F494491

General Info

Members Datasets Scaffolds Average Seq Length
1514 696 1350 146

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_11237297|Ga0157370_112372971
Length 168
Sequence MGEGARCRCIVVVAKTLEGQTMTEMFVSLGTWNWLIFGLILMALELLAPGVFLFWLGLAAFLVGVLSFVFHPAWQTQILLFAIFAVAAVPLWRRLARPKPGANNSPFLNKRADALVGRVCTLEKPIVDGIGTVRVDDTVWRVAGPDAPAGSRVRIVQADGASLTVAAV

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
14 2643221651 Afipia sp. Root123D2 Isolate Unclassified
15 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
16 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
17 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
18 2791355199
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
22 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
23 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
24 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
25 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
26 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
27 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
28 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
29 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
30 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
31 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
32 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
33 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
34 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
35 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
36 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
37 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
38 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
39 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
40 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
41 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
42 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
43 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
44 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
45 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
46 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
47 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
48 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
49 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
50 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
51 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
52 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
53 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
54 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
55 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
56 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
57 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
58 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
59 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
60 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
61 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
62 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
63 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
64 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
65 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
66 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
67 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
68 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
69 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
70 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
71 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
72 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
73 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
74 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
75 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
76 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
77 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
78 2909042592 Labrys sp. LIt4 Isolate Nodule
79 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
80 2922368715
81 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
82 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
83 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
84 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
85 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
86 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
87 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
88 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
89 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
90 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
91 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
92 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
93 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
94 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
95 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
96 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
97 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
98 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
99 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
100 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
101 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
102 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
103 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
104 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
105 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
106 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
107 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
108 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
109 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
110 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
111 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
112 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
113 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
114 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
115 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
116 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
117 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
118 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
119 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
120 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
121 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
122 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
123 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
124 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
125 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
126 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
127 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
128 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
129 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
130 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
131 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
132 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
133 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
134 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
135 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
136 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
137 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
138 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
139 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
140 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
141 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
142 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
143 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
144 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
145 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
146 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
147 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
148 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
149 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
150 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
151 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
152 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
153 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
154 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
155 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
156 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
157 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
158 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
159 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
160 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
161 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
162 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
163 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
164 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
165 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
166 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
167 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
168 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
169 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
170 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
171 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
172 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
173 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
174 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
175 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
176 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
177 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
178 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
179 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
180 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
181 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
182 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
183 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
184 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
185 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
186 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
187 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
188 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
189 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
190 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
191 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
192 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
193 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
194 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
195 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
196 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
197 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
198 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
199 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
200 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
201 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
202 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
203 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
204 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
205 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
206 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
207 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
208 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
209 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
210 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
211 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
212 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
213 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
214 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
215 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
216 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
217 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
218 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
219 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
220 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
221 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
222 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
223 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
224 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
225 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
226 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
227 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
228 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
229 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
230 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
231 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
232 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
233 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
234 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
235 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
236 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
237 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
238 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
239 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
240 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
241 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
242 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
243 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
244 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
245 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
246 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
247 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
248 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
249 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
250 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
251 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
252 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
253 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
254 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
255 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
256 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
257 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
258 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
259 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
260 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
261 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
262 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
263 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
264 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
265 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
266 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
267 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
268 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
269 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
270 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
271 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
272 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
273 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
274 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
275 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
276 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
277 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
278 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
279 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
280 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
281 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
282 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
283 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
284 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
285 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
286 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
287 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
290 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
292 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
293 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
295 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
362 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
363 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
364 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
365 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
368 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
369 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
373 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
374 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
375 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
376 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
377 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
378 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
379 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
380 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
381 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
382 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
383 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
384 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
385 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
386 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
387 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
388 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
389 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
390 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
391 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
392 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
393 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
394 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
395 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
396 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
397 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
398 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
399 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
400 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
401 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
402 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
403 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
404 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
405 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
406 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
407 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
408 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
409 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
410 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
411 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
412 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
413 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
414 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
415 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
416 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
417 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
418 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
419 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
420 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
421 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
422 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
423 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
424 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
425 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
426 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
427 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
428 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
429 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
430 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
431 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
432 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
433 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
434 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
435 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
436 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
437 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
438 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
439 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
440 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
441 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
442 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
443 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
444 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
445 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
446 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
447 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
448 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
449 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
450 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
451 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
452 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
453 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
454 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
455 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
456 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
457 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
458 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
459 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
460 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
461 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
462 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
463 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
464 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
465 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
466 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
467 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
468 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
469 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
470 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
471 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
472 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
473 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
474 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
475 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
476 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
477 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
478 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
479 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
480 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
481 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
482 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
483 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
484 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
485 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
486 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
487 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
488 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
489 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
490 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
491 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
492 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
493 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
494 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
495 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
496 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
497 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
498 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
499 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
500 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
501 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
502 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
503 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
504 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
505 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
506 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
507 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
508 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
509 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
510 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
511 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
512 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
513 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
514 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
515 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
516 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
517 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
518 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
519 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
520 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
521 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
522 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
523 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
524 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
525 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
526 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
527 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
528 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
529 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
530 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
531 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
532 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
533 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
534 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
535 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
536 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
537 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
538 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
539 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
540 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
541 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
542 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
543 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
544 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
545 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
546 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
547 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
548 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
549 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
550 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
551 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
552 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
553 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
554 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
555 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
556 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
557 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
558 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
559 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
560 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
562 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
563 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
564 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
565 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
567 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
573 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
574 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
575 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
576 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
577 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
578 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
579 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
580 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
581 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
582 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
583 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
584 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
585 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
586 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
587 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
589 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
590 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
591 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
592 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
593 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
594 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
595 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
596 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
597 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
598 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
599 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
600 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
601 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
602 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
603 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
604 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
605 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
606 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
607 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
608 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
609 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
610 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
611 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
612 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
613 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
614 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
615 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
616 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
617 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
618 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
619 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
620 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
621 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
622 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
623 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
624 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
625 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
626 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
627 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
628 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
629 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
630 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
631 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
632 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
633 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
634 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
635 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
636 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
637 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
638 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
639 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
640 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
641 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
642 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
643 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
644 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
645 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
646 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
647 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
648 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
649 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
650 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
651 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
652 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
653 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
654 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
655 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
656 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
657 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
658 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
659 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
660 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
661 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
662 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
663 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
664 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
665 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
666 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
667 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
668 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
669 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
670 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
671 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
672 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
673 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
674 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
675 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
676 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
677 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
678 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
679 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
680 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
681 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
682 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
683 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
684 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
685 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
686 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
687 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
688 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
689 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
690 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
691 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
692 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
693 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
694 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
695 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
696 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.02
Metatranscriptomes 0.26
Isolates 10.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.6
Nodule 8.26
Rhizoplane 3.96
Rhizosphere 64
Stem 0
Stem Tuber 0
Unclassified 9.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10017720 3300001990 Bacteria 2291
2 JGI24738J21930_10061017 3300002075 Bacteria 774
3 JGI25406J46586_10004414 3300003203 Bacteria 6552
4 JGI25165J46597_1012534 3300003214 Bacteria 1183
5 JGI25153J46596_10001134 3300003215 Bacteria 16126
6 JGI25153J46596_10003236 3300003215 Bacteria 9159
7 JGI25153J46596_10009457 3300003215 Bacteria 4528
8 JGI25153J46596_10016604 3300003215 Bacteria 2939
9 JGI25153J46596_10047080 3300003215 Bacteria 1272
10 JGI25153J46596_10099626 3300003215 Bacteria 685
11 rootL2_10122270 3300003322 Bacteria 1560
12 JGI25160J50197_1012741 3300003354 Bacteria 2900
13 JGI25404J52841_10003333 3300003659 Bacteria 3163
14 JGI25404J52841_10018969 3300003659 Bacteria 1490
15 JGI25404J52841_10021526 3300003659 Bacteria 1396
16 JGI25404J52841_10029752 3300003659 Bacteria 1171
17 JGI25404J52841_10129563 3300003659 Bacteria 533
18 Ga0055542_1037136 3300003762 Bacteria 590
19 Ga0055531_10004135 3300003794 Bacteria 8966
20 Ga0055543_1009650 3300004625 Bacteria 2063
21 Ga0065165_1003814 3300005262 Bacteria 10056
22 Ga0065715_10357385 3300005293 Bacteria 941
23 Ga0065715_10650476 3300005293 Bacteria 679
24 Ga0070658_10445178 3300005327 Bacteria 1116
25 Ga0070658_10582973 3300005327 Bacteria 969
26 Ga0070658_11248106 3300005327 Bacteria 646
27 Ga0070658_11427710 3300005327 Bacteria 600
28 Ga0070683_100023213 3300005329 Bacteria 5547
29 Ga0070683_100032795 3300005329 Bacteria 4733
30 Ga0070683_100234015 3300005329 Bacteria 1746
31 Ga0070683_100325152 3300005329 Bacteria 1464
32 Ga0070683_100863738 3300005329 Bacteria 868
33 Ga0070690_100188781 3300005330 Bacteria 1428
34 Ga0070670_100135781 3300005331 Bacteria 2125
35 Ga0070670_100454455 3300005331 Bacteria 1135
36 Ga0068869_100025714 3300005334 Bacteria 4091
37 Ga0068869_100165004 3300005334 Bacteria 1727
38 Ga0068869_101048429 3300005334 Bacteria 712
39 Ga0070666_10389018 3300005335 Bacteria 1002
40 Ga0070666_11227897 3300005335 Bacteria 559
41 Ga0070680_100011781 3300005336 Bacteria 6782
42 Ga0070680_100067141 3300005336 Bacteria 2941
43 Ga0070680_100105949 3300005336 Bacteria 2337
44 Ga0070680_100380436 3300005336 Bacteria 1202
45 Ga0070680_100652933 3300005336 Bacteria 904
46 Ga0068868_100105457 3300005338 Bacteria 2285
47 Ga0068868_100400882 3300005338 Bacteria 1184
48 Ga0070660_100190658 3300005339 Bacteria 1660
49 Ga0070660_100351071 3300005339 Bacteria 1215
50 Ga0070689_100969785 3300005340 Bacteria 755
51 Ga0070691_10223404 3300005341 Bacteria 999
52 Ga0070687_101381990 3300005343 Bacteria 526
53 Ga0070661_100140954 3300005344 Bacteria 1817
54 Ga0070661_100572100 3300005344 Bacteria 911
55 Ga0070668_100822140 3300005347 Bacteria 826
56 Ga0070668_101239926 3300005347 Bacteria 677
57 Ga0070669_100356393 3300005353 Bacteria 1189
58 Ga0070669_100397600 3300005353 Bacteria 1127
59 Ga0070675_100558745 3300005354 Bacteria 1035
60 Ga0070675_100938750 3300005354 Bacteria 793
61 Ga0070671_100878563 3300005355 Bacteria 783
62 Ga0070671_101455966 3300005355 Bacteria 606
63 Ga0070674_100031034 3300005356 Bacteria 3537
64 Ga0070673_100305186 3300005364 Bacteria 1402
65 Ga0070673_101102683 3300005364 Bacteria 741
66 Ga0070688_100970253 3300005365 Bacteria 674
67 Ga0070659_100121951 3300005366 Bacteria 2112
68 Ga0070667_101088893 3300005367 Bacteria 747
69 Ga0070667_101488755 3300005367 Bacteria 635
70 Ga0070709_10001491 3300005434 Bacteria 12644
71 Ga0070709_10029857 3300005434 Bacteria 3265
72 Ga0070709_10432253 3300005434 Bacteria 989
73 Ga0070714_100030496 3300005435 Bacteria 4489
74 Ga0070714_100034604 3300005435 Bacteria 4231
75 Ga0070714_100254434 3300005435 Bacteria 1625
76 Ga0070714_100567260 3300005435 Bacteria 1088
77 Ga0070713_100065716 3300005436 Bacteria 3049
78 Ga0070713_100464833 3300005436 Bacteria 1190
79 Ga0070710_10392853 3300005437 Bacteria 928
80 Ga0070711_100606493 3300005439 Bacteria 914
81 Ga0070705_100686406 3300005440 Bacteria 803
82 Ga0070700_100085290 3300005441 Bacteria 2049
83 Ga0070708_100704916 3300005445 Bacteria 950
84 Ga0070708_101189968 3300005445 Bacteria 713
85 Ga0070663_100029162 3300005455 Bacteria 3767
86 Ga0070663_100092281 3300005455 Bacteria 2245
87 Ga0070663_100144426 3300005455 Bacteria 1819
88 Ga0070663_100463485 3300005455 Bacteria 1046
89 Ga0070663_100531847 3300005455 Bacteria 980
90 Ga0070663_100660587 3300005455 Bacteria 885
91 Ga0070663_101370384 3300005455 Bacteria 626
92 Ga0070678_100003092 3300005456 Bacteria 9227
93 Ga0070678_100267806 3300005456 Bacteria 1439
94 Ga0070662_101106580 3300005457 Bacteria 680
95 Ga0070681_10057744 3300005458 Bacteria 3861
96 Ga0070681_10165152 3300005458 Bacteria 2137
97 Ga0070681_10859626 3300005458 Bacteria 825
98 Ga0070681_11078366 3300005458 Bacteria 724
99 Ga0068867_100502098 3300005459 Bacteria 1043
100 Ga0068867_101235039 3300005459 Bacteria 688
101 Ga0070706_100361798 3300005467 Bacteria 1352
102 Ga0070707_100316008 3300005468 Bacteria 1518
103 Ga0070698_100074379 3300005471 Bacteria 3403
104 Ga0070698_100107615 3300005471 Bacteria 2755
105 Ga0070699_100201113 3300005518 Bacteria 1772
106 Ga0070699_100211008 3300005518 Bacteria 1728
107 Ga0070699_100388481 3300005518 Bacteria 1261
108 Ga0070679_100028212 3300005530 Bacteria 5533
109 Ga0070679_100217903 3300005530 Bacteria 1871
110 Ga0070679_100234226 3300005530 Bacteria 1795
111 Ga0070679_100568078 3300005530 Bacteria 1078
112 Ga0070679_100681058 3300005530 Bacteria 971
113 Ga0070684_100073878 3300005535 Bacteria 3005
114 Ga0068853_100018531 3300005539 Bacteria 5764
115 Ga0068853_100085139 3300005539 Bacteria 2771
116 Ga0068853_100127409 3300005539 Bacteria 2276
117 Ga0068853_100196279 3300005539 Bacteria 1836
118 Ga0068853_100201713 3300005539 Bacteria 1810
119 Ga0068853_100336480 3300005539 Bacteria 1402
120 Ga0068853_101025068 3300005539 Bacteria 795
121 Ga0070672_100049102 3300005543 Bacteria 3281
122 Ga0070672_100704163 3300005543 Bacteria 884
123 Ga0070695_101130705 3300005545 Bacteria 642
124 Ga0070665_100052241 3300005548 Bacteria 4100
125 Ga0070665_100084542 3300005548 Bacteria 3179
126 Ga0070665_100169822 3300005548 Bacteria 2182
127 Ga0070665_100468867 3300005548 Bacteria 1270
128 Ga0070665_100518411 3300005548 Bacteria 1204
129 Ga0070665_100784636 3300005548 Bacteria 966
130 Ga0070665_101095992 3300005548 Bacteria 808
131 Ga0070665_101146177 3300005548 Bacteria 789
132 Ga0070704_101008081 3300005549 Bacteria 753
133 Ga0068855_100092439 3300005563 Bacteria 3489
134 Ga0068855_100432527 3300005563 Bacteria 1438
135 Ga0068855_100480265 3300005563 Bacteria 1353
136 Ga0068855_100496985 3300005563 Bacteria 1326
137 Ga0068855_100587955 3300005563 Bacteria 1202
138 Ga0068855_100726659 3300005563 Bacteria 1061
139 Ga0068855_100864344 3300005563 Bacteria 957
140 Ga0070664_100125780 3300005564 Bacteria 2249
141 Ga0070664_100893368 3300005564 Bacteria 833
142 Ga0068857_100017449 3300005577 Bacteria 6291
143 Ga0068857_100059766 3300005577 Bacteria 3387
144 Ga0068857_100262105 3300005577 Bacteria 1586
145 Ga0068854_100023883 3300005578 Bacteria 4179
146 Ga0068854_100081520 3300005578 Bacteria 2390
147 Ga0068854_100202857 3300005578 Bacteria 1560
148 Ga0068854_101386686 3300005578 Bacteria 635
149 Ga0068856_100000522 3300005614 Bacteria 42457
150 Ga0068856_100021340 3300005614 Bacteria 6294
151 Ga0068856_100157594 3300005614 Bacteria 2280
152 Ga0068856_100433270 3300005614 Bacteria 1335
153 Ga0068856_100434702 3300005614 Bacteria 1333
154 Ga0070702_100655043 3300005615 Bacteria 795
155 Ga0070702_100662957 3300005615 Bacteria 790
156 Ga0070702_101627397 3300005615 Bacteria 535
157 Ga0068852_100005154 3300005616 Bacteria 9315
158 Ga0068852_100384269 3300005616 Bacteria 1378
159 Ga0068852_100515489 3300005616 Bacteria 1192
160 Ga0068852_100663802 3300005616 Bacteria 1051
161 Ga0068859_100955820 3300005617 Bacteria 940
162 Ga0068859_101477533 3300005617 Bacteria 750
163 Ga0068859_101901889 3300005617 Bacteria 657
164 Ga0068864_100208484 3300005618 Bacteria 1799
165 Ga0068864_100212870 3300005618 Bacteria 1780
166 Ga0068864_101100723 3300005618 Bacteria 791
167 Ga0068864_101274626 3300005618 Bacteria 735
168 Ga0068866_10149684 3300005718 Bacteria 1350
169 Ga0068861_100211061 3300005719 Bacteria 1635
170 Ga0068861_101852455 3300005719 Bacteria 599
171 Ga0068863_100156143 3300005841 Bacteria 2185
172 Ga0068863_100439669 3300005841 Bacteria 1279
173 Ga0068863_100464863 3300005841 Bacteria 1243
174 Ga0068858_100034437 3300005842 Bacteria 4698
175 Ga0068858_100173954 3300005842 Bacteria 2031
176 Ga0068858_100829588 3300005842 Bacteria 903
177 Ga0068860_100118797 3300005843 Bacteria 2531
178 Ga0068862_100446298 3300005844 Bacteria 1219
179 Ga0068862_100567903 3300005844 Bacteria 1085
180 Ga0081455_10001332 3300005937 Bacteria 30542
181 Ga0081455_10026185 3300005937 Bacteria 5372
182 Ga0081455_10029427 3300005937 Bacteria 5008
183 Ga0081455_10032880 3300005937 Bacteria 4668
184 Ga0081455_10076533 3300005937 Bacteria 2756
185 Ga0081455_10195085 3300005937 Bacteria 1521
186 Ga0081540_1002747 3300005983 Bacteria 14302
187 Ga0081540_1006321 3300005983 Bacteria 8657
188 Ga0081540_1007063 3300005983 Bacteria 8070
189 Ga0081540_1008395 3300005983 Bacteria 7220
190 Ga0081540_1010443 3300005983 Bacteria 6287
191 Ga0081540_1014706 3300005983 Bacteria 4997
192 Ga0081540_1049888 3300005983 Bacteria 2084
193 Ga0081540_1100218 3300005983 Bacteria 1250
194 Ga0081539_10003211 3300005985 Bacteria 20647
195 Ga0081539_10003502 3300005985 Bacteria 19186
196 Ga0081539_10017936 3300005985 Bacteria 4939
197 Ga0081539_10018388 3300005985 Bacteria 4852
198 Ga0081539_10165408 3300005985 Bacteria 1051
199 Ga0070717_10106977 3300006028 Bacteria 2382
200 Ga0070717_11780088 3300006028 Bacteria 557
201 Ga0075365_10002534 3300006038 Bacteria 9011
202 Ga0075365_10074736 3300006038 Bacteria 2286
203 Ga0075365_10075901 3300006038 Bacteria 2269
204 Ga0075365_10077246 3300006038 Bacteria 2250
205 Ga0075365_10094874 3300006038 Bacteria 2037
206 Ga0075365_10119918 3300006038 Bacteria 1814
207 Ga0075365_10258838 3300006038 Bacteria 1223
208 Ga0075365_10344734 3300006038 Bacteria 1050
209 Ga0075368_10010232 3300006042 Bacteria 3387
210 Ga0075368_10097188 3300006042 Bacteria 1207
211 Ga0075363_100012149 3300006048 Bacteria 4142
212 Ga0075363_100018535 3300006048 Bacteria 3470
213 Ga0075363_100058674 3300006048 Bacteria 2067
214 Ga0075363_100454948 3300006048 Bacteria 757
215 Ga0075364_10006018 3300006051 Bacteria 7094
216 Ga0075364_10013934 3300006051 Bacteria 4955
217 Ga0075364_10015976 3300006051 Bacteria 4662
218 Ga0070715_10180891 3300006163 Bacteria 1057
219 Ga0070715_10296864 3300006163 Bacteria 863
220 Ga0070716_101462518 3300006173 Bacteria 557
221 Ga0070712_100441599 3300006175 Bacteria 1082
222 Ga0075362_10003916 3300006177 Bacteria 5291
223 Ga0075362_10068209 3300006177 Bacteria 1619
224 Ga0075362_10231095 3300006177 Bacteria 906
225 Ga0075367_10038406 3300006178 Bacteria 2787
226 Ga0075367_10082884 3300006178 Bacteria 1942
227 Ga0075367_10170466 3300006178 Bacteria 1356
228 Ga0075367_10179276 3300006178 Bacteria 1321
229 Ga0075369_10017261 3300006186 Bacteria 2922
230 Ga0075369_10026495 3300006186 Bacteria 2416
231 Ga0075369_10059198 3300006186 Bacteria 1669
232 Ga0075369_10096794 3300006186 Bacteria 1321
233 Ga0075366_10009134 3300006195 Bacteria 5528
234 Ga0075366_10011900 3300006195 Bacteria 4924
235 Ga0075366_10019386 3300006195 Bacteria 3935
236 Ga0075366_10024339 3300006195 Bacteria 3531
237 Ga0075366_10120593 3300006195 Bacteria 1580
238 Ga0097621_100889785 3300006237 Bacteria 829
239 Ga0075370_10017821 3300006353 Bacteria 3841
240 Ga0075370_10028156 3300006353 Bacteria 3122
241 Ga0075370_10167745 3300006353 Bacteria 1290
242 Ga0075370_10309359 3300006353 Bacteria 940
243 Ga0075370_10359035 3300006353 Bacteria 871
244 Ga0075370_11014985 3300006353 Bacteria 509
245 Ga0068871_100227592 3300006358 Bacteria 1617
246 Ga0068871_100471553 3300006358 Bacteria 1128
247 Ga0075430_100356590 3300006846 Bacteria 1207
248 Ga0075430_101214397 3300006846 Bacteria 621
249 Ga0075431_100048608 3300006847 Bacteria 4375
250 Ga0075431_100070799 3300006847 Bacteria 3598
251 Ga0075433_10537269 3300006852 Bacteria 1028
252 Ga0075433_10652485 3300006852 Bacteria 923
253 Ga0075433_10813894 3300006852 Bacteria 816
254 Ga0075434_100011477 3300006871 Bacteria 8362
255 Ga0075434_100127180 3300006871 Bacteria 2565
256 Ga0075429_100005400 3300006880 Bacteria 10997
257 Ga0068865_100196644 3300006881 Bacteria 1563
258 Ga0075436_100676489 3300006914 Bacteria 764
259 Ga0097620_100955774 3300006931 Bacteria 940
260 Ga0097620_101477702 3300006931 Bacteria 750
261 Ga0097620_101901597 3300006931 Bacteria 657
262 Ga0099825_1028430 3300006941 Bacteria 2720
263 Ga0099824_1014343 3300006942 Bacteria 7902
264 Ga0099823_1010603 3300006944 Bacteria 9345
265 Ga0075435_100653780 3300007076 Bacteria 913
266 Ga0099794_10009479 3300007265 Bacteria 4096
267 Ga0099794_10030878 3300007265 Bacteria 2505
268 Ga0099794_10085976 3300007265 Bacteria 1557
269 Ga0099794_10194323 3300007265 Bacteria 1038
270 Ga0099794_10712929 3300007265 Bacteria 535
271 Ga0099795_10061490 3300007788 Bacteria 1395
272 Ga0099795_10075316 3300007788 Bacteria 1281
273 Ga0099795_10086383 3300007788 Bacteria 1209
274 Ga0099795_10117559 3300007788 Bacteria 1060
275 Ga0099795_10258586 3300007788 Bacteria 753
276 Ga0105251_10222271 3300009011 Bacteria 850
277 Ga0105250_10113873 3300009092 Bacteria 1109
278 Ga0105240_10014502 3300009093 Bacteria 10759
279 Ga0105240_10130068 3300009093 Bacteria 3021
280 Ga0105240_10202953 3300009093 Bacteria 2322
281 Ga0105240_10616178 3300009093 Bacteria 1193
282 Ga0105240_12153193 3300009093 Bacteria 579
283 Ga0105240_12214333 3300009093 Bacteria 570
284 Ga0111539_10144285 3300009094 Bacteria 2787
285 Ga0111539_10205773 3300009094 Bacteria 2294
286 Ga0105245_10074222 3300009098 Bacteria 3095
287 Ga0105245_10230300 3300009098 Bacteria 1792
288 Ga0105245_11036517 3300009098 Bacteria 865
289 Ga0105245_11254512 3300009098 Bacteria 790
290 Ga0105247_10123534 3300009101 Bacteria 1680
291 Ga0105247_10900988 3300009101 Bacteria 683
292 Ga0114129_10003546 3300009147 Bacteria 21965
293 Ga0114129_10063906 3300009147 Bacteria 5136
294 Ga0105243_10104007 3300009148 Bacteria 2362
295 Ga0105243_10404528 3300009148 Bacteria 1269
296 Ga0105243_10491022 3300009148 Bacteria 1161
297 Ga0105243_11060030 3300009148 Bacteria 817
298 Ga0105243_11068895 3300009148 Bacteria 813
299 Ga0105241_10144238 3300009174 Bacteria 1942
300 Ga0105241_10423280 3300009174 Bacteria 1172
301 Ga0105241_12671599 3300009174 Bacteria 502
302 Ga0105242_11620060 3300009176 Bacteria 681
303 Ga0105242_11741629 3300009176 Bacteria 660
304 Ga0105248_10092495 3300009177 Bacteria 3406
305 Ga0105248_10144108 3300009177 Bacteria 2688
306 Ga0105237_10011109 3300009545 Bacteria 9544
307 Ga0105237_10045833 3300009545 Bacteria 4400
308 Ga0105237_10078738 3300009545 Bacteria 3285
309 Ga0105237_10091332 3300009545 Bacteria 3034
310 Ga0105237_10121243 3300009545 Bacteria 2609
311 Ga0105237_10149889 3300009545 Bacteria 2329
312 Ga0105237_10229709 3300009545 Bacteria 1856
313 Ga0105237_10231483 3300009545 Bacteria 1849
314 Ga0105237_11082359 3300009545 Unclassified 808
315 Ga0105237_11145491 3300009545 Bacteria 784
316 Ga0105237_11222030 3300009545 Bacteria 758
317 Ga0105238_10062524 3300009551 Bacteria 3723
318 Ga0105238_10587335 3300009551 Bacteria 1121
319 Ga0105238_10597818 3300009551 Bacteria 1111
320 Ga0105238_10773199 3300009551 Bacteria 975
321 Ga0105238_10917319 3300009551 Bacteria 895
322 Ga0105238_12217183 3300009551 Bacteria 584
323 Ga0105249_10806706 3300009553 Bacteria 1003
324 Ga0105249_12004761 3300009553 Bacteria 651
325 Ga0105249_12039160 3300009553 Bacteria 646
326 Ga0099796_10058503 3300010159 Bacteria 1359
327 Ga0099796_10220192 3300010159 Bacteria 777
328 Ga0105239_10025680 3300010375 Bacteria 6487
329 Ga0105239_10102400 3300010375 Bacteria 3169
330 Ga0105239_10307416 3300010375 Bacteria 1786
331 Ga0105239_10727186 3300010375 Bacteria 1136
332 Ga0105246_10005981 3300011119 Bacteria 7428
333 Ga0105246_10012518 3300011119 Bacteria 5298
334 Ga0157337_1006390 3300012483 Bacteria 814
335 Ga0157338_1052413 3300012515 Bacteria 589
336 Ga0157373_10328759 3300013100 Bacteria 1088
337 Ga0157371_10120382 3300013102 Bacteria 1866
338 Ga0157370_10901211 3300013104 Bacteria 802
339 Ga0157370_11237297 3300013104 Bacteria 673
340 Ga0157369_10021285 3300013105 Bacteria 7251
341 Ga0157369_10049503 3300013105 Bacteria 4555
342 Ga0157369_10091698 3300013105 Bacteria 3243
343 Ga0157369_10454431 3300013105 Bacteria 1326
344 Ga0157374_10112947 3300013296 Bacteria 2615
345 Ga0157374_10720385 3300013296 Bacteria 1011
346 Ga0157374_10885789 3300013296 Bacteria 910
347 Ga0157378_10018404 3300013297 Bacteria 6135
348 Ga0157378_10457761 3300013297 Bacteria 1267
349 Ga0157378_11127564 3300013297 Bacteria 822
350 Ga0157378_12280702 3300013297 Bacteria 593
351 Ga0163162_10718957 3300013306 Bacteria 1119
352 Ga0163162_12248743 3300013306 Bacteria 626
353 Ga0163162_13305704 3300013306 Bacteria 516
354 Ga0157372_10240295 3300013307 Bacteria 2101
355 Ga0157372_10821700 3300013307 Bacteria 1079
356 Ga0157372_11232324 3300013307 Bacteria 864
357 Ga0157375_10402868 3300013308 Bacteria 1535
358 Ga0157375_10913973 3300013308 Bacteria 1021
359 Ga0163163_10483978 3300014325 Bacteria 1299
360 Ga0163163_10532864 3300014325 Bacteria 1237
361 Ga0163163_11209191 3300014325 Bacteria 818
362 Ga0157380_12868886 3300014326 Bacteria 548
363 Ga0157379_10603076 3300014968 Bacteria 1025
364 Ga0157379_10921933 3300014968 Bacteria 830
365 Ga0157376_10371391 3300014969 Bacteria 1375
366 Ga0157376_10777036 3300014969 Bacteria 969
367 Ga0163161_10066998 3300017792 Bacteria 2622
368 Ga0163161_10407128 3300017792 Bacteria 1092
369 Ga0163161_11164591 3300017792 Bacteria 665
370 Ga0197907_10373094 3300020069 Bacteria 1701
371 Ga0206356_11321139 3300020070 Bacteria 1371
372 Ga0206353_10549197 3300020082 Bacteria 1464
373 Ga0214544_1000011 3300021320 Bacteria 262952
374 Ga0214544_1037611 3300021320 Bacteria 1185
375 Ga0214542_1000009 3300021321 Bacteria 262861
376 Ga0214542_1040708 3300021321 Bacteria 1183
377 Ga0214545_1000007 3300021324 Bacteria 262984
378 Ga0214545_1021801 3300021324 Bacteria 4682
379 Ga0214543_1000020 3300021327 Bacteria 262861
380 Ga0214543_1034552 3300021327 Bacteria 1721
381 Ga0213875_10099466 3300021388 Bacteria 1357
382 Ga0224712_10023785 3300022467 Bacteria 2131
383 Ga0209563_104176 3300025230 Bacteria 2808
384 Ga0209148_1000707 3300025254 Bacteria 26803
385 Ga0209233_1004187 3300025261 Bacteria 4953
386 Ga0209233_1013847 3300025261 Bacteria 2293
387 Ga0209455_1001372 3300025272 Bacteria 11131
388 Ga0209564_1004298 3300025295 Bacteria 8821
389 Ga0209564_1014730 3300025295 Bacteria 3229
390 Ga0209758_1000088 3300025297 Bacteria 251547
391 Ga0209758_1000106 3300025297 Bacteria 218450
392 Ga0209758_1002009 3300025297 Bacteria 21878
393 Ga0209758_1002346 3300025297 Bacteria 19505
394 Ga0209758_1004848 3300025297 Bacteria 10855
395 Ga0209758_1005033 3300025297 Bacteria 10518
396 Ga0209758_1005694 3300025297 Bacteria 9412
397 Ga0209758_1005984 3300025297 Bacteria 9007
398 Ga0209758_1065498 3300025297 Bacteria 1172
399 Ga0209256_1003346 3300025299 Bacteria 11365
400 Ga0209256_1030804 3300025299 Bacteria 1476
401 Ga0207426_1000337 3300025302 Bacteria 88200
402 Ga0207426_1002354 3300025302 Bacteria 12313
403 Ga0207426_1007721 3300025302 Bacteria 4461
404 Ga0207426_1009646 3300025302 Bacteria 3801
405 Ga0209051_1042694 3300025303 Bacteria 1599
406 Ga0209257_1000684 3300025304 Bacteria 52769
407 Ga0209257_1009117 3300025304 Bacteria 5415
408 Ga0209257_1046344 3300025304 Bacteria 1256
409 Ga0207697_10026025 3300025315 Bacteria 2392
410 Ga0207656_10060841 3300025321 Bacteria 1656
411 Ga0207696_1102227 3300025711 Bacteria 780
412 Ga0207682_10007221 3300025893 Bacteria 4442
413 Ga0207642_10138451 3300025899 Bacteria 1280
414 Ga0207710_10112002 3300025900 Bacteria 1297
415 Ga0207710_10179041 3300025900 Bacteria 1039
416 Ga0207688_10119257 3300025901 Bacteria 1538
417 Ga0207680_10386371 3300025903 Bacteria 987
418 Ga0207647_10011565 3300025904 Bacteria 6184
419 Ga0207647_10052997 3300025904 Bacteria 2502
420 Ga0207647_10226681 3300025904 Bacteria 1076
421 Ga0207685_10269363 3300025905 Bacteria 831
422 Ga0207699_10741159 3300025906 Bacteria 720
423 Ga0207645_10121167 3300025907 Bacteria 1698
424 Ga0207643_10106644 3300025908 Bacteria 1647
425 Ga0207705_10061230 3300025909 Bacteria 2719
426 Ga0207705_10346507 3300025909 Bacteria 1144
427 Ga0207684_10289008 3300025910 Bacteria 1414
428 Ga0207654_10408922 3300025911 Bacteria 945
429 Ga0207654_10794375 3300025911 Bacteria 683
430 Ga0207707_10002648 3300025912 Bacteria 15999
431 Ga0207707_10140285 3300025912 Bacteria 2113
432 Ga0207707_10249254 3300025912 Bacteria 1543
433 Ga0207695_10000478 3300025913 Bacteria 86076
434 Ga0207695_10387936 3300025913 Bacteria 1282
435 Ga0207695_11366995 3300025913 Bacteria 588
436 Ga0207671_10003206 3300025914 Bacteria 16477
437 Ga0207671_10034599 3300025914 Bacteria 3753
438 Ga0207671_10109212 3300025914 Bacteria 2103
439 Ga0207671_10304159 3300025914 Bacteria 1260
440 Ga0207671_10354156 3300025914 Bacteria 1164
441 Ga0207671_11371331 3300025914 Bacteria 549
442 Ga0207693_10039417 3300025915 Bacteria 3721
443 Ga0207693_10065145 3300025915 Bacteria 2854
444 Ga0207693_11048918 3300025915 Bacteria 621
445 Ga0207663_10041428 3300025916 Bacteria 2807
446 Ga0207663_10139368 3300025916 Bacteria 1687
447 Ga0207663_10679740 3300025916 Bacteria 814
448 Ga0207663_10794519 3300025916 Bacteria 753
449 Ga0207660_10050359 3300025917 Bacteria 2957
450 Ga0207660_10134958 3300025917 Bacteria 1882
451 Ga0207662_10044943 3300025918 Bacteria 2609
452 Ga0207657_10113299 3300025919 Bacteria 2238
453 Ga0207657_10181252 3300025919 Bacteria 1702
454 Ga0207649_10232413 3300025920 Bacteria 1319
455 Ga0207652_10175065 3300025921 Bacteria 1927
456 Ga0207681_10823460 3300025923 Bacteria 776
457 Ga0207681_10877985 3300025923 Bacteria 751
458 Ga0207694_10115714 3300025924 Bacteria 2137
459 Ga0207694_10325138 3300025924 Bacteria 1270
460 Ga0207694_10604681 3300025924 Bacteria 922
461 Ga0207694_11146041 3300025924 Bacteria 658
462 Ga0207650_11024041 3300025925 Bacteria 702
463 Ga0207659_10724062 3300025926 Bacteria 852
464 Ga0207687_11198091 3300025927 Bacteria 653
465 Ga0207700_10954497 3300025928 Unclassified 767
466 Ga0207644_10161659 3300025931 Bacteria 1741
467 Ga0207644_10387053 3300025931 Bacteria 1141
468 Ga0207690_10164092 3300025932 Bacteria 1658
469 Ga0207690_10456869 3300025932 Bacteria 1027
470 Ga0207690_11276392 3300025932 Bacteria 614
471 Ga0207706_10399559 3300025933 Bacteria 1191
472 Ga0207686_10409587 3300025934 Bacteria 1035
473 Ga0207670_10889945 3300025936 Bacteria 745
474 Ga0207670_11309239 3300025936 Bacteria 614
475 Ga0207669_10047202 3300025937 Bacteria 2549
476 Ga0207669_10904267 3300025937 Bacteria 737
477 Ga0207704_10268052 3300025938 Bacteria 1291
478 Ga0207704_10617941 3300025938 Bacteria 889
479 Ga0207665_10355518 3300025939 Bacteria 1106
480 Ga0207665_10682269 3300025939 Bacteria 807
481 Ga0207665_11025669 3300025939 Bacteria 657
482 Ga0207665_11678446 3300025939 Bacteria 503
483 Ga0207691_10093307 3300025940 Bacteria 2696
484 Ga0207691_10136939 3300025940 Bacteria 2159
485 Ga0207691_10672961 3300025940 Bacteria 874
486 Ga0207711_10042861 3300025941 Bacteria 3858
487 Ga0207689_10507330 3300025942 Bacteria 1011
488 Ga0207661_10088916 3300025944 Bacteria 2568
489 Ga0207661_10512137 3300025944 Bacteria 1097
490 Ga0207661_10644229 3300025944 Bacteria 974
491 Ga0207679_10389319 3300025945 Bacteria 1224
492 Ga0207679_11054894 3300025945 Bacteria 745
493 Ga0207667_10031470 3300025949 Bacteria 5728
494 Ga0207667_10058763 3300025949 Bacteria 4031
495 Ga0207667_10429077 3300025949 Bacteria 1344
496 Ga0207667_10594892 3300025949 Bacteria 1116
497 Ga0207667_10840498 3300025949 Bacteria 913
498 Ga0207667_10853575 3300025949 Bacteria 904
499 Ga0207667_11310256 3300025949 Bacteria 700
500 Ga0207651_10783317 3300025960 Bacteria 844
501 Ga0207712_10267410 3300025961 Bacteria 1389
502 Ga0207712_11171341 3300025961 Bacteria 685
503 Ga0207668_10029496 3300025972 Bacteria 3596
504 Ga0207668_10812227 3300025972 Bacteria 828
505 Ga0207668_11441510 3300025972 Bacteria 621
506 Ga0207640_10017622 3300025981 Bacteria 4183
507 Ga0207640_10082467 3300025981 Bacteria 2202
508 Ga0207640_10457375 3300025981 Bacteria 1053
509 Ga0207640_10674880 3300025981 Bacteria 883
510 Ga0207640_12136635 3300025981 Bacteria 508
511 Ga0207658_10126154 3300025986 Bacteria 2049
512 Ga0207658_10567023 3300025986 Bacteria 1017
513 Ga0207658_11525757 3300025986 Bacteria 611
514 Ga0207677_10289706 3300026023 Bacteria 1348
515 Ga0207677_10383814 3300026023 Bacteria 1186
516 Ga0207677_10435302 3300026023 Bacteria 1120
517 Ga0207703_10261444 3300026035 Bacteria 1564
518 Ga0207639_10074387 3300026041 Bacteria 2668
519 Ga0207639_10163104 3300026041 Bacteria 1880
520 Ga0207639_10249059 3300026041 Bacteria 1548
521 Ga0207639_10932548 3300026041 Bacteria 812
522 Ga0207639_11111372 3300026041 Bacteria 741
523 Ga0207678_10018506 3300026067 Bacteria 6118
524 Ga0207678_10062712 3300026067 Bacteria 3194
525 Ga0207678_10087188 3300026067 Bacteria 2668
526 Ga0207678_10484970 3300026067 Bacteria 1077
527 Ga0207708_10038627 3300026075 Bacteria 3636
528 Ga0207702_10000014 3300026078 Bacteria 253304
529 Ga0207702_10064516 3300026078 Bacteria 3134
530 Ga0207702_10108606 3300026078 Bacteria 2462
531 Ga0207702_10386182 3300026078 Bacteria 1347
532 Ga0207702_11207456 3300026078 Bacteria 750
533 Ga0207641_10190665 3300026088 Bacteria 1884
534 Ga0207641_10386112 3300026088 Bacteria 1342
535 Ga0207641_10751478 3300026088 Bacteria 963
536 Ga0207641_11437068 3300026088 Bacteria 691
537 Ga0207648_10138524 3300026089 Bacteria 2144
538 Ga0207648_10160389 3300026089 Bacteria 1986
539 Ga0207648_10864554 3300026089 Bacteria 844
540 Ga0207648_12277539 3300026089 Bacteria 502
541 Ga0207676_10103153 3300026095 Bacteria 2369
542 Ga0207676_10292136 3300026095 Bacteria 1485
543 Ga0207676_11099073 3300026095 Bacteria 786
544 Ga0207674_10040618 3300026116 Bacteria 4818
545 Ga0207674_10048642 3300026116 Bacteria 4339
546 Ga0207674_10118208 3300026116 Bacteria 2621
547 Ga0207674_10199570 3300026116 Bacteria 1950
548 Ga0207674_10200513 3300026116 Bacteria 1945
549 Ga0207674_10221090 3300026116 Bacteria 1842
550 Ga0207674_10285202 3300026116 Bacteria 1600
551 Ga0207674_11288687 3300026116 Unclassified 700
552 Ga0207675_100064150 3300026118 Bacteria 3433
553 Ga0207675_100242617 3300026118 Bacteria 1741
554 Ga0207675_100360379 3300026118 Bacteria 1426
555 Ga0207675_100748389 3300026118 Bacteria 988
556 Ga0207675_101736904 3300026118 Bacteria 644
557 Ga0207683_10006624 3300026121 Bacteria 9911
558 Ga0207698_10226550 3300026142 Bacteria 1694
559 Ga0207698_10326911 3300026142 Bacteria 1439
560 Ga0209389_1000016 3300027296 Bacteria 184844
561 Ga0209389_1000027 3300027296 Bacteria 146917
562 Ga0209589_1000031 3300027357 Bacteria 147054
563 Ga0209489_100057 3300027361 Bacteria 147398
564 Ga0209489_100063 3300027361 Bacteria 144408
565 Ga0209700_100012 3300027363 Bacteria 357892
566 Ga0209179_1006250 3300027512 Bacteria 1910
567 Ga0209179_1053771 3300027512 Bacteria 867
568 Ga0209179_1150651 3300027512 Bacteria 519
569 Ga0209588_1013388 3300027671 Bacteria 2501
570 Ga0209588_1017488 3300027671 Bacteria 2223
571 Ga0209813_10007065 3300027866 Bacteria 2788
572 Ga0207428_10378273 3300027907 Bacteria 1039
573 Ga0268266_10042057 3300028379 Bacteria 3901
574 Ga0268266_10065542 3300028379 Bacteria 3140
575 Ga0268266_10624786 3300028379 Bacteria 1036
576 Ga0268266_10934277 3300028379 Bacteria 839
577 Ga0268265_10217616 3300028380 Bacteria 1669
578 Ga0268265_10485201 3300028380 Bacteria 1162
579 Ga0268265_10790384 3300028380 Bacteria 924
580 Ga0268265_11322935 3300028380 Bacteria 721
581 Ga0268264_10073031 3300028381 Bacteria 2910
582 Ga0268264_11335280 3300028381 Bacteria 727
583 Ga0307515_10524494 3300028794 Bacteria 794
584 Ga0265330_10057547 3300031235 Bacteria 1695
585 Ga0265330_10116263 3300031235 Bacteria 1140
586 Ga0265330_10155745 3300031235 Bacteria 970
587 Ga0265332_10015930 3300031238 Bacteria 3318
588 Ga0265332_10068107 3300031238 Bacteria 1517
589 Ga0265325_10002521 3300031241 Bacteria 12324
590 Ga0265340_10011977 3300031247 Bacteria 4587
591 Ga0265339_10031947 3300031249 Bacteria 2971
592 Ga0265339_10207940 3300031249 Bacteria 963
593 Ga0265331_10099252 3300031250 Bacteria 1341
594 Ga0307513_10617626 3300031456 Bacteria 792
595 Ga0307513_10813939 3300031456 Bacteria 640
596 Ga0307408_100016075 3300031548 Bacteria 4990
597 Ga0307508_10096491 3300031616 Bacteria 2548
598 Ga0307508_10558890 3300031616 Bacteria 743
599 Ga0265314_10151638 3300031711 Bacteria 1420
600 Ga0265314_10252968 3300031711 Bacteria 1011
601 Ga0265342_10006957 3300031712 Bacteria 8359
602 Ga0265342_10120079 3300031712 Bacteria 1481
603 Ga0265342_10250025 3300031712 Bacteria 946
604 Ga0265342_10524670 3300031712 Bacteria 602
605 Ga0307405_10815821 3300031731 Bacteria 783
606 Ga0307405_11429139 3300031731 Bacteria 606
607 Ga0307413_10177153 3300031824 Bacteria 1516
608 Ga0307413_11448801 3300031824 Bacteria 605
609 Ga0307407_10239427 3300031903 Bacteria 1237
610 Ga0307412_10277039 3300031911 Bacteria 1315
611 Ga0307416_101108066 3300032002 Bacteria 896
612 Ga0307416_102290996 3300032002 Bacteria 641
613 Ga0307411_10216058 3300032005 Bacteria 1484
614 Ga0307510_10014233 3300033180 Bacteria 9419
615 Ga0307510_10186963 3300033180 Bacteria 1625
616 Ga0307510_10215149 3300033180 Bacteria 1439
617 Ga0307510_10371714 3300033180 Bacteria 876
618 Ga0373959_0025704 3300034820 Bacteria 1159
619 Ga0373923_0027673 3300035111 Bacteria 2263
620 Ga0373923_0029745 3300035111 Bacteria 2192
621 Ga0373923_0188601 3300035111 Bacteria 949
622 Ga0373936_0019234 3300035113 Bacteria 2646
623 Ga0373936_0033299 3300035113 Bacteria 2042
624 Ga0373936_0093376 3300035113 Bacteria 1263
625 Ga0373939_0429153 3300035114 Bacteria 553
626 Ga0373941_0452892 3300035115 Unclassified 539
627 Ga0373945_0045919 3300035116 Bacteria 1592
628 Ga0373953_0010951 3300035117 Bacteria 3169
629 Ga0373953_0067760 3300035117 Bacteria 1468
630 Ga0373954_0007579 3300035118 Bacteria 4751
631 Ga0373954_0074160 3300035118 Bacteria 1619
632 Ga0373954_0083207 3300035118 Bacteria 1531
633 Ga0373956_0015887 3300035119 Bacteria 3157
634 Ga0373956_0074826 3300035119 Bacteria 1548
635 Ga0373957_0002603 3300035120 Bacteria 5178
636 Ga0373957_0078627 3300035120 Bacteria 1299
637 Ga0373943_0043483 3300035170 Bacteria 2182
638 Ga0373943_0425743 3300035170 Bacteria 769
639 Ga0373946_0002066 3300035171 Bacteria 7052
640 Ga0373946_0021133 3300035171 Bacteria 2521
641 Ga0373946_0034419 3300035171 Unclassified 2045
642 Ga0373946_0336415 3300035171 Bacteria 752
643 Ga0373955_0005384 3300035172 Bacteria 5748
644 Ga0373955_0026687 3300035172 Bacteria 2978
645 Ga0373955_0127771 3300035172 Bacteria 1482
646 Ga0373955_0171001 3300035172 Bacteria 1286
647 Ga0373955_0302418 3300035172 Bacteria 965
648 Ga0373961_0404324 3300035241 Unclassified 525
649 Ga0373924_0067023 3300035410 Bacteria 1509
650 Ga0373935_0000354 3300035692 Bacteria 23386
651 Ga0373935_0027114 3300035692 Bacteria 3541
652 Ga0373935_0178952 3300035692 Bacteria 1455
653 Ga0373935_0680437 3300035692 Bacteria 756
654 Ga0373927_0004375 3300035695 Bacteria 9906
655 Ga0373927_0154520 3300035695 Bacteria 1502
656 Ga0373927_0215435 3300035695 Bacteria 1261
657 Ga0373927_0249701 3300035695 Bacteria 1166
658 Ga0373933_0010862 3300035724 Bacteria 4997
659 Ga0373933_0024661 3300035724 Bacteria 3443
660 Ga0373933_0373654 3300035724 Bacteria 928
661 Ga0373933_0745430 3300035724 Bacteria 644
662 Ga0373947_0003434 3300035725 Bacteria 9372
663 Ga0373937_0071808 3300036401 Bacteria 3192
664 Ga0373937_0318803 3300036401 Bacteria 1471
665 Ga0373937_0434940 3300036401 Bacteria 1245
666 Ga0373937_0949714 3300036401 Bacteria 808
667 Ga0373925_0009064 3300037068 Bacteria 7242
668 Ga0373925_0032743 3300037068 Bacteria 3827
669 Ga0373925_0192937 3300037068 Bacteria 1617
670 Ga0373925_0709685 3300037068 Bacteria 829
671 Ga0395899_0179037 3300037312 Bacteria 1489
672 Ga0395900_0037623 3300037418 Bacteria 4988
673 Ga0395900_0699207 3300037418 Bacteria 947
674 Ga0395900_0989418 3300037418 Bacteria 761
675 Ga0395898_0015240 3300037466 Bacteria 7892
676 Ga0395898_0099111 3300037466 Bacteria 2798
677 Ga0395905_0033626 3300037471 Bacteria 4815
678 Ga0395905_0343358 3300037471 Bacteria 1384
679 Ga0395905_0595133 3300037471 Bacteria 1008
680 Ga0395905_1015226 3300037471 Bacteria 733
681 Ga0436364_0082096 3300037853 Bacteria 754
682 Ga0436364_0211323 3300037853 Bacteria 2361
683 Ga0436364_0252830 3300037853 Bacteria 934
684 Ga0436364_0541162 3300037853 Bacteria 1438
685 Ga0436364_0729467 3300037853 Bacteria 2056
686 Ga0436364_0854930 3300037853 Bacteria 3093
687 Ga0436364_1011261 3300037853 Bacteria 1231
688 Ga0436364_1068178 3300037853 Bacteria 1568
689 Ga0395901_0037234 3300038443 Bacteria 5032
690 Ga0395901_0074312 3300038443 Bacteria 3546
691 Ga0395901_0550278 3300038443 Bacteria 1169
692 Ga0395901_1455676 3300038443 Bacteria 642
693 Ga0436365_0056450 3300039437 Unclassified 677
694 Ga0436365_0258439 3300039437 Bacteria 1608
695 Ga0436365_0620989 3300039437 Bacteria 1857
696 Ga0436361_0261667 3300039447 Bacteria 943
697 Ga0436361_0374357 3300039447 Bacteria 552
698 Ga0436363_0374194 3300039450 Bacteria 2896
699 Ga0436363_1204188 3300039450 Bacteria 4442
700 Ga0436363_1278762 3300039450 Bacteria 1572
701 Ga0436363_1391982 3300039450 Bacteria 766
702 Ga0439453_0001001 3300041408 Bacteria 3447
703 Ga0451789_0651678 3300041443 Bacteria 754
704 Ga0439441_012115 3300042001 Bacteria 1475
705 Ga0439443_036147 3300042003 Bacteria 830
706 Ga0439432_131068 3300042006 Bacteria 740
707 Ga0439434_0120306 3300042435 Bacteria 856
708 Ga0439435_0107580 3300042436 Bacteria 862
709 Ga0439435_0151183 3300042436 Bacteria 745
710 Ga0439459_0069202 3300042438 Bacteria 813
711 Ga0439460_0008111 3300042461 Bacteria 2648
712 Ga0466969_0106171 3300044656 Bacteria 1318
713 Ga0466972_0009680 3300044658 Bacteria 4836
714 Ga0466965_0085702 3300044683 Bacteria 1597
715 Ga0466966_0001941 3300044684 Bacteria 13395
716 Ga0466966_0019524 3300044684 Bacteria 4459
717 Ga0466961_0000136 3300044693 Bacteria 49049
718 Ga0466963_0134279 3300044694 Bacteria 1711
719 Ga0466963_0718024 3300044694 Bacteria 705
720 Ga0466971_0078700 3300044719 Bacteria 1502
721 Ga0466968_0187516 3300044735 Bacteria 964
722 Ga0466968_0204030 3300044735 Bacteria 927
723 Ga0466968_0450894 3300044735 Bacteria 636
724 Ga0466970_0089373 3300044765 Bacteria 1671
725 Ga0466957_0217646 3300044842 Bacteria 1260
726 Ga0466960_0058091 3300044901 Bacteria 1888
727 Ga0466959_0011393 3300045049 Bacteria 6388
728 Ga0466959_0018900 3300045049 Bacteria 5063
729 Ga0466959_0325495 3300045049 Bacteria 1050
730 Ga0466959_1019042 3300045049 Bacteria 551
731 Ga0466958_0078895 3300045836 Bacteria 2024
732 Ga0466967_0167506 3300045976 Bacteria 2065
733 Ga0466967_0285436 3300045976 Bacteria 1584
734 Ga0466967_0521371 3300045976 Bacteria 1168
735 Ga0466967_1390278 3300045976 Bacteria 699
736 Ga0495592_0062845 3300046454 Bacteria 2724
737 Ga0495592_0648223 3300046454 Bacteria 640
738 Ga0495603_0002779 3300046455 Bacteria 10318
739 Ga0495603_0549721 3300046455 Bacteria 661
740 Ga0495603_0557422 3300046455 Bacteria 656
741 Ga0495629_0000416 3300046459 Bacteria 35794
742 Ga0495629_0016818 3300046459 Bacteria 5249
743 Ga0495629_0033833 3300046459 Bacteria 3614
744 Ga0495629_0096054 3300046459 Bacteria 2067
745 Ga0495629_0152827 3300046459 Bacteria 1604
746 Ga0495629_0456542 3300046459 Bacteria 865
747 Ga0495638_0016852 3300046460 Bacteria 4886
748 Ga0495638_0064183 3300046460 Bacteria 2262
749 Ga0495638_0310851 3300046460 Bacteria 846
750 Ga0495641_0008565 3300046461 Bacteria 6206
751 Ga0495651_0002380 3300046462 Bacteria 14527
752 Ga0495651_0269265 3300046462 Bacteria 1155
753 Ga0495653_0098531 3300046463 Bacteria 2122
754 Ga0495653_0180145 3300046463 Bacteria 1451
755 Ga0495650_0057495 3300046471 Bacteria 1574
756 Ga0495580_0004213 3300046472 Bacteria 12094
757 Ga0495582_0000497 3300046473 Bacteria 21510
758 Ga0495605_0024252 3300046474 Bacteria 3177
759 Ga0495605_0044520 3300046474 Bacteria 2194
760 Ga0495605_0076334 3300046474 Bacteria 1574
761 Ga0495639_0000087 3300046475 Bacteria 44546
762 Ga0495662_0000367 3300046476 Bacteria 19860
763 Ga0495662_0048456 3300046476 Bacteria 2051
764 Ga0495662_0113884 3300046476 Bacteria 1326
765 Ga0495664_0010747 3300046477 Bacteria 5146
766 Ga0495585_0164234 3300046492 Bacteria 1151
767 Ga0495585_0466482 3300046492 Bacteria 603
768 Ga0495594_0000194 3300046499 Bacteria 29650
769 Ga0495607_0088400 3300046501 Bacteria 1684
770 Ga0495583_0020666 3300046506 Bacteria 3403
771 Ga0495583_0114690 3300046506 Bacteria 1139
772 Ga0495583_0204801 3300046506 Bacteria 801
773 Ga0495606_0001686 3300046507 Bacteria 28531
774 Ga0495606_0012396 3300046507 Bacteria 6839
775 Ga0495608_0031497 3300046511 Bacteria 3586
776 Ga0495608_0083854 3300046511 Bacteria 2068
777 Ga0495608_0163701 3300046511 Bacteria 1413
778 Ga0495608_0342143 3300046511 Bacteria 921
779 Ga0495610_0084953 3300046512 Bacteria 1445
780 Ga0495616_0167354 3300046513 Bacteria 985
781 Ga0495616_0359938 3300046513 Bacteria 604
782 Ga0495618_0180936 3300046514 Bacteria 1339
783 Ga0495618_0489658 3300046514 Bacteria 742
784 Ga0495620_0055003 3300046515 Bacteria 1679
785 Ga0495620_0055233 3300046515 Bacteria 1674
786 Ga0495628_0043501 3300046516 Bacteria 3577
787 Ga0495628_0053601 3300046516 Bacteria 3182
788 Ga0495628_0220286 3300046516 Bacteria 1425
789 Ga0495628_0750522 3300046516 Bacteria 686
790 Ga0495630_0003691 3300046517 Bacteria 10674
791 Ga0495630_0104051 3300046517 Unclassified 2148
792 Ga0495631_0364261 3300046518 Bacteria 615
793 Ga0495631_0479187 3300046518 Bacteria 530
794 Ga0495632_0237341 3300046519 Bacteria 821
795 Ga0495632_0420318 3300046519 Bacteria 582
796 Ga0495637_0048898 3300046520 Bacteria 1779
797 Ga0495643_0010042 3300046522 Bacteria 5839
798 Ga0495643_0053044 3300046522 Bacteria 2175
799 Ga0495643_0436995 3300046522 Bacteria 572
800 Ga0495648_0004620 3300046524 Bacteria 11709
801 Ga0495648_0049275 3300046524 Bacteria 2584
802 Ga0495648_0057380 3300046524 Bacteria 2336
803 Ga0495648_0434609 3300046524 Bacteria 578
804 Ga0495648_0446885 3300046524 Bacteria 566
805 Ga0495663_0100245 3300046525 Bacteria 953
806 Ga0495666_0250781 3300046526 Bacteria 806
807 Ga0495666_0387388 3300046526 Bacteria 629
808 Ga0495652_0004532 3300046529 Bacteria 13256
809 Ga0495652_0037315 3300046529 Bacteria 4216
810 Ga0495652_0043038 3300046529 Bacteria 3892
811 Ga0495652_0087578 3300046529 Bacteria 2554
812 Ga0495652_0116213 3300046529 Bacteria 2142
813 Ga0495652_0646890 3300046529 Bacteria 716
814 Ga0495654_0138044 3300046530 Bacteria 1089
815 Ga0495654_0170372 3300046530 Bacteria 949
816 Ga0495665_0003980 3300046531 Bacteria 7973
817 Ga0495665_0219626 3300046531 Bacteria 983
818 Ga0495640_0014526 3300046533 Bacteria 5952
819 Ga0495640_0019303 3300046533 Bacteria 5035
820 Ga0495640_0033520 3300046533 Bacteria 3647
821 Ga0495640_0262611 3300046533 Bacteria 1078
822 Ga0495640_0380468 3300046533 Bacteria 868
823 Ga0495586_0099642 3300046535 Unclassified 1612
824 Ga0495587_0011034 3300046536 Bacteria 5730
825 Ga0495587_0026501 3300046536 Bacteria 3534
826 Ga0495587_0133453 3300046536 Bacteria 1419
827 Ga0495598_0323464 3300046537 Bacteria 588
828 Ga0495609_0061619 3300046538 Bacteria 1657
829 Ga0495645_0005471 3300046543 Bacteria 8723
830 Ga0495645_0061773 3300046543 Bacteria 2714
831 Ga0495622_0018728 3300046557 Bacteria 3224
832 Ga0495622_0034440 3300046557 Bacteria 2362
833 Ga0495622_0083079 3300046557 Bacteria 1473
834 Ga0495622_0123645 3300046557 Bacteria 1181
835 Ga0495667_0036362 3300046559 Bacteria 3287
836 Ga0495667_0037776 3300046559 Bacteria 3217
837 Ga0495667_0101512 3300046559 Bacteria 1861
838 Ga0495667_0270918 3300046559 Bacteria 1079
839 Ga0495656_0170379 3300046615 Bacteria 1064
840 Ga0495668_0071584 3300046616 Bacteria 1905
841 Ga0495668_0126299 3300046616 Bacteria 1400
842 Ga0495634_0000602 3300046642 Bacteria 34812
843 Ga0495634_0017152 3300046642 Bacteria 5171
844 Ga0495634_0020925 3300046642 Bacteria 4633
845 Ga0495634_0033514 3300046642 Bacteria 3529
846 Ga0495634_0035236 3300046642 Bacteria 3429
847 Ga0495634_0049299 3300046642 Bacteria 2832
848 Ga0495634_0151463 3300046642 Bacteria 1467
849 Ga0495634_0233360 3300046642 Unclassified 1131
850 Ga0495611_0050541 3300046648 Bacteria 1873
851 Ga0495611_0552127 3300046648 Bacteria 522
852 Ga0495625_0025297 3300046660 Bacteria 4503
853 Ga0495625_0152047 3300046660 Bacteria 1555
854 Ga0495625_0173816 3300046660 Bacteria 1436
855 Ga0495635_0012357 3300046663 Bacteria 5984
856 Ga0495635_0022635 3300046663 Bacteria 4379
857 Ga0495635_0098604 3300046663 Bacteria 1997
858 Ga0495635_0153569 3300046663 Bacteria 1567
859 Ga0495661_0078710 3300046665 Bacteria 1906
860 Ga0495661_0250310 3300046665 Bacteria 905
861 Ga0495588_0005519 3300046674 Bacteria 5632
862 Ga0495588_0492009 3300046674 Bacteria 643
863 Ga0495657_0006838 3300046675 Bacteria 8876
864 Ga0495657_0013190 3300046675 Bacteria 6105
865 Ga0495657_0021986 3300046675 Bacteria 4572
866 Ga0495599_0003392 3300046678 Bacteria 9321
867 Ga0495599_0014177 3300046678 Bacteria 4935
868 Ga0495599_0031175 3300046678 Bacteria 3346
869 Ga0495599_0081377 3300046678 Bacteria 2023
870 Ga0495623_0005381 3300046679 Bacteria 8379
871 Ga0495623_0024198 3300046679 Bacteria 3916
872 Ga0495646_0034243 3300046680 Bacteria 3155
873 Ga0495646_0102487 3300046680 Bacteria 1639
874 Ga0495646_0294721 3300046680 Bacteria 859
875 Ga0495646_0398330 3300046680 Bacteria 716
876 Ga0495647_0000694 3300046681 Bacteria 10013
877 Ga0495658_0000593 3300046683 Bacteria 19832
878 Ga0495669_0036595 3300046684 Bacteria 2170
879 Ga0495613_0020037 3300046689 Bacteria 4984
880 Ga0495613_0051126 3300046689 Bacteria 3046
881 Ga0495613_0179629 3300046689 Bacteria 1499
882 Ga0495613_0957963 3300046689 Bacteria 551
883 Ga0495624_0004068 3300046690 Bacteria 10762
884 Ga0495624_0392726 3300046690 Bacteria 833
885 Ga0495670_0026322 3300046691 Bacteria 2879
886 Ga0495671_0035145 3300046692 Bacteria 2546
887 Ga0495671_0345388 3300046692 Bacteria 714
888 Ga0495649_0012812 3300046694 Bacteria 4862
889 Ga0495600_0017947 3300046809 Bacteria 4504
890 Ga0495600_0102634 3300046809 Bacteria 1864
891 Ga0495660_0151860 3300046810 Bacteria 1143
892 Ga0495581_0000133 3300047315 Bacteria 32384
893 Ga0495604_0011413 3300047317 Bacteria 7051
894 Ga0495604_0021586 3300047317 Bacteria 5140
895 Ga0495604_0042818 3300047317 Bacteria 3546
896 Ga0495604_0187671 3300047317 Bacteria 1442
897 Ga0495636_0193810 3300047318 Bacteria 926
898 Ga0495674_0000874 3300047319 Bacteria 28828
899 Ga0495674_0027148 3300047319 Bacteria 5235
900 Ga0495674_0055959 3300047319 Bacteria 3457
901 Ga0495674_0065377 3300047319 Bacteria 3159
902 Ga0495674_1340353 3300047319 Bacteria 535
903 Ga0495672_0021766 3300047320 Bacteria 4176
904 Ga0495672_0263461 3300047320 Bacteria 831
905 Ga0495676_0192779 3300047321 Bacteria 1421
906 Ga0495680_0015402 3300047322 Bacteria 6598
907 Ga0495680_0075333 3300047322 Bacteria 2560
908 Ga0495680_0125751 3300047322 Bacteria 1888
909 Ga0495683_0073082 3300047323 Bacteria 1682
910 Ga0495687_019104 3300047443 Bacteria 3370
911 Ga0495675_0045534 3300047444 Bacteria 2793
912 Ga0495675_0148431 3300047444 Bacteria 1449
913 Ga0495677_0234833 3300047445 Bacteria 716
914 Ga0495673_0064070 3300047469 Bacteria 1565
915 Ga0495681_0225750 3300047470 Bacteria 749
916 Ga0495684_0046162 3300047471 Bacteria 3333
917 Ga0495684_0048321 3300047471 Bacteria 3254
918 Ga0495684_0124268 3300047471 Bacteria 1942
919 Ga0495686_0018634 3300047472 Bacteria 4652
920 Ga0495686_0035947 3300047472 Bacteria 3181
921 Ga0495686_0084022 3300047472 Bacteria 1941
922 Ga0495686_0284314 3300047472 Bacteria 918
923 Ga0495593_0000022 3300047673 Bacteria 69741
924 Ga0495593_0029769 3300047673 Bacteria 2991
925 Ga0495593_0400060 3300047673 Bacteria 687
926 Ga0495602_0009068 3300048088 Bacteria 10356
927 Ga0495602_0102994 3300048088 Bacteria 2337
928 Ga0495614_0071559 3300048089 Bacteria 1495
929 Ga0495615_0019230 3300048090 Bacteria 1514
930 Ga0495626_0113523 3300048091 Bacteria 1171
931 Ga0496100_0286625 3300048903 Bacteria 1229
932 Ga0496100_0331639 3300048903 Bacteria 1145
933 Ga0496100_0766693 3300048903 Bacteria 755
934 Ga0496100_1190044 3300048903 Bacteria 601
935 Ga0496100_1408556 3300048903 Bacteria 550
936 Ga0496101_0106229 3300048904 Bacteria 2108
937 Ga0496101_0232606 3300048904 Bacteria 1433
938 Ga0496101_0445125 3300048904 Bacteria 1022
939 Ga0496102_0283823 3300048905 Bacteria 1560
940 Ga0496102_0393081 3300048905 Bacteria 1304
941 Ga0496102_1297998 3300048905 Bacteria 647
942 Ga0496102_1518183 3300048905 Bacteria 588
943 Ga0496103_0022617 3300048906 Bacteria 3785
944 Ga0496103_0213094 3300048906 Bacteria 1242
945 Ga0496103_0427946 3300048906 Bacteria 850
946 Ga0496104_0002244 3300048907 Bacteria 16671
947 Ga0496104_0045777 3300048907 Bacteria 4117
948 Ga0496104_0055621 3300048907 Bacteria 3742
949 Ga0496104_0076254 3300048907 Bacteria 3193
950 Ga0496104_0099583 3300048907 Bacteria 2782
951 Ga0496104_0249088 3300048907 Bacteria 1689
952 Ga0496105_0007267 3300048908 Bacteria 8556
953 Ga0496105_0136808 3300048908 Bacteria 2018
954 Ga0496105_0160170 3300048908 Bacteria 1848
955 Ga0496106_0027096 3300048909 Bacteria 4268
956 Ga0496106_0257893 3300048909 Bacteria 1395
957 Ga0496106_0664018 3300048909 Bacteria 832
958 Ga0496106_0768700 3300048909 Bacteria 765
959 Ga0496107_0359152 3300048910 Bacteria 1084
960 Ga0496108_0140952 3300048911 Bacteria 2077
961 Ga0496108_0389500 3300048911 Bacteria 1217
962 Ga0496108_0467497 3300048911 Bacteria 1102
963 Ga0496109_0053854 3300048912 Bacteria 3671
964 Ga0496109_0570835 3300048912 Bacteria 1066
965 Ga0496109_0633372 3300048912 Bacteria 1006
966 Ga0496109_0981334 3300048912 Bacteria 782
967 Ga0496110_0130851 3300048913 Bacteria 2266
968 Ga0496110_0259592 3300048913 Bacteria 1581
969 Ga0496110_0292748 3300048913 Bacteria 1483
970 Ga0496110_0637285 3300048913 Bacteria 965
971 Ga0496110_1769793 3300048913 Bacteria 528
972 Ga0496111_0050207 3300048914 Bacteria 3008
973 Ga0496111_0232978 3300048914 Bacteria 1367
974 Ga0496111_0298459 3300048914 Bacteria 1194
975 Ga0496111_0391557 3300048914 Bacteria 1027
976 Ga0496112_0002344 3300048915 Bacteria 15200
977 Ga0496112_0060696 3300048915 Bacteria 3726
978 Ga0496112_0131959 3300048915 Bacteria 2469
979 Ga0496112_0171026 3300048915 Bacteria 2138
980 Ga0496112_0206095 3300048915 Bacteria 1924
981 Ga0496112_0656110 3300048915 Bacteria 979
982 Ga0496113_0049219 3300048916 Bacteria 3138
983 Ga0496113_0204693 3300048916 Bacteria 1569
984 Ga0496113_0255541 3300048916 Bacteria 1399
985 Ga0496114_1429327 3300048917 Bacteria 579
986 Ga0496115_0288740 3300048918 Bacteria 1346
987 Ga0496115_0616255 3300048918 Bacteria 861
988 Ga0496115_0888194 3300048918 Bacteria 688
989 Ga0496116_0001996 3300048919 Bacteria 21971
990 Ga0496117_0012572 3300048920 Bacteria 7446
991 Ga0496117_0144891 3300048920 Bacteria 1416
992 Ga0496117_0155681 3300048920 Bacteria 1345
993 Ga0496117_0373466 3300048920 Bacteria 728
994 Ga0496117_0538572 3300048920 Bacteria 558
995 Ga0496117_0570240 3300048920 Bacteria 535
996 Ga0496118_0057853 3300048921 Bacteria 2902
997 Ga0496118_0073518 3300048921 Bacteria 2449
998 Ga0496118_0152839 3300048921 Bacteria 1442
999 Ga0496118_0205010 3300048921 Bacteria 1163
1000 Ga0496118_0236222 3300048921 Bacteria 1050
1001 Ga0496118_0281871 3300048921 Bacteria 924
1002 Ga0496118_0361341 3300048921 Bacteria 769
1003 Ga0496118_0394337 3300048921 Bacteria 721
1004 Ga0496118_0526033 3300048921 Bacteria 582
1005 Ga0496118_0570689 3300048921 Bacteria 547
1006 Ga0496119_0047398 3300048922 Bacteria 2674
1007 Ga0496119_0055143 3300048922 Bacteria 2415
1008 Ga0496119_0067292 3300048922 Bacteria 2113
1009 Ga0496119_0176859 3300048922 Bacteria 1122
1010 Ga0496119_0518252 3300048922 Bacteria 552
1011 Ga0496120_0047735 3300048923 Bacteria 2467
1012 Ga0496120_0160902 3300048923 Bacteria 1119
1013 Ga0496120_0170290 3300048923 Bacteria 1078
1014 Ga0496120_0203725 3300048923 Bacteria 956
1015 Ga0496120_0298681 3300048923 Bacteria 738
1016 Ga0496121_0001525 3300048924 Bacteria 38839
1017 Ga0496121_0024780 3300048924 Bacteria 5722
1018 Ga0496121_0046275 3300048924 Bacteria 3726
1019 Ga0496121_0073632 3300048924 Bacteria 2736
1020 Ga0496121_0082049 3300048924 Bacteria 2550
1021 Ga0496121_0147457 3300048924 Bacteria 1736
1022 Ga0496121_0466128 3300048924 Bacteria 810
1023 Ga0496122_0019339 3300048925 Bacteria 6225
1024 Ga0496123_0122239 3300048926 Bacteria 1461
1025 Ga0496125_0005069 3300048928 Bacteria 14847
1026 Ga0496125_0006742 3300048928 Bacteria 12341
1027 Ga0496125_0052831 3300048928 Bacteria 3338
1028 Ga0496125_0062155 3300048928 Bacteria 2989
1029 Ga0496125_0123131 3300048928 Bacteria 1844
1030 Ga0496125_0185417 3300048928 Bacteria 1381
1031 Ga0496126_0047835 3300048929 Bacteria 3914
1032 Ga0496126_0048584 3300048929 Bacteria 3876
1033 Ga0496126_0048723 3300048929 Bacteria 3870
1034 Ga0496126_0049241 3300048929 Bacteria 3847
1035 Ga0496126_0057330 3300048929 Bacteria 3517
1036 Ga0496126_0123849 3300048929 Bacteria 2239
1037 Ga0496126_0175444 3300048929 Bacteria 1823
1038 Ga0496126_0181549 3300048929 Bacteria 1787
1039 Ga0496126_0221075 3300048929 Bacteria 1591
1040 Ga0496126_0228930 3300048929 Bacteria 1558
1041 Ga0496126_0239831 3300048929 Bacteria 1515
1042 Ga0496126_0269900 3300048929 Bacteria 1412
1043 Ga0496126_0285276 3300048929 Bacteria 1367
1044 Ga0496126_0401272 3300048929 Bacteria 1112
1045 Ga0496126_0448340 3300048929 Bacteria 1039
1046 Ga0496126_0903775 3300048929 Bacteria 669
1047 Ga0496126_1010394 3300048929 Bacteria 623
1048 Ga0495682_0005291 3300049460 Bacteria 5384
1049 Ga0501031_0006238 3300049568 Bacteria 7772
1050 Ga0501031_0180667 3300049568 Bacteria 1378
1051 Ga0501031_0219289 3300049568 Bacteria 1239
1052 Ga0501032_0000196 3300049569 Bacteria 50261
1053 Ga0501032_0194489 3300049569 Bacteria 1325
1054 Ga0501032_0215503 3300049569 Bacteria 1250
1055 Ga0501033_0003550 3300049570 Bacteria 12758
1056 Ga0501033_0014112 3300049570 Bacteria 6074
1057 Ga0501033_0019071 3300049570 Bacteria 5186
1058 Ga0501033_0019990 3300049570 Bacteria 5061
1059 Ga0501034_0000157 3300049571 Bacteria 128661
1060 Ga0501034_0078872 3300049571 Bacteria 3296
1061 Ga0501034_0120911 3300049571 Bacteria 2605
1062 Ga0501034_0197332 3300049571 Bacteria 1972
1063 Ga0501034_0219819 3300049571 Bacteria 1852
1064 Ga0501036_0000440 3300049572 Bacteria 29582
1065 Ga0501036_0056112 3300049572 Bacteria 3337
1066 Ga0501036_0252312 3300049572 Bacteria 1478
1067 Ga0501036_0286433 3300049572 Bacteria 1378
1068 Ga0501036_0452612 3300049572 Bacteria 1069
1069 Ga0501036_1242480 3300049572 Bacteria 606
1070 Ga0501037_0000969 3300049573 Bacteria 21316
1071 Ga0501037_0030622 3300049573 Bacteria 3975
1072 Ga0501037_0223896 3300049573 Bacteria 1322
1073 Ga0501037_0295852 3300049573 Bacteria 1125
1074 Ga0501038_0000473 3300049574 Bacteria 35337
1075 Ga0501038_0018346 3300049574 Bacteria 6317
1076 Ga0501038_0074628 3300049574 Bacteria 2868
1077 Ga0501038_0288621 3300049574 Bacteria 1290
1078 Ga0501038_0501563 3300049574 Bacteria 928
1079 Ga0501039_0007468 3300049575 Bacteria 8345
1080 Ga0501039_0046128 3300049575 Bacteria 3366
1081 Ga0501039_0237689 3300049575 Bacteria 1432
1082 Ga0501040_0105092 3300049576 Bacteria 1972
1083 Ga0501041_0413570 3300049577 Bacteria 855
1084 Ga0501042_0299817 3300049578 Bacteria 1161
1085 Ga0501042_0559523 3300049578 Bacteria 831
1086 Ga0501043_0001087 3300049579 Bacteria 23901
1087 Ga0501043_0121043 3300049579 Bacteria 2052
1088 Ga0501043_0186149 3300049579 Bacteria 1616
1089 Ga0501043_0290933 3300049579 Bacteria 1250
1090 Ga0501043_0328292 3300049579 Bacteria 1165
1091 Ga0501043_0420700 3300049579 Bacteria 1007
1092 Ga0501046_0000181 3300049580 Bacteria 64035
1093 Ga0501046_0031149 3300049580 Bacteria 4326
1094 Ga0501046_0191740 3300049580 Bacteria 1524
1095 Ga0501046_0320445 3300049580 Bacteria 1130
1096 Ga0501046_0344245 3300049580 Bacteria 1083
1097 Ga0501046_0728723 3300049580 Bacteria 697
1098 Ga0501046_0755960 3300049580 Bacteria 683
1099 Ga0501047_0000419 3300049581 Bacteria 47535
1100 Ga0501047_0130491 3300049581 Bacteria 2393
1101 Ga0501047_0200477 3300049581 Bacteria 1857
1102 Ga0501047_0285830 3300049581 Bacteria 1493
1103 Ga0501047_0578520 3300049581 Bacteria 946
1104 Ga0501048_0000057 3300049582 Bacteria 56138
1105 Ga0501048_0022093 3300049582 Bacteria 4655
1106 Ga0501048_0120264 3300049582 Bacteria 1856
1107 Ga0501048_0473884 3300049582 Bacteria 897
1108 Ga0501067_0000507 3300049583 Bacteria 21269
1109 Ga0501067_0116833 3300049583 Bacteria 1484
1110 Ga0501067_0547468 3300049583 Bacteria 648
1111 Ga0501068_0001808 3300049584 Bacteria 11366
1112 Ga0501068_0050540 3300049584 Bacteria 2513
1113 Ga0501068_0200698 3300049584 Bacteria 1265
1114 Ga0501069_0001596 3300049585 Bacteria 11217
1115 Ga0501069_0069376 3300049585 Bacteria 1973
1116 Ga0501069_0508927 3300049585 Bacteria 719
1117 Ga0501070_0003003 3300049586 Bacteria 14682
1118 Ga0501070_0018309 3300049586 Bacteria 5875
1119 Ga0501070_0075906 3300049586 Bacteria 2782
1120 Ga0501070_0218868 3300049586 Bacteria 1562
1121 Ga0501070_0601426 3300049586 Bacteria 876
1122 Ga0501070_0695609 3300049586 Bacteria 804
1123 Ga0501070_0772540 3300049586 Bacteria 756
1124 Ga0501071_0058732 3300049587 Bacteria 2782
1125 Ga0501071_0094604 3300049587 Bacteria 2198
1126 Ga0501071_0171754 3300049587 Bacteria 1623
1127 Ga0501072_0009854 3300049588 Bacteria 7266
1128 Ga0501072_0142587 3300049588 Bacteria 1910
1129 Ga0501072_0530948 3300049588 Bacteria 930
1130 Ga0501072_0543533 3300049588 Bacteria 918
1131 Ga0501073_0000027 3300049589 Bacteria 121860
1132 Ga0501073_0007901 3300049589 Bacteria 7892
1133 Ga0501073_0915073 3300049589 Bacteria 604
1134 Ga0501074_0000081 3300049590 Bacteria 46487
1135 Ga0501075_0355693 3300049591 Bacteria 1116
1136 Ga0501076_0158314 3300049592 Bacteria 1844
1137 Ga0501076_0219954 3300049592 Bacteria 1552
1138 Ga0501077_0031980 3300049593 Bacteria 3348
1139 Ga0501077_0940908 3300049593 Bacteria 556
1140 Ga0501079_0013289 3300049741 Bacteria 6277
1141 Ga0501079_0037393 3300049741 Bacteria 3741
1142 Ga0501079_0905066 3300049741 Bacteria 695
1143 Ga0501080_0003534 3300049742 Bacteria 13770
1144 Ga0501080_0063839 3300049742 Bacteria 3426
1145 Ga0501080_0482214 3300049742 Bacteria 1109
1146 Ga0501081_0879697 3300049743 Bacteria 675
1147 Ga0501083_0000947 3300049744 Bacteria 19180
1148 Ga0501083_0018670 3300049744 Bacteria 4830
1149 Ga0501083_0328852 3300049744 Bacteria 994
1150 Ga0501035_0000145 3300049822 Bacteria 86013
1151 Ga0501035_0055322 3300049822 Bacteria 3542
1152 Ga0501035_0244481 3300049822 Bacteria 1525
1153 Ga0501035_0259523 3300049822 Bacteria 1473
1154 Ga0501035_0360854 3300049822 Bacteria 1214
1155 Ga0501035_1010306 3300049822 Bacteria 653
1156 Ga0501044_0002483 3300049823 Bacteria 21039
1157 Ga0501044_0011935 3300049823 Bacteria 9416
1158 Ga0501044_0089955 3300049823 Bacteria 3098
1159 Ga0501044_0102043 3300049823 Bacteria 2885
1160 Ga0501044_0253597 3300049823 Bacteria 1699
1161 Ga0501044_0256245 3300049823 Bacteria 1689
1162 Ga0501044_0578859 3300049823 Bacteria 1017
1163 Ga0501044_0952317 3300049823 Bacteria 731
1164 Ga0501044_0974664 3300049823 Bacteria 720
1165 Ga0501044_1027689 3300049823 Bacteria 695
1166 Ga0501045_0008413 3300049824 Bacteria 7191
1167 Ga0501045_0230564 3300049824 Bacteria 1378
1168 nmdc:mga03683_118349_c1 3300050489 Bacteria 1176
1169 nmdc:mga03683_138655_c1 3300050489 Bacteria 1092
1170 nmdc:mga03683_24639_c1 3300050489 Bacteria 2356
1171 nmdc:mga03683_397877_c1 3300050489 Bacteria 657
1172 nmdc:mga03n38_145495_c1 3300050490 Bacteria 1188
1173 nmdc:mga03n38_217001_c1 3300050490 Bacteria 997
1174 nmdc:mga03n38_361713_c1 3300050490 Bacteria 792
1175 nmdc:mga03n38_55894_c1 3300050490 Bacteria 1780
1176 nmdc:mga00v17_128693_c1 3300050491 Bacteria 1617
1177 nmdc:mga00v17_20987_c1 3300050491 Bacteria 3750
1178 nmdc:mga00v17_34141_c1 3300050491 Bacteria 3019
1179 nmdc:mga00v17_367578_c1 3300050491 Bacteria 935
1180 nmdc:mga00v17_372647_c1 3300050491 Bacteria 928
1181 nmdc:mga00v17_570737_c1 3300050491 Bacteria 731
1182 nmdc:mga00v17_64124_c1 3300050491 Bacteria 2264
1183 nmdc:mga0yw44_2044_c1 3300050492 Bacteria 8411
1184 nmdc:mga0yw44_20554_c1 3300050492 Bacteria 3666
1185 nmdc:mga0yw44_5981_c1 3300050492 Bacteria 5824
1186 nmdc:mga0yw44_78818_c1 3300050492 Bacteria 2060
1187 nmdc:mga0yw44_80808_c1 3300050492 Bacteria 2037
1188 nmdc:mga0yw44_8586_c1 3300050492 Bacteria 5100
1189 nmdc:mga0k408_12582_c1 3300050493 Bacteria 4626
1190 nmdc:mga0k408_145062_c1 3300050493 Bacteria 1413
1191 nmdc:mga0k408_212989_c1 3300050493 Bacteria 1154
1192 nmdc:mga0k408_6223_c1 3300050493 Bacteria 3587
1193 nmdc:mga0k408_9579_c1 3300050493 Bacteria 5227
1194 nmdc:mga06z11_356224_c1 3300050494 Bacteria 877
1195 nmdc:mga06z11_394799_c1 3300050494 Bacteria 832
1196 nmdc:mga06z11_538023_c1 3300050494 Bacteria 709
1197 nmdc:mga06z11_69049_c1 3300050494 Bacteria 1864
1198 nmdc:mga06z11_919732_c1 3300050494 Bacteria 533
1199 nmdc:mga04h51_71852_c1 3300050495 Bacteria 1210
1200 nmdc:mga07m45_179963_c1 3300050496 Bacteria 1229
1201 nmdc:mga07m45_429412_c1 3300050496 Bacteria 766
1202 nmdc:mga07m45_45899_c1 3300050496 Bacteria 2453
1203 nmdc:mga07m45_56187_c1 3300050496 Bacteria 2225
1204 nmdc:mga07m45_747047_c1 3300050496 Bacteria 562
1205 nmdc:mga05p37_1609438_c1 3300050507 Bacteria 639
1206 nmdc:mga05p37_72861_c1 3300050507 Bacteria 4227
1207 nmdc:mga05p37_73893_c1 3300050507 Bacteria 4196
1208 nmdc:mga0qj67_1071363_c1 3300050509 Bacteria 630
1209 nmdc:mga0qj67_41057_c1 3300050509 Bacteria 3638
1210 nmdc:mga06r32_1021692_c1 3300050510 Bacteria 779
1211 nmdc:mga08y16_165438_c1 3300050511 Bacteria 2298
1212 nmdc:mga08y16_470105_c1 3300050511 Bacteria 1280
1213 nmdc:mga0n895_10129_c1 3300050512 Bacteria 8297
1214 nmdc:mga0n895_336454_c1 3300050512 Bacteria 1529
1215 nmdc:mga0n895_648364_c1 3300050512 Bacteria 1055
1216 nmdc:mga0rr50_1194805_c1 3300050513 Bacteria 646
1217 nmdc:mga08x19_610591_c1 3300050514 Bacteria 773
1218 nmdc:mga08x19_738350_c1 3300050514 Bacteria 699
1219 nmdc:mga0a205_445443_c1 3300050515 Bacteria 1155
1220 nmdc:mga0sz30_21539_c1 3300050516 Bacteria 2610
1221 nmdc:mga0sz30_218645_c1 3300050516 Bacteria 847
1222 nmdc:mga0sz30_3415_c1 3300050516 Bacteria 3487
1223 nmdc:mga0sz30_48337_c1 3300050516 Bacteria 1800
1224 nmdc:mga0sz30_59309_c1 3300050516 Bacteria 1633
1225 Ga0495601_0022629 3300053077 Bacteria 3860
1226 Ga0495601_0244131 3300053077 Bacteria 1172
1227 Ga0495601_0291664 3300053077 Bacteria 1063
1228 Ga0495601_0407803 3300053077 Bacteria 881
1229 Ga0495601_0844451 3300053077 Bacteria 580
1230 Ga0495612_0011436 3300053078 Bacteria 3579
1231 Ga0495612_0028665 3300053078 Bacteria 2242
1232 Ga0495612_0209187 3300053078 Bacteria 862
1233 Ga0500635_0001095 3300053080 Bacteria 6483
1234 Ga0500635_0006128 3300053080 Bacteria 3197
1235 Ga0500635_0345415 3300053080 Bacteria 589
1236 Ga0495655_0178982 3300053083 Bacteria 683
1237 Ga0495595_0004815 3300053084 Bacteria 5434
1238 Ga0495595_0009867 3300053084 Bacteria 3958
1239 Ga0495595_0375009 3300053084 Bacteria 720
1240 Ga0495595_0493234 3300053084 Bacteria 624
1241 Ga0495619_0016828 3300053085 Bacteria 4629
1242 Ga0495619_0029722 3300053085 Bacteria 3532
1243 Ga0495619_0145887 3300053085 Bacteria 1631
1244 Ga0495619_0504910 3300053085 Bacteria 831
1245 Ga0495619_1110296 3300053085 Unclassified 526
1246 Ga0500578_0771260 3300053086 Bacteria 511
1247 Ga0500643_000052 3300053087 Bacteria 144656
1248 Ga0500644_0107119 3300053088 Bacteria 1071
1249 Ga0500581_209572 3300053089 Bacteria 856
1250 Ga0500646_0104548 3300053090 Bacteria 893
1251 Ga0500583_0155343 3300053092 Bacteria 1139
1252 Ga0500583_0351899 3300053092 Bacteria 714
1253 Ga0500651_0002435 3300053093 Bacteria 9828
1254 Ga0500651_0040927 3300053093 Bacteria 2920
1255 Ga0500651_0143448 3300053093 Bacteria 1438
1256 Ga0500651_0273696 3300053093 Bacteria 976
1257 Ga0500566_0000113 3300053094 Bacteria 41467
1258 Ga0500566_0001807 3300053094 Bacteria 12572
1259 Ga0500566_0018844 3300053094 Bacteria 4052
1260 Ga0500566_0514724 3300053094 Bacteria 513
1261 Ga0500640_004118 3300053095 Bacteria 5231
1262 Ga0500640_273821 3300053095 Bacteria 523
1263 Ga0500641_0195775 3300053096 Bacteria 864
1264 Ga0500641_0349270 3300053096 Bacteria 595
1265 Ga0500650_0000211 3300053098 Bacteria 14092
1266 Ga0500650_0385404 3300053098 Bacteria 608
1267 Ga0500554_018039 3300053102 Bacteria 1898
1268 Ga0500555_003023 3300053103 Bacteria 4805
1269 Ga0500556_0000035 3300053104 Bacteria 145357
1270 Ga0500556_0270398 3300053104 Bacteria 667
1271 Ga0500557_000057 3300053105 Bacteria 47849
1272 Ga0500562_063601 3300053108 Bacteria 992
1273 Ga0500569_011160 3300053109 Bacteria 2138
1274 Ga0500569_019952 3300053109 Bacteria 1751
1275 Ga0500572_000626 3300053111 Bacteria 11812
1276 Ga0500572_150885 3300053111 Bacteria 759
1277 Ga0500591_030004 3300053115 Bacteria 2628
1278 Ga0500592_002833 3300053116 Bacteria 2787
1279 Ga0500594_0078228 3300053118 Bacteria 985
1280 Ga0500595_005291 3300053119 Bacteria 5655
1281 Ga0500595_020996 3300053119 Bacteria 2338
1282 Ga0500595_036027 3300053119 Bacteria 1624
1283 Ga0500607_231258 3300053121 Bacteria 757
1284 Ga0500607_268513 3300053121 Bacteria 661
1285 Ga0500608_000655 3300053122 Bacteria 12732
1286 Ga0500608_009359 3300053122 Bacteria 4158
1287 Ga0500614_010315 3300053123 Bacteria 2004
1288 Ga0500618_001755 3300053125 Bacteria 9191
1289 Ga0500626_100377 3300053128 Bacteria 1262
1290 Ga0500642_0000027 3300053130 Bacteria 119688
1291 Ga0500642_0093206 3300053130 Bacteria 1394
1292 Ga0500642_0190691 3300053130 Bacteria 956
1293 Ga0500642_0496599 3300053130 Bacteria 516
1294 Ga0500652_000244 3300053131 Bacteria 20528
1295 Ga0500658_0160164 3300053134 Bacteria 1018
1296 Ga0500658_0256067 3300053134 Bacteria 804
1297 Ga0500658_0551072 3300053134 Bacteria 519
1298 Ga0500559_0000064 3300053136 Bacteria 85844
1299 Ga0500559_0004501 3300053136 Bacteria 6598
1300 Ga0500559_0039467 3300053136 Bacteria 2053
1301 Ga0500559_0128063 3300053136 Bacteria 1185
1302 Ga0500559_0139069 3300053136 Bacteria 1136
1303 Ga0500559_0434627 3300053136 Bacteria 608
1304 Ga0500568_0000443 3300053139 Bacteria 31089
1305 Ga0500568_0016857 3300053139 Bacteria 3236
1306 Ga0500568_0109108 3300053139 Bacteria 1035
1307 Ga0500577_0004109 3300053142 Bacteria 3819
1308 Ga0500586_004396 3300053145 Bacteria 3443
1309 Ga0500590_027615 3300053148 Bacteria 2944
1310 Ga0500603_000215 3300053150 Bacteria 15318
1311 Ga0500603_001657 3300053150 Bacteria 5012
1312 Ga0500604_0009467 3300053151 Bacteria 2595
1313 Ga0500616_0000028 3300053153 Bacteria 435722
1314 Ga0500616_0000054 3300053153 Bacteria 290186
1315 Ga0500616_0224703 3300053153 Bacteria 817
1316 Ga0500620_000883 3300053155 Bacteria 5196
1317 Ga0500622_0003283 3300053156 Bacteria 10965
1318 Ga0500622_0009279 3300053156 Bacteria 5453
1319 Ga0500627_0011595 3300053158 Bacteria 3264
1320 Ga0500627_0327533 3300053158 Bacteria 664
1321 Ga0500627_0484747 3300053158 Bacteria 516
1322 Ga0500630_000802 3300053159 Bacteria 14482
1323 Ga0500634_0200378 3300053161 Bacteria 877
1324 Ga0500638_038121 3300053162 Bacteria 2332
1325 Ga0500639_000899 3300053163 Bacteria 15129
1326 Ga0500639_098582 3300053163 Bacteria 1443
1327 Ga0500636_0000594 3300053177 Bacteria 19747
1328 Ga0500636_0000823 3300053177 Bacteria 16716
1329 Ga0500636_0064057 3300053177 Bacteria 2142
1330 Ga0500636_0168364 3300053177 Bacteria 1187
1331 Ga0500636_0476856 3300053177 Bacteria 557
1332 Ga0500637_0085474 3300053178 Bacteria 1824
1333 Ga0500637_0124117 3300053178 Bacteria 1498
1334 Ga0500637_0166750 3300053178 Bacteria 1267
1335 Ga0500637_0301275 3300053178 Bacteria 874
1336 Ga0500570_219005 3300053724 Bacteria 548
1337 Ga0500625_036943 3300053729 Bacteria 2311
1338 Ga0500645_046197 3300053730 Bacteria 1278
1339 Ga0500596_001109 3300053735 Bacteria 5417
1340 Ga0500599_009363 3300053736 Bacteria 1282
1341 Ga0500601_000119 3300053737 Bacteria 16610
1342 Ga0501084_0011359 3300054114 Bacteria 7375
1343 Ga0501084_0022705 3300054114 Bacteria 5236
1344 Ga0500661_007552 3300055283 Bacteria 2008
1345 Ga0500661_123637 3300055283 Bacteria 502
1346 Ga0501082_0008590 3300060353 Bacteria 8811
1347 Ga0501082_0059486 3300060353 Bacteria 3292
1348 Ga0501082_1396245 3300060353 Bacteria 612
1349 Ga0466962_0065345 3300061719 Bacteria 1737
1350 Ga0530510_0488741 3300061734 Bacteria 933

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0001686 Ga0495606_0001686_23773_24210 119
2 3300048915 Ga0496112_0002344 Ga0496112_0002344_6390_6836 123
3 3300013306 Ga0163162_13305704 Ga0163162_133057041 133
4 3300031731 Ga0307405_11429139 Ga0307405_114291391 133
5 3300050490 nmdc:mga03n38_217001_c1 nmdc:mga03n38_217001_c1_535_987 133
6 3300005719 Ga0068861_101852455 Ga0068861_1018524551 134
7 3300005844 Ga0068862_100567903 Ga0068862_1005679032 134
8 3300032002 Ga0307416_102290996 Ga0307416_1022909962 134
9 3300042006 Ga0439432_131068 Ga0439432_131068_266_721 134
10 3300042435 Ga0439434_0120306 Ga0439434_0120306_18_473 134
11 3300013297 Ga0157378_10018404 Ga0157378_100184046 136
12 3300026089 Ga0207648_12277539 Ga0207648_122775391 136
13 3300028794 Ga0307515_10524494 Ga0307515_105244942 137
14 3300031456 Ga0307513_10813939 Ga0307513_108139391 137
15 3300035171 Ga0373946_0021133 Ga0373946_0021133_1917_2339 137
16 3300035692 Ga0373935_0027114 Ga0373935_0027114_168_590 137
17 3300037853 Ga0436364_0541162 Ga0436364_0541162_348_764 137
18 3300046689 Ga0495613_0179629 Ga0495613_0179629_1039_1461 137
19 3300048089 Ga0495614_0071559 Ga0495614_0071559_173_595 137
20 3300049589 Ga0501073_0915073 Ga0501073_0915073_23_469 137
21 3300009553 Ga0105249_10806706 Ga0105249_108067062 138
22 3300035115 Ga0373941_0452892 Ga0373941_0452892_40_495 138
23 3300035241 Ga0373961_0404324 Ga0373961_0404324_10_465 138
24 3300049580 Ga0501046_0320445 Ga0501046_0320445_252_713 138
25 3300049581 Ga0501047_0285830 Ga0501047_0285830_94_555 138
26 3300049586 Ga0501070_0018309 Ga0501070_0018309_392_853 138
27 3300049742 Ga0501080_0063839 Ga0501080_0063839_2816_3277 138
28 3300049823 Ga0501044_0011935 Ga0501044_0011935_8942_9403 138
29 3300005329 Ga0070683_100863738 Ga0070683_1008637381 139
30 3300005331 Ga0070670_100135781 Ga0070670_1001357812 139
31 3300005334 Ga0068869_100025714 Ga0068869_1000257145 139
32 3300005338 Ga0068868_100105457 Ga0068868_1001054572 139
33 3300005339 Ga0070660_100351071 Ga0070660_1003510712 139
34 3300005353 Ga0070669_100356393 Ga0070669_1003563933 139
35 3300005366 Ga0070659_100121951 Ga0070659_1001219513 139
36 3300005367 Ga0070667_101488755 Ga0070667_1014887551 139
37 3300005440 Ga0070705_100686406 Ga0070705_1006864061 139
38 3300005455 Ga0070663_100092281 Ga0070663_1000922812 139
39 3300005456 Ga0070678_100267806 Ga0070678_1002678062 139
40 3300005518 Ga0070699_100201113 Ga0070699_1002011132 139
41 3300005614 Ga0068856_100434702 Ga0068856_1004347023 139
42 3300005615 Ga0070702_100662957 Ga0070702_1006629572 139
43 3300005616 Ga0068852_100515489 Ga0068852_1005154892 139
44 3300005618 Ga0068864_100212870 Ga0068864_1002128702 139
45 3300005719 Ga0068861_100211061 Ga0068861_1002110613 139
46 3300005842 Ga0068858_100034437 Ga0068858_1000344371 139
47 3300006042 Ga0075368_10097188 Ga0075368_100971882 139
48 3300006048 Ga0075363_100058674 Ga0075363_1000586742 139
49 3300006177 Ga0075362_10068209 Ga0075362_100682092 139
50 3300006186 Ga0075369_10096794 Ga0075369_100967942 139
51 3300006195 Ga0075366_10120593 Ga0075366_101205932 139
52 3300006353 Ga0075370_10309359 Ga0075370_103093591 139
53 3300006358 Ga0068871_100227592 Ga0068871_1002275922 139
54 3300006852 Ga0075433_10652485 Ga0075433_106524852 139
55 3300006871 Ga0075434_100127180 Ga0075434_1001271803 139
56 3300006914 Ga0075436_100676489 Ga0075436_1006764892 139
57 3300007076 Ga0075435_100653780 Ga0075435_1006537802 139
58 3300009011 Ga0105251_10222271 Ga0105251_102222712 139
59 3300009092 Ga0105250_10113873 Ga0105250_101138732 139
60 3300009098 Ga0105245_10074222 Ga0105245_100742222 139
61 3300009147 Ga0114129_10003546 Ga0114129_100035462 139
62 3300009148 Ga0105243_10404528 Ga0105243_104045282 139
63 3300009148 Ga0105243_11068895 Ga0105243_110688952 139
64 3300009177 Ga0105248_10092495 Ga0105248_100924954 139
65 3300009545 Ga0105237_10149889 Ga0105237_101498892 139
66 3300010375 Ga0105239_10727186 Ga0105239_107271862 139
67 3300011119 Ga0105246_10005981 Ga0105246_100059817 139
68 3300013100 Ga0157373_10328759 Ga0157373_103287592 139
69 3300013296 Ga0157374_10885789 Ga0157374_108857892 139
70 3300013297 Ga0157378_11127564 Ga0157378_111275641 139
71 3300013306 Ga0163162_12248743 Ga0163162_122487431 139
72 3300014325 Ga0163163_10532864 Ga0163163_105328641 139
73 3300014326 Ga0157380_12868886 Ga0157380_128688861 139
74 3300014969 Ga0157376_10371391 Ga0157376_103713912 139
75 3300025711 Ga0207696_1102227 Ga0207696_11022271 139
76 3300025900 Ga0207710_10112002 Ga0207710_101120022 139
77 3300025900 Ga0207710_10179041 Ga0207710_101790412 139
78 3300025907 Ga0207645_10121167 Ga0207645_101211672 139
79 3300025908 Ga0207643_10106644 Ga0207643_101066443 139
80 3300025914 Ga0207671_10304159 Ga0207671_103041591 139
81 3300025919 Ga0207657_10181252 Ga0207657_101812523 139
82 3300025925 Ga0207650_11024041 Ga0207650_110240411 139
83 3300025932 Ga0207690_10456869 Ga0207690_104568692 139
84 3300025938 Ga0207704_10617941 Ga0207704_106179412 139
85 3300025941 Ga0207711_10042861 Ga0207711_100428612 139
86 3300025944 Ga0207661_10644229 Ga0207661_106442292 139
87 3300025972 Ga0207668_10029496 Ga0207668_100294964 139
88 3300026078 Ga0207702_10108606 Ga0207702_101086062 139
89 3300026095 Ga0207676_10103153 Ga0207676_101031534 139
90 3300026116 Ga0207674_10048642 Ga0207674_100486422 139
91 3300026118 Ga0207675_100242617 Ga0207675_1002426172 139
92 3300026142 Ga0207698_10226550 Ga0207698_102265503 139
93 3300031824 Ga0307413_11448801 Ga0307413_114488012 139
94 3300042001 Ga0439441_012115 Ga0439441_012115_946_1416 139
95 3300042436 Ga0439435_0151183 Ga0439435_0151183_264_734 139
96 3300047319 Ga0495674_0065377 Ga0495674_0065377_1012_1434 139
97 3300048903 Ga0496100_1190044 Ga0496100_1190044_31_477 139
98 3300048909 Ga0496106_0027096 Ga0496106_0027096_3689_4135 139
99 3300048912 Ga0496109_0570835 Ga0496109_0570835_54_500 139
100 3300048914 Ga0496111_0391557 Ga0496111_0391557_453_899 139
101 3300048915 Ga0496112_0131959 Ga0496112_0131959_1427_1873 139
102 3300048915 Ga0496112_0656110 Ga0496112_0656110_219_647 139
103 3300048917 Ga0496114_1429327 Ga0496114_1429327_53_499 139
104 3300048923 Ga0496120_0170290 Ga0496120_0170290_53_499 139
105 3300048924 Ga0496121_0147457 Ga0496121_0147457_999_1445 139
106 3300048928 Ga0496125_0123131 Ga0496125_0123131_1137_1583 139
107 3300050490 nmdc:mga03n38_361713_c1 nmdc:mga03n38_361713_c1_35_481 139
108 3300050491 nmdc:mga00v17_570737_c1 nmdc:mga00v17_570737_c1_205_651 139
109 3300050493 nmdc:mga0k408_212989_c1 nmdc:mga0k408_212989_c1_282_728 139
110 3300050507 nmdc:mga05p37_73893_c1 nmdc:mga05p37_73893_c1_261_719 139
111 3300050512 nmdc:mga0n895_336454_c1 nmdc:mga0n895_336454_c1_98_544 139
112 3300050514 nmdc:mga08x19_610591_c1 nmdc:mga08x19_610591_c1_261_707 139
113 3300053086 Ga0500578_0771260 Ga0500578_0771260_79_501 139
114 3300046459 Ga0495629_0456542 Ga0495629_0456542_242_688 140
115 3300048929 Ga0496126_0049241 Ga0496126_0049241_1353_1796 140
116 3300049571 Ga0501034_0078872 Ga0501034_0078872_824_1264 140
117 3300049582 Ga0501048_0120264 Ga0501048_0120264_1188_1628 140
118 3300049586 Ga0501070_0075906 Ga0501070_0075906_494_934 140
119 3300049587 Ga0501071_0058732 Ga0501071_0058732_1877_2317 140
120 3300049823 Ga0501044_0578859 Ga0501044_0578859_167_607 140
121 3300005458 Ga0070681_10859626 Ga0070681_108596262 141
122 3300005983 Ga0081540_1008395 Ga0081540_10083954 141
123 3300006048 Ga0075363_100454948 Ga0075363_1004549481 141
124 3300006195 Ga0075366_10009134 Ga0075366_100091344 141
125 3300025972 Ga0207668_11441510 Ga0207668_114415101 141
126 3300026118 Ga0207675_100748389 Ga0207675_1007483892 141
127 3300028380 Ga0268265_10485201 Ga0268265_104852012 141
128 3300031456 Ga0307513_10617626 Ga0307513_106176262 141
129 3300037853 Ga0436364_1068178 Ga0436364_1068178_176_616 141
130 3300039450 Ga0436363_0374194 Ga0436363_0374194_526_966 141
131 3300039450 Ga0436363_1278762 Ga0436363_1278762_828_1268 141
132 3300042438 Ga0439459_0069202 Ga0439459_0069202_291_755 141
133 3300044684 Ga0466966_0019524 Ga0466966_0019524_2382_2822 141
134 3300044719 Ga0466971_0078700 Ga0466971_0078700_956_1396 141
135 3300045049 Ga0466959_0011393 Ga0466959_0011393_2462_2902 141
136 3300046455 Ga0495603_0549721 Ga0495603_0549721_73_519 141
137 3300050493 nmdc:mga0k408_6223_c1 nmdc:mga0k408_6223_c1_1570_2034 141
138 3300053136 Ga0500559_0128063 Ga0500559_0128063_62_508 141
139 3300035171 Ga0373946_0034419 Ga0373946_0034419_682_1128 142
140 3300046642 Ga0495634_0233360 Ga0495634_0233360_238_684 142
141 iso_pu_bacteria 2511231028 2511398397 142
142 iso_pu_bacteria 2513237094 2513638647 142
143 iso_pu_bacteria 2513237095 2513649964 142
144 iso_pu_bacteria 2513237102 2513702491 142
145 iso_pu_bacteria 2513237104 2513716808 142
146 iso_pu_bacteria 2513237139 2513874257 142
147 iso_pu_bacteria 2513237161 2514009977 142
148 iso_pu_bacteria 2517093001 2517104597 142
149 iso_pu_bacteria 2524023205 2524438552 142
150 iso_pu_bacteria 2528768022 2528850403 142
151 iso_pu_bacteria 2602042107 2603860633 142
152 iso_pu_bacteria 2617270735 2617353882 142
153 iso_pu_bacteria 2617270741 2617374660 142
154 iso_pu_bacteria 2643221651 2644290220 142
155 iso_pu_bacteria 2744054633 2745077222 142
156 iso_pu_bacteria 2791355196 2793059392 142
157 iso_pu_bacteria 2802429603 2805916023 142
158 iso_pu_bacteria 2816332527 2818240964 142
159 iso_pu_bacteria 2824600985 2824608608 142
160 iso_pu_bacteria 2824609381 2824616190 142
161 iso_pu_bacteria 2824617872 2824626021 142
162 iso_pu_bacteria 2824626560 2824634322 142
163 iso_pu_bacteria 2824635225 2824642683 142
164 iso_pu_bacteria 2824644064 2824650610 142
165 iso_pu_bacteria 2824653114 2824660675 142
166 iso_pu_bacteria 2824661429 2824671204 142
167 iso_pu_bacteria 2824671348 2824679442 142
168 iso_pu_bacteria 2824679649 2824686276 142
169 iso_pu_bacteria 2824687955 2824696049 142
170 iso_pu_bacteria 2824704595 2824713907 142
171 iso_pu_bacteria 2824714736 2824722251 142
172 iso_pu_bacteria 2824723954 2824730699 142
173 iso_pu_bacteria 2824732956 2824738950 142
174 iso_pu_bacteria 2824746037 2824753285 142
175 iso_pu_bacteria 2824753945 2824761102 142
176 iso_pu_bacteria 2824763712 2824771781 142
177 iso_pu_bacteria 2824773399 2824779776 142
178 iso_pu_bacteria 2841941048 2841942489 142
179 iso_pu_bacteria 2841949485 2841953162 142
180 iso_pu_bacteria 2841957949 2841960669 142
181 iso_pu_bacteria 2841966195 2841970815 142
182 iso_pu_bacteria 2841974524 2841977926 142
183 iso_pu_bacteria 2842038055 2842041771 142
184 iso_pu_bacteria 2842045827 2842049813 142
185 iso_pu_bacteria 2844315083 2844321345 142
186 iso_pu_bacteria 2847930680 2847932065 142
187 iso_pu_bacteria 2849076700 2849077029 142
188 iso_pu_bacteria 2857509624 2857514696 142
189 iso_pu_bacteria 2857524615 2857525592 142
190 iso_pu_bacteria 2874612657 2874620295 142
191 iso_pu_bacteria 2874620515 2874624232 142
192 iso_pu_bacteria 2874628541 2874630296 142
193 iso_pu_bacteria 2876761206 2876767672 142
194 iso_pu_bacteria 2879083081 2879085741 142
195 iso_pu_bacteria 2879099564 2879100003 142
196 iso_pu_bacteria 2881364244 2881367734 142
197 iso_pu_bacteria 2881665667 2881669326 142
198 iso_pu_bacteria 2885366525 2885374473 142
199 iso_pu_bacteria 2885409591 2885412125 142
200 iso_pu_bacteria 2888378607 2888387643 142
201 iso_pu_bacteria 2888388044 2888391519 142
202 iso_pu_bacteria 2888419890 2888426859 142
203 iso_pu_bacteria 2893066018 2893070686 142
204 iso_pu_bacteria 2903727486 2903731465 142
205 iso_pu_bacteria 2904666416 2904670943 142
206 iso_pu_bacteria 2904711408 2904713564 142
207 iso_pu_bacteria 2906602504 2906607959 142
208 iso_pu_bacteria 2906626472 2906633068 142
209 iso_pu_bacteria 2906643746 2906647274 142
210 iso_pu_bacteria 2908775508 2908777141 142
211 iso_pu_bacteria 2909042592 2909047590 142
212 iso_pu_bacteria 2919073203 2919074599 142
213 iso_pu_bacteria 2922368715 2922376627 142
214 iso_pu_bacteria 2922386360 2922391518 142
215 iso_pu_bacteria 2922393267 2922398577 142
216 iso_pu_bacteria 2929615660 2929619868 142
217 iso_pu_bacteria 2929624759 2929629180 142
218 iso_pu_bacteria 2932784394 2932789687 142
219 iso_pu_bacteria 2932794094 2932796644 142
220 iso_pu_bacteria 2932801729 2932802575 142
221 iso_pu_bacteria 2932809354 2932818196 142
222 iso_pu_bacteria 2932818245 2932828034 142
223 iso_pu_bacteria 2932828146 2932835612 142
224 iso_pu_bacteria 2933577622 2933581786 142
225 iso_pu_bacteria 2935608549 2935613246 142
226 iso_pu_bacteria 2935616580 2935624614 142
227 iso_pu_bacteria 2935638405 2935647159 142
228 iso_pu_bacteria 2935665750 2935674378 142
229 iso_pu_bacteria 2935675223 2935684083 142
230 iso_pu_bacteria 2935684952 2935689131 142
231 iso_pu_bacteria 2935694250 2935697608 142
232 iso_pu_bacteria 2935703347 2935711367 142
233 iso_pu_bacteria 2935713505 2935720077 142
234 iso_pu_bacteria 2935722832 2935728306 142
235 iso_pu_bacteria 2935732158 2935737097 142
236 iso_pu_bacteria 2935741537 2935746842 142
237 iso_pu_bacteria 2935750917 2935757809 142
238 iso_pu_bacteria 2935760218 2935764188 142
239 iso_pu_bacteria 2935769743 2935775185 142
240 iso_pu_bacteria 2935777560 2935780087 142
241 iso_pu_bacteria 2935785616 2935790209 142
242 iso_pu_bacteria 2935793552 2935798749 142
243 iso_pu_bacteria 2935801545 2935809847 142
244 iso_pu_bacteria 2935810662 2935819774 142
245 iso_pu_bacteria 2935819856 2935824900 142
246 iso_pu_bacteria 2935827899 2935836583 142
247 iso_pu_bacteria 2935837841 2935844695 142
248 iso_pu_bacteria 2935847175 2935852120 142
249 iso_pu_bacteria 2935855204 2935863176 142
250 iso_pu_bacteria 2935864058 2935868645 142
251 iso_pu_bacteria 2935873716 2935879419 142
252 iso_pu_bacteria 2935883170 2935883614 142
253 iso_pu_bacteria 2935908558 2935911467 142
254 iso_pu_bacteria 2935916978 2935925384 142
255 iso_pu_bacteria 2935926038 2935928496 142
256 iso_pu_bacteria 2935934488 2935938141 142
257 iso_pu_bacteria 2935942939 2935945423 142
258 iso_pu_bacteria 2935951376 2935954071 142
259 iso_pu_bacteria 2935967501 2935971661 142
260 iso_pu_bacteria 2935992306 2936000213 142
261 iso_pu_bacteria 2936002035 2936010255 142
262 iso_pu_bacteria 2936037263 2936046484 142
263 iso_pu_bacteria 2940556831 2940563369 142
264 iso_pu_bacteria 2941531003 2941531918 142
265 iso_pu_bacteria 2941538514 2941547535 142
266 iso_pu_bacteria 3005483717 3005485995 142
267 iso_pu_bacteria 3005506211 3005506661 142
268 iso_pu_bacteria 3005587118 3005591817 142
269 iso_pu_bacteria 3005594810 3005601698 142
270 iso_pu_bacteria 3005710791 3005717437 142
271 iso_pu_bacteria 3005718088 3005724379 142
272 iso_pu_bacteria 8006926726 8006930839 142
273 iso_pu_bacteria 8016511872 8016519207 142
274 iso_pu_bacteria 8016522445 8016525114 142
275 iso_pu_bacteria 8016530956 8016538692 142
276 iso_pu_bacteria 8016539877 8016542980 142
277 iso_pu_bacteria 8016548790 8016550311 142
278 iso_pu_bacteria 8016557553 8016558719 142
279 iso_pu_bacteria 8016566248 8016568381 142
280 iso_pu_bacteria 8016575299 8016581037 142
281 iso_pu_bacteria 8016583857 8016587685 142
282 iso_pu_bacteria 8016595262 8016596696 142
283 iso_pu_bacteria 8016603502 8016607570 142
284 iso_pu_bacteria 8016613128 8016619363 142
285 iso_pu_bacteria 8016622563 8016630228 142
286 iso_pu_bacteria 8017057580 8017066299 142
287 iso_pu_bacteria 8019530166 8019538364 142
288 iso_pu_bacteria 8019538911 8019541459 142
289 iso_pu_bacteria 8019547302 8019549169 142
290 iso_pu_bacteria 8019576017 8019578318 142
291 iso_pu_bacteria 8019586578 8019596358 142
292 iso_pu_bacteria 8019597564 8019605344 142
293 iso_pu_bacteria 8019608314 8019613198 142
294 iso_pu_bacteria 8019648815 8019651564 142
295 iso_pu_bacteria 8019687851 8019695247 142
296 iso_pu_bacteria 8055742211 8055750380 142
297 iso_pu_bacteria 8056967851 8056971840 142
298 3300009545 Ga0105237_10045833 Ga0105237_100458335 143
299 3300037312 Ga0395899_0179037 Ga0395899_0179037_19_453 143
300 3300037418 Ga0395900_0699207 Ga0395900_0699207_97_531 143
301 3300037466 Ga0395898_0099111 Ga0395898_0099111_990_1424 143
302 3300037471 Ga0395905_0343358 Ga0395905_0343358_738_1172 143
303 3300038443 Ga0395901_0550278 Ga0395901_0550278_203_637 143
304 3300049569 Ga0501032_0194489 Ga0501032_0194489_358_792 143
305 3300049574 Ga0501038_0288621 Ga0501038_0288621_348_782 143
306 3300053153 Ga0500616_0224703 Ga0500616_0224703_29_466 143
307 iso_pu_bacteria 2728368998 2728751714 143
308 iso_pu_bacteria 2791355199 2793078560 143
309 iso_pu_bacteria 2889033259 2889034145 143
310 3300005548 Ga0070665_100468867 Ga0070665_1004688672 144
311 3300006038 Ga0075365_10002534 Ga0075365_100025346 144
312 3300006051 Ga0075364_10013934 Ga0075364_100139342 144
313 3300006178 Ga0075367_10082884 Ga0075367_100828841 144
314 3300028379 Ga0268266_10624786 Ga0268266_106247861 144
315 3300035114 Ga0373939_0429153 Ga0373939_0429153_53_490 144
316 3300035170 Ga0373943_0425743 Ga0373943_0425743_289_726 144
317 3300035692 Ga0373935_0178952 Ga0373935_0178952_357_794 144
318 3300039437 Ga0436365_0056450 Ga0436365_0056450_108_557 144
319 3300046460 Ga0495638_0310851 Ga0495638_0310851_214_651 144
320 3300046492 Ga0495585_0466482 Ga0495585_0466482_58_495 144
321 3300046519 Ga0495632_0237341 Ga0495632_0237341_357_794 144
322 3300046616 Ga0495668_0126299 Ga0495668_0126299_541_978 144
323 3300046648 Ga0495611_0552127 Ga0495611_0552127_25_462 144
324 3300046665 Ga0495661_0250310 Ga0495661_0250310_446_883 144
325 3300046684 Ga0495669_0036595 Ga0495669_0036595_1144_1581 144
326 3300048905 Ga0496102_1297998 Ga0496102_1297998_78_515 144
327 3300050491 nmdc:mga00v17_128693_c1 nmdc:mga00v17_128693_c1_760_1197 144
328 3300050492 nmdc:mga0yw44_2044_c1 nmdc:mga0yw44_2044_c1_3760_4197 144
329 3300050513 nmdc:mga0rr50_1194805_c1 nmdc:mga0rr50_1194805_c1_25_462 144
330 3300053177 Ga0500636_0064057 Ga0500636_0064057_189_626 144
331 3300053178 Ga0500637_0166750 Ga0500637_0166750_813_1250 144
332 3300003215 JGI25153J46596_10099626 JGI25153J46596_100996262 145
333 3300003659 JGI25404J52841_10018969 JGI25404J52841_100189692 145
334 3300003659 JGI25404J52841_10021526 JGI25404J52841_100215263 145
335 3300003659 JGI25404J52841_10129563 JGI25404J52841_101295631 145
336 3300005327 Ga0070658_10445178 Ga0070658_104451782 145
337 3300005441 Ga0070700_100085290 Ga0070700_1000852902 145
338 3300005455 Ga0070663_100660587 Ga0070663_1006605872 145
339 3300005841 Ga0068863_100464863 Ga0068863_1004648632 145
340 3300005937 Ga0081455_10029427 Ga0081455_100294274 145
341 3300005937 Ga0081455_10076533 Ga0081455_100765334 145
342 3300005983 Ga0081540_1006321 Ga0081540_10063212 145
343 3300005983 Ga0081540_1010443 Ga0081540_10104435 145
344 3300005983 Ga0081540_1049888 Ga0081540_10498883 145
345 3300014325 Ga0163163_11209191 Ga0163163_112091912 145
346 3300025297 Ga0209758_1002009 Ga0209758_10020094 145
347 3300025909 Ga0207705_10346507 Ga0207705_103465072 145
348 3300026088 Ga0207641_10751478 Ga0207641_107514781 145
349 3300026116 Ga0207674_11288687 Ga0207674_112886872 145
350 3300039437 Ga0436365_0620989 Ga0436365_0620989_477_917 145
351 3300039450 Ga0436363_1204188 Ga0436363_1204188_1456_1896 145
352 3300046518 Ga0495631_0479187 Ga0495631_0479187_29_469 145
353 3300048929 Ga0496126_0048584 Ga0496126_0048584_280_720 145
354 3300048929 Ga0496126_0048723 Ga0496126_0048723_2565_3005 145
355 3300049586 Ga0501070_0695609 Ga0501070_0695609_75_515 145
356 3300049744 Ga0501083_0328852 Ga0501083_0328852_447_887 145
357 3300003203 JGI25406J46586_10004414 JGI25406J46586_100044143 146
358 3300003214 JGI25165J46597_1012534 JGI25165J46597_10125342 146
359 3300003215 JGI25153J46596_10001134 JGI25153J46596_100011348 146
360 3300003215 JGI25153J46596_10003236 JGI25153J46596_100032367 146
361 3300003215 JGI25153J46596_10009457 JGI25153J46596_100094573 146
362 3300003215 JGI25153J46596_10016604 JGI25153J46596_100166042 146
363 3300003215 JGI25153J46596_10047080 JGI25153J46596_100470801 146
364 3300003354 JGI25160J50197_1012741 JGI25160J50197_10127414 146
365 3300003659 JGI25404J52841_10003333 JGI25404J52841_100033332 146
366 3300003659 JGI25404J52841_10029752 JGI25404J52841_100297522 146
367 3300003762 Ga0055542_1037136 Ga0055542_10371361 146
368 3300003794 Ga0055531_10004135 Ga0055531_100041358 146
369 3300004625 Ga0055543_1009650 Ga0055543_10096502 146
370 3300005262 Ga0065165_1003814 Ga0065165_10038149 146
371 3300005293 Ga0065715_10357385 Ga0065715_103573852 146
372 3300005327 Ga0070658_11248106 Ga0070658_112481061 146
373 3300005327 Ga0070658_11427710 Ga0070658_114277101 146
374 3300005329 Ga0070683_100325152 Ga0070683_1003251523 146
375 3300005331 Ga0070670_100454455 Ga0070670_1004544552 146
376 3300005334 Ga0068869_101048429 Ga0068869_1010484291 146
377 3300005335 Ga0070666_10389018 Ga0070666_103890182 146
378 3300005335 Ga0070666_11227897 Ga0070666_112278971 146
379 3300005336 Ga0070680_100105949 Ga0070680_1001059492 146
380 3300005338 Ga0068868_100400882 Ga0068868_1004008822 146
381 3300005339 Ga0070660_100190658 Ga0070660_1001906582 146
382 3300005340 Ga0070689_100969785 Ga0070689_1009697852 146
383 3300005343 Ga0070687_101381990 Ga0070687_1013819901 146
384 3300005344 Ga0070661_100140954 Ga0070661_1001409543 146
385 3300005347 Ga0070668_100822140 Ga0070668_1008221402 146
386 3300005353 Ga0070669_100397600 Ga0070669_1003976002 146
387 3300005354 Ga0070675_100558745 Ga0070675_1005587452 146
388 3300005354 Ga0070675_100938750 Ga0070675_1009387502 146
389 3300005355 Ga0070671_100878563 Ga0070671_1008785632 146
390 3300005355 Ga0070671_101455966 Ga0070671_1014559661 146
391 3300005356 Ga0070674_100031034 Ga0070674_1000310343 146
392 3300005364 Ga0070673_100305186 Ga0070673_1003051862 146
393 3300005364 Ga0070673_101102683 Ga0070673_1011026831 146
394 3300005367 Ga0070667_101088893 Ga0070667_1010888932 146
395 3300005434 Ga0070709_10432253 Ga0070709_104322531 146
396 3300005435 Ga0070714_100030496 Ga0070714_1000304962 146
397 3300005435 Ga0070714_100254434 Ga0070714_1002544342 146
398 3300005436 Ga0070713_100464833 Ga0070713_1004648332 146
399 3300005437 Ga0070710_10392853 Ga0070710_103928532 146
400 3300005455 Ga0070663_100029162 Ga0070663_1000291623 146
401 3300005455 Ga0070663_100463485 Ga0070663_1004634851 146
402 3300005455 Ga0070663_101370384 Ga0070663_1013703841 146
403 3300005456 Ga0070678_100003092 Ga0070678_1000030928 146
404 3300005457 Ga0070662_101106580 Ga0070662_1011065802 146
405 3300005458 Ga0070681_11078366 Ga0070681_110783661 146
406 3300005459 Ga0068867_100502098 Ga0068867_1005020982 146
407 3300005459 Ga0068867_101235039 Ga0068867_1012350391 146
408 3300005467 Ga0070706_100361798 Ga0070706_1003617981 146
409 3300005468 Ga0070707_100316008 Ga0070707_1003160082 146
410 3300005471 Ga0070698_100074379 Ga0070698_1000743794 146
411 3300005518 Ga0070699_100388481 Ga0070699_1003884812 146
412 3300005530 Ga0070679_100217903 Ga0070679_1002179032 146
413 3300005530 Ga0070679_100568078 Ga0070679_1005680782 146
414 3300005539 Ga0068853_100127409 Ga0068853_1001274092 146
415 3300005539 Ga0068853_100336480 Ga0068853_1003364801 146
416 3300005539 Ga0068853_101025068 Ga0068853_1010250681 146
417 3300005543 Ga0070672_100049102 Ga0070672_1000491022 146
418 3300005543 Ga0070672_100704163 Ga0070672_1007041632 146
419 3300005545 Ga0070695_101130705 Ga0070695_1011307051 146
420 3300005548 Ga0070665_100084542 Ga0070665_1000845421 146
421 3300005548 Ga0070665_100169822 Ga0070665_1001698224 146
422 3300005548 Ga0070665_100518411 Ga0070665_1005184111 146
423 3300005548 Ga0070665_100784636 Ga0070665_1007846362 146
424 3300005548 Ga0070665_101095992 Ga0070665_1010959922 146
425 3300005548 Ga0070665_101146177 Ga0070665_1011461772 146
426 3300005549 Ga0070704_101008081 Ga0070704_1010080811 146
427 3300005563 Ga0068855_100587955 Ga0068855_1005879552 146
428 3300005563 Ga0068855_100726659 Ga0068855_1007266592 146
429 3300005563 Ga0068855_100864344 Ga0068855_1008643441 146
430 3300005564 Ga0070664_100125780 Ga0070664_1001257802 146
431 3300005578 Ga0068854_100202857 Ga0068854_1002028572 146
432 3300005578 Ga0068854_101386686 Ga0068854_1013866861 146
433 3300005614 Ga0068856_100157594 Ga0068856_1001575942 146
434 3300005615 Ga0070702_101627397 Ga0070702_1016273971 146
435 3300005616 Ga0068852_100005154 Ga0068852_1000051545 146
436 3300005617 Ga0068859_100955820 Ga0068859_1009558202 146
437 3300005617 Ga0068859_101901889 Ga0068859_1019018891 146
438 3300005618 Ga0068864_100208484 Ga0068864_1002084842 146
439 3300005718 Ga0068866_10149684 Ga0068866_101496842 146
440 3300005841 Ga0068863_100156143 Ga0068863_1001561432 146
441 3300005841 Ga0068863_100439669 Ga0068863_1004396692 146
442 3300005842 Ga0068858_100829588 Ga0068858_1008295882 146
443 3300005843 Ga0068860_100118797 Ga0068860_1001187973 146
444 3300005844 Ga0068862_100446298 Ga0068862_1004462982 146
445 3300005937 Ga0081455_10001332 Ga0081455_1000133219 146
446 3300005937 Ga0081455_10026185 Ga0081455_100261856 146
447 3300005937 Ga0081455_10032880 Ga0081455_100328805 146
448 3300005937 Ga0081455_10195085 Ga0081455_101950853 146
449 3300005983 Ga0081540_1002747 Ga0081540_10027477 146
450 3300005983 Ga0081540_1007063 Ga0081540_10070635 146
451 3300005983 Ga0081540_1014706 Ga0081540_10147065 146
452 3300005985 Ga0081539_10003211 Ga0081539_100032118 146
453 3300005985 Ga0081539_10003502 Ga0081539_100035029 146
454 3300005985 Ga0081539_10017936 Ga0081539_100179365 146
455 3300005985 Ga0081539_10018388 Ga0081539_100183883 146
456 3300006028 Ga0070717_10106977 Ga0070717_101069772 146
457 3300006028 Ga0070717_11780088 Ga0070717_117800881 146
458 3300006038 Ga0075365_10074736 Ga0075365_100747364 146
459 3300006038 Ga0075365_10075901 Ga0075365_100759013 146
460 3300006038 Ga0075365_10077246 Ga0075365_100772463 146
461 3300006038 Ga0075365_10094874 Ga0075365_100948744 146
462 3300006038 Ga0075365_10258838 Ga0075365_102588382 146
463 3300006038 Ga0075365_10344734 Ga0075365_103447342 146
464 3300006042 Ga0075368_10010232 Ga0075368_100102322 146
465 3300006048 Ga0075363_100012149 Ga0075363_1000121492 146
466 3300006048 Ga0075363_100018535 Ga0075363_1000185353 146
467 3300006051 Ga0075364_10006018 Ga0075364_100060184 146
468 3300006051 Ga0075364_10015976 Ga0075364_100159763 146
469 3300006163 Ga0070715_10180891 Ga0070715_101808912 146
470 3300006163 Ga0070715_10296864 Ga0070715_102968641 146
471 3300006173 Ga0070716_101462518 Ga0070716_1014625181 146
472 3300006175 Ga0070712_100441599 Ga0070712_1004415992 146
473 3300006177 Ga0075362_10003916 Ga0075362_100039163 146
474 3300006177 Ga0075362_10231095 Ga0075362_102310952 146
475 3300006178 Ga0075367_10038406 Ga0075367_100384063 146
476 3300006178 Ga0075367_10170466 Ga0075367_101704662 146
477 3300006178 Ga0075367_10179276 Ga0075367_101792762 146
478 3300006186 Ga0075369_10017261 Ga0075369_100172611 146
479 3300006186 Ga0075369_10026495 Ga0075369_100264954 146
480 3300006186 Ga0075369_10059198 Ga0075369_100591982 146
481 3300006195 Ga0075366_10011900 Ga0075366_100119004 146
482 3300006195 Ga0075366_10019386 Ga0075366_100193864 146
483 3300006195 Ga0075366_10024339 Ga0075366_100243394 146
484 3300006237 Ga0097621_100889785 Ga0097621_1008897852 146
485 3300006353 Ga0075370_10017821 Ga0075370_100178213 146
486 3300006353 Ga0075370_10028156 Ga0075370_100281563 146
487 3300006353 Ga0075370_10167745 Ga0075370_101677452 146
488 3300006353 Ga0075370_10359035 Ga0075370_103590352 146
489 3300006353 Ga0075370_11014985 Ga0075370_110149851 146
490 3300006358 Ga0068871_100471553 Ga0068871_1004715531 146
491 3300006846 Ga0075430_100356590 Ga0075430_1003565901 146
492 3300006846 Ga0075430_101214397 Ga0075430_1012143971 146
493 3300006847 Ga0075431_100048608 Ga0075431_1000486083 146
494 3300006847 Ga0075431_100070799 Ga0075431_1000707992 146
495 3300006852 Ga0075433_10537269 Ga0075433_105372692 146
496 3300006880 Ga0075429_100005400 Ga0075429_1000054002 146
497 3300006881 Ga0068865_100196644 Ga0068865_1001966442 146
498 3300006931 Ga0097620_100955774 Ga0097620_1009557742 146
499 3300006931 Ga0097620_101901597 Ga0097620_1019015971 146
500 3300006941 Ga0099825_1028430 Ga0099825_10284301 146
501 3300006942 Ga0099824_1014343 Ga0099824_10143437 146
502 3300006944 Ga0099823_1010603 Ga0099823_10106038 146
503 3300007788 Ga0099795_10061490 Ga0099795_100614901 146
504 3300009093 Ga0105240_10014502 Ga0105240_100145029 146
505 3300009093 Ga0105240_12153193 Ga0105240_121531931 146
506 3300009094 Ga0111539_10144285 Ga0111539_101442853 146
507 3300009094 Ga0111539_10205773 Ga0111539_102057733 146
508 3300009098 Ga0105245_10230300 Ga0105245_102303002 146
509 3300009098 Ga0105245_11036517 Ga0105245_110365171 146
510 3300009101 Ga0105247_10900988 Ga0105247_109009881 146
511 3300009147 Ga0114129_10063906 Ga0114129_100639062 146
512 3300009148 Ga0105243_10104007 Ga0105243_101040072 146
513 3300009148 Ga0105243_10491022 Ga0105243_104910222 146
514 3300009174 Ga0105241_10144238 Ga0105241_101442383 146
515 3300009176 Ga0105242_11620060 Ga0105242_116200601 146
516 3300009176 Ga0105242_11741629 Ga0105242_117416291 146
517 3300009177 Ga0105248_10144108 Ga0105248_101441081 146
518 3300009545 Ga0105237_10011109 Ga0105237_100111093 146
519 3300009545 Ga0105237_10121243 Ga0105237_101212433 146
520 3300009545 Ga0105237_10229709 Ga0105237_102297094 146
521 3300009545 Ga0105237_10231483 Ga0105237_102314833 146
522 3300009545 Ga0105237_11145491 Ga0105237_111454912 146
523 3300009551 Ga0105238_10587335 Ga0105238_105873352 146
524 3300009551 Ga0105238_10773199 Ga0105238_107731991 146
525 3300009551 Ga0105238_10917319 Ga0105238_109173192 146
526 3300009551 Ga0105238_12217183 Ga0105238_122171831 146
527 3300010375 Ga0105239_10102400 Ga0105239_101024003 146
528 3300010375 Ga0105239_10307416 Ga0105239_103074163 146
529 3300011119 Ga0105246_10012518 Ga0105246_100125182 146
530 3300013102 Ga0157371_10120382 Ga0157371_101203822 146
531 3300013104 Ga0157370_11237297 Ga0157370_112372971 146
532 3300013105 Ga0157369_10454431 Ga0157369_104544312 146
533 3300013296 Ga0157374_10112947 Ga0157374_101129472 146
534 3300013296 Ga0157374_10720385 Ga0157374_107203852 146
535 3300013297 Ga0157378_10457761 Ga0157378_104577613 146
536 3300013297 Ga0157378_12280702 Ga0157378_122807022 146
537 3300013306 Ga0163162_10718957 Ga0163162_107189572 146
538 3300013307 Ga0157372_10821700 Ga0157372_108217001 146
539 3300013307 Ga0157372_11232324 Ga0157372_112323241 146
540 3300013308 Ga0157375_10402868 Ga0157375_104028681 146
541 3300013308 Ga0157375_10913973 Ga0157375_109139732 146
542 3300014325 Ga0163163_10483978 Ga0163163_104839782 146
543 3300014968 Ga0157379_10603076 Ga0157379_106030762 146
544 3300014969 Ga0157376_10777036 Ga0157376_107770362 146
545 3300017792 Ga0163161_10066998 Ga0163161_100669982 146
546 3300017792 Ga0163161_11164591 Ga0163161_111645912 146
547 3300021320 Ga0214544_1000011 Ga0214544_100001146 146
548 3300021320 Ga0214544_1037611 Ga0214544_10376112 146
549 3300021321 Ga0214542_1000009 Ga0214542_1000009196 146
550 3300021321 Ga0214542_1040708 Ga0214542_10407082 146
551 3300021324 Ga0214545_1000007 Ga0214545_100000746 146
552 3300021324 Ga0214545_1021801 Ga0214545_10218015 146
553 3300021327 Ga0214543_1000020 Ga0214543_1000020196 146
554 3300021327 Ga0214543_1034552 Ga0214543_10345522 146
555 3300025230 Ga0209563_104176 Ga0209563_1041763 146
556 3300025254 Ga0209148_1000707 Ga0209148_100070723 146
557 3300025261 Ga0209233_1004187 Ga0209233_10041875 146
558 3300025272 Ga0209455_1001372 Ga0209455_10013726 146
559 3300025295 Ga0209564_1004298 Ga0209564_10042982 146
560 3300025295 Ga0209564_1014730 Ga0209564_10147302 146
561 3300025297 Ga0209758_1000088 Ga0209758_100008890 146
562 3300025297 Ga0209758_1000106 Ga0209758_1000106140 146
563 3300025297 Ga0209758_1002346 Ga0209758_10023467 146
564 3300025297 Ga0209758_1004848 Ga0209758_10048484 146
565 3300025297 Ga0209758_1005033 Ga0209758_10050337 146
566 3300025297 Ga0209758_1005694 Ga0209758_10056947 146
567 3300025297 Ga0209758_1005984 Ga0209758_10059847 146
568 3300025297 Ga0209758_1065498 Ga0209758_10654981 146
569 3300025299 Ga0209256_1003346 Ga0209256_100334610 146
570 3300025299 Ga0209256_1030804 Ga0209256_10308042 146
571 3300025302 Ga0207426_1000337 Ga0207426_10003377 146
572 3300025302 Ga0207426_1002354 Ga0207426_10023546 146
573 3300025302 Ga0207426_1007721 Ga0207426_10077214 146
574 3300025302 Ga0207426_1009646 Ga0207426_10096463 146
575 3300025303 Ga0209051_1042694 Ga0209051_10426942 146
576 3300025304 Ga0209257_1000684 Ga0209257_10006848 146
577 3300025304 Ga0209257_1009117 Ga0209257_10091174 146
578 3300025304 Ga0209257_1046344 Ga0209257_10463442 146
579 3300025315 Ga0207697_10026025 Ga0207697_100260251 146
580 3300025893 Ga0207682_10007221 Ga0207682_100072214 146
581 3300025899 Ga0207642_10138451 Ga0207642_101384512 146
582 3300025901 Ga0207688_10119257 Ga0207688_101192572 146
583 3300025903 Ga0207680_10386371 Ga0207680_103863711 146
584 3300025904 Ga0207647_10052997 Ga0207647_100529972 146
585 3300025904 Ga0207647_10226681 Ga0207647_102266811 146
586 3300025905 Ga0207685_10269363 Ga0207685_102693631 146
587 3300025906 Ga0207699_10741159 Ga0207699_107411591 146
588 3300025909 Ga0207705_10061230 Ga0207705_100612302 146
589 3300025910 Ga0207684_10289008 Ga0207684_102890081 146
590 3300025911 Ga0207654_10408922 Ga0207654_104089222 146
591 3300025913 Ga0207695_10000478 Ga0207695_1000047834 146
592 3300025913 Ga0207695_11366995 Ga0207695_113669951 146
593 3300025914 Ga0207671_10003206 Ga0207671_100032069 146
594 3300025914 Ga0207671_10034599 Ga0207671_100345994 146
595 3300025914 Ga0207671_11371331 Ga0207671_113713311 146
596 3300025915 Ga0207693_10039417 Ga0207693_100394173 146
597 3300025915 Ga0207693_10065145 Ga0207693_100651453 146
598 3300025916 Ga0207663_10041428 Ga0207663_100414284 146
599 3300025918 Ga0207662_10044943 Ga0207662_100449432 146
600 3300025919 Ga0207657_10113299 Ga0207657_101132991 146
601 3300025923 Ga0207681_10823460 Ga0207681_108234602 146
602 3300025923 Ga0207681_10877985 Ga0207681_108779851 146
603 3300025924 Ga0207694_10604681 Ga0207694_106046811 146
604 3300025924 Ga0207694_11146041 Ga0207694_111460412 146
605 3300025926 Ga0207659_10724062 Ga0207659_107240622 146
606 3300025927 Ga0207687_11198091 Ga0207687_111980911 146
607 3300025928 Ga0207700_10954497 Ga0207700_109544972 146
608 3300025931 Ga0207644_10161659 Ga0207644_101616592 146
609 3300025931 Ga0207644_10387053 Ga0207644_103870532 146
610 3300025932 Ga0207690_10164092 Ga0207690_101640922 146
611 3300025933 Ga0207706_10399559 Ga0207706_103995591 146
612 3300025934 Ga0207686_10409587 Ga0207686_104095872 146
613 3300025936 Ga0207670_10889945 Ga0207670_108899451 146
614 3300025936 Ga0207670_11309239 Ga0207670_113092391 146
615 3300025937 Ga0207669_10047202 Ga0207669_100472022 146
616 3300025937 Ga0207669_10904267 Ga0207669_109042672 146
617 3300025938 Ga0207704_10268052 Ga0207704_102680521 146
618 3300025939 Ga0207665_10355518 Ga0207665_103555182 146
619 3300025939 Ga0207665_10682269 Ga0207665_106822692 146
620 3300025939 Ga0207665_11025669 Ga0207665_110256692 146
621 3300025940 Ga0207691_10093307 Ga0207691_100933072 146
622 3300025940 Ga0207691_10136939 Ga0207691_101369394 146
623 3300025940 Ga0207691_10672961 Ga0207691_106729612 146
624 3300025942 Ga0207689_10507330 Ga0207689_105073302 146
625 3300025944 Ga0207661_10512137 Ga0207661_105121373 146
626 3300025945 Ga0207679_10389319 Ga0207679_103893192 146
627 3300025949 Ga0207667_10594892 Ga0207667_105948922 146
628 3300025949 Ga0207667_10853575 Ga0207667_108535751 146
629 3300025949 Ga0207667_11310256 Ga0207667_113102561 146
630 3300025960 Ga0207651_10783317 Ga0207651_107833172 146
631 3300025961 Ga0207712_10267410 Ga0207712_102674102 146
632 3300025972 Ga0207668_10812227 Ga0207668_108122271 146
633 3300025981 Ga0207640_10457375 Ga0207640_104573751 146
634 3300025981 Ga0207640_10674880 Ga0207640_106748801 146
635 3300025986 Ga0207658_10126154 Ga0207658_101261542 146
636 3300025986 Ga0207658_10567023 Ga0207658_105670232 146
637 3300025986 Ga0207658_11525757 Ga0207658_115257571 146
638 3300026023 Ga0207677_10289706 Ga0207677_102897061 146
639 3300026023 Ga0207677_10383814 Ga0207677_103838142 146
640 3300026035 Ga0207703_10261444 Ga0207703_102614441 146
641 3300026041 Ga0207639_10249059 Ga0207639_102490592 146
642 3300026041 Ga0207639_10932548 Ga0207639_109325482 146
643 3300026041 Ga0207639_11111372 Ga0207639_111113721 146
644 3300026067 Ga0207678_10018506 Ga0207678_100185063 146
645 3300026067 Ga0207678_10087188 Ga0207678_100871882 146
646 3300026067 Ga0207678_10484970 Ga0207678_104849701 146
647 3300026075 Ga0207708_10038627 Ga0207708_100386272 146
648 3300026078 Ga0207702_10386182 Ga0207702_103861822 146
649 3300026078 Ga0207702_11207456 Ga0207702_112074561 146
650 3300026088 Ga0207641_10190665 Ga0207641_101906653 146
651 3300026088 Ga0207641_10386112 Ga0207641_103861122 146
652 3300026089 Ga0207648_10138524 Ga0207648_101385243 146
653 3300026089 Ga0207648_10160389 Ga0207648_101603892 146
654 3300026089 Ga0207648_10864554 Ga0207648_108645542 146
655 3300026095 Ga0207676_10292136 Ga0207676_102921361 146
656 3300026095 Ga0207676_11099073 Ga0207676_110990732 146
657 3300026116 Ga0207674_10199570 Ga0207674_101995703 146
658 3300026116 Ga0207674_10221090 Ga0207674_102210902 146
659 3300026116 Ga0207674_10285202 Ga0207674_102852022 146
660 3300026118 Ga0207675_100064150 Ga0207675_1000641503 146
661 3300026118 Ga0207675_100360379 Ga0207675_1003603792 146
662 3300026118 Ga0207675_101736904 Ga0207675_1017369041 146
663 3300026121 Ga0207683_10006624 Ga0207683_100066245 146
664 3300027296 Ga0209389_1000016 Ga0209389_100001666 146
665 3300027296 Ga0209389_1000027 Ga0209389_100002780 146
666 3300027357 Ga0209589_1000031 Ga0209589_100003192 146
667 3300027361 Ga0209489_100057 Ga0209489_10005755 146
668 3300027361 Ga0209489_100063 Ga0209489_10006324 146
669 3300027363 Ga0209700_100012 Ga0209700_10001267 146
670 3300027512 Ga0209179_1150651 Ga0209179_11506511 146
671 3300027866 Ga0209813_10007065 Ga0209813_100070653 146
672 3300027907 Ga0207428_10378273 Ga0207428_103782732 146
673 3300028379 Ga0268266_10042057 Ga0268266_100420571 146
674 3300028379 Ga0268266_10065542 Ga0268266_100655424 146
675 3300028379 Ga0268266_10934277 Ga0268266_109342772 146
676 3300028380 Ga0268265_10217616 Ga0268265_102176162 146
677 3300028380 Ga0268265_10790384 Ga0268265_107903842 146
678 3300028380 Ga0268265_11322935 Ga0268265_113229352 146
679 3300028381 Ga0268264_10073031 Ga0268264_100730313 146
680 3300028381 Ga0268264_11335280 Ga0268264_113352802 146
681 3300031548 Ga0307408_100016075 Ga0307408_1000160752 146
682 3300031616 Ga0307508_10558890 Ga0307508_105588902 146
683 3300031731 Ga0307405_10815821 Ga0307405_108158212 146
684 3300031824 Ga0307413_10177153 Ga0307413_101771531 146
685 3300031903 Ga0307407_10239427 Ga0307407_102394272 146
686 3300031911 Ga0307412_10277039 Ga0307412_102770392 146
687 3300032002 Ga0307416_101108066 Ga0307416_1011080661 146
688 3300032005 Ga0307411_10216058 Ga0307411_102160582 146
689 3300033180 Ga0307510_10014233 Ga0307510_100142337 146
690 3300033180 Ga0307510_10371714 Ga0307510_103717141 146
691 3300035113 Ga0373936_0019234 Ga0373936_0019234_1312_1761 146
692 3300035113 Ga0373936_0033299 Ga0373936_0033299_186_629 146
693 3300035170 Ga0373943_0043483 Ga0373943_0043483_1103_1552 146
694 3300035171 Ga0373946_0336415 Ga0373946_0336415_14_463 146
695 3300035172 Ga0373955_0127771 Ga0373955_0127771_978_1427 146
696 3300035695 Ga0373927_0154520 Ga0373927_0154520_295_744 146
697 3300035695 Ga0373927_0215435 Ga0373927_0215435_257_706 146
698 3300035695 Ga0373927_0249701 Ga0373927_0249701_51_494 146
699 3300037068 Ga0373925_0192937 Ga0373925_0192937_220_663 146
700 3300037418 Ga0395900_0037623 Ga0395900_0037623_4178_4621 146
701 3300037418 Ga0395900_0989418 Ga0395900_0989418_51_494 146
702 3300037466 Ga0395898_0015240 Ga0395898_0015240_3975_4418 146
703 3300037471 Ga0395905_0033626 Ga0395905_0033626_145_588 146
704 3300037471 Ga0395905_0595133 Ga0395905_0595133_470_913 146
705 3300037471 Ga0395905_1015226 Ga0395905_1015226_120_563 146
706 3300037853 Ga0436364_0082096 Ga0436364_0082096_137_580 146
707 3300038443 Ga0395901_0037234 Ga0395901_0037234_425_868 146
708 3300038443 Ga0395901_0074312 Ga0395901_0074312_1016_1459 146
709 3300038443 Ga0395901_1455676 Ga0395901_1455676_148_591 146
710 3300041408 Ga0439453_0001001 Ga0439453_0001001_1286_1750 146
711 3300041443 Ga0451789_0651678 Ga0451789_0651678_93_536 146
712 3300042003 Ga0439443_036147 Ga0439443_036147_20_484 146
713 3300042436 Ga0439435_0107580 Ga0439435_0107580_76_540 146
714 3300042461 Ga0439460_0008111 Ga0439460_0008111_11_475 146
715 3300044658 Ga0466972_0009680 Ga0466972_0009680_3567_4010 146
716 3300044683 Ga0466965_0085702 Ga0466965_0085702_72_515 146
717 3300044684 Ga0466966_0001941 Ga0466966_0001941_7767_8210 146
718 3300044693 Ga0466961_0000136 Ga0466961_0000136_7779_8222 146
719 3300044694 Ga0466963_0134279 Ga0466963_0134279_34_477 146
720 3300044694 Ga0466963_0718024 Ga0466963_0718024_94_534 146
721 3300044735 Ga0466968_0204030 Ga0466968_0204030_272_715 146
722 3300044735 Ga0466968_0450894 Ga0466968_0450894_52_495 146
723 3300044765 Ga0466970_0089373 Ga0466970_0089373_913_1356 146
724 3300044901 Ga0466960_0058091 Ga0466960_0058091_117_560 146
725 3300045049 Ga0466959_0018900 Ga0466959_0018900_74_517 146
726 3300045049 Ga0466959_0325495 Ga0466959_0325495_106_549 146
727 3300045049 Ga0466959_1019042 Ga0466959_1019042_10_453 146
728 3300045976 Ga0466967_0167506 Ga0466967_0167506_58_501 146
729 3300046454 Ga0495592_0648223 Ga0495592_0648223_61_504 146
730 3300046455 Ga0495603_0557422 Ga0495603_0557422_59_502 146
731 3300046459 Ga0495629_0016818 Ga0495629_0016818_1086_1529 146
732 3300046459 Ga0495629_0152827 Ga0495629_0152827_672_1121 146
733 3300046460 Ga0495638_0016852 Ga0495638_0016852_19_462 146
734 3300046460 Ga0495638_0064183 Ga0495638_0064183_580_1023 146
735 3300046462 Ga0495651_0002380 Ga0495651_0002380_11533_11976 146
736 3300046463 Ga0495653_0180145 Ga0495653_0180145_124_567 146
737 3300046471 Ga0495650_0057495 Ga0495650_0057495_1090_1533 146
738 3300046474 Ga0495605_0024252 Ga0495605_0024252_1827_2270 146
739 3300046474 Ga0495605_0044520 Ga0495605_0044520_701_1144 146
740 3300046474 Ga0495605_0076334 Ga0495605_0076334_77_520 146
741 3300046476 Ga0495662_0048456 Ga0495662_0048456_1083_1532 146
742 3300046476 Ga0495662_0113884 Ga0495662_0113884_160_609 146
743 3300046492 Ga0495585_0164234 Ga0495585_0164234_102_548 146
744 3300046501 Ga0495607_0088400 Ga0495607_0088400_530_973 146
745 3300046506 Ga0495583_0020666 Ga0495583_0020666_225_668 146
746 3300046506 Ga0495583_0114690 Ga0495583_0114690_41_484 146
747 3300046506 Ga0495583_0204801 Ga0495583_0204801_194_637 146
748 3300046507 Ga0495606_0012396 Ga0495606_0012396_2037_2480 146
749 3300046511 Ga0495608_0083854 Ga0495608_0083854_1584_2027 146
750 3300046511 Ga0495608_0163701 Ga0495608_0163701_944_1387 146
751 3300046512 Ga0495610_0084953 Ga0495610_0084953_650_1093 146
752 3300046513 Ga0495616_0167354 Ga0495616_0167354_443_886 146
753 3300046513 Ga0495616_0359938 Ga0495616_0359938_67_510 146
754 3300046515 Ga0495620_0055003 Ga0495620_0055003_701_1144 146
755 3300046515 Ga0495620_0055233 Ga0495620_0055233_229_672 146
756 3300046516 Ga0495628_0220286 Ga0495628_0220286_32_475 146
757 3300046516 Ga0495628_0750522 Ga0495628_0750522_222_665 146
758 3300046517 Ga0495630_0104051 Ga0495630_0104051_200_649 146
759 3300046518 Ga0495631_0364261 Ga0495631_0364261_107_550 146
760 3300046519 Ga0495632_0420318 Ga0495632_0420318_39_482 146
761 3300046520 Ga0495637_0048898 Ga0495637_0048898_320_763 146
762 3300046522 Ga0495643_0010042 Ga0495643_0010042_5305_5748 146
763 3300046522 Ga0495643_0053044 Ga0495643_0053044_1353_1796 146
764 3300046522 Ga0495643_0436995 Ga0495643_0436995_40_483 146
765 3300046524 Ga0495648_0004620 Ga0495648_0004620_11085_11528 146
766 3300046524 Ga0495648_0049275 Ga0495648_0049275_78_521 146
767 3300046524 Ga0495648_0057380 Ga0495648_0057380_156_599 146
768 3300046524 Ga0495648_0434609 Ga0495648_0434609_102_545 146
769 3300046524 Ga0495648_0446885 Ga0495648_0446885_31_474 146
770 3300046526 Ga0495666_0387388 Ga0495666_0387388_117_566 146
771 3300046529 Ga0495652_0004532 Ga0495652_0004532_5512_5955 146
772 3300046529 Ga0495652_0087578 Ga0495652_0087578_1193_1636 146
773 3300046530 Ga0495654_0138044 Ga0495654_0138044_449_892 146
774 3300046530 Ga0495654_0170372 Ga0495654_0170372_32_475 146
775 3300046531 Ga0495665_0219626 Ga0495665_0219626_508_957 146
776 3300046533 Ga0495640_0019303 Ga0495640_0019303_1644_2093 146
777 3300046533 Ga0495640_0262611 Ga0495640_0262611_316_759 146
778 3300046533 Ga0495640_0380468 Ga0495640_0380468_358_807 146
779 3300046535 Ga0495586_0099642 Ga0495586_0099642_1134_1583 146
780 3300046536 Ga0495587_0011034 Ga0495587_0011034_193_636 146
781 3300046536 Ga0495587_0133453 Ga0495587_0133453_675_1118 146
782 3300046537 Ga0495598_0323464 Ga0495598_0323464_12_455 146
783 3300046538 Ga0495609_0061619 Ga0495609_0061619_1038_1481 146
784 3300046543 Ga0495645_0005471 Ga0495645_0005471_4508_4951 146
785 3300046557 Ga0495622_0034440 Ga0495622_0034440_909_1352 146
786 3300046557 Ga0495622_0083079 Ga0495622_0083079_333_776 146
787 3300046557 Ga0495622_0123645 Ga0495622_0123645_93_536 146
788 3300046559 Ga0495667_0037776 Ga0495667_0037776_745_1188 146
789 3300046559 Ga0495667_0270918 Ga0495667_0270918_533_982 146
790 3300046616 Ga0495668_0071584 Ga0495668_0071584_80_523 146
791 3300046642 Ga0495634_0017152 Ga0495634_0017152_1818_2261 146
792 3300046642 Ga0495634_0033514 Ga0495634_0033514_1766_2215 146
793 3300046642 Ga0495634_0049299 Ga0495634_0049299_1039_1488 146
794 3300046642 Ga0495634_0151463 Ga0495634_0151463_72_515 146
795 3300046660 Ga0495625_0025297 Ga0495625_0025297_4034_4477 146
796 3300046660 Ga0495625_0152047 Ga0495625_0152047_503_946 146
797 3300046660 Ga0495625_0173816 Ga0495625_0173816_833_1276 146
798 3300046663 Ga0495635_0153569 Ga0495635_0153569_49_492 146
799 3300046665 Ga0495661_0078710 Ga0495661_0078710_1384_1827 146
800 3300046674 Ga0495588_0005519 Ga0495588_0005519_4584_5027 146
801 3300046675 Ga0495657_0006838 Ga0495657_0006838_2232_2675 146
802 3300046678 Ga0495599_0014177 Ga0495599_0014177_1375_1818 146
803 3300046679 Ga0495623_0005381 Ga0495623_0005381_6779_7222 146
804 3300046680 Ga0495646_0398330 Ga0495646_0398330_16_459 146
805 3300046689 Ga0495613_0020037 Ga0495613_0020037_739_1182 146
806 3300046689 Ga0495613_0957963 Ga0495613_0957963_31_474 146
807 3300046690 Ga0495624_0392726 Ga0495624_0392726_138_587 146
808 3300046691 Ga0495670_0026322 Ga0495670_0026322_266_709 146
809 3300046692 Ga0495671_0035145 Ga0495671_0035145_157_600 146
810 3300046692 Ga0495671_0345388 Ga0495671_0345388_73_516 146
811 3300046694 Ga0495649_0012812 Ga0495649_0012812_3387_3830 146
812 3300046809 Ga0495600_0102634 Ga0495600_0102634_1388_1831 146
813 3300046810 Ga0495660_0151860 Ga0495660_0151860_10_453 146
814 3300047317 Ga0495604_0011413 Ga0495604_0011413_2578_3021 146
815 3300047317 Ga0495604_0042818 Ga0495604_0042818_960_1403 146
816 3300047318 Ga0495636_0193810 Ga0495636_0193810_363_806 146
817 3300047319 Ga0495674_0027148 Ga0495674_0027148_1876_2319 146
818 3300047320 Ga0495672_0021766 Ga0495672_0021766_856_1302 146
819 3300047321 Ga0495676_0192779 Ga0495676_0192779_293_736 146
820 3300047322 Ga0495680_0015402 Ga0495680_0015402_5940_6383 146
821 3300047323 Ga0495683_0073082 Ga0495683_0073082_1211_1654 146
822 3300047443 Ga0495687_019104 Ga0495687_019104_2782_3225 146
823 3300047444 Ga0495675_0148431 Ga0495675_0148431_979_1422 146
824 3300047445 Ga0495677_0234833 Ga0495677_0234833_31_474 146
825 3300047471 Ga0495684_0124268 Ga0495684_0124268_1050_1499 146
826 3300047472 Ga0495686_0018634 Ga0495686_0018634_1764_2207 146
827 3300047472 Ga0495686_0035947 Ga0495686_0035947_165_608 146
828 3300047472 Ga0495686_0084022 Ga0495686_0084022_827_1270 146
829 3300047472 Ga0495686_0284314 Ga0495686_0284314_151_594 146
830 3300048088 Ga0495602_0009068 Ga0495602_0009068_7754_8197 146
831 3300048090 Ga0495615_0019230 Ga0495615_0019230_140_583 146
832 3300048091 Ga0495626_0113523 Ga0495626_0113523_291_734 146
833 3300048903 Ga0496100_0286625 Ga0496100_0286625_132_578 146
834 3300048903 Ga0496100_0331639 Ga0496100_0331639_163_606 146
835 3300048903 Ga0496100_0766693 Ga0496100_0766693_260_703 146
836 3300048904 Ga0496101_0106229 Ga0496101_0106229_1002_1448 146
837 3300048904 Ga0496101_0232606 Ga0496101_0232606_382_825 146
838 3300048905 Ga0496102_0283823 Ga0496102_0283823_811_1254 146
839 3300048905 Ga0496102_0393081 Ga0496102_0393081_124_567 146
840 3300048906 Ga0496103_0022617 Ga0496103_0022617_520_963 146
841 3300048906 Ga0496103_0427946 Ga0496103_0427946_308_751 146
842 3300048907 Ga0496104_0002244 Ga0496104_0002244_2746_3192 146
843 3300048907 Ga0496104_0055621 Ga0496104_0055621_2777_3280 146
844 3300048907 Ga0496104_0076254 Ga0496104_0076254_1808_2251 146
845 3300048907 Ga0496104_0099583 Ga0496104_0099583_72_515 146
846 3300048907 Ga0496104_0249088 Ga0496104_0249088_982_1425 146
847 3300048908 Ga0496105_0007267 Ga0496105_0007267_3868_4311 146
848 3300048908 Ga0496105_0136808 Ga0496105_0136808_532_975 146
849 3300048909 Ga0496106_0257893 Ga0496106_0257893_720_1163 146
850 3300048909 Ga0496106_0664018 Ga0496106_0664018_249_692 146
851 3300048911 Ga0496108_0140952 Ga0496108_0140952_765_1208 146
852 3300048911 Ga0496108_0467497 Ga0496108_0467497_423_866 146
853 3300048912 Ga0496109_0053854 Ga0496109_0053854_3088_3534 146
854 3300048912 Ga0496109_0633372 Ga0496109_0633372_405_848 146
855 3300048913 Ga0496110_0130851 Ga0496110_0130851_171_617 146
856 3300048913 Ga0496110_0259592 Ga0496110_0259592_733_1176 146
857 3300048913 Ga0496110_0292748 Ga0496110_0292748_199_645 146
858 3300048914 Ga0496111_0050207 Ga0496111_0050207_2150_2593 146
859 3300048914 Ga0496111_0232978 Ga0496111_0232978_450_896 146
860 3300048915 Ga0496112_0060696 Ga0496112_0060696_971_1414 146
861 3300048915 Ga0496112_0171026 Ga0496112_0171026_915_1361 146
862 3300048916 Ga0496113_0049219 Ga0496113_0049219_1555_2001 146
863 3300048916 Ga0496113_0204693 Ga0496113_0204693_481_924 146
864 3300048918 Ga0496115_0288740 Ga0496115_0288740_445_888 146
865 3300048918 Ga0496115_0616255 Ga0496115_0616255_40_483 146
866 3300048918 Ga0496115_0888194 Ga0496115_0888194_58_501 146
867 3300048919 Ga0496116_0001996 Ga0496116_0001996_15674_16117 146
868 3300048920 Ga0496117_0012572 Ga0496117_0012572_6206_6649 146
869 3300048920 Ga0496117_0144891 Ga0496117_0144891_832_1275 146
870 3300048920 Ga0496117_0155681 Ga0496117_0155681_77_520 146
871 3300048920 Ga0496117_0373466 Ga0496117_0373466_75_518 146
872 3300048920 Ga0496117_0538572 Ga0496117_0538572_97_540 146
873 3300048920 Ga0496117_0570240 Ga0496117_0570240_37_480 146
874 3300048921 Ga0496118_0057853 Ga0496118_0057853_1381_1824 146
875 3300048921 Ga0496118_0073518 Ga0496118_0073518_1107_1550 146
876 3300048921 Ga0496118_0152839 Ga0496118_0152839_387_830 146
877 3300048921 Ga0496118_0205010 Ga0496118_0205010_397_840 146
878 3300048921 Ga0496118_0236222 Ga0496118_0236222_358_801 146
879 3300048921 Ga0496118_0281871 Ga0496118_0281871_307_750 146
880 3300048921 Ga0496118_0361341 Ga0496118_0361341_55_498 146
881 3300048921 Ga0496118_0394337 Ga0496118_0394337_175_618 146
882 3300048921 Ga0496118_0526033 Ga0496118_0526033_101_544 146
883 3300048921 Ga0496118_0570689 Ga0496118_0570689_44_487 146
884 3300048922 Ga0496119_0047398 Ga0496119_0047398_1732_2175 146
885 3300048922 Ga0496119_0055143 Ga0496119_0055143_1334_1777 146
886 3300048922 Ga0496119_0067292 Ga0496119_0067292_991_1434 146
887 3300048922 Ga0496119_0176859 Ga0496119_0176859_267_710 146
888 3300048922 Ga0496119_0518252 Ga0496119_0518252_47_490 146
889 3300048923 Ga0496120_0047735 Ga0496120_0047735_820_1263 146
890 3300048923 Ga0496120_0160902 Ga0496120_0160902_71_514 146
891 3300048923 Ga0496120_0203725 Ga0496120_0203725_407_850 146
892 3300048923 Ga0496120_0298681 Ga0496120_0298681_248_691 146
893 3300048924 Ga0496121_0001525 Ga0496121_0001525_6900_7343 146
894 3300048924 Ga0496121_0024780 Ga0496121_0024780_3627_4070 146
895 3300048924 Ga0496121_0046275 Ga0496121_0046275_1709_2152 146
896 3300048924 Ga0496121_0073632 Ga0496121_0073632_678_1121 146
897 3300048924 Ga0496121_0466128 Ga0496121_0466128_183_626 146
898 3300048925 Ga0496122_0019339 Ga0496122_0019339_3354_3797 146
899 3300048926 Ga0496123_0122239 Ga0496123_0122239_206_649 146
900 3300048928 Ga0496125_0005069 Ga0496125_0005069_12199_12642 146
901 3300048928 Ga0496125_0006742 Ga0496125_0006742_11435_11878 146
902 3300048928 Ga0496125_0052831 Ga0496125_0052831_2823_3266 146
903 3300048928 Ga0496125_0062155 Ga0496125_0062155_1759_2202 146
904 3300048928 Ga0496125_0185417 Ga0496125_0185417_689_1132 146
905 3300048929 Ga0496126_0057330 Ga0496126_0057330_2008_2448 146
906 3300048929 Ga0496126_0181549 Ga0496126_0181549_1243_1686 146
907 3300048929 Ga0496126_0239831 Ga0496126_0239831_510_953 146
908 3300048929 Ga0496126_0269900 Ga0496126_0269900_935_1378 146
909 3300048929 Ga0496126_0285276 Ga0496126_0285276_606_1049 146
910 3300048929 Ga0496126_0401272 Ga0496126_0401272_297_740 146
911 3300048929 Ga0496126_0448340 Ga0496126_0448340_48_491 146
912 3300048929 Ga0496126_1010394 Ga0496126_1010394_79_522 146
913 3300049460 Ga0495682_0005291 Ga0495682_0005291_4893_5336 146
914 3300049568 Ga0501031_0006238 Ga0501031_0006238_5359_5802 146
915 3300049568 Ga0501031_0180667 Ga0501031_0180667_269_712 146
916 3300049568 Ga0501031_0219289 Ga0501031_0219289_137_580 146
917 3300049569 Ga0501032_0000196 Ga0501032_0000196_47564_48007 146
918 3300049569 Ga0501032_0215503 Ga0501032_0215503_187_630 146
919 3300049570 Ga0501033_0003550 Ga0501033_0003550_6512_6955 146
920 3300049570 Ga0501033_0014112 Ga0501033_0014112_4352_4795 146
921 3300049570 Ga0501033_0019071 Ga0501033_0019071_4167_4610 146
922 3300049570 Ga0501033_0019990 Ga0501033_0019990_1968_2411 146
923 3300049571 Ga0501034_0000157 Ga0501034_0000157_11028_11471 146
924 3300049571 Ga0501034_0120911 Ga0501034_0120911_873_1316 146
925 3300049571 Ga0501034_0197332 Ga0501034_0197332_694_1137 146
926 3300049571 Ga0501034_0219819 Ga0501034_0219819_1280_1723 146
927 3300049572 Ga0501036_0000440 Ga0501036_0000440_22528_22971 146
928 3300049572 Ga0501036_0056112 Ga0501036_0056112_242_685 146
929 3300049572 Ga0501036_0252312 Ga0501036_0252312_303_749 146
930 3300049572 Ga0501036_0286433 Ga0501036_0286433_621_1064 146
931 3300049572 Ga0501036_0452612 Ga0501036_0452612_342_785 146
932 3300049572 Ga0501036_1242480 Ga0501036_1242480_77_520 146
933 3300049573 Ga0501037_0000969 Ga0501037_0000969_1159_1602 146
934 3300049573 Ga0501037_0030622 Ga0501037_0030622_2858_3301 146
935 3300049573 Ga0501037_0223896 Ga0501037_0223896_232_678 146
936 3300049573 Ga0501037_0295852 Ga0501037_0295852_411_854 146
937 3300049574 Ga0501038_0000473 Ga0501038_0000473_10900_11343 146
938 3300049574 Ga0501038_0018346 Ga0501038_0018346_325_771 146
939 3300049574 Ga0501038_0074628 Ga0501038_0074628_1146_1589 146
940 3300049574 Ga0501038_0501563 Ga0501038_0501563_433_876 146
941 3300049575 Ga0501039_0007468 Ga0501039_0007468_4724_5167 146
942 3300049575 Ga0501039_0046128 Ga0501039_0046128_1644_2087 146
943 3300049575 Ga0501039_0237689 Ga0501039_0237689_840_1286 146
944 3300049576 Ga0501040_0105092 Ga0501040_0105092_155_598 146
945 3300049577 Ga0501041_0413570 Ga0501041_0413570_332_775 146
946 3300049578 Ga0501042_0299817 Ga0501042_0299817_513_956 146
947 3300049578 Ga0501042_0559523 Ga0501042_0559523_314_760 146
948 3300049579 Ga0501043_0001087 Ga0501043_0001087_14425_14868 146
949 3300049579 Ga0501043_0121043 Ga0501043_0121043_330_773 146
950 3300049579 Ga0501043_0186149 Ga0501043_0186149_331_777 146
951 3300049579 Ga0501043_0290933 Ga0501043_0290933_235_678 146
952 3300049579 Ga0501043_0328292 Ga0501043_0328292_422_880 146
953 3300049579 Ga0501043_0420700 Ga0501043_0420700_321_764 146
954 3300049580 Ga0501046_0000181 Ga0501046_0000181_47564_48007 146
955 3300049580 Ga0501046_0031149 Ga0501046_0031149_1601_2044 146
956 3300049580 Ga0501046_0191740 Ga0501046_0191740_940_1383 146
957 3300049580 Ga0501046_0344245 Ga0501046_0344245_52_495 146
958 3300049580 Ga0501046_0728723 Ga0501046_0728723_156_602 146
959 3300049580 Ga0501046_0755960 Ga0501046_0755960_72_515 146
960 3300049581 Ga0501047_0000419 Ga0501047_0000419_29883_30326 146
961 3300049581 Ga0501047_0130491 Ga0501047_0130491_391_834 146
962 3300049581 Ga0501047_0200477 Ga0501047_0200477_1290_1733 146
963 3300049581 Ga0501047_0578520 Ga0501047_0578520_218_661 146
964 3300049582 Ga0501048_0000057 Ga0501048_0000057_19786_20229 146
965 3300049582 Ga0501048_0022093 Ga0501048_0022093_2771_3214 146
966 3300049582 Ga0501048_0473884 Ga0501048_0473884_122_565 146
967 3300049583 Ga0501067_0000507 Ga0501067_0000507_2874_3317 146
968 3300049583 Ga0501067_0116833 Ga0501067_0116833_938_1381 146
969 3300049583 Ga0501067_0547468 Ga0501067_0547468_20_463 146
970 3300049584 Ga0501068_0001808 Ga0501068_0001808_8334_8777 146
971 3300049584 Ga0501068_0050540 Ga0501068_0050540_635_1078 146
972 3300049584 Ga0501068_0200698 Ga0501068_0200698_540_983 146
973 3300049585 Ga0501069_0001596 Ga0501069_0001596_6349_6792 146
974 3300049585 Ga0501069_0069376 Ga0501069_0069376_1191_1634 146
975 3300049585 Ga0501069_0508927 Ga0501069_0508927_133_576 146
976 3300049586 Ga0501070_0003003 Ga0501070_0003003_13453_13896 146
977 3300049586 Ga0501070_0218868 Ga0501070_0218868_1094_1537 146
978 3300049586 Ga0501070_0601426 Ga0501070_0601426_247_690 146
979 3300049586 Ga0501070_0772540 Ga0501070_0772540_29_472 146
980 3300049587 Ga0501071_0094604 Ga0501071_0094604_316_759 146
981 3300049587 Ga0501071_0171754 Ga0501071_0171754_426_869 146
982 3300049588 Ga0501072_0009854 Ga0501072_0009854_1025_1468 146
983 3300049588 Ga0501072_0142587 Ga0501072_0142587_688_1131 146
984 3300049588 Ga0501072_0530948 Ga0501072_0530948_303_749 146
985 3300049588 Ga0501072_0543533 Ga0501072_0543533_78_521 146
986 3300049589 Ga0501073_0000027 Ga0501073_0000027_48607_49050 146
987 3300049589 Ga0501073_0007901 Ga0501073_0007901_330_773 146
988 3300049590 Ga0501074_0000081 Ga0501074_0000081_23027_23470 146
989 3300049591 Ga0501075_0355693 Ga0501075_0355693_229_672 146
990 3300049592 Ga0501076_0158314 Ga0501076_0158314_593_1036 146
991 3300049592 Ga0501076_0219954 Ga0501076_0219954_17_460 146
992 3300049593 Ga0501077_0031980 Ga0501077_0031980_1739_2182 146
993 3300049593 Ga0501077_0940908 Ga0501077_0940908_61_504 146
994 3300049741 Ga0501079_0013289 Ga0501079_0013289_199_642 146
995 3300049741 Ga0501079_0037393 Ga0501079_0037393_2678_3121 146
996 3300049741 Ga0501079_0905066 Ga0501079_0905066_11_454 146
997 3300049742 Ga0501080_0003534 Ga0501080_0003534_3281_3724 146
998 3300049742 Ga0501080_0482214 Ga0501080_0482214_394_840 146
999 3300049743 Ga0501081_0879697 Ga0501081_0879697_60_503 146
1000 3300049744 Ga0501083_0000947 Ga0501083_0000947_2581_3024 146
1001 3300049744 Ga0501083_0018670 Ga0501083_0018670_2885_3328 146
1002 3300049822 Ga0501035_0000145 Ga0501035_0000145_5028_5471 146
1003 3300049822 Ga0501035_0055322 Ga0501035_0055322_2742_3185 146
1004 3300049822 Ga0501035_0244481 Ga0501035_0244481_617_1060 146
1005 3300049822 Ga0501035_0259523 Ga0501035_0259523_129_572 146
1006 3300049822 Ga0501035_0360854 Ga0501035_0360854_490_936 146
1007 3300049822 Ga0501035_1010306 Ga0501035_1010306_129_572 146
1008 3300049823 Ga0501044_0002483 Ga0501044_0002483_2873_3316 146
1009 3300049823 Ga0501044_0089955 Ga0501044_0089955_1631_2074 146
1010 3300049823 Ga0501044_0102043 Ga0501044_0102043_1929_2372 146
1011 3300049823 Ga0501044_0253597 Ga0501044_0253597_715_1158 146
1012 3300049823 Ga0501044_0256245 Ga0501044_0256245_150_593 146
1013 3300049823 Ga0501044_0952317 Ga0501044_0952317_159_602 146
1014 3300049823 Ga0501044_0974664 Ga0501044_0974664_171_614 146
1015 3300049823 Ga0501044_1027689 Ga0501044_1027689_86_529 146
1016 3300049824 Ga0501045_0008413 Ga0501045_0008413_3914_4357 146
1017 3300049824 Ga0501045_0230564 Ga0501045_0230564_315_758 146
1018 3300050489 nmdc:mga03683_118349_c1 nmdc:mga03683_118349_c1_704_1147 146
1019 3300050489 nmdc:mga03683_138655_c1 nmdc:mga03683_138655_c1_205_648 146
1020 3300050489 nmdc:mga03683_24639_c1 nmdc:mga03683_24639_c1_801_1247 146
1021 3300050489 nmdc:mga03683_397877_c1 nmdc:mga03683_397877_c1_93_536 146
1022 3300050490 nmdc:mga03n38_145495_c1 nmdc:mga03n38_145495_c1_127_570 146
1023 3300050490 nmdc:mga03n38_55894_c1 nmdc:mga03n38_55894_c1_563_1009 146
1024 3300050491 nmdc:mga00v17_20987_c1 nmdc:mga00v17_20987_c1_3115_3558 146
1025 3300050491 nmdc:mga00v17_34141_c1 nmdc:mga00v17_34141_c1_1571_2017 146
1026 3300050491 nmdc:mga00v17_367578_c1 nmdc:mga00v17_367578_c1_473_916 146
1027 3300050491 nmdc:mga00v17_372647_c1 nmdc:mga00v17_372647_c1_16_459 146
1028 3300050491 nmdc:mga00v17_64124_c1 nmdc:mga00v17_64124_c1_1283_1726 146
1029 3300050492 nmdc:mga0yw44_20554_c1 nmdc:mga0yw44_20554_c1_717_1160 146
1030 3300050492 nmdc:mga0yw44_5981_c1 nmdc:mga0yw44_5981_c1_2974_3417 146
1031 3300050492 nmdc:mga0yw44_78818_c1 nmdc:mga0yw44_78818_c1_1562_2005 146
1032 3300050492 nmdc:mga0yw44_80808_c1 nmdc:mga0yw44_80808_c1_1543_1986 146
1033 3300050492 nmdc:mga0yw44_8586_c1 nmdc:mga0yw44_8586_c1_2055_2498 146
1034 3300050493 nmdc:mga0k408_12582_c1 nmdc:mga0k408_12582_c1_3619_4062 146
1035 3300050493 nmdc:mga0k408_145062_c1 nmdc:mga0k408_145062_c1_576_1019 146
1036 3300050493 nmdc:mga0k408_9579_c1 nmdc:mga0k408_9579_c1_1688_2134 146
1037 3300050494 nmdc:mga06z11_356224_c1 nmdc:mga06z11_356224_c1_289_732 146
1038 3300050494 nmdc:mga06z11_394799_c1 nmdc:mga06z11_394799_c1_239_682 146
1039 3300050494 nmdc:mga06z11_538023_c1 nmdc:mga06z11_538023_c1_230_673 146
1040 3300050494 nmdc:mga06z11_69049_c1 nmdc:mga06z11_69049_c1_107_553 146
1041 3300050494 nmdc:mga06z11_919732_c1 nmdc:mga06z11_919732_c1_49_492 146
1042 3300050495 nmdc:mga04h51_71852_c1 nmdc:mga04h51_71852_c1_350_793 146
1043 3300050496 nmdc:mga07m45_179963_c1 nmdc:mga07m45_179963_c1_240_683 146
1044 3300050496 nmdc:mga07m45_429412_c1 nmdc:mga07m45_429412_c1_246_689 146
1045 3300050496 nmdc:mga07m45_45899_c1 nmdc:mga07m45_45899_c1_1858_2301 146
1046 3300050496 nmdc:mga07m45_56187_c1 nmdc:mga07m45_56187_c1_1718_2161 146
1047 3300050496 nmdc:mga07m45_747047_c1 nmdc:mga07m45_747047_c1_61_504 146
1048 3300050507 nmdc:mga05p37_72861_c1 nmdc:mga05p37_72861_c1_2627_3070 146
1049 3300050509 nmdc:mga0qj67_1071363_c1 nmdc:mga0qj67_1071363_c1_19_483 146
1050 3300050509 nmdc:mga0qj67_41057_c1 nmdc:mga0qj67_41057_c1_1876_2319 146
1051 3300050510 nmdc:mga06r32_1021692_c1 nmdc:mga06r32_1021692_c1_92_535 146
1052 3300050511 nmdc:mga08y16_165438_c1 nmdc:mga08y16_165438_c1_1228_1692 146
1053 3300050511 nmdc:mga08y16_470105_c1 nmdc:mga08y16_470105_c1_419_895 146
1054 3300050514 nmdc:mga08x19_738350_c1 nmdc:mga08x19_738350_c1_29_478 146
1055 3300050516 nmdc:mga0sz30_21539_c1 nmdc:mga0sz30_21539_c1_1080_1523 146
1056 3300050516 nmdc:mga0sz30_218645_c1 nmdc:mga0sz30_218645_c1_363_806 146
1057 3300050516 nmdc:mga0sz30_3415_c1 nmdc:mga0sz30_3415_c1_350_793 146
1058 3300050516 nmdc:mga0sz30_48337_c1 nmdc:mga0sz30_48337_c1_374_817 146
1059 3300050516 nmdc:mga0sz30_59309_c1 nmdc:mga0sz30_59309_c1_1038_1481 146
1060 3300053077 Ga0495601_0291664 Ga0495601_0291664_222_671 146
1061 3300053077 Ga0495601_0407803 Ga0495601_0407803_138_581 146
1062 3300053077 Ga0495601_0844451 Ga0495601_0844451_33_476 146
1063 3300053080 Ga0500635_0001095 Ga0500635_0001095_3999_4442 146
1064 3300053080 Ga0500635_0345415 Ga0500635_0345415_89_532 146
1065 3300053083 Ga0495655_0178982 Ga0495655_0178982_46_489 146
1066 3300053084 Ga0495595_0493234 Ga0495595_0493234_25_468 146
1067 3300053085 Ga0495619_0145887 Ga0495619_0145887_960_1403 146
1068 3300053085 Ga0495619_1110296 Ga0495619_1110296_41_490 146
1069 3300053087 Ga0500643_000052 Ga0500643_000052_70934_71377 146
1070 3300053088 Ga0500644_0107119 Ga0500644_0107119_618_1061 146
1071 3300053089 Ga0500581_209572 Ga0500581_209572_79_522 146
1072 3300053090 Ga0500646_0104548 Ga0500646_0104548_75_518 146
1073 3300053092 Ga0500583_0155343 Ga0500583_0155343_326_769 146
1074 3300053092 Ga0500583_0351899 Ga0500583_0351899_94_537 146
1075 3300053093 Ga0500651_0002435 Ga0500651_0002435_3544_3987 146
1076 3300053093 Ga0500651_0040927 Ga0500651_0040927_722_1165 146
1077 3300053093 Ga0500651_0143448 Ga0500651_0143448_310_753 146
1078 3300053093 Ga0500651_0273696 Ga0500651_0273696_341_784 146
1079 3300053094 Ga0500566_0000113 Ga0500566_0000113_1494_1937 146
1080 3300053094 Ga0500566_0001807 Ga0500566_0001807_9104_9547 146
1081 3300053094 Ga0500566_0018844 Ga0500566_0018844_559_1002 146
1082 3300053095 Ga0500640_004118 Ga0500640_004118_4170_4613 146
1083 3300053095 Ga0500640_273821 Ga0500640_273821_62_505 146
1084 3300053096 Ga0500641_0195775 Ga0500641_0195775_30_473 146
1085 3300053096 Ga0500641_0349270 Ga0500641_0349270_66_509 146
1086 3300053098 Ga0500650_0000211 Ga0500650_0000211_10310_10753 146
1087 3300053098 Ga0500650_0385404 Ga0500650_0385404_33_476 146
1088 3300053103 Ga0500555_003023 Ga0500555_003023_4307_4750 146
1089 3300053104 Ga0500556_0000035 Ga0500556_0000035_64899_65342 146
1090 3300053104 Ga0500556_0270398 Ga0500556_0270398_79_522 146
1091 3300053105 Ga0500557_000057 Ga0500557_000057_9325_9768 146
1092 3300053108 Ga0500562_063601 Ga0500562_063601_123_566 146
1093 3300053109 Ga0500569_011160 Ga0500569_011160_932_1375 146
1094 3300053109 Ga0500569_019952 Ga0500569_019952_1191_1634 146
1095 3300053111 Ga0500572_000626 Ga0500572_000626_4129_4572 146
1096 3300053111 Ga0500572_150885 Ga0500572_150885_101_544 146
1097 3300053115 Ga0500591_030004 Ga0500591_030004_738_1181 146
1098 3300053116 Ga0500592_002833 Ga0500592_002833_918_1361 146
1099 3300053118 Ga0500594_0078228 Ga0500594_0078228_162_605 146
1100 3300053119 Ga0500595_005291 Ga0500595_005291_1125_1568 146
1101 3300053119 Ga0500595_020996 Ga0500595_020996_1768_2211 146
1102 3300053119 Ga0500595_036027 Ga0500595_036027_561_1004 146
1103 3300053121 Ga0500607_231258 Ga0500607_231258_298_741 146
1104 3300053121 Ga0500607_268513 Ga0500607_268513_41_484 146
1105 3300053122 Ga0500608_000655 Ga0500608_000655_3689_4132 146
1106 3300053122 Ga0500608_009359 Ga0500608_009359_166_609 146
1107 3300053123 Ga0500614_010315 Ga0500614_010315_468_911 146
1108 3300053125 Ga0500618_001755 Ga0500618_001755_2971_3414 146
1109 3300053128 Ga0500626_100377 Ga0500626_100377_201_644 146
1110 3300053130 Ga0500642_0000027 Ga0500642_0000027_80292_80735 146
1111 3300053130 Ga0500642_0093206 Ga0500642_0093206_124_567 146
1112 3300053130 Ga0500642_0190691 Ga0500642_0190691_39_482 146
1113 3300053130 Ga0500642_0496599 Ga0500642_0496599_47_490 146
1114 3300053131 Ga0500652_000244 Ga0500652_000244_15945_16388 146
1115 3300053134 Ga0500658_0160164 Ga0500658_0160164_563_1006 146
1116 3300053134 Ga0500658_0256067 Ga0500658_0256067_47_490 146
1117 3300053134 Ga0500658_0551072 Ga0500658_0551072_58_501 146
1118 3300053136 Ga0500559_0000064 Ga0500559_0000064_33182_33625 146
1119 3300053136 Ga0500559_0004501 Ga0500559_0004501_2027_2470 146
1120 3300053136 Ga0500559_0039467 Ga0500559_0039467_1483_1926 146
1121 3300053136 Ga0500559_0139069 Ga0500559_0139069_157_600 146
1122 3300053136 Ga0500559_0434627 Ga0500559_0434627_111_554 146
1123 3300053139 Ga0500568_0000443 Ga0500568_0000443_1696_2139 146
1124 3300053139 Ga0500568_0016857 Ga0500568_0016857_2483_2926 146
1125 3300053139 Ga0500568_0109108 Ga0500568_0109108_302_745 146
1126 3300053142 Ga0500577_0004109 Ga0500577_0004109_185_628 146
1127 3300053145 Ga0500586_004396 Ga0500586_004396_1325_1768 146
1128 3300053148 Ga0500590_027615 Ga0500590_027615_2478_2921 146
1129 3300053150 Ga0500603_000215 Ga0500603_000215_10332_10775 146
1130 3300053151 Ga0500604_0009467 Ga0500604_0009467_564_1007 146
1131 3300053153 Ga0500616_0000028 Ga0500616_0000028_407602_408045 146
1132 3300053153 Ga0500616_0000054 Ga0500616_0000054_221784_222227 146
1133 3300053155 Ga0500620_000883 Ga0500620_000883_3020_3463 146
1134 3300053156 Ga0500622_0003283 Ga0500622_0003283_5751_6194 146
1135 3300053156 Ga0500622_0009279 Ga0500622_0009279_1547_1990 146
1136 3300053158 Ga0500627_0011595 Ga0500627_0011595_1407_1850 146
1137 3300053158 Ga0500627_0327533 Ga0500627_0327533_79_522 146
1138 3300053158 Ga0500627_0484747 Ga0500627_0484747_58_501 146
1139 3300053159 Ga0500630_000802 Ga0500630_000802_4128_4571 146
1140 3300053161 Ga0500634_0200378 Ga0500634_0200378_262_705 146
1141 3300053162 Ga0500638_038121 Ga0500638_038121_425_868 146
1142 3300053163 Ga0500639_000899 Ga0500639_000899_14331_14774 146
1143 3300053163 Ga0500639_098582 Ga0500639_098582_710_1153 146
1144 3300053177 Ga0500636_0000594 Ga0500636_0000594_6749_7192 146
1145 3300053177 Ga0500636_0000823 Ga0500636_0000823_1242_1685 146
1146 3300053177 Ga0500636_0168364 Ga0500636_0168364_414_857 146
1147 3300053177 Ga0500636_0476856 Ga0500636_0476856_63_506 146
1148 3300053178 Ga0500637_0085474 Ga0500637_0085474_374_817 146
1149 3300053178 Ga0500637_0124117 Ga0500637_0124117_647_1090 146
1150 3300053178 Ga0500637_0301275 Ga0500637_0301275_395_838 146
1151 3300053724 Ga0500570_219005 Ga0500570_219005_17_460 146
1152 3300053729 Ga0500625_036943 Ga0500625_036943_940_1383 146
1153 3300053730 Ga0500645_046197 Ga0500645_046197_222_665 146
1154 3300053735 Ga0500596_001109 Ga0500596_001109_4128_4571 146
1155 3300053736 Ga0500599_009363 Ga0500599_009363_209_652 146
1156 3300053737 Ga0500601_000119 Ga0500601_000119_5098_5541 146
1157 3300054114 Ga0501084_0011359 Ga0501084_0011359_2312_2755 146
1158 3300054114 Ga0501084_0022705 Ga0501084_0022705_2745_3188 146
1159 3300055283 Ga0500661_007552 Ga0500661_007552_1478_1921 146
1160 3300055283 Ga0500661_123637 Ga0500661_123637_44_487 146
1161 3300060353 Ga0501082_0008590 Ga0501082_0008590_6277_6720 146
1162 3300060353 Ga0501082_0059486 Ga0501082_0059486_159_602 146
1163 3300060353 Ga0501082_1396245 Ga0501082_1396245_114_557 146
1164 3300061734 Ga0530510_0488741 Ga0530510_0488741_111_554 146
1165 iso_pu_bacteria 2824696289 2824699011 146
1166 iso_pu_bacteria 2838122688 2838126118 146
1167 iso_pu_bacteria 2841983080 2841984509 146
1168 iso_pu_bacteria 2847939898 2847943302 146
1169 3300001990 JGI24737J22298_10017720 JGI24737J22298_100177202 147
1170 3300002075 JGI24738J21930_10061017 JGI24738J21930_100610171 147
1171 3300003322 rootL2_10122270 rootL2_101222703 147
1172 3300005293 Ga0065715_10650476 Ga0065715_106504762 147
1173 3300005327 Ga0070658_10582973 Ga0070658_105829732 147
1174 3300005329 Ga0070683_100023213 Ga0070683_1000232133 147
1175 3300005329 Ga0070683_100032795 Ga0070683_1000327954 147
1176 3300005329 Ga0070683_100234015 Ga0070683_1002340152 147
1177 3300005330 Ga0070690_100188781 Ga0070690_1001887812 147
1178 3300005334 Ga0068869_100165004 Ga0068869_1001650042 147
1179 3300005336 Ga0070680_100011781 Ga0070680_1000117815 147
1180 3300005336 Ga0070680_100067141 Ga0070680_1000671412 147
1181 3300005336 Ga0070680_100380436 Ga0070680_1003804362 147
1182 3300005336 Ga0070680_100652933 Ga0070680_1006529331 147
1183 3300005341 Ga0070691_10223404 Ga0070691_102234042 147
1184 3300005344 Ga0070661_100572100 Ga0070661_1005721002 147
1185 3300005347 Ga0070668_101239926 Ga0070668_1012399262 147
1186 3300005365 Ga0070688_100970253 Ga0070688_1009702532 147
1187 3300005434 Ga0070709_10001491 Ga0070709_100014917 147
1188 3300005434 Ga0070709_10029857 Ga0070709_100298573 147
1189 3300005435 Ga0070714_100034604 Ga0070714_1000346044 147
1190 3300005435 Ga0070714_100567260 Ga0070714_1005672602 147
1191 3300005436 Ga0070713_100065716 Ga0070713_1000657163 147
1192 3300005439 Ga0070711_100606493 Ga0070711_1006064932 147
1193 3300005445 Ga0070708_100704916 Ga0070708_1007049161 147
1194 3300005445 Ga0070708_101189968 Ga0070708_1011899681 147
1195 3300005455 Ga0070663_100144426 Ga0070663_1001444262 147
1196 3300005455 Ga0070663_100531847 Ga0070663_1005318472 147
1197 3300005458 Ga0070681_10057744 Ga0070681_100577442 147
1198 3300005458 Ga0070681_10165152 Ga0070681_101651523 147
1199 3300005471 Ga0070698_100107615 Ga0070698_1001076152 147
1200 3300005518 Ga0070699_100211008 Ga0070699_1002110083 147
1201 3300005530 Ga0070679_100028212 Ga0070679_1000282123 147
1202 3300005530 Ga0070679_100234226 Ga0070679_1002342262 147
1203 3300005530 Ga0070679_100681058 Ga0070679_1006810581 147
1204 3300005535 Ga0070684_100073878 Ga0070684_1000738783 147
1205 3300005539 Ga0068853_100018531 Ga0068853_1000185316 147
1206 3300005539 Ga0068853_100085139 Ga0068853_1000851394 147
1207 3300005539 Ga0068853_100196279 Ga0068853_1001962792 147
1208 3300005539 Ga0068853_100201713 Ga0068853_1002017132 147
1209 3300005548 Ga0070665_100052241 Ga0070665_1000522412 147
1210 3300005563 Ga0068855_100092439 Ga0068855_1000924394 147
1211 3300005563 Ga0068855_100432527 Ga0068855_1004325272 147
1212 3300005563 Ga0068855_100480265 Ga0068855_1004802653 147
1213 3300005563 Ga0068855_100496985 Ga0068855_1004969853 147
1214 3300005564 Ga0070664_100893368 Ga0070664_1008933681 147
1215 3300005577 Ga0068857_100017449 Ga0068857_1000174494 147
1216 3300005577 Ga0068857_100059766 Ga0068857_1000597663 147
1217 3300005577 Ga0068857_100262105 Ga0068857_1002621052 147
1218 3300005578 Ga0068854_100023883 Ga0068854_1000238832 147
1219 3300005578 Ga0068854_100081520 Ga0068854_1000815202 147
1220 3300005614 Ga0068856_100000522 Ga0068856_10000052241 147
1221 3300005614 Ga0068856_100021340 Ga0068856_1000213404 147
1222 3300005614 Ga0068856_100433270 Ga0068856_1004332701 147
1223 3300005615 Ga0070702_100655043 Ga0070702_1006550432 147
1224 3300005616 Ga0068852_100384269 Ga0068852_1003842692 147
1225 3300005616 Ga0068852_100663802 Ga0068852_1006638022 147
1226 3300005617 Ga0068859_101477533 Ga0068859_1014775332 147
1227 3300005618 Ga0068864_101100723 Ga0068864_1011007232 147
1228 3300005618 Ga0068864_101274626 Ga0068864_1012746261 147
1229 3300005842 Ga0068858_100173954 Ga0068858_1001739542 147
1230 3300005983 Ga0081540_1100218 Ga0081540_11002182 147
1231 3300005985 Ga0081539_10165408 Ga0081539_101654082 147
1232 3300006038 Ga0075365_10119918 Ga0075365_101199182 147
1233 3300006852 Ga0075433_10813894 Ga0075433_108138942 147
1234 3300006871 Ga0075434_100011477 Ga0075434_1000114777 147
1235 3300006931 Ga0097620_101477702 Ga0097620_1014777022 147
1236 3300007265 Ga0099794_10009479 Ga0099794_100094794 147
1237 3300007265 Ga0099794_10030878 Ga0099794_100308782 147
1238 3300007265 Ga0099794_10085976 Ga0099794_100859764 147
1239 3300007265 Ga0099794_10194323 Ga0099794_101943231 147
1240 3300007265 Ga0099794_10712929 Ga0099794_107129291 147
1241 3300007788 Ga0099795_10075316 Ga0099795_100753162 147
1242 3300007788 Ga0099795_10086383 Ga0099795_100863832 147
1243 3300007788 Ga0099795_10117559 Ga0099795_101175592 147
1244 3300007788 Ga0099795_10258586 Ga0099795_102585862 147
1245 3300009093 Ga0105240_10130068 Ga0105240_101300684 147
1246 3300009093 Ga0105240_10202953 Ga0105240_102029534 147
1247 3300009093 Ga0105240_10616178 Ga0105240_106161781 147
1248 3300009093 Ga0105240_12214333 Ga0105240_122143331 147
1249 3300009098 Ga0105245_11254512 Ga0105245_112545122 147
1250 3300009101 Ga0105247_10123534 Ga0105247_101235342 147
1251 3300009148 Ga0105243_11060030 Ga0105243_110600302 147
1252 3300009174 Ga0105241_10423280 Ga0105241_104232802 147
1253 3300009174 Ga0105241_12671599 Ga0105241_126715991 147
1254 3300009545 Ga0105237_10078738 Ga0105237_100787384 147
1255 3300009545 Ga0105237_10091332 Ga0105237_100913324 147
1256 3300009545 Ga0105237_11082359 Ga0105237_110823592 147
1257 3300009545 Ga0105237_11222030 Ga0105237_112220301 147
1258 3300009551 Ga0105238_10062524 Ga0105238_100625241 147
1259 3300009551 Ga0105238_10597818 Ga0105238_105978182 147
1260 3300009553 Ga0105249_12004761 Ga0105249_120047611 147
1261 3300009553 Ga0105249_12039160 Ga0105249_120391601 147
1262 3300010159 Ga0099796_10058503 Ga0099796_100585031 147
1263 3300010159 Ga0099796_10220192 Ga0099796_102201922 147
1264 3300010375 Ga0105239_10025680 Ga0105239_100256804 147
1265 3300012483 Ga0157337_1006390 Ga0157337_10063902 147
1266 3300012515 Ga0157338_1052413 Ga0157338_10524131 147
1267 3300013104 Ga0157370_10901211 Ga0157370_109012111 147
1268 3300013105 Ga0157369_10021285 Ga0157369_100212853 147
1269 3300013105 Ga0157369_10049503 Ga0157369_100495035 147
1270 3300013105 Ga0157369_10091698 Ga0157369_100916985 147
1271 3300013307 Ga0157372_10240295 Ga0157372_102402952 147
1272 3300014968 Ga0157379_10921933 Ga0157379_109219332 147
1273 3300017792 Ga0163161_10407128 Ga0163161_104071282 147
1274 3300020069 Ga0197907_10373094 Ga0197907_103730941 147
1275 3300020070 Ga0206356_11321139 Ga0206356_113211392 147
1276 3300020082 Ga0206353_10549197 Ga0206353_105491972 147
1277 3300021388 Ga0213875_10099466 Ga0213875_100994662 147
1278 3300022467 Ga0224712_10023785 Ga0224712_100237852 147
1279 3300025261 Ga0209233_1013847 Ga0209233_10138473 147
1280 3300025321 Ga0207656_10060841 Ga0207656_100608411 147
1281 3300025904 Ga0207647_10011565 Ga0207647_100115655 147
1282 3300025911 Ga0207654_10794375 Ga0207654_107943752 147
1283 3300025912 Ga0207707_10002648 Ga0207707_1000264818 147
1284 3300025912 Ga0207707_10140285 Ga0207707_101402852 147
1285 3300025912 Ga0207707_10249254 Ga0207707_102492543 147
1286 3300025913 Ga0207695_10387936 Ga0207695_103879362 147
1287 3300025914 Ga0207671_10109212 Ga0207671_101092121 147
1288 3300025914 Ga0207671_10354156 Ga0207671_103541562 147
1289 3300025915 Ga0207693_11048918 Ga0207693_110489181 147
1290 3300025916 Ga0207663_10139368 Ga0207663_101393682 147
1291 3300025916 Ga0207663_10679740 Ga0207663_106797401 147
1292 3300025916 Ga0207663_10794519 Ga0207663_107945192 147
1293 3300025917 Ga0207660_10050359 Ga0207660_100503593 147
1294 3300025917 Ga0207660_10134958 Ga0207660_101349583 147
1295 3300025920 Ga0207649_10232413 Ga0207649_102324132 147
1296 3300025921 Ga0207652_10175065 Ga0207652_101750652 147
1297 3300025924 Ga0207694_10115714 Ga0207694_101157144 147
1298 3300025924 Ga0207694_10325138 Ga0207694_103251382 147
1299 3300025932 Ga0207690_11276392 Ga0207690_112763922 147
1300 3300025939 Ga0207665_11678446 Ga0207665_116784461 147
1301 3300025944 Ga0207661_10088916 Ga0207661_100889162 147
1302 3300025945 Ga0207679_11054894 Ga0207679_110548942 147
1303 3300025949 Ga0207667_10031470 Ga0207667_100314702 147
1304 3300025949 Ga0207667_10058763 Ga0207667_100587633 147
1305 3300025949 Ga0207667_10429077 Ga0207667_104290773 147
1306 3300025949 Ga0207667_10840498 Ga0207667_108404981 147
1307 3300025961 Ga0207712_11171341 Ga0207712_111713412 147
1308 3300025981 Ga0207640_10017622 Ga0207640_100176222 147
1309 3300025981 Ga0207640_10082467 Ga0207640_100824672 147
1310 3300025981 Ga0207640_12136635 Ga0207640_121366351 147
1311 3300026023 Ga0207677_10435302 Ga0207677_104353022 147
1312 3300026041 Ga0207639_10074387 Ga0207639_100743874 147
1313 3300026041 Ga0207639_10163104 Ga0207639_101631043 147
1314 3300026067 Ga0207678_10062712 Ga0207678_100627124 147
1315 3300026078 Ga0207702_10000014 Ga0207702_10000014239 147
1316 3300026078 Ga0207702_10064516 Ga0207702_100645162 147
1317 3300026088 Ga0207641_11437068 Ga0207641_114370681 147
1318 3300026116 Ga0207674_10040618 Ga0207674_100406182 147
1319 3300026116 Ga0207674_10118208 Ga0207674_101182082 147
1320 3300026116 Ga0207674_10200513 Ga0207674_102005133 147
1321 3300026142 Ga0207698_10326911 Ga0207698_103269112 147
1322 3300027512 Ga0209179_1006250 Ga0209179_10062502 147
1323 3300027512 Ga0209179_1053771 Ga0209179_10537712 147
1324 3300027671 Ga0209588_1013388 Ga0209588_10133883 147
1325 3300027671 Ga0209588_1017488 Ga0209588_10174883 147
1326 3300031235 Ga0265330_10057547 Ga0265330_100575472 147
1327 3300031235 Ga0265330_10116263 Ga0265330_101162632 147
1328 3300031235 Ga0265330_10155745 Ga0265330_101557451 147
1329 3300031238 Ga0265332_10015930 Ga0265332_100159302 147
1330 3300031238 Ga0265332_10068107 Ga0265332_100681072 147
1331 3300031241 Ga0265325_10002521 Ga0265325_100025213 147
1332 3300031247 Ga0265340_10011977 Ga0265340_100119772 147
1333 3300031249 Ga0265339_10031947 Ga0265339_100319473 147
1334 3300031249 Ga0265339_10207940 Ga0265339_102079402 147
1335 3300031250 Ga0265331_10099252 Ga0265331_100992522 147
1336 3300031616 Ga0307508_10096491 Ga0307508_100964912 147
1337 3300031711 Ga0265314_10151638 Ga0265314_101516381 147
1338 3300031711 Ga0265314_10252968 Ga0265314_102529682 147
1339 3300031712 Ga0265342_10006957 Ga0265342_100069572 147
1340 3300031712 Ga0265342_10120079 Ga0265342_101200791 147
1341 3300031712 Ga0265342_10250025 Ga0265342_102500251 147
1342 3300031712 Ga0265342_10524670 Ga0265342_105246702 147
1343 3300033180 Ga0307510_10186963 Ga0307510_101869632 147
1344 3300033180 Ga0307510_10215149 Ga0307510_102151492 147
1345 3300034820 Ga0373959_0025704 Ga0373959_0025704_658_1104 147
1346 3300035111 Ga0373923_0027673 Ga0373923_0027673_129_575 147
1347 3300035111 Ga0373923_0029745 Ga0373923_0029745_1716_2162 147
1348 3300035111 Ga0373923_0188601 Ga0373923_0188601_475_921 147
1349 3300035113 Ga0373936_0093376 Ga0373936_0093376_764_1210 147
1350 3300035116 Ga0373945_0045919 Ga0373945_0045919_935_1381 147
1351 3300035117 Ga0373953_0010951 Ga0373953_0010951_2608_3054 147
1352 3300035117 Ga0373953_0067760 Ga0373953_0067760_875_1321 147
1353 3300035118 Ga0373954_0007579 Ga0373954_0007579_2209_2655 147
1354 3300035118 Ga0373954_0074160 Ga0373954_0074160_994_1440 147
1355 3300035118 Ga0373954_0083207 Ga0373954_0083207_232_678 147
1356 3300035119 Ga0373956_0015887 Ga0373956_0015887_2097_2543 147
1357 3300035119 Ga0373956_0074826 Ga0373956_0074826_326_772 147
1358 3300035120 Ga0373957_0002603 Ga0373957_0002603_2584_3030 147
1359 3300035120 Ga0373957_0078627 Ga0373957_0078627_749_1195 147
1360 3300035171 Ga0373946_0002066 Ga0373946_0002066_3033_3479 147
1361 3300035172 Ga0373955_0005384 Ga0373955_0005384_2846_3292 147
1362 3300035172 Ga0373955_0026687 Ga0373955_0026687_2371_2817 147
1363 3300035172 Ga0373955_0171001 Ga0373955_0171001_725_1171 147
1364 3300035172 Ga0373955_0302418 Ga0373955_0302418_20_466 147
1365 3300035410 Ga0373924_0067023 Ga0373924_0067023_286_732 147
1366 3300035692 Ga0373935_0000354 Ga0373935_0000354_19831_20277 147
1367 3300035692 Ga0373935_0680437 Ga0373935_0680437_210_656 147
1368 3300035695 Ga0373927_0004375 Ga0373927_0004375_196_642 147
1369 3300035724 Ga0373933_0010862 Ga0373933_0010862_3248_3694 147
1370 3300035724 Ga0373933_0024661 Ga0373933_0024661_1869_2315 147
1371 3300035724 Ga0373933_0373654 Ga0373933_0373654_27_473 147
1372 3300035724 Ga0373933_0745430 Ga0373933_0745430_135_581 147
1373 3300035725 Ga0373947_0003434 Ga0373947_0003434_5805_6251 147
1374 3300036401 Ga0373937_0071808 Ga0373937_0071808_2002_2448 147
1375 3300036401 Ga0373937_0318803 Ga0373937_0318803_375_821 147
1376 3300036401 Ga0373937_0434940 Ga0373937_0434940_418_864 147
1377 3300036401 Ga0373937_0949714 Ga0373937_0949714_304_750 147
1378 3300037068 Ga0373925_0009064 Ga0373925_0009064_3911_4357 147
1379 3300037068 Ga0373925_0032743 Ga0373925_0032743_1378_1824 147
1380 3300037068 Ga0373925_0709685 Ga0373925_0709685_336_782 147
1381 3300037853 Ga0436364_0211323 Ga0436364_0211323_1375_1827 147
1382 3300037853 Ga0436364_0252830 Ga0436364_0252830_47_493 147
1383 3300037853 Ga0436364_0729467 Ga0436364_0729467_492_944 147
1384 3300037853 Ga0436364_0854930 Ga0436364_0854930_1181_1627 147
1385 3300037853 Ga0436364_1011261 Ga0436364_1011261_469_915 147
1386 3300039437 Ga0436365_0258439 Ga0436365_0258439_535_981 147
1387 3300039447 Ga0436361_0261667 Ga0436361_0261667_41_499 147
1388 3300039447 Ga0436361_0374357 Ga0436361_0374357_37_483 147
1389 3300039450 Ga0436363_1391982 Ga0436363_1391982_147_593 147
1390 3300044656 Ga0466969_0106171 Ga0466969_0106171_496_942 147
1391 3300044735 Ga0466968_0187516 Ga0466968_0187516_72_518 147
1392 3300044842 Ga0466957_0217646 Ga0466957_0217646_50_496 147
1393 3300045836 Ga0466958_0078895 Ga0466958_0078895_803_1249 147
1394 3300045976 Ga0466967_0285436 Ga0466967_0285436_104_550 147
1395 3300045976 Ga0466967_0521371 Ga0466967_0521371_678_1124 147
1396 3300045976 Ga0466967_1390278 Ga0466967_1390278_56_502 147
1397 3300046454 Ga0495592_0062845 Ga0495592_0062845_1953_2399 147
1398 3300046455 Ga0495603_0002779 Ga0495603_0002779_6686_7132 147
1399 3300046459 Ga0495629_0000416 Ga0495629_0000416_3163_3609 147
1400 3300046459 Ga0495629_0033833 Ga0495629_0033833_1989_2435 147
1401 3300046459 Ga0495629_0096054 Ga0495629_0096054_643_1089 147
1402 3300046461 Ga0495641_0008565 Ga0495641_0008565_2571_3017 147
1403 3300046462 Ga0495651_0269265 Ga0495651_0269265_616_1062 147
1404 3300046463 Ga0495653_0098531 Ga0495653_0098531_488_934 147
1405 3300046472 Ga0495580_0004213 Ga0495580_0004213_10565_11011 147
1406 3300046473 Ga0495582_0000497 Ga0495582_0000497_17942_18388 147
1407 3300046475 Ga0495639_0000087 Ga0495639_0000087_5347_5793 147
1408 3300046476 Ga0495662_0000367 Ga0495662_0000367_16049_16495 147
1409 3300046477 Ga0495664_0010747 Ga0495664_0010747_3482_3928 147
1410 3300046499 Ga0495594_0000194 Ga0495594_0000194_86_532 147
1411 3300046511 Ga0495608_0031497 Ga0495608_0031497_1357_1803 147
1412 3300046511 Ga0495608_0342143 Ga0495608_0342143_94_540 147
1413 3300046514 Ga0495618_0180936 Ga0495618_0180936_875_1321 147
1414 3300046514 Ga0495618_0489658 Ga0495618_0489658_154_600 147
1415 3300046516 Ga0495628_0043501 Ga0495628_0043501_163_609 147
1416 3300046516 Ga0495628_0053601 Ga0495628_0053601_1141_1587 147
1417 3300046517 Ga0495630_0003691 Ga0495630_0003691_3833_4279 147
1418 3300046525 Ga0495663_0100245 Ga0495663_0100245_139_585 147
1419 3300046526 Ga0495666_0250781 Ga0495666_0250781_293_739 147
1420 3300046529 Ga0495652_0037315 Ga0495652_0037315_316_762 147
1421 3300046529 Ga0495652_0043038 Ga0495652_0043038_2258_2704 147
1422 3300046529 Ga0495652_0116213 Ga0495652_0116213_17_463 147
1423 3300046529 Ga0495652_0646890 Ga0495652_0646890_188_634 147
1424 3300046531 Ga0495665_0003980 Ga0495665_0003980_1146_1592 147
1425 3300046533 Ga0495640_0014526 Ga0495640_0014526_495_941 147
1426 3300046533 Ga0495640_0033520 Ga0495640_0033520_3103_3549 147
1427 3300046536 Ga0495587_0026501 Ga0495587_0026501_1158_1604 147
1428 3300046543 Ga0495645_0061773 Ga0495645_0061773_2169_2615 147
1429 3300046557 Ga0495622_0018728 Ga0495622_0018728_624_1070 147
1430 3300046559 Ga0495667_0036362 Ga0495667_0036362_1171_1617 147
1431 3300046559 Ga0495667_0101512 Ga0495667_0101512_1373_1819 147
1432 3300046615 Ga0495656_0170379 Ga0495656_0170379_243_689 147
1433 3300046642 Ga0495634_0000602 Ga0495634_0000602_31244_31690 147
1434 3300046642 Ga0495634_0020925 Ga0495634_0020925_1907_2353 147
1435 3300046642 Ga0495634_0035236 Ga0495634_0035236_2796_3242 147
1436 3300046648 Ga0495611_0050541 Ga0495611_0050541_256_702 147
1437 3300046663 Ga0495635_0012357 Ga0495635_0012357_3244_3690 147
1438 3300046663 Ga0495635_0022635 Ga0495635_0022635_2755_3201 147
1439 3300046663 Ga0495635_0098604 Ga0495635_0098604_776_1222 147
1440 3300046674 Ga0495588_0492009 Ga0495588_0492009_109_555 147
1441 3300046675 Ga0495657_0013190 Ga0495657_0013190_4312_4758 147
1442 3300046675 Ga0495657_0021986 Ga0495657_0021986_1413_1859 147
1443 3300046678 Ga0495599_0003392 Ga0495599_0003392_1997_2443 147
1444 3300046678 Ga0495599_0031175 Ga0495599_0031175_1178_1624 147
1445 3300046678 Ga0495599_0081377 Ga0495599_0081377_1529_1975 147
1446 3300046679 Ga0495623_0024198 Ga0495623_0024198_222_668 147
1447 3300046680 Ga0495646_0034243 Ga0495646_0034243_541_987 147
1448 3300046680 Ga0495646_0102487 Ga0495646_0102487_1101_1547 147
1449 3300046680 Ga0495646_0294721 Ga0495646_0294721_237_683 147
1450 3300046681 Ga0495647_0000694 Ga0495647_0000694_6383_6829 147
1451 3300046683 Ga0495658_0000593 Ga0495658_0000593_19295_19741 147
1452 3300046689 Ga0495613_0051126 Ga0495613_0051126_2114_2560 147
1453 3300046690 Ga0495624_0004068 Ga0495624_0004068_7141_7587 147
1454 3300046809 Ga0495600_0017947 Ga0495600_0017947_2195_2641 147
1455 3300047315 Ga0495581_0000133 Ga0495581_0000133_28348_28794 147
1456 3300047317 Ga0495604_0021586 Ga0495604_0021586_2195_2641 147
1457 3300047317 Ga0495604_0187671 Ga0495604_0187671_94_540 147
1458 3300047319 Ga0495674_0000874 Ga0495674_0000874_3141_3587 147
1459 3300047319 Ga0495674_0055959 Ga0495674_0055959_939_1385 147
1460 3300047319 Ga0495674_1340353 Ga0495674_1340353_70_516 147
1461 3300047320 Ga0495672_0263461 Ga0495672_0263461_270_722 147
1462 3300047322 Ga0495680_0075333 Ga0495680_0075333_309_755 147
1463 3300047322 Ga0495680_0125751 Ga0495680_0125751_254_700 147
1464 3300047444 Ga0495675_0045534 Ga0495675_0045534_395_841 147
1465 3300047469 Ga0495673_0064070 Ga0495673_0064070_249_695 147
1466 3300047470 Ga0495681_0225750 Ga0495681_0225750_276_722 147
1467 3300047471 Ga0495684_0046162 Ga0495684_0046162_161_607 147
1468 3300047471 Ga0495684_0048321 Ga0495684_0048321_2761_3207 147
1469 3300047673 Ga0495593_0000022 Ga0495593_0000022_30990_31436 147
1470 3300047673 Ga0495593_0029769 Ga0495593_0029769_1831_2277 147
1471 3300047673 Ga0495593_0400060 Ga0495593_0400060_170_616 147
1472 3300048088 Ga0495602_0102994 Ga0495602_0102994_1671_2117 147
1473 3300048903 Ga0496100_1408556 Ga0496100_1408556_71_517 147
1474 3300048904 Ga0496101_0445125 Ga0496101_0445125_188_631 147
1475 3300048905 Ga0496102_1518183 Ga0496102_1518183_70_516 147
1476 3300048906 Ga0496103_0213094 Ga0496103_0213094_614_1060 147
1477 3300048907 Ga0496104_0045777 Ga0496104_0045777_3297_3743 147
1478 3300048908 Ga0496105_0160170 Ga0496105_0160170_65_511 147
1479 3300048909 Ga0496106_0768700 Ga0496106_0768700_57_500 147
1480 3300048910 Ga0496107_0359152 Ga0496107_0359152_336_782 147
1481 3300048911 Ga0496108_0389500 Ga0496108_0389500_406_852 147
1482 3300048912 Ga0496109_0981334 Ga0496109_0981334_277_723 147
1483 3300048913 Ga0496110_0637285 Ga0496110_0637285_49_495 147
1484 3300048913 Ga0496110_1769793 Ga0496110_1769793_38_484 147
1485 3300048914 Ga0496111_0298459 Ga0496111_0298459_450_896 147
1486 3300048915 Ga0496112_0206095 Ga0496112_0206095_821_1267 147
1487 3300048916 Ga0496113_0255541 Ga0496113_0255541_229_675 147
1488 3300048924 Ga0496121_0082049 Ga0496121_0082049_1278_1724 147
1489 3300048929 Ga0496126_0047835 Ga0496126_0047835_1585_2028 147
1490 3300048929 Ga0496126_0123849 Ga0496126_0123849_434_880 147
1491 3300048929 Ga0496126_0175444 Ga0496126_0175444_47_493 147
1492 3300048929 Ga0496126_0221075 Ga0496126_0221075_684_1130 147
1493 3300048929 Ga0496126_0228930 Ga0496126_0228930_295_741 147
1494 3300048929 Ga0496126_0903775 Ga0496126_0903775_131_577 147
1495 3300050507 nmdc:mga05p37_1609438_c1 nmdc:mga05p37_1609438_c1_170_619 147
1496 3300050512 nmdc:mga0n895_10129_c1 nmdc:mga0n895_10129_c1_589_1032 147
1497 3300050512 nmdc:mga0n895_648364_c1 nmdc:mga0n895_648364_c1_554_1000 147
1498 3300050515 nmdc:mga0a205_445443_c1 nmdc:mga0a205_445443_c1_568_1011 147
1499 3300053077 Ga0495601_0022629 Ga0495601_0022629_1267_1713 147
1500 3300053077 Ga0495601_0244131 Ga0495601_0244131_601_1047 147
1501 3300053078 Ga0495612_0011436 Ga0495612_0011436_3102_3548 147
1502 3300053078 Ga0495612_0028665 Ga0495612_0028665_868_1314 147
1503 3300053078 Ga0495612_0209187 Ga0495612_0209187_33_479 147
1504 3300053080 Ga0500635_0006128 Ga0500635_0006128_2047_2493 147
1505 3300053084 Ga0495595_0004815 Ga0495595_0004815_1799_2272 147
1506 3300053084 Ga0495595_0009867 Ga0495595_0009867_338_784 147
1507 3300053084 Ga0495595_0375009 Ga0495595_0375009_16_462 147
1508 3300053085 Ga0495619_0016828 Ga0495619_0016828_2388_2834 147
1509 3300053085 Ga0495619_0029722 Ga0495619_0029722_326_772 147
1510 3300053085 Ga0495619_0504910 Ga0495619_0504910_55_501 147
1511 3300053094 Ga0500566_0514724 Ga0500566_0514724_19_465 147
1512 3300053102 Ga0500554_018039 Ga0500554_018039_1409_1855 147
1513 3300053150 Ga0500603_001657 Ga0500603_001657_2999_3445 147
1514 3300061719 Ga0466962_0065345 Ga0466962_0065345_327_773 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01957

NfeD

NfeD-like C-terminal, partner-binding

80

166

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.8441 89 144
2k5h-assembly1.cif.gz_A solution nmr structure of protein encoded by mth693 from methanobacterium thermoautotrophicum: northeast structural genomics consortium target tt824a 0.8339 90 145
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.8305 89 145
2exd-assembly1.cif.gz_A the solution structure of the c-terminal domain of a nfed homolog from pyrococcus horikoshii 0.8048 92 145
1wa7-assembly1.cif.gz_A sh3 domain of human lyn tyrosine kinase in complex with a herpesviral ligand 0.7614 94 145
ID Description Score Start End Superfamily
af_P0AAS3_95_152_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.97 92 145 2.40.50.140
af_P0AAS3_95_152_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8903 92 145 2.40.50.140
af_P0AAS3_1_89_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8776 1 75 1.10.287.70
af_Q58236_70_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8757 91 145 2.40.50.140
af_P71767_83_144_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8543 91 145 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A317HXF2-F1-model_v4 deleted 0.9956 83 145
AF-H0SGX8-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9768 79 145
AF-A0A7C1MG96-F1-model_v4 deleted 0.9712 82 145
AF-A0A7V6PHG3-F1-model_v4 NfeD family protein 0.9452 83 145
AF-A0A7Y4J6A4-F1-model_v4 deleted 0.9382 79 145

Feature Viewer

pLDDT pTM Quality
84.07 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map