F494491
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1514 | 696 | 1350 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_11237297|Ga0157370_112372971 |
| Length | 168 |
| Sequence | MGEGARCRCIVVVAKTLEGQTMTEMFVSLGTWNWLIFGLILMALELLAPGVFLFWLGLAAFLVGVLSFVFHPAWQTQILLFAIFAVAAVPLWRRLARPKPGANNSPFLNKRADALVGRVCTLEKPIVDGIGTVRVDDTVWRVAGPDAPAGSRVRIVQADGASLTVAAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 5 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 6 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 7 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 10 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 11 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 12 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 13 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 14 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 15 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 16 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 17 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 18 | 2791355199 | |||
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 22 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 23 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 24 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 25 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 26 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 27 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 28 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 29 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 30 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 31 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 32 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 33 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 34 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 35 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 36 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 37 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 38 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 39 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 40 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 41 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 42 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 43 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 44 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 45 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 46 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 47 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 48 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 49 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 50 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 51 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 52 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 53 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 54 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 55 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 56 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 57 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 58 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 59 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 60 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 61 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 62 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 63 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 64 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 65 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 66 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 67 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 68 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 69 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 70 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 71 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 72 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 73 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 74 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 75 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 76 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 77 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 78 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 79 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 80 | 2922368715 | |||
| 81 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 82 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 83 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 84 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 85 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 86 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 87 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 88 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 89 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 90 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 91 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 92 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 93 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 94 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 95 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 96 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 97 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 98 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 99 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 100 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 101 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 102 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 103 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 104 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 105 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 106 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 107 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 108 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 109 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 110 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 111 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 112 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 113 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 114 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 115 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 116 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 117 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 118 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 119 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 120 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 121 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 122 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 123 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 124 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 125 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 126 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 127 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 128 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 129 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 130 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 131 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 132 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 133 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 134 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 135 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 136 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 137 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 138 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 139 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 140 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 141 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 142 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 143 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 144 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 145 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 146 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 147 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 148 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 149 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 150 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 151 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 152 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 154 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 155 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 157 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 159 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 160 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 162 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 163 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 164 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 172 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 175 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 177 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 178 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 181 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 186 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 187 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 188 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 190 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 192 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 193 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 194 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 196 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 198 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 199 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 201 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 202 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 203 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 205 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 206 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 207 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 208 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 209 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 210 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 211 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 212 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 213 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 214 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 215 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 216 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 218 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 219 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 220 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 221 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 222 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 225 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 226 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 227 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 228 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 230 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 231 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 232 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 233 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 234 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 235 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 236 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 237 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 238 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 240 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 241 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 242 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 243 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 244 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 245 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 260 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 263 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 264 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 279 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 280 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 281 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 282 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 283 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 284 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 285 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 286 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 287 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 292 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 294 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 362 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 363 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 364 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 365 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 369 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 373 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 374 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 375 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 376 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 377 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 378 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 379 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 380 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 381 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 382 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 383 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 384 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 385 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 386 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 387 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 388 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 389 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 390 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 391 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 392 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 393 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 394 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 395 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 396 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 397 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 398 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 399 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 400 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 401 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 402 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 403 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 404 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 405 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 406 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 407 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 408 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 409 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 410 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 411 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 412 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 413 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 414 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 415 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 416 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 417 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 418 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 419 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 420 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 421 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 422 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 423 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 424 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 425 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 426 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 427 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 428 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 429 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 430 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 431 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 432 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 433 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 434 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 435 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 436 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 437 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 438 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 439 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 440 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 441 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 442 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 443 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 444 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 531 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 532 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 533 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 534 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 535 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 536 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 537 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 538 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 539 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 540 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 541 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 542 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 543 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 544 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 545 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 546 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 547 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 548 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 549 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 550 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 551 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 552 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 553 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 554 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 555 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 556 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 559 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 560 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 562 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 563 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 564 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 565 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 566 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 567 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 569 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 577 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 578 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 580 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 587 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 589 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 590 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 591 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 592 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 593 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 594 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 595 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 596 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 597 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 598 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 599 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 600 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 601 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 602 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 603 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 604 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 605 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 606 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 607 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 610 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 614 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 615 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 616 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 617 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 618 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 619 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 620 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 621 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 622 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 623 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 624 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 625 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 626 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 627 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 628 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 629 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 630 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 631 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 632 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 633 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 634 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 635 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 636 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 637 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 638 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 639 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 640 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 641 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 642 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 643 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 644 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 645 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 646 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 647 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 648 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 649 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 650 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 651 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 652 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 653 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 654 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 655 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 656 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 657 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 658 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 659 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 660 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 661 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 662 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 663 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 664 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 665 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 666 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 667 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 668 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 669 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 670 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 671 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 672 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 673 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 674 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 675 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 676 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 677 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 678 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 679 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 680 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 681 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 682 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 683 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 684 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 685 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 686 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 687 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 688 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 689 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 690 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 691 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 692 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 693 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 694 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 695 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 696 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.02 |
| Metatranscriptomes | 0.26 |
| Isolates | 10.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.6 |
| Nodule | 8.26 |
| Rhizoplane | 3.96 |
| Rhizosphere | 64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10017720 | 3300001990 | Bacteria | 2291 |
| 2 | JGI24738J21930_10061017 | 3300002075 | Bacteria | 774 |
| 3 | JGI25406J46586_10004414 | 3300003203 | Bacteria | 6552 |
| 4 | JGI25165J46597_1012534 | 3300003214 | Bacteria | 1183 |
| 5 | JGI25153J46596_10001134 | 3300003215 | Bacteria | 16126 |
| 6 | JGI25153J46596_10003236 | 3300003215 | Bacteria | 9159 |
| 7 | JGI25153J46596_10009457 | 3300003215 | Bacteria | 4528 |
| 8 | JGI25153J46596_10016604 | 3300003215 | Bacteria | 2939 |
| 9 | JGI25153J46596_10047080 | 3300003215 | Bacteria | 1272 |
| 10 | JGI25153J46596_10099626 | 3300003215 | Bacteria | 685 |
| 11 | rootL2_10122270 | 3300003322 | Bacteria | 1560 |
| 12 | JGI25160J50197_1012741 | 3300003354 | Bacteria | 2900 |
| 13 | JGI25404J52841_10003333 | 3300003659 | Bacteria | 3163 |
| 14 | JGI25404J52841_10018969 | 3300003659 | Bacteria | 1490 |
| 15 | JGI25404J52841_10021526 | 3300003659 | Bacteria | 1396 |
| 16 | JGI25404J52841_10029752 | 3300003659 | Bacteria | 1171 |
| 17 | JGI25404J52841_10129563 | 3300003659 | Bacteria | 533 |
| 18 | Ga0055542_1037136 | 3300003762 | Bacteria | 590 |
| 19 | Ga0055531_10004135 | 3300003794 | Bacteria | 8966 |
| 20 | Ga0055543_1009650 | 3300004625 | Bacteria | 2063 |
| 21 | Ga0065165_1003814 | 3300005262 | Bacteria | 10056 |
| 22 | Ga0065715_10357385 | 3300005293 | Bacteria | 941 |
| 23 | Ga0065715_10650476 | 3300005293 | Bacteria | 679 |
| 24 | Ga0070658_10445178 | 3300005327 | Bacteria | 1116 |
| 25 | Ga0070658_10582973 | 3300005327 | Bacteria | 969 |
| 26 | Ga0070658_11248106 | 3300005327 | Bacteria | 646 |
| 27 | Ga0070658_11427710 | 3300005327 | Bacteria | 600 |
| 28 | Ga0070683_100023213 | 3300005329 | Bacteria | 5547 |
| 29 | Ga0070683_100032795 | 3300005329 | Bacteria | 4733 |
| 30 | Ga0070683_100234015 | 3300005329 | Bacteria | 1746 |
| 31 | Ga0070683_100325152 | 3300005329 | Bacteria | 1464 |
| 32 | Ga0070683_100863738 | 3300005329 | Bacteria | 868 |
| 33 | Ga0070690_100188781 | 3300005330 | Bacteria | 1428 |
| 34 | Ga0070670_100135781 | 3300005331 | Bacteria | 2125 |
| 35 | Ga0070670_100454455 | 3300005331 | Bacteria | 1135 |
| 36 | Ga0068869_100025714 | 3300005334 | Bacteria | 4091 |
| 37 | Ga0068869_100165004 | 3300005334 | Bacteria | 1727 |
| 38 | Ga0068869_101048429 | 3300005334 | Bacteria | 712 |
| 39 | Ga0070666_10389018 | 3300005335 | Bacteria | 1002 |
| 40 | Ga0070666_11227897 | 3300005335 | Bacteria | 559 |
| 41 | Ga0070680_100011781 | 3300005336 | Bacteria | 6782 |
| 42 | Ga0070680_100067141 | 3300005336 | Bacteria | 2941 |
| 43 | Ga0070680_100105949 | 3300005336 | Bacteria | 2337 |
| 44 | Ga0070680_100380436 | 3300005336 | Bacteria | 1202 |
| 45 | Ga0070680_100652933 | 3300005336 | Bacteria | 904 |
| 46 | Ga0068868_100105457 | 3300005338 | Bacteria | 2285 |
| 47 | Ga0068868_100400882 | 3300005338 | Bacteria | 1184 |
| 48 | Ga0070660_100190658 | 3300005339 | Bacteria | 1660 |
| 49 | Ga0070660_100351071 | 3300005339 | Bacteria | 1215 |
| 50 | Ga0070689_100969785 | 3300005340 | Bacteria | 755 |
| 51 | Ga0070691_10223404 | 3300005341 | Bacteria | 999 |
| 52 | Ga0070687_101381990 | 3300005343 | Bacteria | 526 |
| 53 | Ga0070661_100140954 | 3300005344 | Bacteria | 1817 |
| 54 | Ga0070661_100572100 | 3300005344 | Bacteria | 911 |
| 55 | Ga0070668_100822140 | 3300005347 | Bacteria | 826 |
| 56 | Ga0070668_101239926 | 3300005347 | Bacteria | 677 |
| 57 | Ga0070669_100356393 | 3300005353 | Bacteria | 1189 |
| 58 | Ga0070669_100397600 | 3300005353 | Bacteria | 1127 |
| 59 | Ga0070675_100558745 | 3300005354 | Bacteria | 1035 |
| 60 | Ga0070675_100938750 | 3300005354 | Bacteria | 793 |
| 61 | Ga0070671_100878563 | 3300005355 | Bacteria | 783 |
| 62 | Ga0070671_101455966 | 3300005355 | Bacteria | 606 |
| 63 | Ga0070674_100031034 | 3300005356 | Bacteria | 3537 |
| 64 | Ga0070673_100305186 | 3300005364 | Bacteria | 1402 |
| 65 | Ga0070673_101102683 | 3300005364 | Bacteria | 741 |
| 66 | Ga0070688_100970253 | 3300005365 | Bacteria | 674 |
| 67 | Ga0070659_100121951 | 3300005366 | Bacteria | 2112 |
| 68 | Ga0070667_101088893 | 3300005367 | Bacteria | 747 |
| 69 | Ga0070667_101488755 | 3300005367 | Bacteria | 635 |
| 70 | Ga0070709_10001491 | 3300005434 | Bacteria | 12644 |
| 71 | Ga0070709_10029857 | 3300005434 | Bacteria | 3265 |
| 72 | Ga0070709_10432253 | 3300005434 | Bacteria | 989 |
| 73 | Ga0070714_100030496 | 3300005435 | Bacteria | 4489 |
| 74 | Ga0070714_100034604 | 3300005435 | Bacteria | 4231 |
| 75 | Ga0070714_100254434 | 3300005435 | Bacteria | 1625 |
| 76 | Ga0070714_100567260 | 3300005435 | Bacteria | 1088 |
| 77 | Ga0070713_100065716 | 3300005436 | Bacteria | 3049 |
| 78 | Ga0070713_100464833 | 3300005436 | Bacteria | 1190 |
| 79 | Ga0070710_10392853 | 3300005437 | Bacteria | 928 |
| 80 | Ga0070711_100606493 | 3300005439 | Bacteria | 914 |
| 81 | Ga0070705_100686406 | 3300005440 | Bacteria | 803 |
| 82 | Ga0070700_100085290 | 3300005441 | Bacteria | 2049 |
| 83 | Ga0070708_100704916 | 3300005445 | Bacteria | 950 |
| 84 | Ga0070708_101189968 | 3300005445 | Bacteria | 713 |
| 85 | Ga0070663_100029162 | 3300005455 | Bacteria | 3767 |
| 86 | Ga0070663_100092281 | 3300005455 | Bacteria | 2245 |
| 87 | Ga0070663_100144426 | 3300005455 | Bacteria | 1819 |
| 88 | Ga0070663_100463485 | 3300005455 | Bacteria | 1046 |
| 89 | Ga0070663_100531847 | 3300005455 | Bacteria | 980 |
| 90 | Ga0070663_100660587 | 3300005455 | Bacteria | 885 |
| 91 | Ga0070663_101370384 | 3300005455 | Bacteria | 626 |
| 92 | Ga0070678_100003092 | 3300005456 | Bacteria | 9227 |
| 93 | Ga0070678_100267806 | 3300005456 | Bacteria | 1439 |
| 94 | Ga0070662_101106580 | 3300005457 | Bacteria | 680 |
| 95 | Ga0070681_10057744 | 3300005458 | Bacteria | 3861 |
| 96 | Ga0070681_10165152 | 3300005458 | Bacteria | 2137 |
| 97 | Ga0070681_10859626 | 3300005458 | Bacteria | 825 |
| 98 | Ga0070681_11078366 | 3300005458 | Bacteria | 724 |
| 99 | Ga0068867_100502098 | 3300005459 | Bacteria | 1043 |
| 100 | Ga0068867_101235039 | 3300005459 | Bacteria | 688 |
| 101 | Ga0070706_100361798 | 3300005467 | Bacteria | 1352 |
| 102 | Ga0070707_100316008 | 3300005468 | Bacteria | 1518 |
| 103 | Ga0070698_100074379 | 3300005471 | Bacteria | 3403 |
| 104 | Ga0070698_100107615 | 3300005471 | Bacteria | 2755 |
| 105 | Ga0070699_100201113 | 3300005518 | Bacteria | 1772 |
| 106 | Ga0070699_100211008 | 3300005518 | Bacteria | 1728 |
| 107 | Ga0070699_100388481 | 3300005518 | Bacteria | 1261 |
| 108 | Ga0070679_100028212 | 3300005530 | Bacteria | 5533 |
| 109 | Ga0070679_100217903 | 3300005530 | Bacteria | 1871 |
| 110 | Ga0070679_100234226 | 3300005530 | Bacteria | 1795 |
| 111 | Ga0070679_100568078 | 3300005530 | Bacteria | 1078 |
| 112 | Ga0070679_100681058 | 3300005530 | Bacteria | 971 |
| 113 | Ga0070684_100073878 | 3300005535 | Bacteria | 3005 |
| 114 | Ga0068853_100018531 | 3300005539 | Bacteria | 5764 |
| 115 | Ga0068853_100085139 | 3300005539 | Bacteria | 2771 |
| 116 | Ga0068853_100127409 | 3300005539 | Bacteria | 2276 |
| 117 | Ga0068853_100196279 | 3300005539 | Bacteria | 1836 |
| 118 | Ga0068853_100201713 | 3300005539 | Bacteria | 1810 |
| 119 | Ga0068853_100336480 | 3300005539 | Bacteria | 1402 |
| 120 | Ga0068853_101025068 | 3300005539 | Bacteria | 795 |
| 121 | Ga0070672_100049102 | 3300005543 | Bacteria | 3281 |
| 122 | Ga0070672_100704163 | 3300005543 | Bacteria | 884 |
| 123 | Ga0070695_101130705 | 3300005545 | Bacteria | 642 |
| 124 | Ga0070665_100052241 | 3300005548 | Bacteria | 4100 |
| 125 | Ga0070665_100084542 | 3300005548 | Bacteria | 3179 |
| 126 | Ga0070665_100169822 | 3300005548 | Bacteria | 2182 |
| 127 | Ga0070665_100468867 | 3300005548 | Bacteria | 1270 |
| 128 | Ga0070665_100518411 | 3300005548 | Bacteria | 1204 |
| 129 | Ga0070665_100784636 | 3300005548 | Bacteria | 966 |
| 130 | Ga0070665_101095992 | 3300005548 | Bacteria | 808 |
| 131 | Ga0070665_101146177 | 3300005548 | Bacteria | 789 |
| 132 | Ga0070704_101008081 | 3300005549 | Bacteria | 753 |
| 133 | Ga0068855_100092439 | 3300005563 | Bacteria | 3489 |
| 134 | Ga0068855_100432527 | 3300005563 | Bacteria | 1438 |
| 135 | Ga0068855_100480265 | 3300005563 | Bacteria | 1353 |
| 136 | Ga0068855_100496985 | 3300005563 | Bacteria | 1326 |
| 137 | Ga0068855_100587955 | 3300005563 | Bacteria | 1202 |
| 138 | Ga0068855_100726659 | 3300005563 | Bacteria | 1061 |
| 139 | Ga0068855_100864344 | 3300005563 | Bacteria | 957 |
| 140 | Ga0070664_100125780 | 3300005564 | Bacteria | 2249 |
| 141 | Ga0070664_100893368 | 3300005564 | Bacteria | 833 |
| 142 | Ga0068857_100017449 | 3300005577 | Bacteria | 6291 |
| 143 | Ga0068857_100059766 | 3300005577 | Bacteria | 3387 |
| 144 | Ga0068857_100262105 | 3300005577 | Bacteria | 1586 |
| 145 | Ga0068854_100023883 | 3300005578 | Bacteria | 4179 |
| 146 | Ga0068854_100081520 | 3300005578 | Bacteria | 2390 |
| 147 | Ga0068854_100202857 | 3300005578 | Bacteria | 1560 |
| 148 | Ga0068854_101386686 | 3300005578 | Bacteria | 635 |
| 149 | Ga0068856_100000522 | 3300005614 | Bacteria | 42457 |
| 150 | Ga0068856_100021340 | 3300005614 | Bacteria | 6294 |
| 151 | Ga0068856_100157594 | 3300005614 | Bacteria | 2280 |
| 152 | Ga0068856_100433270 | 3300005614 | Bacteria | 1335 |
| 153 | Ga0068856_100434702 | 3300005614 | Bacteria | 1333 |
| 154 | Ga0070702_100655043 | 3300005615 | Bacteria | 795 |
| 155 | Ga0070702_100662957 | 3300005615 | Bacteria | 790 |
| 156 | Ga0070702_101627397 | 3300005615 | Bacteria | 535 |
| 157 | Ga0068852_100005154 | 3300005616 | Bacteria | 9315 |
| 158 | Ga0068852_100384269 | 3300005616 | Bacteria | 1378 |
| 159 | Ga0068852_100515489 | 3300005616 | Bacteria | 1192 |
| 160 | Ga0068852_100663802 | 3300005616 | Bacteria | 1051 |
| 161 | Ga0068859_100955820 | 3300005617 | Bacteria | 940 |
| 162 | Ga0068859_101477533 | 3300005617 | Bacteria | 750 |
| 163 | Ga0068859_101901889 | 3300005617 | Bacteria | 657 |
| 164 | Ga0068864_100208484 | 3300005618 | Bacteria | 1799 |
| 165 | Ga0068864_100212870 | 3300005618 | Bacteria | 1780 |
| 166 | Ga0068864_101100723 | 3300005618 | Bacteria | 791 |
| 167 | Ga0068864_101274626 | 3300005618 | Bacteria | 735 |
| 168 | Ga0068866_10149684 | 3300005718 | Bacteria | 1350 |
| 169 | Ga0068861_100211061 | 3300005719 | Bacteria | 1635 |
| 170 | Ga0068861_101852455 | 3300005719 | Bacteria | 599 |
| 171 | Ga0068863_100156143 | 3300005841 | Bacteria | 2185 |
| 172 | Ga0068863_100439669 | 3300005841 | Bacteria | 1279 |
| 173 | Ga0068863_100464863 | 3300005841 | Bacteria | 1243 |
| 174 | Ga0068858_100034437 | 3300005842 | Bacteria | 4698 |
| 175 | Ga0068858_100173954 | 3300005842 | Bacteria | 2031 |
| 176 | Ga0068858_100829588 | 3300005842 | Bacteria | 903 |
| 177 | Ga0068860_100118797 | 3300005843 | Bacteria | 2531 |
| 178 | Ga0068862_100446298 | 3300005844 | Bacteria | 1219 |
| 179 | Ga0068862_100567903 | 3300005844 | Bacteria | 1085 |
| 180 | Ga0081455_10001332 | 3300005937 | Bacteria | 30542 |
| 181 | Ga0081455_10026185 | 3300005937 | Bacteria | 5372 |
| 182 | Ga0081455_10029427 | 3300005937 | Bacteria | 5008 |
| 183 | Ga0081455_10032880 | 3300005937 | Bacteria | 4668 |
| 184 | Ga0081455_10076533 | 3300005937 | Bacteria | 2756 |
| 185 | Ga0081455_10195085 | 3300005937 | Bacteria | 1521 |
| 186 | Ga0081540_1002747 | 3300005983 | Bacteria | 14302 |
| 187 | Ga0081540_1006321 | 3300005983 | Bacteria | 8657 |
| 188 | Ga0081540_1007063 | 3300005983 | Bacteria | 8070 |
| 189 | Ga0081540_1008395 | 3300005983 | Bacteria | 7220 |
| 190 | Ga0081540_1010443 | 3300005983 | Bacteria | 6287 |
| 191 | Ga0081540_1014706 | 3300005983 | Bacteria | 4997 |
| 192 | Ga0081540_1049888 | 3300005983 | Bacteria | 2084 |
| 193 | Ga0081540_1100218 | 3300005983 | Bacteria | 1250 |
| 194 | Ga0081539_10003211 | 3300005985 | Bacteria | 20647 |
| 195 | Ga0081539_10003502 | 3300005985 | Bacteria | 19186 |
| 196 | Ga0081539_10017936 | 3300005985 | Bacteria | 4939 |
| 197 | Ga0081539_10018388 | 3300005985 | Bacteria | 4852 |
| 198 | Ga0081539_10165408 | 3300005985 | Bacteria | 1051 |
| 199 | Ga0070717_10106977 | 3300006028 | Bacteria | 2382 |
| 200 | Ga0070717_11780088 | 3300006028 | Bacteria | 557 |
| 201 | Ga0075365_10002534 | 3300006038 | Bacteria | 9011 |
| 202 | Ga0075365_10074736 | 3300006038 | Bacteria | 2286 |
| 203 | Ga0075365_10075901 | 3300006038 | Bacteria | 2269 |
| 204 | Ga0075365_10077246 | 3300006038 | Bacteria | 2250 |
| 205 | Ga0075365_10094874 | 3300006038 | Bacteria | 2037 |
| 206 | Ga0075365_10119918 | 3300006038 | Bacteria | 1814 |
| 207 | Ga0075365_10258838 | 3300006038 | Bacteria | 1223 |
| 208 | Ga0075365_10344734 | 3300006038 | Bacteria | 1050 |
| 209 | Ga0075368_10010232 | 3300006042 | Bacteria | 3387 |
| 210 | Ga0075368_10097188 | 3300006042 | Bacteria | 1207 |
| 211 | Ga0075363_100012149 | 3300006048 | Bacteria | 4142 |
| 212 | Ga0075363_100018535 | 3300006048 | Bacteria | 3470 |
| 213 | Ga0075363_100058674 | 3300006048 | Bacteria | 2067 |
| 214 | Ga0075363_100454948 | 3300006048 | Bacteria | 757 |
| 215 | Ga0075364_10006018 | 3300006051 | Bacteria | 7094 |
| 216 | Ga0075364_10013934 | 3300006051 | Bacteria | 4955 |
| 217 | Ga0075364_10015976 | 3300006051 | Bacteria | 4662 |
| 218 | Ga0070715_10180891 | 3300006163 | Bacteria | 1057 |
| 219 | Ga0070715_10296864 | 3300006163 | Bacteria | 863 |
| 220 | Ga0070716_101462518 | 3300006173 | Bacteria | 557 |
| 221 | Ga0070712_100441599 | 3300006175 | Bacteria | 1082 |
| 222 | Ga0075362_10003916 | 3300006177 | Bacteria | 5291 |
| 223 | Ga0075362_10068209 | 3300006177 | Bacteria | 1619 |
| 224 | Ga0075362_10231095 | 3300006177 | Bacteria | 906 |
| 225 | Ga0075367_10038406 | 3300006178 | Bacteria | 2787 |
| 226 | Ga0075367_10082884 | 3300006178 | Bacteria | 1942 |
| 227 | Ga0075367_10170466 | 3300006178 | Bacteria | 1356 |
| 228 | Ga0075367_10179276 | 3300006178 | Bacteria | 1321 |
| 229 | Ga0075369_10017261 | 3300006186 | Bacteria | 2922 |
| 230 | Ga0075369_10026495 | 3300006186 | Bacteria | 2416 |
| 231 | Ga0075369_10059198 | 3300006186 | Bacteria | 1669 |
| 232 | Ga0075369_10096794 | 3300006186 | Bacteria | 1321 |
| 233 | Ga0075366_10009134 | 3300006195 | Bacteria | 5528 |
| 234 | Ga0075366_10011900 | 3300006195 | Bacteria | 4924 |
| 235 | Ga0075366_10019386 | 3300006195 | Bacteria | 3935 |
| 236 | Ga0075366_10024339 | 3300006195 | Bacteria | 3531 |
| 237 | Ga0075366_10120593 | 3300006195 | Bacteria | 1580 |
| 238 | Ga0097621_100889785 | 3300006237 | Bacteria | 829 |
| 239 | Ga0075370_10017821 | 3300006353 | Bacteria | 3841 |
| 240 | Ga0075370_10028156 | 3300006353 | Bacteria | 3122 |
| 241 | Ga0075370_10167745 | 3300006353 | Bacteria | 1290 |
| 242 | Ga0075370_10309359 | 3300006353 | Bacteria | 940 |
| 243 | Ga0075370_10359035 | 3300006353 | Bacteria | 871 |
| 244 | Ga0075370_11014985 | 3300006353 | Bacteria | 509 |
| 245 | Ga0068871_100227592 | 3300006358 | Bacteria | 1617 |
| 246 | Ga0068871_100471553 | 3300006358 | Bacteria | 1128 |
| 247 | Ga0075430_100356590 | 3300006846 | Bacteria | 1207 |
| 248 | Ga0075430_101214397 | 3300006846 | Bacteria | 621 |
| 249 | Ga0075431_100048608 | 3300006847 | Bacteria | 4375 |
| 250 | Ga0075431_100070799 | 3300006847 | Bacteria | 3598 |
| 251 | Ga0075433_10537269 | 3300006852 | Bacteria | 1028 |
| 252 | Ga0075433_10652485 | 3300006852 | Bacteria | 923 |
| 253 | Ga0075433_10813894 | 3300006852 | Bacteria | 816 |
| 254 | Ga0075434_100011477 | 3300006871 | Bacteria | 8362 |
| 255 | Ga0075434_100127180 | 3300006871 | Bacteria | 2565 |
| 256 | Ga0075429_100005400 | 3300006880 | Bacteria | 10997 |
| 257 | Ga0068865_100196644 | 3300006881 | Bacteria | 1563 |
| 258 | Ga0075436_100676489 | 3300006914 | Bacteria | 764 |
| 259 | Ga0097620_100955774 | 3300006931 | Bacteria | 940 |
| 260 | Ga0097620_101477702 | 3300006931 | Bacteria | 750 |
| 261 | Ga0097620_101901597 | 3300006931 | Bacteria | 657 |
| 262 | Ga0099825_1028430 | 3300006941 | Bacteria | 2720 |
| 263 | Ga0099824_1014343 | 3300006942 | Bacteria | 7902 |
| 264 | Ga0099823_1010603 | 3300006944 | Bacteria | 9345 |
| 265 | Ga0075435_100653780 | 3300007076 | Bacteria | 913 |
| 266 | Ga0099794_10009479 | 3300007265 | Bacteria | 4096 |
| 267 | Ga0099794_10030878 | 3300007265 | Bacteria | 2505 |
| 268 | Ga0099794_10085976 | 3300007265 | Bacteria | 1557 |
| 269 | Ga0099794_10194323 | 3300007265 | Bacteria | 1038 |
| 270 | Ga0099794_10712929 | 3300007265 | Bacteria | 535 |
| 271 | Ga0099795_10061490 | 3300007788 | Bacteria | 1395 |
| 272 | Ga0099795_10075316 | 3300007788 | Bacteria | 1281 |
| 273 | Ga0099795_10086383 | 3300007788 | Bacteria | 1209 |
| 274 | Ga0099795_10117559 | 3300007788 | Bacteria | 1060 |
| 275 | Ga0099795_10258586 | 3300007788 | Bacteria | 753 |
| 276 | Ga0105251_10222271 | 3300009011 | Bacteria | 850 |
| 277 | Ga0105250_10113873 | 3300009092 | Bacteria | 1109 |
| 278 | Ga0105240_10014502 | 3300009093 | Bacteria | 10759 |
| 279 | Ga0105240_10130068 | 3300009093 | Bacteria | 3021 |
| 280 | Ga0105240_10202953 | 3300009093 | Bacteria | 2322 |
| 281 | Ga0105240_10616178 | 3300009093 | Bacteria | 1193 |
| 282 | Ga0105240_12153193 | 3300009093 | Bacteria | 579 |
| 283 | Ga0105240_12214333 | 3300009093 | Bacteria | 570 |
| 284 | Ga0111539_10144285 | 3300009094 | Bacteria | 2787 |
| 285 | Ga0111539_10205773 | 3300009094 | Bacteria | 2294 |
| 286 | Ga0105245_10074222 | 3300009098 | Bacteria | 3095 |
| 287 | Ga0105245_10230300 | 3300009098 | Bacteria | 1792 |
| 288 | Ga0105245_11036517 | 3300009098 | Bacteria | 865 |
| 289 | Ga0105245_11254512 | 3300009098 | Bacteria | 790 |
| 290 | Ga0105247_10123534 | 3300009101 | Bacteria | 1680 |
| 291 | Ga0105247_10900988 | 3300009101 | Bacteria | 683 |
| 292 | Ga0114129_10003546 | 3300009147 | Bacteria | 21965 |
| 293 | Ga0114129_10063906 | 3300009147 | Bacteria | 5136 |
| 294 | Ga0105243_10104007 | 3300009148 | Bacteria | 2362 |
| 295 | Ga0105243_10404528 | 3300009148 | Bacteria | 1269 |
| 296 | Ga0105243_10491022 | 3300009148 | Bacteria | 1161 |
| 297 | Ga0105243_11060030 | 3300009148 | Bacteria | 817 |
| 298 | Ga0105243_11068895 | 3300009148 | Bacteria | 813 |
| 299 | Ga0105241_10144238 | 3300009174 | Bacteria | 1942 |
| 300 | Ga0105241_10423280 | 3300009174 | Bacteria | 1172 |
| 301 | Ga0105241_12671599 | 3300009174 | Bacteria | 502 |
| 302 | Ga0105242_11620060 | 3300009176 | Bacteria | 681 |
| 303 | Ga0105242_11741629 | 3300009176 | Bacteria | 660 |
| 304 | Ga0105248_10092495 | 3300009177 | Bacteria | 3406 |
| 305 | Ga0105248_10144108 | 3300009177 | Bacteria | 2688 |
| 306 | Ga0105237_10011109 | 3300009545 | Bacteria | 9544 |
| 307 | Ga0105237_10045833 | 3300009545 | Bacteria | 4400 |
| 308 | Ga0105237_10078738 | 3300009545 | Bacteria | 3285 |
| 309 | Ga0105237_10091332 | 3300009545 | Bacteria | 3034 |
| 310 | Ga0105237_10121243 | 3300009545 | Bacteria | 2609 |
| 311 | Ga0105237_10149889 | 3300009545 | Bacteria | 2329 |
| 312 | Ga0105237_10229709 | 3300009545 | Bacteria | 1856 |
| 313 | Ga0105237_10231483 | 3300009545 | Bacteria | 1849 |
| 314 | Ga0105237_11082359 | 3300009545 | Unclassified | 808 |
| 315 | Ga0105237_11145491 | 3300009545 | Bacteria | 784 |
| 316 | Ga0105237_11222030 | 3300009545 | Bacteria | 758 |
| 317 | Ga0105238_10062524 | 3300009551 | Bacteria | 3723 |
| 318 | Ga0105238_10587335 | 3300009551 | Bacteria | 1121 |
| 319 | Ga0105238_10597818 | 3300009551 | Bacteria | 1111 |
| 320 | Ga0105238_10773199 | 3300009551 | Bacteria | 975 |
| 321 | Ga0105238_10917319 | 3300009551 | Bacteria | 895 |
| 322 | Ga0105238_12217183 | 3300009551 | Bacteria | 584 |
| 323 | Ga0105249_10806706 | 3300009553 | Bacteria | 1003 |
| 324 | Ga0105249_12004761 | 3300009553 | Bacteria | 651 |
| 325 | Ga0105249_12039160 | 3300009553 | Bacteria | 646 |
| 326 | Ga0099796_10058503 | 3300010159 | Bacteria | 1359 |
| 327 | Ga0099796_10220192 | 3300010159 | Bacteria | 777 |
| 328 | Ga0105239_10025680 | 3300010375 | Bacteria | 6487 |
| 329 | Ga0105239_10102400 | 3300010375 | Bacteria | 3169 |
| 330 | Ga0105239_10307416 | 3300010375 | Bacteria | 1786 |
| 331 | Ga0105239_10727186 | 3300010375 | Bacteria | 1136 |
| 332 | Ga0105246_10005981 | 3300011119 | Bacteria | 7428 |
| 333 | Ga0105246_10012518 | 3300011119 | Bacteria | 5298 |
| 334 | Ga0157337_1006390 | 3300012483 | Bacteria | 814 |
| 335 | Ga0157338_1052413 | 3300012515 | Bacteria | 589 |
| 336 | Ga0157373_10328759 | 3300013100 | Bacteria | 1088 |
| 337 | Ga0157371_10120382 | 3300013102 | Bacteria | 1866 |
| 338 | Ga0157370_10901211 | 3300013104 | Bacteria | 802 |
| 339 | Ga0157370_11237297 | 3300013104 | Bacteria | 673 |
| 340 | Ga0157369_10021285 | 3300013105 | Bacteria | 7251 |
| 341 | Ga0157369_10049503 | 3300013105 | Bacteria | 4555 |
| 342 | Ga0157369_10091698 | 3300013105 | Bacteria | 3243 |
| 343 | Ga0157369_10454431 | 3300013105 | Bacteria | 1326 |
| 344 | Ga0157374_10112947 | 3300013296 | Bacteria | 2615 |
| 345 | Ga0157374_10720385 | 3300013296 | Bacteria | 1011 |
| 346 | Ga0157374_10885789 | 3300013296 | Bacteria | 910 |
| 347 | Ga0157378_10018404 | 3300013297 | Bacteria | 6135 |
| 348 | Ga0157378_10457761 | 3300013297 | Bacteria | 1267 |
| 349 | Ga0157378_11127564 | 3300013297 | Bacteria | 822 |
| 350 | Ga0157378_12280702 | 3300013297 | Bacteria | 593 |
| 351 | Ga0163162_10718957 | 3300013306 | Bacteria | 1119 |
| 352 | Ga0163162_12248743 | 3300013306 | Bacteria | 626 |
| 353 | Ga0163162_13305704 | 3300013306 | Bacteria | 516 |
| 354 | Ga0157372_10240295 | 3300013307 | Bacteria | 2101 |
| 355 | Ga0157372_10821700 | 3300013307 | Bacteria | 1079 |
| 356 | Ga0157372_11232324 | 3300013307 | Bacteria | 864 |
| 357 | Ga0157375_10402868 | 3300013308 | Bacteria | 1535 |
| 358 | Ga0157375_10913973 | 3300013308 | Bacteria | 1021 |
| 359 | Ga0163163_10483978 | 3300014325 | Bacteria | 1299 |
| 360 | Ga0163163_10532864 | 3300014325 | Bacteria | 1237 |
| 361 | Ga0163163_11209191 | 3300014325 | Bacteria | 818 |
| 362 | Ga0157380_12868886 | 3300014326 | Bacteria | 548 |
| 363 | Ga0157379_10603076 | 3300014968 | Bacteria | 1025 |
| 364 | Ga0157379_10921933 | 3300014968 | Bacteria | 830 |
| 365 | Ga0157376_10371391 | 3300014969 | Bacteria | 1375 |
| 366 | Ga0157376_10777036 | 3300014969 | Bacteria | 969 |
| 367 | Ga0163161_10066998 | 3300017792 | Bacteria | 2622 |
| 368 | Ga0163161_10407128 | 3300017792 | Bacteria | 1092 |
| 369 | Ga0163161_11164591 | 3300017792 | Bacteria | 665 |
| 370 | Ga0197907_10373094 | 3300020069 | Bacteria | 1701 |
| 371 | Ga0206356_11321139 | 3300020070 | Bacteria | 1371 |
| 372 | Ga0206353_10549197 | 3300020082 | Bacteria | 1464 |
| 373 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 374 | Ga0214544_1037611 | 3300021320 | Bacteria | 1185 |
| 375 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 376 | Ga0214542_1040708 | 3300021321 | Bacteria | 1183 |
| 377 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 378 | Ga0214545_1021801 | 3300021324 | Bacteria | 4682 |
| 379 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 380 | Ga0214543_1034552 | 3300021327 | Bacteria | 1721 |
| 381 | Ga0213875_10099466 | 3300021388 | Bacteria | 1357 |
| 382 | Ga0224712_10023785 | 3300022467 | Bacteria | 2131 |
| 383 | Ga0209563_104176 | 3300025230 | Bacteria | 2808 |
| 384 | Ga0209148_1000707 | 3300025254 | Bacteria | 26803 |
| 385 | Ga0209233_1004187 | 3300025261 | Bacteria | 4953 |
| 386 | Ga0209233_1013847 | 3300025261 | Bacteria | 2293 |
| 387 | Ga0209455_1001372 | 3300025272 | Bacteria | 11131 |
| 388 | Ga0209564_1004298 | 3300025295 | Bacteria | 8821 |
| 389 | Ga0209564_1014730 | 3300025295 | Bacteria | 3229 |
| 390 | Ga0209758_1000088 | 3300025297 | Bacteria | 251547 |
| 391 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 392 | Ga0209758_1002009 | 3300025297 | Bacteria | 21878 |
| 393 | Ga0209758_1002346 | 3300025297 | Bacteria | 19505 |
| 394 | Ga0209758_1004848 | 3300025297 | Bacteria | 10855 |
| 395 | Ga0209758_1005033 | 3300025297 | Bacteria | 10518 |
| 396 | Ga0209758_1005694 | 3300025297 | Bacteria | 9412 |
| 397 | Ga0209758_1005984 | 3300025297 | Bacteria | 9007 |
| 398 | Ga0209758_1065498 | 3300025297 | Bacteria | 1172 |
| 399 | Ga0209256_1003346 | 3300025299 | Bacteria | 11365 |
| 400 | Ga0209256_1030804 | 3300025299 | Bacteria | 1476 |
| 401 | Ga0207426_1000337 | 3300025302 | Bacteria | 88200 |
| 402 | Ga0207426_1002354 | 3300025302 | Bacteria | 12313 |
| 403 | Ga0207426_1007721 | 3300025302 | Bacteria | 4461 |
| 404 | Ga0207426_1009646 | 3300025302 | Bacteria | 3801 |
| 405 | Ga0209051_1042694 | 3300025303 | Bacteria | 1599 |
| 406 | Ga0209257_1000684 | 3300025304 | Bacteria | 52769 |
| 407 | Ga0209257_1009117 | 3300025304 | Bacteria | 5415 |
| 408 | Ga0209257_1046344 | 3300025304 | Bacteria | 1256 |
| 409 | Ga0207697_10026025 | 3300025315 | Bacteria | 2392 |
| 410 | Ga0207656_10060841 | 3300025321 | Bacteria | 1656 |
| 411 | Ga0207696_1102227 | 3300025711 | Bacteria | 780 |
| 412 | Ga0207682_10007221 | 3300025893 | Bacteria | 4442 |
| 413 | Ga0207642_10138451 | 3300025899 | Bacteria | 1280 |
| 414 | Ga0207710_10112002 | 3300025900 | Bacteria | 1297 |
| 415 | Ga0207710_10179041 | 3300025900 | Bacteria | 1039 |
| 416 | Ga0207688_10119257 | 3300025901 | Bacteria | 1538 |
| 417 | Ga0207680_10386371 | 3300025903 | Bacteria | 987 |
| 418 | Ga0207647_10011565 | 3300025904 | Bacteria | 6184 |
| 419 | Ga0207647_10052997 | 3300025904 | Bacteria | 2502 |
| 420 | Ga0207647_10226681 | 3300025904 | Bacteria | 1076 |
| 421 | Ga0207685_10269363 | 3300025905 | Bacteria | 831 |
| 422 | Ga0207699_10741159 | 3300025906 | Bacteria | 720 |
| 423 | Ga0207645_10121167 | 3300025907 | Bacteria | 1698 |
| 424 | Ga0207643_10106644 | 3300025908 | Bacteria | 1647 |
| 425 | Ga0207705_10061230 | 3300025909 | Bacteria | 2719 |
| 426 | Ga0207705_10346507 | 3300025909 | Bacteria | 1144 |
| 427 | Ga0207684_10289008 | 3300025910 | Bacteria | 1414 |
| 428 | Ga0207654_10408922 | 3300025911 | Bacteria | 945 |
| 429 | Ga0207654_10794375 | 3300025911 | Bacteria | 683 |
| 430 | Ga0207707_10002648 | 3300025912 | Bacteria | 15999 |
| 431 | Ga0207707_10140285 | 3300025912 | Bacteria | 2113 |
| 432 | Ga0207707_10249254 | 3300025912 | Bacteria | 1543 |
| 433 | Ga0207695_10000478 | 3300025913 | Bacteria | 86076 |
| 434 | Ga0207695_10387936 | 3300025913 | Bacteria | 1282 |
| 435 | Ga0207695_11366995 | 3300025913 | Bacteria | 588 |
| 436 | Ga0207671_10003206 | 3300025914 | Bacteria | 16477 |
| 437 | Ga0207671_10034599 | 3300025914 | Bacteria | 3753 |
| 438 | Ga0207671_10109212 | 3300025914 | Bacteria | 2103 |
| 439 | Ga0207671_10304159 | 3300025914 | Bacteria | 1260 |
| 440 | Ga0207671_10354156 | 3300025914 | Bacteria | 1164 |
| 441 | Ga0207671_11371331 | 3300025914 | Bacteria | 549 |
| 442 | Ga0207693_10039417 | 3300025915 | Bacteria | 3721 |
| 443 | Ga0207693_10065145 | 3300025915 | Bacteria | 2854 |
| 444 | Ga0207693_11048918 | 3300025915 | Bacteria | 621 |
| 445 | Ga0207663_10041428 | 3300025916 | Bacteria | 2807 |
| 446 | Ga0207663_10139368 | 3300025916 | Bacteria | 1687 |
| 447 | Ga0207663_10679740 | 3300025916 | Bacteria | 814 |
| 448 | Ga0207663_10794519 | 3300025916 | Bacteria | 753 |
| 449 | Ga0207660_10050359 | 3300025917 | Bacteria | 2957 |
| 450 | Ga0207660_10134958 | 3300025917 | Bacteria | 1882 |
| 451 | Ga0207662_10044943 | 3300025918 | Bacteria | 2609 |
| 452 | Ga0207657_10113299 | 3300025919 | Bacteria | 2238 |
| 453 | Ga0207657_10181252 | 3300025919 | Bacteria | 1702 |
| 454 | Ga0207649_10232413 | 3300025920 | Bacteria | 1319 |
| 455 | Ga0207652_10175065 | 3300025921 | Bacteria | 1927 |
| 456 | Ga0207681_10823460 | 3300025923 | Bacteria | 776 |
| 457 | Ga0207681_10877985 | 3300025923 | Bacteria | 751 |
| 458 | Ga0207694_10115714 | 3300025924 | Bacteria | 2137 |
| 459 | Ga0207694_10325138 | 3300025924 | Bacteria | 1270 |
| 460 | Ga0207694_10604681 | 3300025924 | Bacteria | 922 |
| 461 | Ga0207694_11146041 | 3300025924 | Bacteria | 658 |
| 462 | Ga0207650_11024041 | 3300025925 | Bacteria | 702 |
| 463 | Ga0207659_10724062 | 3300025926 | Bacteria | 852 |
| 464 | Ga0207687_11198091 | 3300025927 | Bacteria | 653 |
| 465 | Ga0207700_10954497 | 3300025928 | Unclassified | 767 |
| 466 | Ga0207644_10161659 | 3300025931 | Bacteria | 1741 |
| 467 | Ga0207644_10387053 | 3300025931 | Bacteria | 1141 |
| 468 | Ga0207690_10164092 | 3300025932 | Bacteria | 1658 |
| 469 | Ga0207690_10456869 | 3300025932 | Bacteria | 1027 |
| 470 | Ga0207690_11276392 | 3300025932 | Bacteria | 614 |
| 471 | Ga0207706_10399559 | 3300025933 | Bacteria | 1191 |
| 472 | Ga0207686_10409587 | 3300025934 | Bacteria | 1035 |
| 473 | Ga0207670_10889945 | 3300025936 | Bacteria | 745 |
| 474 | Ga0207670_11309239 | 3300025936 | Bacteria | 614 |
| 475 | Ga0207669_10047202 | 3300025937 | Bacteria | 2549 |
| 476 | Ga0207669_10904267 | 3300025937 | Bacteria | 737 |
| 477 | Ga0207704_10268052 | 3300025938 | Bacteria | 1291 |
| 478 | Ga0207704_10617941 | 3300025938 | Bacteria | 889 |
| 479 | Ga0207665_10355518 | 3300025939 | Bacteria | 1106 |
| 480 | Ga0207665_10682269 | 3300025939 | Bacteria | 807 |
| 481 | Ga0207665_11025669 | 3300025939 | Bacteria | 657 |
| 482 | Ga0207665_11678446 | 3300025939 | Bacteria | 503 |
| 483 | Ga0207691_10093307 | 3300025940 | Bacteria | 2696 |
| 484 | Ga0207691_10136939 | 3300025940 | Bacteria | 2159 |
| 485 | Ga0207691_10672961 | 3300025940 | Bacteria | 874 |
| 486 | Ga0207711_10042861 | 3300025941 | Bacteria | 3858 |
| 487 | Ga0207689_10507330 | 3300025942 | Bacteria | 1011 |
| 488 | Ga0207661_10088916 | 3300025944 | Bacteria | 2568 |
| 489 | Ga0207661_10512137 | 3300025944 | Bacteria | 1097 |
| 490 | Ga0207661_10644229 | 3300025944 | Bacteria | 974 |
| 491 | Ga0207679_10389319 | 3300025945 | Bacteria | 1224 |
| 492 | Ga0207679_11054894 | 3300025945 | Bacteria | 745 |
| 493 | Ga0207667_10031470 | 3300025949 | Bacteria | 5728 |
| 494 | Ga0207667_10058763 | 3300025949 | Bacteria | 4031 |
| 495 | Ga0207667_10429077 | 3300025949 | Bacteria | 1344 |
| 496 | Ga0207667_10594892 | 3300025949 | Bacteria | 1116 |
| 497 | Ga0207667_10840498 | 3300025949 | Bacteria | 913 |
| 498 | Ga0207667_10853575 | 3300025949 | Bacteria | 904 |
| 499 | Ga0207667_11310256 | 3300025949 | Bacteria | 700 |
| 500 | Ga0207651_10783317 | 3300025960 | Bacteria | 844 |
| 501 | Ga0207712_10267410 | 3300025961 | Bacteria | 1389 |
| 502 | Ga0207712_11171341 | 3300025961 | Bacteria | 685 |
| 503 | Ga0207668_10029496 | 3300025972 | Bacteria | 3596 |
| 504 | Ga0207668_10812227 | 3300025972 | Bacteria | 828 |
| 505 | Ga0207668_11441510 | 3300025972 | Bacteria | 621 |
| 506 | Ga0207640_10017622 | 3300025981 | Bacteria | 4183 |
| 507 | Ga0207640_10082467 | 3300025981 | Bacteria | 2202 |
| 508 | Ga0207640_10457375 | 3300025981 | Bacteria | 1053 |
| 509 | Ga0207640_10674880 | 3300025981 | Bacteria | 883 |
| 510 | Ga0207640_12136635 | 3300025981 | Bacteria | 508 |
| 511 | Ga0207658_10126154 | 3300025986 | Bacteria | 2049 |
| 512 | Ga0207658_10567023 | 3300025986 | Bacteria | 1017 |
| 513 | Ga0207658_11525757 | 3300025986 | Bacteria | 611 |
| 514 | Ga0207677_10289706 | 3300026023 | Bacteria | 1348 |
| 515 | Ga0207677_10383814 | 3300026023 | Bacteria | 1186 |
| 516 | Ga0207677_10435302 | 3300026023 | Bacteria | 1120 |
| 517 | Ga0207703_10261444 | 3300026035 | Bacteria | 1564 |
| 518 | Ga0207639_10074387 | 3300026041 | Bacteria | 2668 |
| 519 | Ga0207639_10163104 | 3300026041 | Bacteria | 1880 |
| 520 | Ga0207639_10249059 | 3300026041 | Bacteria | 1548 |
| 521 | Ga0207639_10932548 | 3300026041 | Bacteria | 812 |
| 522 | Ga0207639_11111372 | 3300026041 | Bacteria | 741 |
| 523 | Ga0207678_10018506 | 3300026067 | Bacteria | 6118 |
| 524 | Ga0207678_10062712 | 3300026067 | Bacteria | 3194 |
| 525 | Ga0207678_10087188 | 3300026067 | Bacteria | 2668 |
| 526 | Ga0207678_10484970 | 3300026067 | Bacteria | 1077 |
| 527 | Ga0207708_10038627 | 3300026075 | Bacteria | 3636 |
| 528 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 529 | Ga0207702_10064516 | 3300026078 | Bacteria | 3134 |
| 530 | Ga0207702_10108606 | 3300026078 | Bacteria | 2462 |
| 531 | Ga0207702_10386182 | 3300026078 | Bacteria | 1347 |
| 532 | Ga0207702_11207456 | 3300026078 | Bacteria | 750 |
| 533 | Ga0207641_10190665 | 3300026088 | Bacteria | 1884 |
| 534 | Ga0207641_10386112 | 3300026088 | Bacteria | 1342 |
| 535 | Ga0207641_10751478 | 3300026088 | Bacteria | 963 |
| 536 | Ga0207641_11437068 | 3300026088 | Bacteria | 691 |
| 537 | Ga0207648_10138524 | 3300026089 | Bacteria | 2144 |
| 538 | Ga0207648_10160389 | 3300026089 | Bacteria | 1986 |
| 539 | Ga0207648_10864554 | 3300026089 | Bacteria | 844 |
| 540 | Ga0207648_12277539 | 3300026089 | Bacteria | 502 |
| 541 | Ga0207676_10103153 | 3300026095 | Bacteria | 2369 |
| 542 | Ga0207676_10292136 | 3300026095 | Bacteria | 1485 |
| 543 | Ga0207676_11099073 | 3300026095 | Bacteria | 786 |
| 544 | Ga0207674_10040618 | 3300026116 | Bacteria | 4818 |
| 545 | Ga0207674_10048642 | 3300026116 | Bacteria | 4339 |
| 546 | Ga0207674_10118208 | 3300026116 | Bacteria | 2621 |
| 547 | Ga0207674_10199570 | 3300026116 | Bacteria | 1950 |
| 548 | Ga0207674_10200513 | 3300026116 | Bacteria | 1945 |
| 549 | Ga0207674_10221090 | 3300026116 | Bacteria | 1842 |
| 550 | Ga0207674_10285202 | 3300026116 | Bacteria | 1600 |
| 551 | Ga0207674_11288687 | 3300026116 | Unclassified | 700 |
| 552 | Ga0207675_100064150 | 3300026118 | Bacteria | 3433 |
| 553 | Ga0207675_100242617 | 3300026118 | Bacteria | 1741 |
| 554 | Ga0207675_100360379 | 3300026118 | Bacteria | 1426 |
| 555 | Ga0207675_100748389 | 3300026118 | Bacteria | 988 |
| 556 | Ga0207675_101736904 | 3300026118 | Bacteria | 644 |
| 557 | Ga0207683_10006624 | 3300026121 | Bacteria | 9911 |
| 558 | Ga0207698_10226550 | 3300026142 | Bacteria | 1694 |
| 559 | Ga0207698_10326911 | 3300026142 | Bacteria | 1439 |
| 560 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 561 | Ga0209389_1000027 | 3300027296 | Bacteria | 146917 |
| 562 | Ga0209589_1000031 | 3300027357 | Bacteria | 147054 |
| 563 | Ga0209489_100057 | 3300027361 | Bacteria | 147398 |
| 564 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 565 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 566 | Ga0209179_1006250 | 3300027512 | Bacteria | 1910 |
| 567 | Ga0209179_1053771 | 3300027512 | Bacteria | 867 |
| 568 | Ga0209179_1150651 | 3300027512 | Bacteria | 519 |
| 569 | Ga0209588_1013388 | 3300027671 | Bacteria | 2501 |
| 570 | Ga0209588_1017488 | 3300027671 | Bacteria | 2223 |
| 571 | Ga0209813_10007065 | 3300027866 | Bacteria | 2788 |
| 572 | Ga0207428_10378273 | 3300027907 | Bacteria | 1039 |
| 573 | Ga0268266_10042057 | 3300028379 | Bacteria | 3901 |
| 574 | Ga0268266_10065542 | 3300028379 | Bacteria | 3140 |
| 575 | Ga0268266_10624786 | 3300028379 | Bacteria | 1036 |
| 576 | Ga0268266_10934277 | 3300028379 | Bacteria | 839 |
| 577 | Ga0268265_10217616 | 3300028380 | Bacteria | 1669 |
| 578 | Ga0268265_10485201 | 3300028380 | Bacteria | 1162 |
| 579 | Ga0268265_10790384 | 3300028380 | Bacteria | 924 |
| 580 | Ga0268265_11322935 | 3300028380 | Bacteria | 721 |
| 581 | Ga0268264_10073031 | 3300028381 | Bacteria | 2910 |
| 582 | Ga0268264_11335280 | 3300028381 | Bacteria | 727 |
| 583 | Ga0307515_10524494 | 3300028794 | Bacteria | 794 |
| 584 | Ga0265330_10057547 | 3300031235 | Bacteria | 1695 |
| 585 | Ga0265330_10116263 | 3300031235 | Bacteria | 1140 |
| 586 | Ga0265330_10155745 | 3300031235 | Bacteria | 970 |
| 587 | Ga0265332_10015930 | 3300031238 | Bacteria | 3318 |
| 588 | Ga0265332_10068107 | 3300031238 | Bacteria | 1517 |
| 589 | Ga0265325_10002521 | 3300031241 | Bacteria | 12324 |
| 590 | Ga0265340_10011977 | 3300031247 | Bacteria | 4587 |
| 591 | Ga0265339_10031947 | 3300031249 | Bacteria | 2971 |
| 592 | Ga0265339_10207940 | 3300031249 | Bacteria | 963 |
| 593 | Ga0265331_10099252 | 3300031250 | Bacteria | 1341 |
| 594 | Ga0307513_10617626 | 3300031456 | Bacteria | 792 |
| 595 | Ga0307513_10813939 | 3300031456 | Bacteria | 640 |
| 596 | Ga0307408_100016075 | 3300031548 | Bacteria | 4990 |
| 597 | Ga0307508_10096491 | 3300031616 | Bacteria | 2548 |
| 598 | Ga0307508_10558890 | 3300031616 | Bacteria | 743 |
| 599 | Ga0265314_10151638 | 3300031711 | Bacteria | 1420 |
| 600 | Ga0265314_10252968 | 3300031711 | Bacteria | 1011 |
| 601 | Ga0265342_10006957 | 3300031712 | Bacteria | 8359 |
| 602 | Ga0265342_10120079 | 3300031712 | Bacteria | 1481 |
| 603 | Ga0265342_10250025 | 3300031712 | Bacteria | 946 |
| 604 | Ga0265342_10524670 | 3300031712 | Bacteria | 602 |
| 605 | Ga0307405_10815821 | 3300031731 | Bacteria | 783 |
| 606 | Ga0307405_11429139 | 3300031731 | Bacteria | 606 |
| 607 | Ga0307413_10177153 | 3300031824 | Bacteria | 1516 |
| 608 | Ga0307413_11448801 | 3300031824 | Bacteria | 605 |
| 609 | Ga0307407_10239427 | 3300031903 | Bacteria | 1237 |
| 610 | Ga0307412_10277039 | 3300031911 | Bacteria | 1315 |
| 611 | Ga0307416_101108066 | 3300032002 | Bacteria | 896 |
| 612 | Ga0307416_102290996 | 3300032002 | Bacteria | 641 |
| 613 | Ga0307411_10216058 | 3300032005 | Bacteria | 1484 |
| 614 | Ga0307510_10014233 | 3300033180 | Bacteria | 9419 |
| 615 | Ga0307510_10186963 | 3300033180 | Bacteria | 1625 |
| 616 | Ga0307510_10215149 | 3300033180 | Bacteria | 1439 |
| 617 | Ga0307510_10371714 | 3300033180 | Bacteria | 876 |
| 618 | Ga0373959_0025704 | 3300034820 | Bacteria | 1159 |
| 619 | Ga0373923_0027673 | 3300035111 | Bacteria | 2263 |
| 620 | Ga0373923_0029745 | 3300035111 | Bacteria | 2192 |
| 621 | Ga0373923_0188601 | 3300035111 | Bacteria | 949 |
| 622 | Ga0373936_0019234 | 3300035113 | Bacteria | 2646 |
| 623 | Ga0373936_0033299 | 3300035113 | Bacteria | 2042 |
| 624 | Ga0373936_0093376 | 3300035113 | Bacteria | 1263 |
| 625 | Ga0373939_0429153 | 3300035114 | Bacteria | 553 |
| 626 | Ga0373941_0452892 | 3300035115 | Unclassified | 539 |
| 627 | Ga0373945_0045919 | 3300035116 | Bacteria | 1592 |
| 628 | Ga0373953_0010951 | 3300035117 | Bacteria | 3169 |
| 629 | Ga0373953_0067760 | 3300035117 | Bacteria | 1468 |
| 630 | Ga0373954_0007579 | 3300035118 | Bacteria | 4751 |
| 631 | Ga0373954_0074160 | 3300035118 | Bacteria | 1619 |
| 632 | Ga0373954_0083207 | 3300035118 | Bacteria | 1531 |
| 633 | Ga0373956_0015887 | 3300035119 | Bacteria | 3157 |
| 634 | Ga0373956_0074826 | 3300035119 | Bacteria | 1548 |
| 635 | Ga0373957_0002603 | 3300035120 | Bacteria | 5178 |
| 636 | Ga0373957_0078627 | 3300035120 | Bacteria | 1299 |
| 637 | Ga0373943_0043483 | 3300035170 | Bacteria | 2182 |
| 638 | Ga0373943_0425743 | 3300035170 | Bacteria | 769 |
| 639 | Ga0373946_0002066 | 3300035171 | Bacteria | 7052 |
| 640 | Ga0373946_0021133 | 3300035171 | Bacteria | 2521 |
| 641 | Ga0373946_0034419 | 3300035171 | Unclassified | 2045 |
| 642 | Ga0373946_0336415 | 3300035171 | Bacteria | 752 |
| 643 | Ga0373955_0005384 | 3300035172 | Bacteria | 5748 |
| 644 | Ga0373955_0026687 | 3300035172 | Bacteria | 2978 |
| 645 | Ga0373955_0127771 | 3300035172 | Bacteria | 1482 |
| 646 | Ga0373955_0171001 | 3300035172 | Bacteria | 1286 |
| 647 | Ga0373955_0302418 | 3300035172 | Bacteria | 965 |
| 648 | Ga0373961_0404324 | 3300035241 | Unclassified | 525 |
| 649 | Ga0373924_0067023 | 3300035410 | Bacteria | 1509 |
| 650 | Ga0373935_0000354 | 3300035692 | Bacteria | 23386 |
| 651 | Ga0373935_0027114 | 3300035692 | Bacteria | 3541 |
| 652 | Ga0373935_0178952 | 3300035692 | Bacteria | 1455 |
| 653 | Ga0373935_0680437 | 3300035692 | Bacteria | 756 |
| 654 | Ga0373927_0004375 | 3300035695 | Bacteria | 9906 |
| 655 | Ga0373927_0154520 | 3300035695 | Bacteria | 1502 |
| 656 | Ga0373927_0215435 | 3300035695 | Bacteria | 1261 |
| 657 | Ga0373927_0249701 | 3300035695 | Bacteria | 1166 |
| 658 | Ga0373933_0010862 | 3300035724 | Bacteria | 4997 |
| 659 | Ga0373933_0024661 | 3300035724 | Bacteria | 3443 |
| 660 | Ga0373933_0373654 | 3300035724 | Bacteria | 928 |
| 661 | Ga0373933_0745430 | 3300035724 | Bacteria | 644 |
| 662 | Ga0373947_0003434 | 3300035725 | Bacteria | 9372 |
| 663 | Ga0373937_0071808 | 3300036401 | Bacteria | 3192 |
| 664 | Ga0373937_0318803 | 3300036401 | Bacteria | 1471 |
| 665 | Ga0373937_0434940 | 3300036401 | Bacteria | 1245 |
| 666 | Ga0373937_0949714 | 3300036401 | Bacteria | 808 |
| 667 | Ga0373925_0009064 | 3300037068 | Bacteria | 7242 |
| 668 | Ga0373925_0032743 | 3300037068 | Bacteria | 3827 |
| 669 | Ga0373925_0192937 | 3300037068 | Bacteria | 1617 |
| 670 | Ga0373925_0709685 | 3300037068 | Bacteria | 829 |
| 671 | Ga0395899_0179037 | 3300037312 | Bacteria | 1489 |
| 672 | Ga0395900_0037623 | 3300037418 | Bacteria | 4988 |
| 673 | Ga0395900_0699207 | 3300037418 | Bacteria | 947 |
| 674 | Ga0395900_0989418 | 3300037418 | Bacteria | 761 |
| 675 | Ga0395898_0015240 | 3300037466 | Bacteria | 7892 |
| 676 | Ga0395898_0099111 | 3300037466 | Bacteria | 2798 |
| 677 | Ga0395905_0033626 | 3300037471 | Bacteria | 4815 |
| 678 | Ga0395905_0343358 | 3300037471 | Bacteria | 1384 |
| 679 | Ga0395905_0595133 | 3300037471 | Bacteria | 1008 |
| 680 | Ga0395905_1015226 | 3300037471 | Bacteria | 733 |
| 681 | Ga0436364_0082096 | 3300037853 | Bacteria | 754 |
| 682 | Ga0436364_0211323 | 3300037853 | Bacteria | 2361 |
| 683 | Ga0436364_0252830 | 3300037853 | Bacteria | 934 |
| 684 | Ga0436364_0541162 | 3300037853 | Bacteria | 1438 |
| 685 | Ga0436364_0729467 | 3300037853 | Bacteria | 2056 |
| 686 | Ga0436364_0854930 | 3300037853 | Bacteria | 3093 |
| 687 | Ga0436364_1011261 | 3300037853 | Bacteria | 1231 |
| 688 | Ga0436364_1068178 | 3300037853 | Bacteria | 1568 |
| 689 | Ga0395901_0037234 | 3300038443 | Bacteria | 5032 |
| 690 | Ga0395901_0074312 | 3300038443 | Bacteria | 3546 |
| 691 | Ga0395901_0550278 | 3300038443 | Bacteria | 1169 |
| 692 | Ga0395901_1455676 | 3300038443 | Bacteria | 642 |
| 693 | Ga0436365_0056450 | 3300039437 | Unclassified | 677 |
| 694 | Ga0436365_0258439 | 3300039437 | Bacteria | 1608 |
| 695 | Ga0436365_0620989 | 3300039437 | Bacteria | 1857 |
| 696 | Ga0436361_0261667 | 3300039447 | Bacteria | 943 |
| 697 | Ga0436361_0374357 | 3300039447 | Bacteria | 552 |
| 698 | Ga0436363_0374194 | 3300039450 | Bacteria | 2896 |
| 699 | Ga0436363_1204188 | 3300039450 | Bacteria | 4442 |
| 700 | Ga0436363_1278762 | 3300039450 | Bacteria | 1572 |
| 701 | Ga0436363_1391982 | 3300039450 | Bacteria | 766 |
| 702 | Ga0439453_0001001 | 3300041408 | Bacteria | 3447 |
| 703 | Ga0451789_0651678 | 3300041443 | Bacteria | 754 |
| 704 | Ga0439441_012115 | 3300042001 | Bacteria | 1475 |
| 705 | Ga0439443_036147 | 3300042003 | Bacteria | 830 |
| 706 | Ga0439432_131068 | 3300042006 | Bacteria | 740 |
| 707 | Ga0439434_0120306 | 3300042435 | Bacteria | 856 |
| 708 | Ga0439435_0107580 | 3300042436 | Bacteria | 862 |
| 709 | Ga0439435_0151183 | 3300042436 | Bacteria | 745 |
| 710 | Ga0439459_0069202 | 3300042438 | Bacteria | 813 |
| 711 | Ga0439460_0008111 | 3300042461 | Bacteria | 2648 |
| 712 | Ga0466969_0106171 | 3300044656 | Bacteria | 1318 |
| 713 | Ga0466972_0009680 | 3300044658 | Bacteria | 4836 |
| 714 | Ga0466965_0085702 | 3300044683 | Bacteria | 1597 |
| 715 | Ga0466966_0001941 | 3300044684 | Bacteria | 13395 |
| 716 | Ga0466966_0019524 | 3300044684 | Bacteria | 4459 |
| 717 | Ga0466961_0000136 | 3300044693 | Bacteria | 49049 |
| 718 | Ga0466963_0134279 | 3300044694 | Bacteria | 1711 |
| 719 | Ga0466963_0718024 | 3300044694 | Bacteria | 705 |
| 720 | Ga0466971_0078700 | 3300044719 | Bacteria | 1502 |
| 721 | Ga0466968_0187516 | 3300044735 | Bacteria | 964 |
| 722 | Ga0466968_0204030 | 3300044735 | Bacteria | 927 |
| 723 | Ga0466968_0450894 | 3300044735 | Bacteria | 636 |
| 724 | Ga0466970_0089373 | 3300044765 | Bacteria | 1671 |
| 725 | Ga0466957_0217646 | 3300044842 | Bacteria | 1260 |
| 726 | Ga0466960_0058091 | 3300044901 | Bacteria | 1888 |
| 727 | Ga0466959_0011393 | 3300045049 | Bacteria | 6388 |
| 728 | Ga0466959_0018900 | 3300045049 | Bacteria | 5063 |
| 729 | Ga0466959_0325495 | 3300045049 | Bacteria | 1050 |
| 730 | Ga0466959_1019042 | 3300045049 | Bacteria | 551 |
| 731 | Ga0466958_0078895 | 3300045836 | Bacteria | 2024 |
| 732 | Ga0466967_0167506 | 3300045976 | Bacteria | 2065 |
| 733 | Ga0466967_0285436 | 3300045976 | Bacteria | 1584 |
| 734 | Ga0466967_0521371 | 3300045976 | Bacteria | 1168 |
| 735 | Ga0466967_1390278 | 3300045976 | Bacteria | 699 |
| 736 | Ga0495592_0062845 | 3300046454 | Bacteria | 2724 |
| 737 | Ga0495592_0648223 | 3300046454 | Bacteria | 640 |
| 738 | Ga0495603_0002779 | 3300046455 | Bacteria | 10318 |
| 739 | Ga0495603_0549721 | 3300046455 | Bacteria | 661 |
| 740 | Ga0495603_0557422 | 3300046455 | Bacteria | 656 |
| 741 | Ga0495629_0000416 | 3300046459 | Bacteria | 35794 |
| 742 | Ga0495629_0016818 | 3300046459 | Bacteria | 5249 |
| 743 | Ga0495629_0033833 | 3300046459 | Bacteria | 3614 |
| 744 | Ga0495629_0096054 | 3300046459 | Bacteria | 2067 |
| 745 | Ga0495629_0152827 | 3300046459 | Bacteria | 1604 |
| 746 | Ga0495629_0456542 | 3300046459 | Bacteria | 865 |
| 747 | Ga0495638_0016852 | 3300046460 | Bacteria | 4886 |
| 748 | Ga0495638_0064183 | 3300046460 | Bacteria | 2262 |
| 749 | Ga0495638_0310851 | 3300046460 | Bacteria | 846 |
| 750 | Ga0495641_0008565 | 3300046461 | Bacteria | 6206 |
| 751 | Ga0495651_0002380 | 3300046462 | Bacteria | 14527 |
| 752 | Ga0495651_0269265 | 3300046462 | Bacteria | 1155 |
| 753 | Ga0495653_0098531 | 3300046463 | Bacteria | 2122 |
| 754 | Ga0495653_0180145 | 3300046463 | Bacteria | 1451 |
| 755 | Ga0495650_0057495 | 3300046471 | Bacteria | 1574 |
| 756 | Ga0495580_0004213 | 3300046472 | Bacteria | 12094 |
| 757 | Ga0495582_0000497 | 3300046473 | Bacteria | 21510 |
| 758 | Ga0495605_0024252 | 3300046474 | Bacteria | 3177 |
| 759 | Ga0495605_0044520 | 3300046474 | Bacteria | 2194 |
| 760 | Ga0495605_0076334 | 3300046474 | Bacteria | 1574 |
| 761 | Ga0495639_0000087 | 3300046475 | Bacteria | 44546 |
| 762 | Ga0495662_0000367 | 3300046476 | Bacteria | 19860 |
| 763 | Ga0495662_0048456 | 3300046476 | Bacteria | 2051 |
| 764 | Ga0495662_0113884 | 3300046476 | Bacteria | 1326 |
| 765 | Ga0495664_0010747 | 3300046477 | Bacteria | 5146 |
| 766 | Ga0495585_0164234 | 3300046492 | Bacteria | 1151 |
| 767 | Ga0495585_0466482 | 3300046492 | Bacteria | 603 |
| 768 | Ga0495594_0000194 | 3300046499 | Bacteria | 29650 |
| 769 | Ga0495607_0088400 | 3300046501 | Bacteria | 1684 |
| 770 | Ga0495583_0020666 | 3300046506 | Bacteria | 3403 |
| 771 | Ga0495583_0114690 | 3300046506 | Bacteria | 1139 |
| 772 | Ga0495583_0204801 | 3300046506 | Bacteria | 801 |
| 773 | Ga0495606_0001686 | 3300046507 | Bacteria | 28531 |
| 774 | Ga0495606_0012396 | 3300046507 | Bacteria | 6839 |
| 775 | Ga0495608_0031497 | 3300046511 | Bacteria | 3586 |
| 776 | Ga0495608_0083854 | 3300046511 | Bacteria | 2068 |
| 777 | Ga0495608_0163701 | 3300046511 | Bacteria | 1413 |
| 778 | Ga0495608_0342143 | 3300046511 | Bacteria | 921 |
| 779 | Ga0495610_0084953 | 3300046512 | Bacteria | 1445 |
| 780 | Ga0495616_0167354 | 3300046513 | Bacteria | 985 |
| 781 | Ga0495616_0359938 | 3300046513 | Bacteria | 604 |
| 782 | Ga0495618_0180936 | 3300046514 | Bacteria | 1339 |
| 783 | Ga0495618_0489658 | 3300046514 | Bacteria | 742 |
| 784 | Ga0495620_0055003 | 3300046515 | Bacteria | 1679 |
| 785 | Ga0495620_0055233 | 3300046515 | Bacteria | 1674 |
| 786 | Ga0495628_0043501 | 3300046516 | Bacteria | 3577 |
| 787 | Ga0495628_0053601 | 3300046516 | Bacteria | 3182 |
| 788 | Ga0495628_0220286 | 3300046516 | Bacteria | 1425 |
| 789 | Ga0495628_0750522 | 3300046516 | Bacteria | 686 |
| 790 | Ga0495630_0003691 | 3300046517 | Bacteria | 10674 |
| 791 | Ga0495630_0104051 | 3300046517 | Unclassified | 2148 |
| 792 | Ga0495631_0364261 | 3300046518 | Bacteria | 615 |
| 793 | Ga0495631_0479187 | 3300046518 | Bacteria | 530 |
| 794 | Ga0495632_0237341 | 3300046519 | Bacteria | 821 |
| 795 | Ga0495632_0420318 | 3300046519 | Bacteria | 582 |
| 796 | Ga0495637_0048898 | 3300046520 | Bacteria | 1779 |
| 797 | Ga0495643_0010042 | 3300046522 | Bacteria | 5839 |
| 798 | Ga0495643_0053044 | 3300046522 | Bacteria | 2175 |
| 799 | Ga0495643_0436995 | 3300046522 | Bacteria | 572 |
| 800 | Ga0495648_0004620 | 3300046524 | Bacteria | 11709 |
| 801 | Ga0495648_0049275 | 3300046524 | Bacteria | 2584 |
| 802 | Ga0495648_0057380 | 3300046524 | Bacteria | 2336 |
| 803 | Ga0495648_0434609 | 3300046524 | Bacteria | 578 |
| 804 | Ga0495648_0446885 | 3300046524 | Bacteria | 566 |
| 805 | Ga0495663_0100245 | 3300046525 | Bacteria | 953 |
| 806 | Ga0495666_0250781 | 3300046526 | Bacteria | 806 |
| 807 | Ga0495666_0387388 | 3300046526 | Bacteria | 629 |
| 808 | Ga0495652_0004532 | 3300046529 | Bacteria | 13256 |
| 809 | Ga0495652_0037315 | 3300046529 | Bacteria | 4216 |
| 810 | Ga0495652_0043038 | 3300046529 | Bacteria | 3892 |
| 811 | Ga0495652_0087578 | 3300046529 | Bacteria | 2554 |
| 812 | Ga0495652_0116213 | 3300046529 | Bacteria | 2142 |
| 813 | Ga0495652_0646890 | 3300046529 | Bacteria | 716 |
| 814 | Ga0495654_0138044 | 3300046530 | Bacteria | 1089 |
| 815 | Ga0495654_0170372 | 3300046530 | Bacteria | 949 |
| 816 | Ga0495665_0003980 | 3300046531 | Bacteria | 7973 |
| 817 | Ga0495665_0219626 | 3300046531 | Bacteria | 983 |
| 818 | Ga0495640_0014526 | 3300046533 | Bacteria | 5952 |
| 819 | Ga0495640_0019303 | 3300046533 | Bacteria | 5035 |
| 820 | Ga0495640_0033520 | 3300046533 | Bacteria | 3647 |
| 821 | Ga0495640_0262611 | 3300046533 | Bacteria | 1078 |
| 822 | Ga0495640_0380468 | 3300046533 | Bacteria | 868 |
| 823 | Ga0495586_0099642 | 3300046535 | Unclassified | 1612 |
| 824 | Ga0495587_0011034 | 3300046536 | Bacteria | 5730 |
| 825 | Ga0495587_0026501 | 3300046536 | Bacteria | 3534 |
| 826 | Ga0495587_0133453 | 3300046536 | Bacteria | 1419 |
| 827 | Ga0495598_0323464 | 3300046537 | Bacteria | 588 |
| 828 | Ga0495609_0061619 | 3300046538 | Bacteria | 1657 |
| 829 | Ga0495645_0005471 | 3300046543 | Bacteria | 8723 |
| 830 | Ga0495645_0061773 | 3300046543 | Bacteria | 2714 |
| 831 | Ga0495622_0018728 | 3300046557 | Bacteria | 3224 |
| 832 | Ga0495622_0034440 | 3300046557 | Bacteria | 2362 |
| 833 | Ga0495622_0083079 | 3300046557 | Bacteria | 1473 |
| 834 | Ga0495622_0123645 | 3300046557 | Bacteria | 1181 |
| 835 | Ga0495667_0036362 | 3300046559 | Bacteria | 3287 |
| 836 | Ga0495667_0037776 | 3300046559 | Bacteria | 3217 |
| 837 | Ga0495667_0101512 | 3300046559 | Bacteria | 1861 |
| 838 | Ga0495667_0270918 | 3300046559 | Bacteria | 1079 |
| 839 | Ga0495656_0170379 | 3300046615 | Bacteria | 1064 |
| 840 | Ga0495668_0071584 | 3300046616 | Bacteria | 1905 |
| 841 | Ga0495668_0126299 | 3300046616 | Bacteria | 1400 |
| 842 | Ga0495634_0000602 | 3300046642 | Bacteria | 34812 |
| 843 | Ga0495634_0017152 | 3300046642 | Bacteria | 5171 |
| 844 | Ga0495634_0020925 | 3300046642 | Bacteria | 4633 |
| 845 | Ga0495634_0033514 | 3300046642 | Bacteria | 3529 |
| 846 | Ga0495634_0035236 | 3300046642 | Bacteria | 3429 |
| 847 | Ga0495634_0049299 | 3300046642 | Bacteria | 2832 |
| 848 | Ga0495634_0151463 | 3300046642 | Bacteria | 1467 |
| 849 | Ga0495634_0233360 | 3300046642 | Unclassified | 1131 |
| 850 | Ga0495611_0050541 | 3300046648 | Bacteria | 1873 |
| 851 | Ga0495611_0552127 | 3300046648 | Bacteria | 522 |
| 852 | Ga0495625_0025297 | 3300046660 | Bacteria | 4503 |
| 853 | Ga0495625_0152047 | 3300046660 | Bacteria | 1555 |
| 854 | Ga0495625_0173816 | 3300046660 | Bacteria | 1436 |
| 855 | Ga0495635_0012357 | 3300046663 | Bacteria | 5984 |
| 856 | Ga0495635_0022635 | 3300046663 | Bacteria | 4379 |
| 857 | Ga0495635_0098604 | 3300046663 | Bacteria | 1997 |
| 858 | Ga0495635_0153569 | 3300046663 | Bacteria | 1567 |
| 859 | Ga0495661_0078710 | 3300046665 | Bacteria | 1906 |
| 860 | Ga0495661_0250310 | 3300046665 | Bacteria | 905 |
| 861 | Ga0495588_0005519 | 3300046674 | Bacteria | 5632 |
| 862 | Ga0495588_0492009 | 3300046674 | Bacteria | 643 |
| 863 | Ga0495657_0006838 | 3300046675 | Bacteria | 8876 |
| 864 | Ga0495657_0013190 | 3300046675 | Bacteria | 6105 |
| 865 | Ga0495657_0021986 | 3300046675 | Bacteria | 4572 |
| 866 | Ga0495599_0003392 | 3300046678 | Bacteria | 9321 |
| 867 | Ga0495599_0014177 | 3300046678 | Bacteria | 4935 |
| 868 | Ga0495599_0031175 | 3300046678 | Bacteria | 3346 |
| 869 | Ga0495599_0081377 | 3300046678 | Bacteria | 2023 |
| 870 | Ga0495623_0005381 | 3300046679 | Bacteria | 8379 |
| 871 | Ga0495623_0024198 | 3300046679 | Bacteria | 3916 |
| 872 | Ga0495646_0034243 | 3300046680 | Bacteria | 3155 |
| 873 | Ga0495646_0102487 | 3300046680 | Bacteria | 1639 |
| 874 | Ga0495646_0294721 | 3300046680 | Bacteria | 859 |
| 875 | Ga0495646_0398330 | 3300046680 | Bacteria | 716 |
| 876 | Ga0495647_0000694 | 3300046681 | Bacteria | 10013 |
| 877 | Ga0495658_0000593 | 3300046683 | Bacteria | 19832 |
| 878 | Ga0495669_0036595 | 3300046684 | Bacteria | 2170 |
| 879 | Ga0495613_0020037 | 3300046689 | Bacteria | 4984 |
| 880 | Ga0495613_0051126 | 3300046689 | Bacteria | 3046 |
| 881 | Ga0495613_0179629 | 3300046689 | Bacteria | 1499 |
| 882 | Ga0495613_0957963 | 3300046689 | Bacteria | 551 |
| 883 | Ga0495624_0004068 | 3300046690 | Bacteria | 10762 |
| 884 | Ga0495624_0392726 | 3300046690 | Bacteria | 833 |
| 885 | Ga0495670_0026322 | 3300046691 | Bacteria | 2879 |
| 886 | Ga0495671_0035145 | 3300046692 | Bacteria | 2546 |
| 887 | Ga0495671_0345388 | 3300046692 | Bacteria | 714 |
| 888 | Ga0495649_0012812 | 3300046694 | Bacteria | 4862 |
| 889 | Ga0495600_0017947 | 3300046809 | Bacteria | 4504 |
| 890 | Ga0495600_0102634 | 3300046809 | Bacteria | 1864 |
| 891 | Ga0495660_0151860 | 3300046810 | Bacteria | 1143 |
| 892 | Ga0495581_0000133 | 3300047315 | Bacteria | 32384 |
| 893 | Ga0495604_0011413 | 3300047317 | Bacteria | 7051 |
| 894 | Ga0495604_0021586 | 3300047317 | Bacteria | 5140 |
| 895 | Ga0495604_0042818 | 3300047317 | Bacteria | 3546 |
| 896 | Ga0495604_0187671 | 3300047317 | Bacteria | 1442 |
| 897 | Ga0495636_0193810 | 3300047318 | Bacteria | 926 |
| 898 | Ga0495674_0000874 | 3300047319 | Bacteria | 28828 |
| 899 | Ga0495674_0027148 | 3300047319 | Bacteria | 5235 |
| 900 | Ga0495674_0055959 | 3300047319 | Bacteria | 3457 |
| 901 | Ga0495674_0065377 | 3300047319 | Bacteria | 3159 |
| 902 | Ga0495674_1340353 | 3300047319 | Bacteria | 535 |
| 903 | Ga0495672_0021766 | 3300047320 | Bacteria | 4176 |
| 904 | Ga0495672_0263461 | 3300047320 | Bacteria | 831 |
| 905 | Ga0495676_0192779 | 3300047321 | Bacteria | 1421 |
| 906 | Ga0495680_0015402 | 3300047322 | Bacteria | 6598 |
| 907 | Ga0495680_0075333 | 3300047322 | Bacteria | 2560 |
| 908 | Ga0495680_0125751 | 3300047322 | Bacteria | 1888 |
| 909 | Ga0495683_0073082 | 3300047323 | Bacteria | 1682 |
| 910 | Ga0495687_019104 | 3300047443 | Bacteria | 3370 |
| 911 | Ga0495675_0045534 | 3300047444 | Bacteria | 2793 |
| 912 | Ga0495675_0148431 | 3300047444 | Bacteria | 1449 |
| 913 | Ga0495677_0234833 | 3300047445 | Bacteria | 716 |
| 914 | Ga0495673_0064070 | 3300047469 | Bacteria | 1565 |
| 915 | Ga0495681_0225750 | 3300047470 | Bacteria | 749 |
| 916 | Ga0495684_0046162 | 3300047471 | Bacteria | 3333 |
| 917 | Ga0495684_0048321 | 3300047471 | Bacteria | 3254 |
| 918 | Ga0495684_0124268 | 3300047471 | Bacteria | 1942 |
| 919 | Ga0495686_0018634 | 3300047472 | Bacteria | 4652 |
| 920 | Ga0495686_0035947 | 3300047472 | Bacteria | 3181 |
| 921 | Ga0495686_0084022 | 3300047472 | Bacteria | 1941 |
| 922 | Ga0495686_0284314 | 3300047472 | Bacteria | 918 |
| 923 | Ga0495593_0000022 | 3300047673 | Bacteria | 69741 |
| 924 | Ga0495593_0029769 | 3300047673 | Bacteria | 2991 |
| 925 | Ga0495593_0400060 | 3300047673 | Bacteria | 687 |
| 926 | Ga0495602_0009068 | 3300048088 | Bacteria | 10356 |
| 927 | Ga0495602_0102994 | 3300048088 | Bacteria | 2337 |
| 928 | Ga0495614_0071559 | 3300048089 | Bacteria | 1495 |
| 929 | Ga0495615_0019230 | 3300048090 | Bacteria | 1514 |
| 930 | Ga0495626_0113523 | 3300048091 | Bacteria | 1171 |
| 931 | Ga0496100_0286625 | 3300048903 | Bacteria | 1229 |
| 932 | Ga0496100_0331639 | 3300048903 | Bacteria | 1145 |
| 933 | Ga0496100_0766693 | 3300048903 | Bacteria | 755 |
| 934 | Ga0496100_1190044 | 3300048903 | Bacteria | 601 |
| 935 | Ga0496100_1408556 | 3300048903 | Bacteria | 550 |
| 936 | Ga0496101_0106229 | 3300048904 | Bacteria | 2108 |
| 937 | Ga0496101_0232606 | 3300048904 | Bacteria | 1433 |
| 938 | Ga0496101_0445125 | 3300048904 | Bacteria | 1022 |
| 939 | Ga0496102_0283823 | 3300048905 | Bacteria | 1560 |
| 940 | Ga0496102_0393081 | 3300048905 | Bacteria | 1304 |
| 941 | Ga0496102_1297998 | 3300048905 | Bacteria | 647 |
| 942 | Ga0496102_1518183 | 3300048905 | Bacteria | 588 |
| 943 | Ga0496103_0022617 | 3300048906 | Bacteria | 3785 |
| 944 | Ga0496103_0213094 | 3300048906 | Bacteria | 1242 |
| 945 | Ga0496103_0427946 | 3300048906 | Bacteria | 850 |
| 946 | Ga0496104_0002244 | 3300048907 | Bacteria | 16671 |
| 947 | Ga0496104_0045777 | 3300048907 | Bacteria | 4117 |
| 948 | Ga0496104_0055621 | 3300048907 | Bacteria | 3742 |
| 949 | Ga0496104_0076254 | 3300048907 | Bacteria | 3193 |
| 950 | Ga0496104_0099583 | 3300048907 | Bacteria | 2782 |
| 951 | Ga0496104_0249088 | 3300048907 | Bacteria | 1689 |
| 952 | Ga0496105_0007267 | 3300048908 | Bacteria | 8556 |
| 953 | Ga0496105_0136808 | 3300048908 | Bacteria | 2018 |
| 954 | Ga0496105_0160170 | 3300048908 | Bacteria | 1848 |
| 955 | Ga0496106_0027096 | 3300048909 | Bacteria | 4268 |
| 956 | Ga0496106_0257893 | 3300048909 | Bacteria | 1395 |
| 957 | Ga0496106_0664018 | 3300048909 | Bacteria | 832 |
| 958 | Ga0496106_0768700 | 3300048909 | Bacteria | 765 |
| 959 | Ga0496107_0359152 | 3300048910 | Bacteria | 1084 |
| 960 | Ga0496108_0140952 | 3300048911 | Bacteria | 2077 |
| 961 | Ga0496108_0389500 | 3300048911 | Bacteria | 1217 |
| 962 | Ga0496108_0467497 | 3300048911 | Bacteria | 1102 |
| 963 | Ga0496109_0053854 | 3300048912 | Bacteria | 3671 |
| 964 | Ga0496109_0570835 | 3300048912 | Bacteria | 1066 |
| 965 | Ga0496109_0633372 | 3300048912 | Bacteria | 1006 |
| 966 | Ga0496109_0981334 | 3300048912 | Bacteria | 782 |
| 967 | Ga0496110_0130851 | 3300048913 | Bacteria | 2266 |
| 968 | Ga0496110_0259592 | 3300048913 | Bacteria | 1581 |
| 969 | Ga0496110_0292748 | 3300048913 | Bacteria | 1483 |
| 970 | Ga0496110_0637285 | 3300048913 | Bacteria | 965 |
| 971 | Ga0496110_1769793 | 3300048913 | Bacteria | 528 |
| 972 | Ga0496111_0050207 | 3300048914 | Bacteria | 3008 |
| 973 | Ga0496111_0232978 | 3300048914 | Bacteria | 1367 |
| 974 | Ga0496111_0298459 | 3300048914 | Bacteria | 1194 |
| 975 | Ga0496111_0391557 | 3300048914 | Bacteria | 1027 |
| 976 | Ga0496112_0002344 | 3300048915 | Bacteria | 15200 |
| 977 | Ga0496112_0060696 | 3300048915 | Bacteria | 3726 |
| 978 | Ga0496112_0131959 | 3300048915 | Bacteria | 2469 |
| 979 | Ga0496112_0171026 | 3300048915 | Bacteria | 2138 |
| 980 | Ga0496112_0206095 | 3300048915 | Bacteria | 1924 |
| 981 | Ga0496112_0656110 | 3300048915 | Bacteria | 979 |
| 982 | Ga0496113_0049219 | 3300048916 | Bacteria | 3138 |
| 983 | Ga0496113_0204693 | 3300048916 | Bacteria | 1569 |
| 984 | Ga0496113_0255541 | 3300048916 | Bacteria | 1399 |
| 985 | Ga0496114_1429327 | 3300048917 | Bacteria | 579 |
| 986 | Ga0496115_0288740 | 3300048918 | Bacteria | 1346 |
| 987 | Ga0496115_0616255 | 3300048918 | Bacteria | 861 |
| 988 | Ga0496115_0888194 | 3300048918 | Bacteria | 688 |
| 989 | Ga0496116_0001996 | 3300048919 | Bacteria | 21971 |
| 990 | Ga0496117_0012572 | 3300048920 | Bacteria | 7446 |
| 991 | Ga0496117_0144891 | 3300048920 | Bacteria | 1416 |
| 992 | Ga0496117_0155681 | 3300048920 | Bacteria | 1345 |
| 993 | Ga0496117_0373466 | 3300048920 | Bacteria | 728 |
| 994 | Ga0496117_0538572 | 3300048920 | Bacteria | 558 |
| 995 | Ga0496117_0570240 | 3300048920 | Bacteria | 535 |
| 996 | Ga0496118_0057853 | 3300048921 | Bacteria | 2902 |
| 997 | Ga0496118_0073518 | 3300048921 | Bacteria | 2449 |
| 998 | Ga0496118_0152839 | 3300048921 | Bacteria | 1442 |
| 999 | Ga0496118_0205010 | 3300048921 | Bacteria | 1163 |
| 1000 | Ga0496118_0236222 | 3300048921 | Bacteria | 1050 |
| 1001 | Ga0496118_0281871 | 3300048921 | Bacteria | 924 |
| 1002 | Ga0496118_0361341 | 3300048921 | Bacteria | 769 |
| 1003 | Ga0496118_0394337 | 3300048921 | Bacteria | 721 |
| 1004 | Ga0496118_0526033 | 3300048921 | Bacteria | 582 |
| 1005 | Ga0496118_0570689 | 3300048921 | Bacteria | 547 |
| 1006 | Ga0496119_0047398 | 3300048922 | Bacteria | 2674 |
| 1007 | Ga0496119_0055143 | 3300048922 | Bacteria | 2415 |
| 1008 | Ga0496119_0067292 | 3300048922 | Bacteria | 2113 |
| 1009 | Ga0496119_0176859 | 3300048922 | Bacteria | 1122 |
| 1010 | Ga0496119_0518252 | 3300048922 | Bacteria | 552 |
| 1011 | Ga0496120_0047735 | 3300048923 | Bacteria | 2467 |
| 1012 | Ga0496120_0160902 | 3300048923 | Bacteria | 1119 |
| 1013 | Ga0496120_0170290 | 3300048923 | Bacteria | 1078 |
| 1014 | Ga0496120_0203725 | 3300048923 | Bacteria | 956 |
| 1015 | Ga0496120_0298681 | 3300048923 | Bacteria | 738 |
| 1016 | Ga0496121_0001525 | 3300048924 | Bacteria | 38839 |
| 1017 | Ga0496121_0024780 | 3300048924 | Bacteria | 5722 |
| 1018 | Ga0496121_0046275 | 3300048924 | Bacteria | 3726 |
| 1019 | Ga0496121_0073632 | 3300048924 | Bacteria | 2736 |
| 1020 | Ga0496121_0082049 | 3300048924 | Bacteria | 2550 |
| 1021 | Ga0496121_0147457 | 3300048924 | Bacteria | 1736 |
| 1022 | Ga0496121_0466128 | 3300048924 | Bacteria | 810 |
| 1023 | Ga0496122_0019339 | 3300048925 | Bacteria | 6225 |
| 1024 | Ga0496123_0122239 | 3300048926 | Bacteria | 1461 |
| 1025 | Ga0496125_0005069 | 3300048928 | Bacteria | 14847 |
| 1026 | Ga0496125_0006742 | 3300048928 | Bacteria | 12341 |
| 1027 | Ga0496125_0052831 | 3300048928 | Bacteria | 3338 |
| 1028 | Ga0496125_0062155 | 3300048928 | Bacteria | 2989 |
| 1029 | Ga0496125_0123131 | 3300048928 | Bacteria | 1844 |
| 1030 | Ga0496125_0185417 | 3300048928 | Bacteria | 1381 |
| 1031 | Ga0496126_0047835 | 3300048929 | Bacteria | 3914 |
| 1032 | Ga0496126_0048584 | 3300048929 | Bacteria | 3876 |
| 1033 | Ga0496126_0048723 | 3300048929 | Bacteria | 3870 |
| 1034 | Ga0496126_0049241 | 3300048929 | Bacteria | 3847 |
| 1035 | Ga0496126_0057330 | 3300048929 | Bacteria | 3517 |
| 1036 | Ga0496126_0123849 | 3300048929 | Bacteria | 2239 |
| 1037 | Ga0496126_0175444 | 3300048929 | Bacteria | 1823 |
| 1038 | Ga0496126_0181549 | 3300048929 | Bacteria | 1787 |
| 1039 | Ga0496126_0221075 | 3300048929 | Bacteria | 1591 |
| 1040 | Ga0496126_0228930 | 3300048929 | Bacteria | 1558 |
| 1041 | Ga0496126_0239831 | 3300048929 | Bacteria | 1515 |
| 1042 | Ga0496126_0269900 | 3300048929 | Bacteria | 1412 |
| 1043 | Ga0496126_0285276 | 3300048929 | Bacteria | 1367 |
| 1044 | Ga0496126_0401272 | 3300048929 | Bacteria | 1112 |
| 1045 | Ga0496126_0448340 | 3300048929 | Bacteria | 1039 |
| 1046 | Ga0496126_0903775 | 3300048929 | Bacteria | 669 |
| 1047 | Ga0496126_1010394 | 3300048929 | Bacteria | 623 |
| 1048 | Ga0495682_0005291 | 3300049460 | Bacteria | 5384 |
| 1049 | Ga0501031_0006238 | 3300049568 | Bacteria | 7772 |
| 1050 | Ga0501031_0180667 | 3300049568 | Bacteria | 1378 |
| 1051 | Ga0501031_0219289 | 3300049568 | Bacteria | 1239 |
| 1052 | Ga0501032_0000196 | 3300049569 | Bacteria | 50261 |
| 1053 | Ga0501032_0194489 | 3300049569 | Bacteria | 1325 |
| 1054 | Ga0501032_0215503 | 3300049569 | Bacteria | 1250 |
| 1055 | Ga0501033_0003550 | 3300049570 | Bacteria | 12758 |
| 1056 | Ga0501033_0014112 | 3300049570 | Bacteria | 6074 |
| 1057 | Ga0501033_0019071 | 3300049570 | Bacteria | 5186 |
| 1058 | Ga0501033_0019990 | 3300049570 | Bacteria | 5061 |
| 1059 | Ga0501034_0000157 | 3300049571 | Bacteria | 128661 |
| 1060 | Ga0501034_0078872 | 3300049571 | Bacteria | 3296 |
| 1061 | Ga0501034_0120911 | 3300049571 | Bacteria | 2605 |
| 1062 | Ga0501034_0197332 | 3300049571 | Bacteria | 1972 |
| 1063 | Ga0501034_0219819 | 3300049571 | Bacteria | 1852 |
| 1064 | Ga0501036_0000440 | 3300049572 | Bacteria | 29582 |
| 1065 | Ga0501036_0056112 | 3300049572 | Bacteria | 3337 |
| 1066 | Ga0501036_0252312 | 3300049572 | Bacteria | 1478 |
| 1067 | Ga0501036_0286433 | 3300049572 | Bacteria | 1378 |
| 1068 | Ga0501036_0452612 | 3300049572 | Bacteria | 1069 |
| 1069 | Ga0501036_1242480 | 3300049572 | Bacteria | 606 |
| 1070 | Ga0501037_0000969 | 3300049573 | Bacteria | 21316 |
| 1071 | Ga0501037_0030622 | 3300049573 | Bacteria | 3975 |
| 1072 | Ga0501037_0223896 | 3300049573 | Bacteria | 1322 |
| 1073 | Ga0501037_0295852 | 3300049573 | Bacteria | 1125 |
| 1074 | Ga0501038_0000473 | 3300049574 | Bacteria | 35337 |
| 1075 | Ga0501038_0018346 | 3300049574 | Bacteria | 6317 |
| 1076 | Ga0501038_0074628 | 3300049574 | Bacteria | 2868 |
| 1077 | Ga0501038_0288621 | 3300049574 | Bacteria | 1290 |
| 1078 | Ga0501038_0501563 | 3300049574 | Bacteria | 928 |
| 1079 | Ga0501039_0007468 | 3300049575 | Bacteria | 8345 |
| 1080 | Ga0501039_0046128 | 3300049575 | Bacteria | 3366 |
| 1081 | Ga0501039_0237689 | 3300049575 | Bacteria | 1432 |
| 1082 | Ga0501040_0105092 | 3300049576 | Bacteria | 1972 |
| 1083 | Ga0501041_0413570 | 3300049577 | Bacteria | 855 |
| 1084 | Ga0501042_0299817 | 3300049578 | Bacteria | 1161 |
| 1085 | Ga0501042_0559523 | 3300049578 | Bacteria | 831 |
| 1086 | Ga0501043_0001087 | 3300049579 | Bacteria | 23901 |
| 1087 | Ga0501043_0121043 | 3300049579 | Bacteria | 2052 |
| 1088 | Ga0501043_0186149 | 3300049579 | Bacteria | 1616 |
| 1089 | Ga0501043_0290933 | 3300049579 | Bacteria | 1250 |
| 1090 | Ga0501043_0328292 | 3300049579 | Bacteria | 1165 |
| 1091 | Ga0501043_0420700 | 3300049579 | Bacteria | 1007 |
| 1092 | Ga0501046_0000181 | 3300049580 | Bacteria | 64035 |
| 1093 | Ga0501046_0031149 | 3300049580 | Bacteria | 4326 |
| 1094 | Ga0501046_0191740 | 3300049580 | Bacteria | 1524 |
| 1095 | Ga0501046_0320445 | 3300049580 | Bacteria | 1130 |
| 1096 | Ga0501046_0344245 | 3300049580 | Bacteria | 1083 |
| 1097 | Ga0501046_0728723 | 3300049580 | Bacteria | 697 |
| 1098 | Ga0501046_0755960 | 3300049580 | Bacteria | 683 |
| 1099 | Ga0501047_0000419 | 3300049581 | Bacteria | 47535 |
| 1100 | Ga0501047_0130491 | 3300049581 | Bacteria | 2393 |
| 1101 | Ga0501047_0200477 | 3300049581 | Bacteria | 1857 |
| 1102 | Ga0501047_0285830 | 3300049581 | Bacteria | 1493 |
| 1103 | Ga0501047_0578520 | 3300049581 | Bacteria | 946 |
| 1104 | Ga0501048_0000057 | 3300049582 | Bacteria | 56138 |
| 1105 | Ga0501048_0022093 | 3300049582 | Bacteria | 4655 |
| 1106 | Ga0501048_0120264 | 3300049582 | Bacteria | 1856 |
| 1107 | Ga0501048_0473884 | 3300049582 | Bacteria | 897 |
| 1108 | Ga0501067_0000507 | 3300049583 | Bacteria | 21269 |
| 1109 | Ga0501067_0116833 | 3300049583 | Bacteria | 1484 |
| 1110 | Ga0501067_0547468 | 3300049583 | Bacteria | 648 |
| 1111 | Ga0501068_0001808 | 3300049584 | Bacteria | 11366 |
| 1112 | Ga0501068_0050540 | 3300049584 | Bacteria | 2513 |
| 1113 | Ga0501068_0200698 | 3300049584 | Bacteria | 1265 |
| 1114 | Ga0501069_0001596 | 3300049585 | Bacteria | 11217 |
| 1115 | Ga0501069_0069376 | 3300049585 | Bacteria | 1973 |
| 1116 | Ga0501069_0508927 | 3300049585 | Bacteria | 719 |
| 1117 | Ga0501070_0003003 | 3300049586 | Bacteria | 14682 |
| 1118 | Ga0501070_0018309 | 3300049586 | Bacteria | 5875 |
| 1119 | Ga0501070_0075906 | 3300049586 | Bacteria | 2782 |
| 1120 | Ga0501070_0218868 | 3300049586 | Bacteria | 1562 |
| 1121 | Ga0501070_0601426 | 3300049586 | Bacteria | 876 |
| 1122 | Ga0501070_0695609 | 3300049586 | Bacteria | 804 |
| 1123 | Ga0501070_0772540 | 3300049586 | Bacteria | 756 |
| 1124 | Ga0501071_0058732 | 3300049587 | Bacteria | 2782 |
| 1125 | Ga0501071_0094604 | 3300049587 | Bacteria | 2198 |
| 1126 | Ga0501071_0171754 | 3300049587 | Bacteria | 1623 |
| 1127 | Ga0501072_0009854 | 3300049588 | Bacteria | 7266 |
| 1128 | Ga0501072_0142587 | 3300049588 | Bacteria | 1910 |
| 1129 | Ga0501072_0530948 | 3300049588 | Bacteria | 930 |
| 1130 | Ga0501072_0543533 | 3300049588 | Bacteria | 918 |
| 1131 | Ga0501073_0000027 | 3300049589 | Bacteria | 121860 |
| 1132 | Ga0501073_0007901 | 3300049589 | Bacteria | 7892 |
| 1133 | Ga0501073_0915073 | 3300049589 | Bacteria | 604 |
| 1134 | Ga0501074_0000081 | 3300049590 | Bacteria | 46487 |
| 1135 | Ga0501075_0355693 | 3300049591 | Bacteria | 1116 |
| 1136 | Ga0501076_0158314 | 3300049592 | Bacteria | 1844 |
| 1137 | Ga0501076_0219954 | 3300049592 | Bacteria | 1552 |
| 1138 | Ga0501077_0031980 | 3300049593 | Bacteria | 3348 |
| 1139 | Ga0501077_0940908 | 3300049593 | Bacteria | 556 |
| 1140 | Ga0501079_0013289 | 3300049741 | Bacteria | 6277 |
| 1141 | Ga0501079_0037393 | 3300049741 | Bacteria | 3741 |
| 1142 | Ga0501079_0905066 | 3300049741 | Bacteria | 695 |
| 1143 | Ga0501080_0003534 | 3300049742 | Bacteria | 13770 |
| 1144 | Ga0501080_0063839 | 3300049742 | Bacteria | 3426 |
| 1145 | Ga0501080_0482214 | 3300049742 | Bacteria | 1109 |
| 1146 | Ga0501081_0879697 | 3300049743 | Bacteria | 675 |
| 1147 | Ga0501083_0000947 | 3300049744 | Bacteria | 19180 |
| 1148 | Ga0501083_0018670 | 3300049744 | Bacteria | 4830 |
| 1149 | Ga0501083_0328852 | 3300049744 | Bacteria | 994 |
| 1150 | Ga0501035_0000145 | 3300049822 | Bacteria | 86013 |
| 1151 | Ga0501035_0055322 | 3300049822 | Bacteria | 3542 |
| 1152 | Ga0501035_0244481 | 3300049822 | Bacteria | 1525 |
| 1153 | Ga0501035_0259523 | 3300049822 | Bacteria | 1473 |
| 1154 | Ga0501035_0360854 | 3300049822 | Bacteria | 1214 |
| 1155 | Ga0501035_1010306 | 3300049822 | Bacteria | 653 |
| 1156 | Ga0501044_0002483 | 3300049823 | Bacteria | 21039 |
| 1157 | Ga0501044_0011935 | 3300049823 | Bacteria | 9416 |
| 1158 | Ga0501044_0089955 | 3300049823 | Bacteria | 3098 |
| 1159 | Ga0501044_0102043 | 3300049823 | Bacteria | 2885 |
| 1160 | Ga0501044_0253597 | 3300049823 | Bacteria | 1699 |
| 1161 | Ga0501044_0256245 | 3300049823 | Bacteria | 1689 |
| 1162 | Ga0501044_0578859 | 3300049823 | Bacteria | 1017 |
| 1163 | Ga0501044_0952317 | 3300049823 | Bacteria | 731 |
| 1164 | Ga0501044_0974664 | 3300049823 | Bacteria | 720 |
| 1165 | Ga0501044_1027689 | 3300049823 | Bacteria | 695 |
| 1166 | Ga0501045_0008413 | 3300049824 | Bacteria | 7191 |
| 1167 | Ga0501045_0230564 | 3300049824 | Bacteria | 1378 |
| 1168 | nmdc:mga03683_118349_c1 | 3300050489 | Bacteria | 1176 |
| 1169 | nmdc:mga03683_138655_c1 | 3300050489 | Bacteria | 1092 |
| 1170 | nmdc:mga03683_24639_c1 | 3300050489 | Bacteria | 2356 |
| 1171 | nmdc:mga03683_397877_c1 | 3300050489 | Bacteria | 657 |
| 1172 | nmdc:mga03n38_145495_c1 | 3300050490 | Bacteria | 1188 |
| 1173 | nmdc:mga03n38_217001_c1 | 3300050490 | Bacteria | 997 |
| 1174 | nmdc:mga03n38_361713_c1 | 3300050490 | Bacteria | 792 |
| 1175 | nmdc:mga03n38_55894_c1 | 3300050490 | Bacteria | 1780 |
| 1176 | nmdc:mga00v17_128693_c1 | 3300050491 | Bacteria | 1617 |
| 1177 | nmdc:mga00v17_20987_c1 | 3300050491 | Bacteria | 3750 |
| 1178 | nmdc:mga00v17_34141_c1 | 3300050491 | Bacteria | 3019 |
| 1179 | nmdc:mga00v17_367578_c1 | 3300050491 | Bacteria | 935 |
| 1180 | nmdc:mga00v17_372647_c1 | 3300050491 | Bacteria | 928 |
| 1181 | nmdc:mga00v17_570737_c1 | 3300050491 | Bacteria | 731 |
| 1182 | nmdc:mga00v17_64124_c1 | 3300050491 | Bacteria | 2264 |
| 1183 | nmdc:mga0yw44_2044_c1 | 3300050492 | Bacteria | 8411 |
| 1184 | nmdc:mga0yw44_20554_c1 | 3300050492 | Bacteria | 3666 |
| 1185 | nmdc:mga0yw44_5981_c1 | 3300050492 | Bacteria | 5824 |
| 1186 | nmdc:mga0yw44_78818_c1 | 3300050492 | Bacteria | 2060 |
| 1187 | nmdc:mga0yw44_80808_c1 | 3300050492 | Bacteria | 2037 |
| 1188 | nmdc:mga0yw44_8586_c1 | 3300050492 | Bacteria | 5100 |
| 1189 | nmdc:mga0k408_12582_c1 | 3300050493 | Bacteria | 4626 |
| 1190 | nmdc:mga0k408_145062_c1 | 3300050493 | Bacteria | 1413 |
| 1191 | nmdc:mga0k408_212989_c1 | 3300050493 | Bacteria | 1154 |
| 1192 | nmdc:mga0k408_6223_c1 | 3300050493 | Bacteria | 3587 |
| 1193 | nmdc:mga0k408_9579_c1 | 3300050493 | Bacteria | 5227 |
| 1194 | nmdc:mga06z11_356224_c1 | 3300050494 | Bacteria | 877 |
| 1195 | nmdc:mga06z11_394799_c1 | 3300050494 | Bacteria | 832 |
| 1196 | nmdc:mga06z11_538023_c1 | 3300050494 | Bacteria | 709 |
| 1197 | nmdc:mga06z11_69049_c1 | 3300050494 | Bacteria | 1864 |
| 1198 | nmdc:mga06z11_919732_c1 | 3300050494 | Bacteria | 533 |
| 1199 | nmdc:mga04h51_71852_c1 | 3300050495 | Bacteria | 1210 |
| 1200 | nmdc:mga07m45_179963_c1 | 3300050496 | Bacteria | 1229 |
| 1201 | nmdc:mga07m45_429412_c1 | 3300050496 | Bacteria | 766 |
| 1202 | nmdc:mga07m45_45899_c1 | 3300050496 | Bacteria | 2453 |
| 1203 | nmdc:mga07m45_56187_c1 | 3300050496 | Bacteria | 2225 |
| 1204 | nmdc:mga07m45_747047_c1 | 3300050496 | Bacteria | 562 |
| 1205 | nmdc:mga05p37_1609438_c1 | 3300050507 | Bacteria | 639 |
| 1206 | nmdc:mga05p37_72861_c1 | 3300050507 | Bacteria | 4227 |
| 1207 | nmdc:mga05p37_73893_c1 | 3300050507 | Bacteria | 4196 |
| 1208 | nmdc:mga0qj67_1071363_c1 | 3300050509 | Bacteria | 630 |
| 1209 | nmdc:mga0qj67_41057_c1 | 3300050509 | Bacteria | 3638 |
| 1210 | nmdc:mga06r32_1021692_c1 | 3300050510 | Bacteria | 779 |
| 1211 | nmdc:mga08y16_165438_c1 | 3300050511 | Bacteria | 2298 |
| 1212 | nmdc:mga08y16_470105_c1 | 3300050511 | Bacteria | 1280 |
| 1213 | nmdc:mga0n895_10129_c1 | 3300050512 | Bacteria | 8297 |
| 1214 | nmdc:mga0n895_336454_c1 | 3300050512 | Bacteria | 1529 |
| 1215 | nmdc:mga0n895_648364_c1 | 3300050512 | Bacteria | 1055 |
| 1216 | nmdc:mga0rr50_1194805_c1 | 3300050513 | Bacteria | 646 |
| 1217 | nmdc:mga08x19_610591_c1 | 3300050514 | Bacteria | 773 |
| 1218 | nmdc:mga08x19_738350_c1 | 3300050514 | Bacteria | 699 |
| 1219 | nmdc:mga0a205_445443_c1 | 3300050515 | Bacteria | 1155 |
| 1220 | nmdc:mga0sz30_21539_c1 | 3300050516 | Bacteria | 2610 |
| 1221 | nmdc:mga0sz30_218645_c1 | 3300050516 | Bacteria | 847 |
| 1222 | nmdc:mga0sz30_3415_c1 | 3300050516 | Bacteria | 3487 |
| 1223 | nmdc:mga0sz30_48337_c1 | 3300050516 | Bacteria | 1800 |
| 1224 | nmdc:mga0sz30_59309_c1 | 3300050516 | Bacteria | 1633 |
| 1225 | Ga0495601_0022629 | 3300053077 | Bacteria | 3860 |
| 1226 | Ga0495601_0244131 | 3300053077 | Bacteria | 1172 |
| 1227 | Ga0495601_0291664 | 3300053077 | Bacteria | 1063 |
| 1228 | Ga0495601_0407803 | 3300053077 | Bacteria | 881 |
| 1229 | Ga0495601_0844451 | 3300053077 | Bacteria | 580 |
| 1230 | Ga0495612_0011436 | 3300053078 | Bacteria | 3579 |
| 1231 | Ga0495612_0028665 | 3300053078 | Bacteria | 2242 |
| 1232 | Ga0495612_0209187 | 3300053078 | Bacteria | 862 |
| 1233 | Ga0500635_0001095 | 3300053080 | Bacteria | 6483 |
| 1234 | Ga0500635_0006128 | 3300053080 | Bacteria | 3197 |
| 1235 | Ga0500635_0345415 | 3300053080 | Bacteria | 589 |
| 1236 | Ga0495655_0178982 | 3300053083 | Bacteria | 683 |
| 1237 | Ga0495595_0004815 | 3300053084 | Bacteria | 5434 |
| 1238 | Ga0495595_0009867 | 3300053084 | Bacteria | 3958 |
| 1239 | Ga0495595_0375009 | 3300053084 | Bacteria | 720 |
| 1240 | Ga0495595_0493234 | 3300053084 | Bacteria | 624 |
| 1241 | Ga0495619_0016828 | 3300053085 | Bacteria | 4629 |
| 1242 | Ga0495619_0029722 | 3300053085 | Bacteria | 3532 |
| 1243 | Ga0495619_0145887 | 3300053085 | Bacteria | 1631 |
| 1244 | Ga0495619_0504910 | 3300053085 | Bacteria | 831 |
| 1245 | Ga0495619_1110296 | 3300053085 | Unclassified | 526 |
| 1246 | Ga0500578_0771260 | 3300053086 | Bacteria | 511 |
| 1247 | Ga0500643_000052 | 3300053087 | Bacteria | 144656 |
| 1248 | Ga0500644_0107119 | 3300053088 | Bacteria | 1071 |
| 1249 | Ga0500581_209572 | 3300053089 | Bacteria | 856 |
| 1250 | Ga0500646_0104548 | 3300053090 | Bacteria | 893 |
| 1251 | Ga0500583_0155343 | 3300053092 | Bacteria | 1139 |
| 1252 | Ga0500583_0351899 | 3300053092 | Bacteria | 714 |
| 1253 | Ga0500651_0002435 | 3300053093 | Bacteria | 9828 |
| 1254 | Ga0500651_0040927 | 3300053093 | Bacteria | 2920 |
| 1255 | Ga0500651_0143448 | 3300053093 | Bacteria | 1438 |
| 1256 | Ga0500651_0273696 | 3300053093 | Bacteria | 976 |
| 1257 | Ga0500566_0000113 | 3300053094 | Bacteria | 41467 |
| 1258 | Ga0500566_0001807 | 3300053094 | Bacteria | 12572 |
| 1259 | Ga0500566_0018844 | 3300053094 | Bacteria | 4052 |
| 1260 | Ga0500566_0514724 | 3300053094 | Bacteria | 513 |
| 1261 | Ga0500640_004118 | 3300053095 | Bacteria | 5231 |
| 1262 | Ga0500640_273821 | 3300053095 | Bacteria | 523 |
| 1263 | Ga0500641_0195775 | 3300053096 | Bacteria | 864 |
| 1264 | Ga0500641_0349270 | 3300053096 | Bacteria | 595 |
| 1265 | Ga0500650_0000211 | 3300053098 | Bacteria | 14092 |
| 1266 | Ga0500650_0385404 | 3300053098 | Bacteria | 608 |
| 1267 | Ga0500554_018039 | 3300053102 | Bacteria | 1898 |
| 1268 | Ga0500555_003023 | 3300053103 | Bacteria | 4805 |
| 1269 | Ga0500556_0000035 | 3300053104 | Bacteria | 145357 |
| 1270 | Ga0500556_0270398 | 3300053104 | Bacteria | 667 |
| 1271 | Ga0500557_000057 | 3300053105 | Bacteria | 47849 |
| 1272 | Ga0500562_063601 | 3300053108 | Bacteria | 992 |
| 1273 | Ga0500569_011160 | 3300053109 | Bacteria | 2138 |
| 1274 | Ga0500569_019952 | 3300053109 | Bacteria | 1751 |
| 1275 | Ga0500572_000626 | 3300053111 | Bacteria | 11812 |
| 1276 | Ga0500572_150885 | 3300053111 | Bacteria | 759 |
| 1277 | Ga0500591_030004 | 3300053115 | Bacteria | 2628 |
| 1278 | Ga0500592_002833 | 3300053116 | Bacteria | 2787 |
| 1279 | Ga0500594_0078228 | 3300053118 | Bacteria | 985 |
| 1280 | Ga0500595_005291 | 3300053119 | Bacteria | 5655 |
| 1281 | Ga0500595_020996 | 3300053119 | Bacteria | 2338 |
| 1282 | Ga0500595_036027 | 3300053119 | Bacteria | 1624 |
| 1283 | Ga0500607_231258 | 3300053121 | Bacteria | 757 |
| 1284 | Ga0500607_268513 | 3300053121 | Bacteria | 661 |
| 1285 | Ga0500608_000655 | 3300053122 | Bacteria | 12732 |
| 1286 | Ga0500608_009359 | 3300053122 | Bacteria | 4158 |
| 1287 | Ga0500614_010315 | 3300053123 | Bacteria | 2004 |
| 1288 | Ga0500618_001755 | 3300053125 | Bacteria | 9191 |
| 1289 | Ga0500626_100377 | 3300053128 | Bacteria | 1262 |
| 1290 | Ga0500642_0000027 | 3300053130 | Bacteria | 119688 |
| 1291 | Ga0500642_0093206 | 3300053130 | Bacteria | 1394 |
| 1292 | Ga0500642_0190691 | 3300053130 | Bacteria | 956 |
| 1293 | Ga0500642_0496599 | 3300053130 | Bacteria | 516 |
| 1294 | Ga0500652_000244 | 3300053131 | Bacteria | 20528 |
| 1295 | Ga0500658_0160164 | 3300053134 | Bacteria | 1018 |
| 1296 | Ga0500658_0256067 | 3300053134 | Bacteria | 804 |
| 1297 | Ga0500658_0551072 | 3300053134 | Bacteria | 519 |
| 1298 | Ga0500559_0000064 | 3300053136 | Bacteria | 85844 |
| 1299 | Ga0500559_0004501 | 3300053136 | Bacteria | 6598 |
| 1300 | Ga0500559_0039467 | 3300053136 | Bacteria | 2053 |
| 1301 | Ga0500559_0128063 | 3300053136 | Bacteria | 1185 |
| 1302 | Ga0500559_0139069 | 3300053136 | Bacteria | 1136 |
| 1303 | Ga0500559_0434627 | 3300053136 | Bacteria | 608 |
| 1304 | Ga0500568_0000443 | 3300053139 | Bacteria | 31089 |
| 1305 | Ga0500568_0016857 | 3300053139 | Bacteria | 3236 |
| 1306 | Ga0500568_0109108 | 3300053139 | Bacteria | 1035 |
| 1307 | Ga0500577_0004109 | 3300053142 | Bacteria | 3819 |
| 1308 | Ga0500586_004396 | 3300053145 | Bacteria | 3443 |
| 1309 | Ga0500590_027615 | 3300053148 | Bacteria | 2944 |
| 1310 | Ga0500603_000215 | 3300053150 | Bacteria | 15318 |
| 1311 | Ga0500603_001657 | 3300053150 | Bacteria | 5012 |
| 1312 | Ga0500604_0009467 | 3300053151 | Bacteria | 2595 |
| 1313 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 1314 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 1315 | Ga0500616_0224703 | 3300053153 | Bacteria | 817 |
| 1316 | Ga0500620_000883 | 3300053155 | Bacteria | 5196 |
| 1317 | Ga0500622_0003283 | 3300053156 | Bacteria | 10965 |
| 1318 | Ga0500622_0009279 | 3300053156 | Bacteria | 5453 |
| 1319 | Ga0500627_0011595 | 3300053158 | Bacteria | 3264 |
| 1320 | Ga0500627_0327533 | 3300053158 | Bacteria | 664 |
| 1321 | Ga0500627_0484747 | 3300053158 | Bacteria | 516 |
| 1322 | Ga0500630_000802 | 3300053159 | Bacteria | 14482 |
| 1323 | Ga0500634_0200378 | 3300053161 | Bacteria | 877 |
| 1324 | Ga0500638_038121 | 3300053162 | Bacteria | 2332 |
| 1325 | Ga0500639_000899 | 3300053163 | Bacteria | 15129 |
| 1326 | Ga0500639_098582 | 3300053163 | Bacteria | 1443 |
| 1327 | Ga0500636_0000594 | 3300053177 | Bacteria | 19747 |
| 1328 | Ga0500636_0000823 | 3300053177 | Bacteria | 16716 |
| 1329 | Ga0500636_0064057 | 3300053177 | Bacteria | 2142 |
| 1330 | Ga0500636_0168364 | 3300053177 | Bacteria | 1187 |
| 1331 | Ga0500636_0476856 | 3300053177 | Bacteria | 557 |
| 1332 | Ga0500637_0085474 | 3300053178 | Bacteria | 1824 |
| 1333 | Ga0500637_0124117 | 3300053178 | Bacteria | 1498 |
| 1334 | Ga0500637_0166750 | 3300053178 | Bacteria | 1267 |
| 1335 | Ga0500637_0301275 | 3300053178 | Bacteria | 874 |
| 1336 | Ga0500570_219005 | 3300053724 | Bacteria | 548 |
| 1337 | Ga0500625_036943 | 3300053729 | Bacteria | 2311 |
| 1338 | Ga0500645_046197 | 3300053730 | Bacteria | 1278 |
| 1339 | Ga0500596_001109 | 3300053735 | Bacteria | 5417 |
| 1340 | Ga0500599_009363 | 3300053736 | Bacteria | 1282 |
| 1341 | Ga0500601_000119 | 3300053737 | Bacteria | 16610 |
| 1342 | Ga0501084_0011359 | 3300054114 | Bacteria | 7375 |
| 1343 | Ga0501084_0022705 | 3300054114 | Bacteria | 5236 |
| 1344 | Ga0500661_007552 | 3300055283 | Bacteria | 2008 |
| 1345 | Ga0500661_123637 | 3300055283 | Bacteria | 502 |
| 1346 | Ga0501082_0008590 | 3300060353 | Bacteria | 8811 |
| 1347 | Ga0501082_0059486 | 3300060353 | Bacteria | 3292 |
| 1348 | Ga0501082_1396245 | 3300060353 | Bacteria | 612 |
| 1349 | Ga0466962_0065345 | 3300061719 | Bacteria | 1737 |
| 1350 | Ga0530510_0488741 | 3300061734 | Bacteria | 933 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046507 | Ga0495606_0001686 | Ga0495606_0001686_23773_24210 | 119 |
| 2 | 3300048915 | Ga0496112_0002344 | Ga0496112_0002344_6390_6836 | 123 |
| 3 | 3300013306 | Ga0163162_13305704 | Ga0163162_133057041 | 133 |
| 4 | 3300031731 | Ga0307405_11429139 | Ga0307405_114291391 | 133 |
| 5 | 3300050490 | nmdc:mga03n38_217001_c1 | nmdc:mga03n38_217001_c1_535_987 | 133 |
| 6 | 3300005719 | Ga0068861_101852455 | Ga0068861_1018524551 | 134 |
| 7 | 3300005844 | Ga0068862_100567903 | Ga0068862_1005679032 | 134 |
| 8 | 3300032002 | Ga0307416_102290996 | Ga0307416_1022909962 | 134 |
| 9 | 3300042006 | Ga0439432_131068 | Ga0439432_131068_266_721 | 134 |
| 10 | 3300042435 | Ga0439434_0120306 | Ga0439434_0120306_18_473 | 134 |
| 11 | 3300013297 | Ga0157378_10018404 | Ga0157378_100184046 | 136 |
| 12 | 3300026089 | Ga0207648_12277539 | Ga0207648_122775391 | 136 |
| 13 | 3300028794 | Ga0307515_10524494 | Ga0307515_105244942 | 137 |
| 14 | 3300031456 | Ga0307513_10813939 | Ga0307513_108139391 | 137 |
| 15 | 3300035171 | Ga0373946_0021133 | Ga0373946_0021133_1917_2339 | 137 |
| 16 | 3300035692 | Ga0373935_0027114 | Ga0373935_0027114_168_590 | 137 |
| 17 | 3300037853 | Ga0436364_0541162 | Ga0436364_0541162_348_764 | 137 |
| 18 | 3300046689 | Ga0495613_0179629 | Ga0495613_0179629_1039_1461 | 137 |
| 19 | 3300048089 | Ga0495614_0071559 | Ga0495614_0071559_173_595 | 137 |
| 20 | 3300049589 | Ga0501073_0915073 | Ga0501073_0915073_23_469 | 137 |
| 21 | 3300009553 | Ga0105249_10806706 | Ga0105249_108067062 | 138 |
| 22 | 3300035115 | Ga0373941_0452892 | Ga0373941_0452892_40_495 | 138 |
| 23 | 3300035241 | Ga0373961_0404324 | Ga0373961_0404324_10_465 | 138 |
| 24 | 3300049580 | Ga0501046_0320445 | Ga0501046_0320445_252_713 | 138 |
| 25 | 3300049581 | Ga0501047_0285830 | Ga0501047_0285830_94_555 | 138 |
| 26 | 3300049586 | Ga0501070_0018309 | Ga0501070_0018309_392_853 | 138 |
| 27 | 3300049742 | Ga0501080_0063839 | Ga0501080_0063839_2816_3277 | 138 |
| 28 | 3300049823 | Ga0501044_0011935 | Ga0501044_0011935_8942_9403 | 138 |
| 29 | 3300005329 | Ga0070683_100863738 | Ga0070683_1008637381 | 139 |
| 30 | 3300005331 | Ga0070670_100135781 | Ga0070670_1001357812 | 139 |
| 31 | 3300005334 | Ga0068869_100025714 | Ga0068869_1000257145 | 139 |
| 32 | 3300005338 | Ga0068868_100105457 | Ga0068868_1001054572 | 139 |
| 33 | 3300005339 | Ga0070660_100351071 | Ga0070660_1003510712 | 139 |
| 34 | 3300005353 | Ga0070669_100356393 | Ga0070669_1003563933 | 139 |
| 35 | 3300005366 | Ga0070659_100121951 | Ga0070659_1001219513 | 139 |
| 36 | 3300005367 | Ga0070667_101488755 | Ga0070667_1014887551 | 139 |
| 37 | 3300005440 | Ga0070705_100686406 | Ga0070705_1006864061 | 139 |
| 38 | 3300005455 | Ga0070663_100092281 | Ga0070663_1000922812 | 139 |
| 39 | 3300005456 | Ga0070678_100267806 | Ga0070678_1002678062 | 139 |
| 40 | 3300005518 | Ga0070699_100201113 | Ga0070699_1002011132 | 139 |
| 41 | 3300005614 | Ga0068856_100434702 | Ga0068856_1004347023 | 139 |
| 42 | 3300005615 | Ga0070702_100662957 | Ga0070702_1006629572 | 139 |
| 43 | 3300005616 | Ga0068852_100515489 | Ga0068852_1005154892 | 139 |
| 44 | 3300005618 | Ga0068864_100212870 | Ga0068864_1002128702 | 139 |
| 45 | 3300005719 | Ga0068861_100211061 | Ga0068861_1002110613 | 139 |
| 46 | 3300005842 | Ga0068858_100034437 | Ga0068858_1000344371 | 139 |
| 47 | 3300006042 | Ga0075368_10097188 | Ga0075368_100971882 | 139 |
| 48 | 3300006048 | Ga0075363_100058674 | Ga0075363_1000586742 | 139 |
| 49 | 3300006177 | Ga0075362_10068209 | Ga0075362_100682092 | 139 |
| 50 | 3300006186 | Ga0075369_10096794 | Ga0075369_100967942 | 139 |
| 51 | 3300006195 | Ga0075366_10120593 | Ga0075366_101205932 | 139 |
| 52 | 3300006353 | Ga0075370_10309359 | Ga0075370_103093591 | 139 |
| 53 | 3300006358 | Ga0068871_100227592 | Ga0068871_1002275922 | 139 |
| 54 | 3300006852 | Ga0075433_10652485 | Ga0075433_106524852 | 139 |
| 55 | 3300006871 | Ga0075434_100127180 | Ga0075434_1001271803 | 139 |
| 56 | 3300006914 | Ga0075436_100676489 | Ga0075436_1006764892 | 139 |
| 57 | 3300007076 | Ga0075435_100653780 | Ga0075435_1006537802 | 139 |
| 58 | 3300009011 | Ga0105251_10222271 | Ga0105251_102222712 | 139 |
| 59 | 3300009092 | Ga0105250_10113873 | Ga0105250_101138732 | 139 |
| 60 | 3300009098 | Ga0105245_10074222 | Ga0105245_100742222 | 139 |
| 61 | 3300009147 | Ga0114129_10003546 | Ga0114129_100035462 | 139 |
| 62 | 3300009148 | Ga0105243_10404528 | Ga0105243_104045282 | 139 |
| 63 | 3300009148 | Ga0105243_11068895 | Ga0105243_110688952 | 139 |
| 64 | 3300009177 | Ga0105248_10092495 | Ga0105248_100924954 | 139 |
| 65 | 3300009545 | Ga0105237_10149889 | Ga0105237_101498892 | 139 |
| 66 | 3300010375 | Ga0105239_10727186 | Ga0105239_107271862 | 139 |
| 67 | 3300011119 | Ga0105246_10005981 | Ga0105246_100059817 | 139 |
| 68 | 3300013100 | Ga0157373_10328759 | Ga0157373_103287592 | 139 |
| 69 | 3300013296 | Ga0157374_10885789 | Ga0157374_108857892 | 139 |
| 70 | 3300013297 | Ga0157378_11127564 | Ga0157378_111275641 | 139 |
| 71 | 3300013306 | Ga0163162_12248743 | Ga0163162_122487431 | 139 |
| 72 | 3300014325 | Ga0163163_10532864 | Ga0163163_105328641 | 139 |
| 73 | 3300014326 | Ga0157380_12868886 | Ga0157380_128688861 | 139 |
| 74 | 3300014969 | Ga0157376_10371391 | Ga0157376_103713912 | 139 |
| 75 | 3300025711 | Ga0207696_1102227 | Ga0207696_11022271 | 139 |
| 76 | 3300025900 | Ga0207710_10112002 | Ga0207710_101120022 | 139 |
| 77 | 3300025900 | Ga0207710_10179041 | Ga0207710_101790412 | 139 |
| 78 | 3300025907 | Ga0207645_10121167 | Ga0207645_101211672 | 139 |
| 79 | 3300025908 | Ga0207643_10106644 | Ga0207643_101066443 | 139 |
| 80 | 3300025914 | Ga0207671_10304159 | Ga0207671_103041591 | 139 |
| 81 | 3300025919 | Ga0207657_10181252 | Ga0207657_101812523 | 139 |
| 82 | 3300025925 | Ga0207650_11024041 | Ga0207650_110240411 | 139 |
| 83 | 3300025932 | Ga0207690_10456869 | Ga0207690_104568692 | 139 |
| 84 | 3300025938 | Ga0207704_10617941 | Ga0207704_106179412 | 139 |
| 85 | 3300025941 | Ga0207711_10042861 | Ga0207711_100428612 | 139 |
| 86 | 3300025944 | Ga0207661_10644229 | Ga0207661_106442292 | 139 |
| 87 | 3300025972 | Ga0207668_10029496 | Ga0207668_100294964 | 139 |
| 88 | 3300026078 | Ga0207702_10108606 | Ga0207702_101086062 | 139 |
| 89 | 3300026095 | Ga0207676_10103153 | Ga0207676_101031534 | 139 |
| 90 | 3300026116 | Ga0207674_10048642 | Ga0207674_100486422 | 139 |
| 91 | 3300026118 | Ga0207675_100242617 | Ga0207675_1002426172 | 139 |
| 92 | 3300026142 | Ga0207698_10226550 | Ga0207698_102265503 | 139 |
| 93 | 3300031824 | Ga0307413_11448801 | Ga0307413_114488012 | 139 |
| 94 | 3300042001 | Ga0439441_012115 | Ga0439441_012115_946_1416 | 139 |
| 95 | 3300042436 | Ga0439435_0151183 | Ga0439435_0151183_264_734 | 139 |
| 96 | 3300047319 | Ga0495674_0065377 | Ga0495674_0065377_1012_1434 | 139 |
| 97 | 3300048903 | Ga0496100_1190044 | Ga0496100_1190044_31_477 | 139 |
| 98 | 3300048909 | Ga0496106_0027096 | Ga0496106_0027096_3689_4135 | 139 |
| 99 | 3300048912 | Ga0496109_0570835 | Ga0496109_0570835_54_500 | 139 |
| 100 | 3300048914 | Ga0496111_0391557 | Ga0496111_0391557_453_899 | 139 |
| 101 | 3300048915 | Ga0496112_0131959 | Ga0496112_0131959_1427_1873 | 139 |
| 102 | 3300048915 | Ga0496112_0656110 | Ga0496112_0656110_219_647 | 139 |
| 103 | 3300048917 | Ga0496114_1429327 | Ga0496114_1429327_53_499 | 139 |
| 104 | 3300048923 | Ga0496120_0170290 | Ga0496120_0170290_53_499 | 139 |
| 105 | 3300048924 | Ga0496121_0147457 | Ga0496121_0147457_999_1445 | 139 |
| 106 | 3300048928 | Ga0496125_0123131 | Ga0496125_0123131_1137_1583 | 139 |
| 107 | 3300050490 | nmdc:mga03n38_361713_c1 | nmdc:mga03n38_361713_c1_35_481 | 139 |
| 108 | 3300050491 | nmdc:mga00v17_570737_c1 | nmdc:mga00v17_570737_c1_205_651 | 139 |
| 109 | 3300050493 | nmdc:mga0k408_212989_c1 | nmdc:mga0k408_212989_c1_282_728 | 139 |
| 110 | 3300050507 | nmdc:mga05p37_73893_c1 | nmdc:mga05p37_73893_c1_261_719 | 139 |
| 111 | 3300050512 | nmdc:mga0n895_336454_c1 | nmdc:mga0n895_336454_c1_98_544 | 139 |
| 112 | 3300050514 | nmdc:mga08x19_610591_c1 | nmdc:mga08x19_610591_c1_261_707 | 139 |
| 113 | 3300053086 | Ga0500578_0771260 | Ga0500578_0771260_79_501 | 139 |
| 114 | 3300046459 | Ga0495629_0456542 | Ga0495629_0456542_242_688 | 140 |
| 115 | 3300048929 | Ga0496126_0049241 | Ga0496126_0049241_1353_1796 | 140 |
| 116 | 3300049571 | Ga0501034_0078872 | Ga0501034_0078872_824_1264 | 140 |
| 117 | 3300049582 | Ga0501048_0120264 | Ga0501048_0120264_1188_1628 | 140 |
| 118 | 3300049586 | Ga0501070_0075906 | Ga0501070_0075906_494_934 | 140 |
| 119 | 3300049587 | Ga0501071_0058732 | Ga0501071_0058732_1877_2317 | 140 |
| 120 | 3300049823 | Ga0501044_0578859 | Ga0501044_0578859_167_607 | 140 |
| 121 | 3300005458 | Ga0070681_10859626 | Ga0070681_108596262 | 141 |
| 122 | 3300005983 | Ga0081540_1008395 | Ga0081540_10083954 | 141 |
| 123 | 3300006048 | Ga0075363_100454948 | Ga0075363_1004549481 | 141 |
| 124 | 3300006195 | Ga0075366_10009134 | Ga0075366_100091344 | 141 |
| 125 | 3300025972 | Ga0207668_11441510 | Ga0207668_114415101 | 141 |
| 126 | 3300026118 | Ga0207675_100748389 | Ga0207675_1007483892 | 141 |
| 127 | 3300028380 | Ga0268265_10485201 | Ga0268265_104852012 | 141 |
| 128 | 3300031456 | Ga0307513_10617626 | Ga0307513_106176262 | 141 |
| 129 | 3300037853 | Ga0436364_1068178 | Ga0436364_1068178_176_616 | 141 |
| 130 | 3300039450 | Ga0436363_0374194 | Ga0436363_0374194_526_966 | 141 |
| 131 | 3300039450 | Ga0436363_1278762 | Ga0436363_1278762_828_1268 | 141 |
| 132 | 3300042438 | Ga0439459_0069202 | Ga0439459_0069202_291_755 | 141 |
| 133 | 3300044684 | Ga0466966_0019524 | Ga0466966_0019524_2382_2822 | 141 |
| 134 | 3300044719 | Ga0466971_0078700 | Ga0466971_0078700_956_1396 | 141 |
| 135 | 3300045049 | Ga0466959_0011393 | Ga0466959_0011393_2462_2902 | 141 |
| 136 | 3300046455 | Ga0495603_0549721 | Ga0495603_0549721_73_519 | 141 |
| 137 | 3300050493 | nmdc:mga0k408_6223_c1 | nmdc:mga0k408_6223_c1_1570_2034 | 141 |
| 138 | 3300053136 | Ga0500559_0128063 | Ga0500559_0128063_62_508 | 141 |
| 139 | 3300035171 | Ga0373946_0034419 | Ga0373946_0034419_682_1128 | 142 |
| 140 | 3300046642 | Ga0495634_0233360 | Ga0495634_0233360_238_684 | 142 |
| 141 | iso_pu_bacteria | 2511231028 | 2511398397 | 142 |
| 142 | iso_pu_bacteria | 2513237094 | 2513638647 | 142 |
| 143 | iso_pu_bacteria | 2513237095 | 2513649964 | 142 |
| 144 | iso_pu_bacteria | 2513237102 | 2513702491 | 142 |
| 145 | iso_pu_bacteria | 2513237104 | 2513716808 | 142 |
| 146 | iso_pu_bacteria | 2513237139 | 2513874257 | 142 |
| 147 | iso_pu_bacteria | 2513237161 | 2514009977 | 142 |
| 148 | iso_pu_bacteria | 2517093001 | 2517104597 | 142 |
| 149 | iso_pu_bacteria | 2524023205 | 2524438552 | 142 |
| 150 | iso_pu_bacteria | 2528768022 | 2528850403 | 142 |
| 151 | iso_pu_bacteria | 2602042107 | 2603860633 | 142 |
| 152 | iso_pu_bacteria | 2617270735 | 2617353882 | 142 |
| 153 | iso_pu_bacteria | 2617270741 | 2617374660 | 142 |
| 154 | iso_pu_bacteria | 2643221651 | 2644290220 | 142 |
| 155 | iso_pu_bacteria | 2744054633 | 2745077222 | 142 |
| 156 | iso_pu_bacteria | 2791355196 | 2793059392 | 142 |
| 157 | iso_pu_bacteria | 2802429603 | 2805916023 | 142 |
| 158 | iso_pu_bacteria | 2816332527 | 2818240964 | 142 |
| 159 | iso_pu_bacteria | 2824600985 | 2824608608 | 142 |
| 160 | iso_pu_bacteria | 2824609381 | 2824616190 | 142 |
| 161 | iso_pu_bacteria | 2824617872 | 2824626021 | 142 |
| 162 | iso_pu_bacteria | 2824626560 | 2824634322 | 142 |
| 163 | iso_pu_bacteria | 2824635225 | 2824642683 | 142 |
| 164 | iso_pu_bacteria | 2824644064 | 2824650610 | 142 |
| 165 | iso_pu_bacteria | 2824653114 | 2824660675 | 142 |
| 166 | iso_pu_bacteria | 2824661429 | 2824671204 | 142 |
| 167 | iso_pu_bacteria | 2824671348 | 2824679442 | 142 |
| 168 | iso_pu_bacteria | 2824679649 | 2824686276 | 142 |
| 169 | iso_pu_bacteria | 2824687955 | 2824696049 | 142 |
| 170 | iso_pu_bacteria | 2824704595 | 2824713907 | 142 |
| 171 | iso_pu_bacteria | 2824714736 | 2824722251 | 142 |
| 172 | iso_pu_bacteria | 2824723954 | 2824730699 | 142 |
| 173 | iso_pu_bacteria | 2824732956 | 2824738950 | 142 |
| 174 | iso_pu_bacteria | 2824746037 | 2824753285 | 142 |
| 175 | iso_pu_bacteria | 2824753945 | 2824761102 | 142 |
| 176 | iso_pu_bacteria | 2824763712 | 2824771781 | 142 |
| 177 | iso_pu_bacteria | 2824773399 | 2824779776 | 142 |
| 178 | iso_pu_bacteria | 2841941048 | 2841942489 | 142 |
| 179 | iso_pu_bacteria | 2841949485 | 2841953162 | 142 |
| 180 | iso_pu_bacteria | 2841957949 | 2841960669 | 142 |
| 181 | iso_pu_bacteria | 2841966195 | 2841970815 | 142 |
| 182 | iso_pu_bacteria | 2841974524 | 2841977926 | 142 |
| 183 | iso_pu_bacteria | 2842038055 | 2842041771 | 142 |
| 184 | iso_pu_bacteria | 2842045827 | 2842049813 | 142 |
| 185 | iso_pu_bacteria | 2844315083 | 2844321345 | 142 |
| 186 | iso_pu_bacteria | 2847930680 | 2847932065 | 142 |
| 187 | iso_pu_bacteria | 2849076700 | 2849077029 | 142 |
| 188 | iso_pu_bacteria | 2857509624 | 2857514696 | 142 |
| 189 | iso_pu_bacteria | 2857524615 | 2857525592 | 142 |
| 190 | iso_pu_bacteria | 2874612657 | 2874620295 | 142 |
| 191 | iso_pu_bacteria | 2874620515 | 2874624232 | 142 |
| 192 | iso_pu_bacteria | 2874628541 | 2874630296 | 142 |
| 193 | iso_pu_bacteria | 2876761206 | 2876767672 | 142 |
| 194 | iso_pu_bacteria | 2879083081 | 2879085741 | 142 |
| 195 | iso_pu_bacteria | 2879099564 | 2879100003 | 142 |
| 196 | iso_pu_bacteria | 2881364244 | 2881367734 | 142 |
| 197 | iso_pu_bacteria | 2881665667 | 2881669326 | 142 |
| 198 | iso_pu_bacteria | 2885366525 | 2885374473 | 142 |
| 199 | iso_pu_bacteria | 2885409591 | 2885412125 | 142 |
| 200 | iso_pu_bacteria | 2888378607 | 2888387643 | 142 |
| 201 | iso_pu_bacteria | 2888388044 | 2888391519 | 142 |
| 202 | iso_pu_bacteria | 2888419890 | 2888426859 | 142 |
| 203 | iso_pu_bacteria | 2893066018 | 2893070686 | 142 |
| 204 | iso_pu_bacteria | 2903727486 | 2903731465 | 142 |
| 205 | iso_pu_bacteria | 2904666416 | 2904670943 | 142 |
| 206 | iso_pu_bacteria | 2904711408 | 2904713564 | 142 |
| 207 | iso_pu_bacteria | 2906602504 | 2906607959 | 142 |
| 208 | iso_pu_bacteria | 2906626472 | 2906633068 | 142 |
| 209 | iso_pu_bacteria | 2906643746 | 2906647274 | 142 |
| 210 | iso_pu_bacteria | 2908775508 | 2908777141 | 142 |
| 211 | iso_pu_bacteria | 2909042592 | 2909047590 | 142 |
| 212 | iso_pu_bacteria | 2919073203 | 2919074599 | 142 |
| 213 | iso_pu_bacteria | 2922368715 | 2922376627 | 142 |
| 214 | iso_pu_bacteria | 2922386360 | 2922391518 | 142 |
| 215 | iso_pu_bacteria | 2922393267 | 2922398577 | 142 |
| 216 | iso_pu_bacteria | 2929615660 | 2929619868 | 142 |
| 217 | iso_pu_bacteria | 2929624759 | 2929629180 | 142 |
| 218 | iso_pu_bacteria | 2932784394 | 2932789687 | 142 |
| 219 | iso_pu_bacteria | 2932794094 | 2932796644 | 142 |
| 220 | iso_pu_bacteria | 2932801729 | 2932802575 | 142 |
| 221 | iso_pu_bacteria | 2932809354 | 2932818196 | 142 |
| 222 | iso_pu_bacteria | 2932818245 | 2932828034 | 142 |
| 223 | iso_pu_bacteria | 2932828146 | 2932835612 | 142 |
| 224 | iso_pu_bacteria | 2933577622 | 2933581786 | 142 |
| 225 | iso_pu_bacteria | 2935608549 | 2935613246 | 142 |
| 226 | iso_pu_bacteria | 2935616580 | 2935624614 | 142 |
| 227 | iso_pu_bacteria | 2935638405 | 2935647159 | 142 |
| 228 | iso_pu_bacteria | 2935665750 | 2935674378 | 142 |
| 229 | iso_pu_bacteria | 2935675223 | 2935684083 | 142 |
| 230 | iso_pu_bacteria | 2935684952 | 2935689131 | 142 |
| 231 | iso_pu_bacteria | 2935694250 | 2935697608 | 142 |
| 232 | iso_pu_bacteria | 2935703347 | 2935711367 | 142 |
| 233 | iso_pu_bacteria | 2935713505 | 2935720077 | 142 |
| 234 | iso_pu_bacteria | 2935722832 | 2935728306 | 142 |
| 235 | iso_pu_bacteria | 2935732158 | 2935737097 | 142 |
| 236 | iso_pu_bacteria | 2935741537 | 2935746842 | 142 |
| 237 | iso_pu_bacteria | 2935750917 | 2935757809 | 142 |
| 238 | iso_pu_bacteria | 2935760218 | 2935764188 | 142 |
| 239 | iso_pu_bacteria | 2935769743 | 2935775185 | 142 |
| 240 | iso_pu_bacteria | 2935777560 | 2935780087 | 142 |
| 241 | iso_pu_bacteria | 2935785616 | 2935790209 | 142 |
| 242 | iso_pu_bacteria | 2935793552 | 2935798749 | 142 |
| 243 | iso_pu_bacteria | 2935801545 | 2935809847 | 142 |
| 244 | iso_pu_bacteria | 2935810662 | 2935819774 | 142 |
| 245 | iso_pu_bacteria | 2935819856 | 2935824900 | 142 |
| 246 | iso_pu_bacteria | 2935827899 | 2935836583 | 142 |
| 247 | iso_pu_bacteria | 2935837841 | 2935844695 | 142 |
| 248 | iso_pu_bacteria | 2935847175 | 2935852120 | 142 |
| 249 | iso_pu_bacteria | 2935855204 | 2935863176 | 142 |
| 250 | iso_pu_bacteria | 2935864058 | 2935868645 | 142 |
| 251 | iso_pu_bacteria | 2935873716 | 2935879419 | 142 |
| 252 | iso_pu_bacteria | 2935883170 | 2935883614 | 142 |
| 253 | iso_pu_bacteria | 2935908558 | 2935911467 | 142 |
| 254 | iso_pu_bacteria | 2935916978 | 2935925384 | 142 |
| 255 | iso_pu_bacteria | 2935926038 | 2935928496 | 142 |
| 256 | iso_pu_bacteria | 2935934488 | 2935938141 | 142 |
| 257 | iso_pu_bacteria | 2935942939 | 2935945423 | 142 |
| 258 | iso_pu_bacteria | 2935951376 | 2935954071 | 142 |
| 259 | iso_pu_bacteria | 2935967501 | 2935971661 | 142 |
| 260 | iso_pu_bacteria | 2935992306 | 2936000213 | 142 |
| 261 | iso_pu_bacteria | 2936002035 | 2936010255 | 142 |
| 262 | iso_pu_bacteria | 2936037263 | 2936046484 | 142 |
| 263 | iso_pu_bacteria | 2940556831 | 2940563369 | 142 |
| 264 | iso_pu_bacteria | 2941531003 | 2941531918 | 142 |
| 265 | iso_pu_bacteria | 2941538514 | 2941547535 | 142 |
| 266 | iso_pu_bacteria | 3005483717 | 3005485995 | 142 |
| 267 | iso_pu_bacteria | 3005506211 | 3005506661 | 142 |
| 268 | iso_pu_bacteria | 3005587118 | 3005591817 | 142 |
| 269 | iso_pu_bacteria | 3005594810 | 3005601698 | 142 |
| 270 | iso_pu_bacteria | 3005710791 | 3005717437 | 142 |
| 271 | iso_pu_bacteria | 3005718088 | 3005724379 | 142 |
| 272 | iso_pu_bacteria | 8006926726 | 8006930839 | 142 |
| 273 | iso_pu_bacteria | 8016511872 | 8016519207 | 142 |
| 274 | iso_pu_bacteria | 8016522445 | 8016525114 | 142 |
| 275 | iso_pu_bacteria | 8016530956 | 8016538692 | 142 |
| 276 | iso_pu_bacteria | 8016539877 | 8016542980 | 142 |
| 277 | iso_pu_bacteria | 8016548790 | 8016550311 | 142 |
| 278 | iso_pu_bacteria | 8016557553 | 8016558719 | 142 |
| 279 | iso_pu_bacteria | 8016566248 | 8016568381 | 142 |
| 280 | iso_pu_bacteria | 8016575299 | 8016581037 | 142 |
| 281 | iso_pu_bacteria | 8016583857 | 8016587685 | 142 |
| 282 | iso_pu_bacteria | 8016595262 | 8016596696 | 142 |
| 283 | iso_pu_bacteria | 8016603502 | 8016607570 | 142 |
| 284 | iso_pu_bacteria | 8016613128 | 8016619363 | 142 |
| 285 | iso_pu_bacteria | 8016622563 | 8016630228 | 142 |
| 286 | iso_pu_bacteria | 8017057580 | 8017066299 | 142 |
| 287 | iso_pu_bacteria | 8019530166 | 8019538364 | 142 |
| 288 | iso_pu_bacteria | 8019538911 | 8019541459 | 142 |
| 289 | iso_pu_bacteria | 8019547302 | 8019549169 | 142 |
| 290 | iso_pu_bacteria | 8019576017 | 8019578318 | 142 |
| 291 | iso_pu_bacteria | 8019586578 | 8019596358 | 142 |
| 292 | iso_pu_bacteria | 8019597564 | 8019605344 | 142 |
| 293 | iso_pu_bacteria | 8019608314 | 8019613198 | 142 |
| 294 | iso_pu_bacteria | 8019648815 | 8019651564 | 142 |
| 295 | iso_pu_bacteria | 8019687851 | 8019695247 | 142 |
| 296 | iso_pu_bacteria | 8055742211 | 8055750380 | 142 |
| 297 | iso_pu_bacteria | 8056967851 | 8056971840 | 142 |
| 298 | 3300009545 | Ga0105237_10045833 | Ga0105237_100458335 | 143 |
| 299 | 3300037312 | Ga0395899_0179037 | Ga0395899_0179037_19_453 | 143 |
| 300 | 3300037418 | Ga0395900_0699207 | Ga0395900_0699207_97_531 | 143 |
| 301 | 3300037466 | Ga0395898_0099111 | Ga0395898_0099111_990_1424 | 143 |
| 302 | 3300037471 | Ga0395905_0343358 | Ga0395905_0343358_738_1172 | 143 |
| 303 | 3300038443 | Ga0395901_0550278 | Ga0395901_0550278_203_637 | 143 |
| 304 | 3300049569 | Ga0501032_0194489 | Ga0501032_0194489_358_792 | 143 |
| 305 | 3300049574 | Ga0501038_0288621 | Ga0501038_0288621_348_782 | 143 |
| 306 | 3300053153 | Ga0500616_0224703 | Ga0500616_0224703_29_466 | 143 |
| 307 | iso_pu_bacteria | 2728368998 | 2728751714 | 143 |
| 308 | iso_pu_bacteria | 2791355199 | 2793078560 | 143 |
| 309 | iso_pu_bacteria | 2889033259 | 2889034145 | 143 |
| 310 | 3300005548 | Ga0070665_100468867 | Ga0070665_1004688672 | 144 |
| 311 | 3300006038 | Ga0075365_10002534 | Ga0075365_100025346 | 144 |
| 312 | 3300006051 | Ga0075364_10013934 | Ga0075364_100139342 | 144 |
| 313 | 3300006178 | Ga0075367_10082884 | Ga0075367_100828841 | 144 |
| 314 | 3300028379 | Ga0268266_10624786 | Ga0268266_106247861 | 144 |
| 315 | 3300035114 | Ga0373939_0429153 | Ga0373939_0429153_53_490 | 144 |
| 316 | 3300035170 | Ga0373943_0425743 | Ga0373943_0425743_289_726 | 144 |
| 317 | 3300035692 | Ga0373935_0178952 | Ga0373935_0178952_357_794 | 144 |
| 318 | 3300039437 | Ga0436365_0056450 | Ga0436365_0056450_108_557 | 144 |
| 319 | 3300046460 | Ga0495638_0310851 | Ga0495638_0310851_214_651 | 144 |
| 320 | 3300046492 | Ga0495585_0466482 | Ga0495585_0466482_58_495 | 144 |
| 321 | 3300046519 | Ga0495632_0237341 | Ga0495632_0237341_357_794 | 144 |
| 322 | 3300046616 | Ga0495668_0126299 | Ga0495668_0126299_541_978 | 144 |
| 323 | 3300046648 | Ga0495611_0552127 | Ga0495611_0552127_25_462 | 144 |
| 324 | 3300046665 | Ga0495661_0250310 | Ga0495661_0250310_446_883 | 144 |
| 325 | 3300046684 | Ga0495669_0036595 | Ga0495669_0036595_1144_1581 | 144 |
| 326 | 3300048905 | Ga0496102_1297998 | Ga0496102_1297998_78_515 | 144 |
| 327 | 3300050491 | nmdc:mga00v17_128693_c1 | nmdc:mga00v17_128693_c1_760_1197 | 144 |
| 328 | 3300050492 | nmdc:mga0yw44_2044_c1 | nmdc:mga0yw44_2044_c1_3760_4197 | 144 |
| 329 | 3300050513 | nmdc:mga0rr50_1194805_c1 | nmdc:mga0rr50_1194805_c1_25_462 | 144 |
| 330 | 3300053177 | Ga0500636_0064057 | Ga0500636_0064057_189_626 | 144 |
| 331 | 3300053178 | Ga0500637_0166750 | Ga0500637_0166750_813_1250 | 144 |
| 332 | 3300003215 | JGI25153J46596_10099626 | JGI25153J46596_100996262 | 145 |
| 333 | 3300003659 | JGI25404J52841_10018969 | JGI25404J52841_100189692 | 145 |
| 334 | 3300003659 | JGI25404J52841_10021526 | JGI25404J52841_100215263 | 145 |
| 335 | 3300003659 | JGI25404J52841_10129563 | JGI25404J52841_101295631 | 145 |
| 336 | 3300005327 | Ga0070658_10445178 | Ga0070658_104451782 | 145 |
| 337 | 3300005441 | Ga0070700_100085290 | Ga0070700_1000852902 | 145 |
| 338 | 3300005455 | Ga0070663_100660587 | Ga0070663_1006605872 | 145 |
| 339 | 3300005841 | Ga0068863_100464863 | Ga0068863_1004648632 | 145 |
| 340 | 3300005937 | Ga0081455_10029427 | Ga0081455_100294274 | 145 |
| 341 | 3300005937 | Ga0081455_10076533 | Ga0081455_100765334 | 145 |
| 342 | 3300005983 | Ga0081540_1006321 | Ga0081540_10063212 | 145 |
| 343 | 3300005983 | Ga0081540_1010443 | Ga0081540_10104435 | 145 |
| 344 | 3300005983 | Ga0081540_1049888 | Ga0081540_10498883 | 145 |
| 345 | 3300014325 | Ga0163163_11209191 | Ga0163163_112091912 | 145 |
| 346 | 3300025297 | Ga0209758_1002009 | Ga0209758_10020094 | 145 |
| 347 | 3300025909 | Ga0207705_10346507 | Ga0207705_103465072 | 145 |
| 348 | 3300026088 | Ga0207641_10751478 | Ga0207641_107514781 | 145 |
| 349 | 3300026116 | Ga0207674_11288687 | Ga0207674_112886872 | 145 |
| 350 | 3300039437 | Ga0436365_0620989 | Ga0436365_0620989_477_917 | 145 |
| 351 | 3300039450 | Ga0436363_1204188 | Ga0436363_1204188_1456_1896 | 145 |
| 352 | 3300046518 | Ga0495631_0479187 | Ga0495631_0479187_29_469 | 145 |
| 353 | 3300048929 | Ga0496126_0048584 | Ga0496126_0048584_280_720 | 145 |
| 354 | 3300048929 | Ga0496126_0048723 | Ga0496126_0048723_2565_3005 | 145 |
| 355 | 3300049586 | Ga0501070_0695609 | Ga0501070_0695609_75_515 | 145 |
| 356 | 3300049744 | Ga0501083_0328852 | Ga0501083_0328852_447_887 | 145 |
| 357 | 3300003203 | JGI25406J46586_10004414 | JGI25406J46586_100044143 | 146 |
| 358 | 3300003214 | JGI25165J46597_1012534 | JGI25165J46597_10125342 | 146 |
| 359 | 3300003215 | JGI25153J46596_10001134 | JGI25153J46596_100011348 | 146 |
| 360 | 3300003215 | JGI25153J46596_10003236 | JGI25153J46596_100032367 | 146 |
| 361 | 3300003215 | JGI25153J46596_10009457 | JGI25153J46596_100094573 | 146 |
| 362 | 3300003215 | JGI25153J46596_10016604 | JGI25153J46596_100166042 | 146 |
| 363 | 3300003215 | JGI25153J46596_10047080 | JGI25153J46596_100470801 | 146 |
| 364 | 3300003354 | JGI25160J50197_1012741 | JGI25160J50197_10127414 | 146 |
| 365 | 3300003659 | JGI25404J52841_10003333 | JGI25404J52841_100033332 | 146 |
| 366 | 3300003659 | JGI25404J52841_10029752 | JGI25404J52841_100297522 | 146 |
| 367 | 3300003762 | Ga0055542_1037136 | Ga0055542_10371361 | 146 |
| 368 | 3300003794 | Ga0055531_10004135 | Ga0055531_100041358 | 146 |
| 369 | 3300004625 | Ga0055543_1009650 | Ga0055543_10096502 | 146 |
| 370 | 3300005262 | Ga0065165_1003814 | Ga0065165_10038149 | 146 |
| 371 | 3300005293 | Ga0065715_10357385 | Ga0065715_103573852 | 146 |
| 372 | 3300005327 | Ga0070658_11248106 | Ga0070658_112481061 | 146 |
| 373 | 3300005327 | Ga0070658_11427710 | Ga0070658_114277101 | 146 |
| 374 | 3300005329 | Ga0070683_100325152 | Ga0070683_1003251523 | 146 |
| 375 | 3300005331 | Ga0070670_100454455 | Ga0070670_1004544552 | 146 |
| 376 | 3300005334 | Ga0068869_101048429 | Ga0068869_1010484291 | 146 |
| 377 | 3300005335 | Ga0070666_10389018 | Ga0070666_103890182 | 146 |
| 378 | 3300005335 | Ga0070666_11227897 | Ga0070666_112278971 | 146 |
| 379 | 3300005336 | Ga0070680_100105949 | Ga0070680_1001059492 | 146 |
| 380 | 3300005338 | Ga0068868_100400882 | Ga0068868_1004008822 | 146 |
| 381 | 3300005339 | Ga0070660_100190658 | Ga0070660_1001906582 | 146 |
| 382 | 3300005340 | Ga0070689_100969785 | Ga0070689_1009697852 | 146 |
| 383 | 3300005343 | Ga0070687_101381990 | Ga0070687_1013819901 | 146 |
| 384 | 3300005344 | Ga0070661_100140954 | Ga0070661_1001409543 | 146 |
| 385 | 3300005347 | Ga0070668_100822140 | Ga0070668_1008221402 | 146 |
| 386 | 3300005353 | Ga0070669_100397600 | Ga0070669_1003976002 | 146 |
| 387 | 3300005354 | Ga0070675_100558745 | Ga0070675_1005587452 | 146 |
| 388 | 3300005354 | Ga0070675_100938750 | Ga0070675_1009387502 | 146 |
| 389 | 3300005355 | Ga0070671_100878563 | Ga0070671_1008785632 | 146 |
| 390 | 3300005355 | Ga0070671_101455966 | Ga0070671_1014559661 | 146 |
| 391 | 3300005356 | Ga0070674_100031034 | Ga0070674_1000310343 | 146 |
| 392 | 3300005364 | Ga0070673_100305186 | Ga0070673_1003051862 | 146 |
| 393 | 3300005364 | Ga0070673_101102683 | Ga0070673_1011026831 | 146 |
| 394 | 3300005367 | Ga0070667_101088893 | Ga0070667_1010888932 | 146 |
| 395 | 3300005434 | Ga0070709_10432253 | Ga0070709_104322531 | 146 |
| 396 | 3300005435 | Ga0070714_100030496 | Ga0070714_1000304962 | 146 |
| 397 | 3300005435 | Ga0070714_100254434 | Ga0070714_1002544342 | 146 |
| 398 | 3300005436 | Ga0070713_100464833 | Ga0070713_1004648332 | 146 |
| 399 | 3300005437 | Ga0070710_10392853 | Ga0070710_103928532 | 146 |
| 400 | 3300005455 | Ga0070663_100029162 | Ga0070663_1000291623 | 146 |
| 401 | 3300005455 | Ga0070663_100463485 | Ga0070663_1004634851 | 146 |
| 402 | 3300005455 | Ga0070663_101370384 | Ga0070663_1013703841 | 146 |
| 403 | 3300005456 | Ga0070678_100003092 | Ga0070678_1000030928 | 146 |
| 404 | 3300005457 | Ga0070662_101106580 | Ga0070662_1011065802 | 146 |
| 405 | 3300005458 | Ga0070681_11078366 | Ga0070681_110783661 | 146 |
| 406 | 3300005459 | Ga0068867_100502098 | Ga0068867_1005020982 | 146 |
| 407 | 3300005459 | Ga0068867_101235039 | Ga0068867_1012350391 | 146 |
| 408 | 3300005467 | Ga0070706_100361798 | Ga0070706_1003617981 | 146 |
| 409 | 3300005468 | Ga0070707_100316008 | Ga0070707_1003160082 | 146 |
| 410 | 3300005471 | Ga0070698_100074379 | Ga0070698_1000743794 | 146 |
| 411 | 3300005518 | Ga0070699_100388481 | Ga0070699_1003884812 | 146 |
| 412 | 3300005530 | Ga0070679_100217903 | Ga0070679_1002179032 | 146 |
| 413 | 3300005530 | Ga0070679_100568078 | Ga0070679_1005680782 | 146 |
| 414 | 3300005539 | Ga0068853_100127409 | Ga0068853_1001274092 | 146 |
| 415 | 3300005539 | Ga0068853_100336480 | Ga0068853_1003364801 | 146 |
| 416 | 3300005539 | Ga0068853_101025068 | Ga0068853_1010250681 | 146 |
| 417 | 3300005543 | Ga0070672_100049102 | Ga0070672_1000491022 | 146 |
| 418 | 3300005543 | Ga0070672_100704163 | Ga0070672_1007041632 | 146 |
| 419 | 3300005545 | Ga0070695_101130705 | Ga0070695_1011307051 | 146 |
| 420 | 3300005548 | Ga0070665_100084542 | Ga0070665_1000845421 | 146 |
| 421 | 3300005548 | Ga0070665_100169822 | Ga0070665_1001698224 | 146 |
| 422 | 3300005548 | Ga0070665_100518411 | Ga0070665_1005184111 | 146 |
| 423 | 3300005548 | Ga0070665_100784636 | Ga0070665_1007846362 | 146 |
| 424 | 3300005548 | Ga0070665_101095992 | Ga0070665_1010959922 | 146 |
| 425 | 3300005548 | Ga0070665_101146177 | Ga0070665_1011461772 | 146 |
| 426 | 3300005549 | Ga0070704_101008081 | Ga0070704_1010080811 | 146 |
| 427 | 3300005563 | Ga0068855_100587955 | Ga0068855_1005879552 | 146 |
| 428 | 3300005563 | Ga0068855_100726659 | Ga0068855_1007266592 | 146 |
| 429 | 3300005563 | Ga0068855_100864344 | Ga0068855_1008643441 | 146 |
| 430 | 3300005564 | Ga0070664_100125780 | Ga0070664_1001257802 | 146 |
| 431 | 3300005578 | Ga0068854_100202857 | Ga0068854_1002028572 | 146 |
| 432 | 3300005578 | Ga0068854_101386686 | Ga0068854_1013866861 | 146 |
| 433 | 3300005614 | Ga0068856_100157594 | Ga0068856_1001575942 | 146 |
| 434 | 3300005615 | Ga0070702_101627397 | Ga0070702_1016273971 | 146 |
| 435 | 3300005616 | Ga0068852_100005154 | Ga0068852_1000051545 | 146 |
| 436 | 3300005617 | Ga0068859_100955820 | Ga0068859_1009558202 | 146 |
| 437 | 3300005617 | Ga0068859_101901889 | Ga0068859_1019018891 | 146 |
| 438 | 3300005618 | Ga0068864_100208484 | Ga0068864_1002084842 | 146 |
| 439 | 3300005718 | Ga0068866_10149684 | Ga0068866_101496842 | 146 |
| 440 | 3300005841 | Ga0068863_100156143 | Ga0068863_1001561432 | 146 |
| 441 | 3300005841 | Ga0068863_100439669 | Ga0068863_1004396692 | 146 |
| 442 | 3300005842 | Ga0068858_100829588 | Ga0068858_1008295882 | 146 |
| 443 | 3300005843 | Ga0068860_100118797 | Ga0068860_1001187973 | 146 |
| 444 | 3300005844 | Ga0068862_100446298 | Ga0068862_1004462982 | 146 |
| 445 | 3300005937 | Ga0081455_10001332 | Ga0081455_1000133219 | 146 |
| 446 | 3300005937 | Ga0081455_10026185 | Ga0081455_100261856 | 146 |
| 447 | 3300005937 | Ga0081455_10032880 | Ga0081455_100328805 | 146 |
| 448 | 3300005937 | Ga0081455_10195085 | Ga0081455_101950853 | 146 |
| 449 | 3300005983 | Ga0081540_1002747 | Ga0081540_10027477 | 146 |
| 450 | 3300005983 | Ga0081540_1007063 | Ga0081540_10070635 | 146 |
| 451 | 3300005983 | Ga0081540_1014706 | Ga0081540_10147065 | 146 |
| 452 | 3300005985 | Ga0081539_10003211 | Ga0081539_100032118 | 146 |
| 453 | 3300005985 | Ga0081539_10003502 | Ga0081539_100035029 | 146 |
| 454 | 3300005985 | Ga0081539_10017936 | Ga0081539_100179365 | 146 |
| 455 | 3300005985 | Ga0081539_10018388 | Ga0081539_100183883 | 146 |
| 456 | 3300006028 | Ga0070717_10106977 | Ga0070717_101069772 | 146 |
| 457 | 3300006028 | Ga0070717_11780088 | Ga0070717_117800881 | 146 |
| 458 | 3300006038 | Ga0075365_10074736 | Ga0075365_100747364 | 146 |
| 459 | 3300006038 | Ga0075365_10075901 | Ga0075365_100759013 | 146 |
| 460 | 3300006038 | Ga0075365_10077246 | Ga0075365_100772463 | 146 |
| 461 | 3300006038 | Ga0075365_10094874 | Ga0075365_100948744 | 146 |
| 462 | 3300006038 | Ga0075365_10258838 | Ga0075365_102588382 | 146 |
| 463 | 3300006038 | Ga0075365_10344734 | Ga0075365_103447342 | 146 |
| 464 | 3300006042 | Ga0075368_10010232 | Ga0075368_100102322 | 146 |
| 465 | 3300006048 | Ga0075363_100012149 | Ga0075363_1000121492 | 146 |
| 466 | 3300006048 | Ga0075363_100018535 | Ga0075363_1000185353 | 146 |
| 467 | 3300006051 | Ga0075364_10006018 | Ga0075364_100060184 | 146 |
| 468 | 3300006051 | Ga0075364_10015976 | Ga0075364_100159763 | 146 |
| 469 | 3300006163 | Ga0070715_10180891 | Ga0070715_101808912 | 146 |
| 470 | 3300006163 | Ga0070715_10296864 | Ga0070715_102968641 | 146 |
| 471 | 3300006173 | Ga0070716_101462518 | Ga0070716_1014625181 | 146 |
| 472 | 3300006175 | Ga0070712_100441599 | Ga0070712_1004415992 | 146 |
| 473 | 3300006177 | Ga0075362_10003916 | Ga0075362_100039163 | 146 |
| 474 | 3300006177 | Ga0075362_10231095 | Ga0075362_102310952 | 146 |
| 475 | 3300006178 | Ga0075367_10038406 | Ga0075367_100384063 | 146 |
| 476 | 3300006178 | Ga0075367_10170466 | Ga0075367_101704662 | 146 |
| 477 | 3300006178 | Ga0075367_10179276 | Ga0075367_101792762 | 146 |
| 478 | 3300006186 | Ga0075369_10017261 | Ga0075369_100172611 | 146 |
| 479 | 3300006186 | Ga0075369_10026495 | Ga0075369_100264954 | 146 |
| 480 | 3300006186 | Ga0075369_10059198 | Ga0075369_100591982 | 146 |
| 481 | 3300006195 | Ga0075366_10011900 | Ga0075366_100119004 | 146 |
| 482 | 3300006195 | Ga0075366_10019386 | Ga0075366_100193864 | 146 |
| 483 | 3300006195 | Ga0075366_10024339 | Ga0075366_100243394 | 146 |
| 484 | 3300006237 | Ga0097621_100889785 | Ga0097621_1008897852 | 146 |
| 485 | 3300006353 | Ga0075370_10017821 | Ga0075370_100178213 | 146 |
| 486 | 3300006353 | Ga0075370_10028156 | Ga0075370_100281563 | 146 |
| 487 | 3300006353 | Ga0075370_10167745 | Ga0075370_101677452 | 146 |
| 488 | 3300006353 | Ga0075370_10359035 | Ga0075370_103590352 | 146 |
| 489 | 3300006353 | Ga0075370_11014985 | Ga0075370_110149851 | 146 |
| 490 | 3300006358 | Ga0068871_100471553 | Ga0068871_1004715531 | 146 |
| 491 | 3300006846 | Ga0075430_100356590 | Ga0075430_1003565901 | 146 |
| 492 | 3300006846 | Ga0075430_101214397 | Ga0075430_1012143971 | 146 |
| 493 | 3300006847 | Ga0075431_100048608 | Ga0075431_1000486083 | 146 |
| 494 | 3300006847 | Ga0075431_100070799 | Ga0075431_1000707992 | 146 |
| 495 | 3300006852 | Ga0075433_10537269 | Ga0075433_105372692 | 146 |
| 496 | 3300006880 | Ga0075429_100005400 | Ga0075429_1000054002 | 146 |
| 497 | 3300006881 | Ga0068865_100196644 | Ga0068865_1001966442 | 146 |
| 498 | 3300006931 | Ga0097620_100955774 | Ga0097620_1009557742 | 146 |
| 499 | 3300006931 | Ga0097620_101901597 | Ga0097620_1019015971 | 146 |
| 500 | 3300006941 | Ga0099825_1028430 | Ga0099825_10284301 | 146 |
| 501 | 3300006942 | Ga0099824_1014343 | Ga0099824_10143437 | 146 |
| 502 | 3300006944 | Ga0099823_1010603 | Ga0099823_10106038 | 146 |
| 503 | 3300007788 | Ga0099795_10061490 | Ga0099795_100614901 | 146 |
| 504 | 3300009093 | Ga0105240_10014502 | Ga0105240_100145029 | 146 |
| 505 | 3300009093 | Ga0105240_12153193 | Ga0105240_121531931 | 146 |
| 506 | 3300009094 | Ga0111539_10144285 | Ga0111539_101442853 | 146 |
| 507 | 3300009094 | Ga0111539_10205773 | Ga0111539_102057733 | 146 |
| 508 | 3300009098 | Ga0105245_10230300 | Ga0105245_102303002 | 146 |
| 509 | 3300009098 | Ga0105245_11036517 | Ga0105245_110365171 | 146 |
| 510 | 3300009101 | Ga0105247_10900988 | Ga0105247_109009881 | 146 |
| 511 | 3300009147 | Ga0114129_10063906 | Ga0114129_100639062 | 146 |
| 512 | 3300009148 | Ga0105243_10104007 | Ga0105243_101040072 | 146 |
| 513 | 3300009148 | Ga0105243_10491022 | Ga0105243_104910222 | 146 |
| 514 | 3300009174 | Ga0105241_10144238 | Ga0105241_101442383 | 146 |
| 515 | 3300009176 | Ga0105242_11620060 | Ga0105242_116200601 | 146 |
| 516 | 3300009176 | Ga0105242_11741629 | Ga0105242_117416291 | 146 |
| 517 | 3300009177 | Ga0105248_10144108 | Ga0105248_101441081 | 146 |
| 518 | 3300009545 | Ga0105237_10011109 | Ga0105237_100111093 | 146 |
| 519 | 3300009545 | Ga0105237_10121243 | Ga0105237_101212433 | 146 |
| 520 | 3300009545 | Ga0105237_10229709 | Ga0105237_102297094 | 146 |
| 521 | 3300009545 | Ga0105237_10231483 | Ga0105237_102314833 | 146 |
| 522 | 3300009545 | Ga0105237_11145491 | Ga0105237_111454912 | 146 |
| 523 | 3300009551 | Ga0105238_10587335 | Ga0105238_105873352 | 146 |
| 524 | 3300009551 | Ga0105238_10773199 | Ga0105238_107731991 | 146 |
| 525 | 3300009551 | Ga0105238_10917319 | Ga0105238_109173192 | 146 |
| 526 | 3300009551 | Ga0105238_12217183 | Ga0105238_122171831 | 146 |
| 527 | 3300010375 | Ga0105239_10102400 | Ga0105239_101024003 | 146 |
| 528 | 3300010375 | Ga0105239_10307416 | Ga0105239_103074163 | 146 |
| 529 | 3300011119 | Ga0105246_10012518 | Ga0105246_100125182 | 146 |
| 530 | 3300013102 | Ga0157371_10120382 | Ga0157371_101203822 | 146 |
| 531 | 3300013104 | Ga0157370_11237297 | Ga0157370_112372971 | 146 |
| 532 | 3300013105 | Ga0157369_10454431 | Ga0157369_104544312 | 146 |
| 533 | 3300013296 | Ga0157374_10112947 | Ga0157374_101129472 | 146 |
| 534 | 3300013296 | Ga0157374_10720385 | Ga0157374_107203852 | 146 |
| 535 | 3300013297 | Ga0157378_10457761 | Ga0157378_104577613 | 146 |
| 536 | 3300013297 | Ga0157378_12280702 | Ga0157378_122807022 | 146 |
| 537 | 3300013306 | Ga0163162_10718957 | Ga0163162_107189572 | 146 |
| 538 | 3300013307 | Ga0157372_10821700 | Ga0157372_108217001 | 146 |
| 539 | 3300013307 | Ga0157372_11232324 | Ga0157372_112323241 | 146 |
| 540 | 3300013308 | Ga0157375_10402868 | Ga0157375_104028681 | 146 |
| 541 | 3300013308 | Ga0157375_10913973 | Ga0157375_109139732 | 146 |
| 542 | 3300014325 | Ga0163163_10483978 | Ga0163163_104839782 | 146 |
| 543 | 3300014968 | Ga0157379_10603076 | Ga0157379_106030762 | 146 |
| 544 | 3300014969 | Ga0157376_10777036 | Ga0157376_107770362 | 146 |
| 545 | 3300017792 | Ga0163161_10066998 | Ga0163161_100669982 | 146 |
| 546 | 3300017792 | Ga0163161_11164591 | Ga0163161_111645912 | 146 |
| 547 | 3300021320 | Ga0214544_1000011 | Ga0214544_100001146 | 146 |
| 548 | 3300021320 | Ga0214544_1037611 | Ga0214544_10376112 | 146 |
| 549 | 3300021321 | Ga0214542_1000009 | Ga0214542_1000009196 | 146 |
| 550 | 3300021321 | Ga0214542_1040708 | Ga0214542_10407082 | 146 |
| 551 | 3300021324 | Ga0214545_1000007 | Ga0214545_100000746 | 146 |
| 552 | 3300021324 | Ga0214545_1021801 | Ga0214545_10218015 | 146 |
| 553 | 3300021327 | Ga0214543_1000020 | Ga0214543_1000020196 | 146 |
| 554 | 3300021327 | Ga0214543_1034552 | Ga0214543_10345522 | 146 |
| 555 | 3300025230 | Ga0209563_104176 | Ga0209563_1041763 | 146 |
| 556 | 3300025254 | Ga0209148_1000707 | Ga0209148_100070723 | 146 |
| 557 | 3300025261 | Ga0209233_1004187 | Ga0209233_10041875 | 146 |
| 558 | 3300025272 | Ga0209455_1001372 | Ga0209455_10013726 | 146 |
| 559 | 3300025295 | Ga0209564_1004298 | Ga0209564_10042982 | 146 |
| 560 | 3300025295 | Ga0209564_1014730 | Ga0209564_10147302 | 146 |
| 561 | 3300025297 | Ga0209758_1000088 | Ga0209758_100008890 | 146 |
| 562 | 3300025297 | Ga0209758_1000106 | Ga0209758_1000106140 | 146 |
| 563 | 3300025297 | Ga0209758_1002346 | Ga0209758_10023467 | 146 |
| 564 | 3300025297 | Ga0209758_1004848 | Ga0209758_10048484 | 146 |
| 565 | 3300025297 | Ga0209758_1005033 | Ga0209758_10050337 | 146 |
| 566 | 3300025297 | Ga0209758_1005694 | Ga0209758_10056947 | 146 |
| 567 | 3300025297 | Ga0209758_1005984 | Ga0209758_10059847 | 146 |
| 568 | 3300025297 | Ga0209758_1065498 | Ga0209758_10654981 | 146 |
| 569 | 3300025299 | Ga0209256_1003346 | Ga0209256_100334610 | 146 |
| 570 | 3300025299 | Ga0209256_1030804 | Ga0209256_10308042 | 146 |
| 571 | 3300025302 | Ga0207426_1000337 | Ga0207426_10003377 | 146 |
| 572 | 3300025302 | Ga0207426_1002354 | Ga0207426_10023546 | 146 |
| 573 | 3300025302 | Ga0207426_1007721 | Ga0207426_10077214 | 146 |
| 574 | 3300025302 | Ga0207426_1009646 | Ga0207426_10096463 | 146 |
| 575 | 3300025303 | Ga0209051_1042694 | Ga0209051_10426942 | 146 |
| 576 | 3300025304 | Ga0209257_1000684 | Ga0209257_10006848 | 146 |
| 577 | 3300025304 | Ga0209257_1009117 | Ga0209257_10091174 | 146 |
| 578 | 3300025304 | Ga0209257_1046344 | Ga0209257_10463442 | 146 |
| 579 | 3300025315 | Ga0207697_10026025 | Ga0207697_100260251 | 146 |
| 580 | 3300025893 | Ga0207682_10007221 | Ga0207682_100072214 | 146 |
| 581 | 3300025899 | Ga0207642_10138451 | Ga0207642_101384512 | 146 |
| 582 | 3300025901 | Ga0207688_10119257 | Ga0207688_101192572 | 146 |
| 583 | 3300025903 | Ga0207680_10386371 | Ga0207680_103863711 | 146 |
| 584 | 3300025904 | Ga0207647_10052997 | Ga0207647_100529972 | 146 |
| 585 | 3300025904 | Ga0207647_10226681 | Ga0207647_102266811 | 146 |
| 586 | 3300025905 | Ga0207685_10269363 | Ga0207685_102693631 | 146 |
| 587 | 3300025906 | Ga0207699_10741159 | Ga0207699_107411591 | 146 |
| 588 | 3300025909 | Ga0207705_10061230 | Ga0207705_100612302 | 146 |
| 589 | 3300025910 | Ga0207684_10289008 | Ga0207684_102890081 | 146 |
| 590 | 3300025911 | Ga0207654_10408922 | Ga0207654_104089222 | 146 |
| 591 | 3300025913 | Ga0207695_10000478 | Ga0207695_1000047834 | 146 |
| 592 | 3300025913 | Ga0207695_11366995 | Ga0207695_113669951 | 146 |
| 593 | 3300025914 | Ga0207671_10003206 | Ga0207671_100032069 | 146 |
| 594 | 3300025914 | Ga0207671_10034599 | Ga0207671_100345994 | 146 |
| 595 | 3300025914 | Ga0207671_11371331 | Ga0207671_113713311 | 146 |
| 596 | 3300025915 | Ga0207693_10039417 | Ga0207693_100394173 | 146 |
| 597 | 3300025915 | Ga0207693_10065145 | Ga0207693_100651453 | 146 |
| 598 | 3300025916 | Ga0207663_10041428 | Ga0207663_100414284 | 146 |
| 599 | 3300025918 | Ga0207662_10044943 | Ga0207662_100449432 | 146 |
| 600 | 3300025919 | Ga0207657_10113299 | Ga0207657_101132991 | 146 |
| 601 | 3300025923 | Ga0207681_10823460 | Ga0207681_108234602 | 146 |
| 602 | 3300025923 | Ga0207681_10877985 | Ga0207681_108779851 | 146 |
| 603 | 3300025924 | Ga0207694_10604681 | Ga0207694_106046811 | 146 |
| 604 | 3300025924 | Ga0207694_11146041 | Ga0207694_111460412 | 146 |
| 605 | 3300025926 | Ga0207659_10724062 | Ga0207659_107240622 | 146 |
| 606 | 3300025927 | Ga0207687_11198091 | Ga0207687_111980911 | 146 |
| 607 | 3300025928 | Ga0207700_10954497 | Ga0207700_109544972 | 146 |
| 608 | 3300025931 | Ga0207644_10161659 | Ga0207644_101616592 | 146 |
| 609 | 3300025931 | Ga0207644_10387053 | Ga0207644_103870532 | 146 |
| 610 | 3300025932 | Ga0207690_10164092 | Ga0207690_101640922 | 146 |
| 611 | 3300025933 | Ga0207706_10399559 | Ga0207706_103995591 | 146 |
| 612 | 3300025934 | Ga0207686_10409587 | Ga0207686_104095872 | 146 |
| 613 | 3300025936 | Ga0207670_10889945 | Ga0207670_108899451 | 146 |
| 614 | 3300025936 | Ga0207670_11309239 | Ga0207670_113092391 | 146 |
| 615 | 3300025937 | Ga0207669_10047202 | Ga0207669_100472022 | 146 |
| 616 | 3300025937 | Ga0207669_10904267 | Ga0207669_109042672 | 146 |
| 617 | 3300025938 | Ga0207704_10268052 | Ga0207704_102680521 | 146 |
| 618 | 3300025939 | Ga0207665_10355518 | Ga0207665_103555182 | 146 |
| 619 | 3300025939 | Ga0207665_10682269 | Ga0207665_106822692 | 146 |
| 620 | 3300025939 | Ga0207665_11025669 | Ga0207665_110256692 | 146 |
| 621 | 3300025940 | Ga0207691_10093307 | Ga0207691_100933072 | 146 |
| 622 | 3300025940 | Ga0207691_10136939 | Ga0207691_101369394 | 146 |
| 623 | 3300025940 | Ga0207691_10672961 | Ga0207691_106729612 | 146 |
| 624 | 3300025942 | Ga0207689_10507330 | Ga0207689_105073302 | 146 |
| 625 | 3300025944 | Ga0207661_10512137 | Ga0207661_105121373 | 146 |
| 626 | 3300025945 | Ga0207679_10389319 | Ga0207679_103893192 | 146 |
| 627 | 3300025949 | Ga0207667_10594892 | Ga0207667_105948922 | 146 |
| 628 | 3300025949 | Ga0207667_10853575 | Ga0207667_108535751 | 146 |
| 629 | 3300025949 | Ga0207667_11310256 | Ga0207667_113102561 | 146 |
| 630 | 3300025960 | Ga0207651_10783317 | Ga0207651_107833172 | 146 |
| 631 | 3300025961 | Ga0207712_10267410 | Ga0207712_102674102 | 146 |
| 632 | 3300025972 | Ga0207668_10812227 | Ga0207668_108122271 | 146 |
| 633 | 3300025981 | Ga0207640_10457375 | Ga0207640_104573751 | 146 |
| 634 | 3300025981 | Ga0207640_10674880 | Ga0207640_106748801 | 146 |
| 635 | 3300025986 | Ga0207658_10126154 | Ga0207658_101261542 | 146 |
| 636 | 3300025986 | Ga0207658_10567023 | Ga0207658_105670232 | 146 |
| 637 | 3300025986 | Ga0207658_11525757 | Ga0207658_115257571 | 146 |
| 638 | 3300026023 | Ga0207677_10289706 | Ga0207677_102897061 | 146 |
| 639 | 3300026023 | Ga0207677_10383814 | Ga0207677_103838142 | 146 |
| 640 | 3300026035 | Ga0207703_10261444 | Ga0207703_102614441 | 146 |
| 641 | 3300026041 | Ga0207639_10249059 | Ga0207639_102490592 | 146 |
| 642 | 3300026041 | Ga0207639_10932548 | Ga0207639_109325482 | 146 |
| 643 | 3300026041 | Ga0207639_11111372 | Ga0207639_111113721 | 146 |
| 644 | 3300026067 | Ga0207678_10018506 | Ga0207678_100185063 | 146 |
| 645 | 3300026067 | Ga0207678_10087188 | Ga0207678_100871882 | 146 |
| 646 | 3300026067 | Ga0207678_10484970 | Ga0207678_104849701 | 146 |
| 647 | 3300026075 | Ga0207708_10038627 | Ga0207708_100386272 | 146 |
| 648 | 3300026078 | Ga0207702_10386182 | Ga0207702_103861822 | 146 |
| 649 | 3300026078 | Ga0207702_11207456 | Ga0207702_112074561 | 146 |
| 650 | 3300026088 | Ga0207641_10190665 | Ga0207641_101906653 | 146 |
| 651 | 3300026088 | Ga0207641_10386112 | Ga0207641_103861122 | 146 |
| 652 | 3300026089 | Ga0207648_10138524 | Ga0207648_101385243 | 146 |
| 653 | 3300026089 | Ga0207648_10160389 | Ga0207648_101603892 | 146 |
| 654 | 3300026089 | Ga0207648_10864554 | Ga0207648_108645542 | 146 |
| 655 | 3300026095 | Ga0207676_10292136 | Ga0207676_102921361 | 146 |
| 656 | 3300026095 | Ga0207676_11099073 | Ga0207676_110990732 | 146 |
| 657 | 3300026116 | Ga0207674_10199570 | Ga0207674_101995703 | 146 |
| 658 | 3300026116 | Ga0207674_10221090 | Ga0207674_102210902 | 146 |
| 659 | 3300026116 | Ga0207674_10285202 | Ga0207674_102852022 | 146 |
| 660 | 3300026118 | Ga0207675_100064150 | Ga0207675_1000641503 | 146 |
| 661 | 3300026118 | Ga0207675_100360379 | Ga0207675_1003603792 | 146 |
| 662 | 3300026118 | Ga0207675_101736904 | Ga0207675_1017369041 | 146 |
| 663 | 3300026121 | Ga0207683_10006624 | Ga0207683_100066245 | 146 |
| 664 | 3300027296 | Ga0209389_1000016 | Ga0209389_100001666 | 146 |
| 665 | 3300027296 | Ga0209389_1000027 | Ga0209389_100002780 | 146 |
| 666 | 3300027357 | Ga0209589_1000031 | Ga0209589_100003192 | 146 |
| 667 | 3300027361 | Ga0209489_100057 | Ga0209489_10005755 | 146 |
| 668 | 3300027361 | Ga0209489_100063 | Ga0209489_10006324 | 146 |
| 669 | 3300027363 | Ga0209700_100012 | Ga0209700_10001267 | 146 |
| 670 | 3300027512 | Ga0209179_1150651 | Ga0209179_11506511 | 146 |
| 671 | 3300027866 | Ga0209813_10007065 | Ga0209813_100070653 | 146 |
| 672 | 3300027907 | Ga0207428_10378273 | Ga0207428_103782732 | 146 |
| 673 | 3300028379 | Ga0268266_10042057 | Ga0268266_100420571 | 146 |
| 674 | 3300028379 | Ga0268266_10065542 | Ga0268266_100655424 | 146 |
| 675 | 3300028379 | Ga0268266_10934277 | Ga0268266_109342772 | 146 |
| 676 | 3300028380 | Ga0268265_10217616 | Ga0268265_102176162 | 146 |
| 677 | 3300028380 | Ga0268265_10790384 | Ga0268265_107903842 | 146 |
| 678 | 3300028380 | Ga0268265_11322935 | Ga0268265_113229352 | 146 |
| 679 | 3300028381 | Ga0268264_10073031 | Ga0268264_100730313 | 146 |
| 680 | 3300028381 | Ga0268264_11335280 | Ga0268264_113352802 | 146 |
| 681 | 3300031548 | Ga0307408_100016075 | Ga0307408_1000160752 | 146 |
| 682 | 3300031616 | Ga0307508_10558890 | Ga0307508_105588902 | 146 |
| 683 | 3300031731 | Ga0307405_10815821 | Ga0307405_108158212 | 146 |
| 684 | 3300031824 | Ga0307413_10177153 | Ga0307413_101771531 | 146 |
| 685 | 3300031903 | Ga0307407_10239427 | Ga0307407_102394272 | 146 |
| 686 | 3300031911 | Ga0307412_10277039 | Ga0307412_102770392 | 146 |
| 687 | 3300032002 | Ga0307416_101108066 | Ga0307416_1011080661 | 146 |
| 688 | 3300032005 | Ga0307411_10216058 | Ga0307411_102160582 | 146 |
| 689 | 3300033180 | Ga0307510_10014233 | Ga0307510_100142337 | 146 |
| 690 | 3300033180 | Ga0307510_10371714 | Ga0307510_103717141 | 146 |
| 691 | 3300035113 | Ga0373936_0019234 | Ga0373936_0019234_1312_1761 | 146 |
| 692 | 3300035113 | Ga0373936_0033299 | Ga0373936_0033299_186_629 | 146 |
| 693 | 3300035170 | Ga0373943_0043483 | Ga0373943_0043483_1103_1552 | 146 |
| 694 | 3300035171 | Ga0373946_0336415 | Ga0373946_0336415_14_463 | 146 |
| 695 | 3300035172 | Ga0373955_0127771 | Ga0373955_0127771_978_1427 | 146 |
| 696 | 3300035695 | Ga0373927_0154520 | Ga0373927_0154520_295_744 | 146 |
| 697 | 3300035695 | Ga0373927_0215435 | Ga0373927_0215435_257_706 | 146 |
| 698 | 3300035695 | Ga0373927_0249701 | Ga0373927_0249701_51_494 | 146 |
| 699 | 3300037068 | Ga0373925_0192937 | Ga0373925_0192937_220_663 | 146 |
| 700 | 3300037418 | Ga0395900_0037623 | Ga0395900_0037623_4178_4621 | 146 |
| 701 | 3300037418 | Ga0395900_0989418 | Ga0395900_0989418_51_494 | 146 |
| 702 | 3300037466 | Ga0395898_0015240 | Ga0395898_0015240_3975_4418 | 146 |
| 703 | 3300037471 | Ga0395905_0033626 | Ga0395905_0033626_145_588 | 146 |
| 704 | 3300037471 | Ga0395905_0595133 | Ga0395905_0595133_470_913 | 146 |
| 705 | 3300037471 | Ga0395905_1015226 | Ga0395905_1015226_120_563 | 146 |
| 706 | 3300037853 | Ga0436364_0082096 | Ga0436364_0082096_137_580 | 146 |
| 707 | 3300038443 | Ga0395901_0037234 | Ga0395901_0037234_425_868 | 146 |
| 708 | 3300038443 | Ga0395901_0074312 | Ga0395901_0074312_1016_1459 | 146 |
| 709 | 3300038443 | Ga0395901_1455676 | Ga0395901_1455676_148_591 | 146 |
| 710 | 3300041408 | Ga0439453_0001001 | Ga0439453_0001001_1286_1750 | 146 |
| 711 | 3300041443 | Ga0451789_0651678 | Ga0451789_0651678_93_536 | 146 |
| 712 | 3300042003 | Ga0439443_036147 | Ga0439443_036147_20_484 | 146 |
| 713 | 3300042436 | Ga0439435_0107580 | Ga0439435_0107580_76_540 | 146 |
| 714 | 3300042461 | Ga0439460_0008111 | Ga0439460_0008111_11_475 | 146 |
| 715 | 3300044658 | Ga0466972_0009680 | Ga0466972_0009680_3567_4010 | 146 |
| 716 | 3300044683 | Ga0466965_0085702 | Ga0466965_0085702_72_515 | 146 |
| 717 | 3300044684 | Ga0466966_0001941 | Ga0466966_0001941_7767_8210 | 146 |
| 718 | 3300044693 | Ga0466961_0000136 | Ga0466961_0000136_7779_8222 | 146 |
| 719 | 3300044694 | Ga0466963_0134279 | Ga0466963_0134279_34_477 | 146 |
| 720 | 3300044694 | Ga0466963_0718024 | Ga0466963_0718024_94_534 | 146 |
| 721 | 3300044735 | Ga0466968_0204030 | Ga0466968_0204030_272_715 | 146 |
| 722 | 3300044735 | Ga0466968_0450894 | Ga0466968_0450894_52_495 | 146 |
| 723 | 3300044765 | Ga0466970_0089373 | Ga0466970_0089373_913_1356 | 146 |
| 724 | 3300044901 | Ga0466960_0058091 | Ga0466960_0058091_117_560 | 146 |
| 725 | 3300045049 | Ga0466959_0018900 | Ga0466959_0018900_74_517 | 146 |
| 726 | 3300045049 | Ga0466959_0325495 | Ga0466959_0325495_106_549 | 146 |
| 727 | 3300045049 | Ga0466959_1019042 | Ga0466959_1019042_10_453 | 146 |
| 728 | 3300045976 | Ga0466967_0167506 | Ga0466967_0167506_58_501 | 146 |
| 729 | 3300046454 | Ga0495592_0648223 | Ga0495592_0648223_61_504 | 146 |
| 730 | 3300046455 | Ga0495603_0557422 | Ga0495603_0557422_59_502 | 146 |
| 731 | 3300046459 | Ga0495629_0016818 | Ga0495629_0016818_1086_1529 | 146 |
| 732 | 3300046459 | Ga0495629_0152827 | Ga0495629_0152827_672_1121 | 146 |
| 733 | 3300046460 | Ga0495638_0016852 | Ga0495638_0016852_19_462 | 146 |
| 734 | 3300046460 | Ga0495638_0064183 | Ga0495638_0064183_580_1023 | 146 |
| 735 | 3300046462 | Ga0495651_0002380 | Ga0495651_0002380_11533_11976 | 146 |
| 736 | 3300046463 | Ga0495653_0180145 | Ga0495653_0180145_124_567 | 146 |
| 737 | 3300046471 | Ga0495650_0057495 | Ga0495650_0057495_1090_1533 | 146 |
| 738 | 3300046474 | Ga0495605_0024252 | Ga0495605_0024252_1827_2270 | 146 |
| 739 | 3300046474 | Ga0495605_0044520 | Ga0495605_0044520_701_1144 | 146 |
| 740 | 3300046474 | Ga0495605_0076334 | Ga0495605_0076334_77_520 | 146 |
| 741 | 3300046476 | Ga0495662_0048456 | Ga0495662_0048456_1083_1532 | 146 |
| 742 | 3300046476 | Ga0495662_0113884 | Ga0495662_0113884_160_609 | 146 |
| 743 | 3300046492 | Ga0495585_0164234 | Ga0495585_0164234_102_548 | 146 |
| 744 | 3300046501 | Ga0495607_0088400 | Ga0495607_0088400_530_973 | 146 |
| 745 | 3300046506 | Ga0495583_0020666 | Ga0495583_0020666_225_668 | 146 |
| 746 | 3300046506 | Ga0495583_0114690 | Ga0495583_0114690_41_484 | 146 |
| 747 | 3300046506 | Ga0495583_0204801 | Ga0495583_0204801_194_637 | 146 |
| 748 | 3300046507 | Ga0495606_0012396 | Ga0495606_0012396_2037_2480 | 146 |
| 749 | 3300046511 | Ga0495608_0083854 | Ga0495608_0083854_1584_2027 | 146 |
| 750 | 3300046511 | Ga0495608_0163701 | Ga0495608_0163701_944_1387 | 146 |
| 751 | 3300046512 | Ga0495610_0084953 | Ga0495610_0084953_650_1093 | 146 |
| 752 | 3300046513 | Ga0495616_0167354 | Ga0495616_0167354_443_886 | 146 |
| 753 | 3300046513 | Ga0495616_0359938 | Ga0495616_0359938_67_510 | 146 |
| 754 | 3300046515 | Ga0495620_0055003 | Ga0495620_0055003_701_1144 | 146 |
| 755 | 3300046515 | Ga0495620_0055233 | Ga0495620_0055233_229_672 | 146 |
| 756 | 3300046516 | Ga0495628_0220286 | Ga0495628_0220286_32_475 | 146 |
| 757 | 3300046516 | Ga0495628_0750522 | Ga0495628_0750522_222_665 | 146 |
| 758 | 3300046517 | Ga0495630_0104051 | Ga0495630_0104051_200_649 | 146 |
| 759 | 3300046518 | Ga0495631_0364261 | Ga0495631_0364261_107_550 | 146 |
| 760 | 3300046519 | Ga0495632_0420318 | Ga0495632_0420318_39_482 | 146 |
| 761 | 3300046520 | Ga0495637_0048898 | Ga0495637_0048898_320_763 | 146 |
| 762 | 3300046522 | Ga0495643_0010042 | Ga0495643_0010042_5305_5748 | 146 |
| 763 | 3300046522 | Ga0495643_0053044 | Ga0495643_0053044_1353_1796 | 146 |
| 764 | 3300046522 | Ga0495643_0436995 | Ga0495643_0436995_40_483 | 146 |
| 765 | 3300046524 | Ga0495648_0004620 | Ga0495648_0004620_11085_11528 | 146 |
| 766 | 3300046524 | Ga0495648_0049275 | Ga0495648_0049275_78_521 | 146 |
| 767 | 3300046524 | Ga0495648_0057380 | Ga0495648_0057380_156_599 | 146 |
| 768 | 3300046524 | Ga0495648_0434609 | Ga0495648_0434609_102_545 | 146 |
| 769 | 3300046524 | Ga0495648_0446885 | Ga0495648_0446885_31_474 | 146 |
| 770 | 3300046526 | Ga0495666_0387388 | Ga0495666_0387388_117_566 | 146 |
| 771 | 3300046529 | Ga0495652_0004532 | Ga0495652_0004532_5512_5955 | 146 |
| 772 | 3300046529 | Ga0495652_0087578 | Ga0495652_0087578_1193_1636 | 146 |
| 773 | 3300046530 | Ga0495654_0138044 | Ga0495654_0138044_449_892 | 146 |
| 774 | 3300046530 | Ga0495654_0170372 | Ga0495654_0170372_32_475 | 146 |
| 775 | 3300046531 | Ga0495665_0219626 | Ga0495665_0219626_508_957 | 146 |
| 776 | 3300046533 | Ga0495640_0019303 | Ga0495640_0019303_1644_2093 | 146 |
| 777 | 3300046533 | Ga0495640_0262611 | Ga0495640_0262611_316_759 | 146 |
| 778 | 3300046533 | Ga0495640_0380468 | Ga0495640_0380468_358_807 | 146 |
| 779 | 3300046535 | Ga0495586_0099642 | Ga0495586_0099642_1134_1583 | 146 |
| 780 | 3300046536 | Ga0495587_0011034 | Ga0495587_0011034_193_636 | 146 |
| 781 | 3300046536 | Ga0495587_0133453 | Ga0495587_0133453_675_1118 | 146 |
| 782 | 3300046537 | Ga0495598_0323464 | Ga0495598_0323464_12_455 | 146 |
| 783 | 3300046538 | Ga0495609_0061619 | Ga0495609_0061619_1038_1481 | 146 |
| 784 | 3300046543 | Ga0495645_0005471 | Ga0495645_0005471_4508_4951 | 146 |
| 785 | 3300046557 | Ga0495622_0034440 | Ga0495622_0034440_909_1352 | 146 |
| 786 | 3300046557 | Ga0495622_0083079 | Ga0495622_0083079_333_776 | 146 |
| 787 | 3300046557 | Ga0495622_0123645 | Ga0495622_0123645_93_536 | 146 |
| 788 | 3300046559 | Ga0495667_0037776 | Ga0495667_0037776_745_1188 | 146 |
| 789 | 3300046559 | Ga0495667_0270918 | Ga0495667_0270918_533_982 | 146 |
| 790 | 3300046616 | Ga0495668_0071584 | Ga0495668_0071584_80_523 | 146 |
| 791 | 3300046642 | Ga0495634_0017152 | Ga0495634_0017152_1818_2261 | 146 |
| 792 | 3300046642 | Ga0495634_0033514 | Ga0495634_0033514_1766_2215 | 146 |
| 793 | 3300046642 | Ga0495634_0049299 | Ga0495634_0049299_1039_1488 | 146 |
| 794 | 3300046642 | Ga0495634_0151463 | Ga0495634_0151463_72_515 | 146 |
| 795 | 3300046660 | Ga0495625_0025297 | Ga0495625_0025297_4034_4477 | 146 |
| 796 | 3300046660 | Ga0495625_0152047 | Ga0495625_0152047_503_946 | 146 |
| 797 | 3300046660 | Ga0495625_0173816 | Ga0495625_0173816_833_1276 | 146 |
| 798 | 3300046663 | Ga0495635_0153569 | Ga0495635_0153569_49_492 | 146 |
| 799 | 3300046665 | Ga0495661_0078710 | Ga0495661_0078710_1384_1827 | 146 |
| 800 | 3300046674 | Ga0495588_0005519 | Ga0495588_0005519_4584_5027 | 146 |
| 801 | 3300046675 | Ga0495657_0006838 | Ga0495657_0006838_2232_2675 | 146 |
| 802 | 3300046678 | Ga0495599_0014177 | Ga0495599_0014177_1375_1818 | 146 |
| 803 | 3300046679 | Ga0495623_0005381 | Ga0495623_0005381_6779_7222 | 146 |
| 804 | 3300046680 | Ga0495646_0398330 | Ga0495646_0398330_16_459 | 146 |
| 805 | 3300046689 | Ga0495613_0020037 | Ga0495613_0020037_739_1182 | 146 |
| 806 | 3300046689 | Ga0495613_0957963 | Ga0495613_0957963_31_474 | 146 |
| 807 | 3300046690 | Ga0495624_0392726 | Ga0495624_0392726_138_587 | 146 |
| 808 | 3300046691 | Ga0495670_0026322 | Ga0495670_0026322_266_709 | 146 |
| 809 | 3300046692 | Ga0495671_0035145 | Ga0495671_0035145_157_600 | 146 |
| 810 | 3300046692 | Ga0495671_0345388 | Ga0495671_0345388_73_516 | 146 |
| 811 | 3300046694 | Ga0495649_0012812 | Ga0495649_0012812_3387_3830 | 146 |
| 812 | 3300046809 | Ga0495600_0102634 | Ga0495600_0102634_1388_1831 | 146 |
| 813 | 3300046810 | Ga0495660_0151860 | Ga0495660_0151860_10_453 | 146 |
| 814 | 3300047317 | Ga0495604_0011413 | Ga0495604_0011413_2578_3021 | 146 |
| 815 | 3300047317 | Ga0495604_0042818 | Ga0495604_0042818_960_1403 | 146 |
| 816 | 3300047318 | Ga0495636_0193810 | Ga0495636_0193810_363_806 | 146 |
| 817 | 3300047319 | Ga0495674_0027148 | Ga0495674_0027148_1876_2319 | 146 |
| 818 | 3300047320 | Ga0495672_0021766 | Ga0495672_0021766_856_1302 | 146 |
| 819 | 3300047321 | Ga0495676_0192779 | Ga0495676_0192779_293_736 | 146 |
| 820 | 3300047322 | Ga0495680_0015402 | Ga0495680_0015402_5940_6383 | 146 |
| 821 | 3300047323 | Ga0495683_0073082 | Ga0495683_0073082_1211_1654 | 146 |
| 822 | 3300047443 | Ga0495687_019104 | Ga0495687_019104_2782_3225 | 146 |
| 823 | 3300047444 | Ga0495675_0148431 | Ga0495675_0148431_979_1422 | 146 |
| 824 | 3300047445 | Ga0495677_0234833 | Ga0495677_0234833_31_474 | 146 |
| 825 | 3300047471 | Ga0495684_0124268 | Ga0495684_0124268_1050_1499 | 146 |
| 826 | 3300047472 | Ga0495686_0018634 | Ga0495686_0018634_1764_2207 | 146 |
| 827 | 3300047472 | Ga0495686_0035947 | Ga0495686_0035947_165_608 | 146 |
| 828 | 3300047472 | Ga0495686_0084022 | Ga0495686_0084022_827_1270 | 146 |
| 829 | 3300047472 | Ga0495686_0284314 | Ga0495686_0284314_151_594 | 146 |
| 830 | 3300048088 | Ga0495602_0009068 | Ga0495602_0009068_7754_8197 | 146 |
| 831 | 3300048090 | Ga0495615_0019230 | Ga0495615_0019230_140_583 | 146 |
| 832 | 3300048091 | Ga0495626_0113523 | Ga0495626_0113523_291_734 | 146 |
| 833 | 3300048903 | Ga0496100_0286625 | Ga0496100_0286625_132_578 | 146 |
| 834 | 3300048903 | Ga0496100_0331639 | Ga0496100_0331639_163_606 | 146 |
| 835 | 3300048903 | Ga0496100_0766693 | Ga0496100_0766693_260_703 | 146 |
| 836 | 3300048904 | Ga0496101_0106229 | Ga0496101_0106229_1002_1448 | 146 |
| 837 | 3300048904 | Ga0496101_0232606 | Ga0496101_0232606_382_825 | 146 |
| 838 | 3300048905 | Ga0496102_0283823 | Ga0496102_0283823_811_1254 | 146 |
| 839 | 3300048905 | Ga0496102_0393081 | Ga0496102_0393081_124_567 | 146 |
| 840 | 3300048906 | Ga0496103_0022617 | Ga0496103_0022617_520_963 | 146 |
| 841 | 3300048906 | Ga0496103_0427946 | Ga0496103_0427946_308_751 | 146 |
| 842 | 3300048907 | Ga0496104_0002244 | Ga0496104_0002244_2746_3192 | 146 |
| 843 | 3300048907 | Ga0496104_0055621 | Ga0496104_0055621_2777_3280 | 146 |
| 844 | 3300048907 | Ga0496104_0076254 | Ga0496104_0076254_1808_2251 | 146 |
| 845 | 3300048907 | Ga0496104_0099583 | Ga0496104_0099583_72_515 | 146 |
| 846 | 3300048907 | Ga0496104_0249088 | Ga0496104_0249088_982_1425 | 146 |
| 847 | 3300048908 | Ga0496105_0007267 | Ga0496105_0007267_3868_4311 | 146 |
| 848 | 3300048908 | Ga0496105_0136808 | Ga0496105_0136808_532_975 | 146 |
| 849 | 3300048909 | Ga0496106_0257893 | Ga0496106_0257893_720_1163 | 146 |
| 850 | 3300048909 | Ga0496106_0664018 | Ga0496106_0664018_249_692 | 146 |
| 851 | 3300048911 | Ga0496108_0140952 | Ga0496108_0140952_765_1208 | 146 |
| 852 | 3300048911 | Ga0496108_0467497 | Ga0496108_0467497_423_866 | 146 |
| 853 | 3300048912 | Ga0496109_0053854 | Ga0496109_0053854_3088_3534 | 146 |
| 854 | 3300048912 | Ga0496109_0633372 | Ga0496109_0633372_405_848 | 146 |
| 855 | 3300048913 | Ga0496110_0130851 | Ga0496110_0130851_171_617 | 146 |
| 856 | 3300048913 | Ga0496110_0259592 | Ga0496110_0259592_733_1176 | 146 |
| 857 | 3300048913 | Ga0496110_0292748 | Ga0496110_0292748_199_645 | 146 |
| 858 | 3300048914 | Ga0496111_0050207 | Ga0496111_0050207_2150_2593 | 146 |
| 859 | 3300048914 | Ga0496111_0232978 | Ga0496111_0232978_450_896 | 146 |
| 860 | 3300048915 | Ga0496112_0060696 | Ga0496112_0060696_971_1414 | 146 |
| 861 | 3300048915 | Ga0496112_0171026 | Ga0496112_0171026_915_1361 | 146 |
| 862 | 3300048916 | Ga0496113_0049219 | Ga0496113_0049219_1555_2001 | 146 |
| 863 | 3300048916 | Ga0496113_0204693 | Ga0496113_0204693_481_924 | 146 |
| 864 | 3300048918 | Ga0496115_0288740 | Ga0496115_0288740_445_888 | 146 |
| 865 | 3300048918 | Ga0496115_0616255 | Ga0496115_0616255_40_483 | 146 |
| 866 | 3300048918 | Ga0496115_0888194 | Ga0496115_0888194_58_501 | 146 |
| 867 | 3300048919 | Ga0496116_0001996 | Ga0496116_0001996_15674_16117 | 146 |
| 868 | 3300048920 | Ga0496117_0012572 | Ga0496117_0012572_6206_6649 | 146 |
| 869 | 3300048920 | Ga0496117_0144891 | Ga0496117_0144891_832_1275 | 146 |
| 870 | 3300048920 | Ga0496117_0155681 | Ga0496117_0155681_77_520 | 146 |
| 871 | 3300048920 | Ga0496117_0373466 | Ga0496117_0373466_75_518 | 146 |
| 872 | 3300048920 | Ga0496117_0538572 | Ga0496117_0538572_97_540 | 146 |
| 873 | 3300048920 | Ga0496117_0570240 | Ga0496117_0570240_37_480 | 146 |
| 874 | 3300048921 | Ga0496118_0057853 | Ga0496118_0057853_1381_1824 | 146 |
| 875 | 3300048921 | Ga0496118_0073518 | Ga0496118_0073518_1107_1550 | 146 |
| 876 | 3300048921 | Ga0496118_0152839 | Ga0496118_0152839_387_830 | 146 |
| 877 | 3300048921 | Ga0496118_0205010 | Ga0496118_0205010_397_840 | 146 |
| 878 | 3300048921 | Ga0496118_0236222 | Ga0496118_0236222_358_801 | 146 |
| 879 | 3300048921 | Ga0496118_0281871 | Ga0496118_0281871_307_750 | 146 |
| 880 | 3300048921 | Ga0496118_0361341 | Ga0496118_0361341_55_498 | 146 |
| 881 | 3300048921 | Ga0496118_0394337 | Ga0496118_0394337_175_618 | 146 |
| 882 | 3300048921 | Ga0496118_0526033 | Ga0496118_0526033_101_544 | 146 |
| 883 | 3300048921 | Ga0496118_0570689 | Ga0496118_0570689_44_487 | 146 |
| 884 | 3300048922 | Ga0496119_0047398 | Ga0496119_0047398_1732_2175 | 146 |
| 885 | 3300048922 | Ga0496119_0055143 | Ga0496119_0055143_1334_1777 | 146 |
| 886 | 3300048922 | Ga0496119_0067292 | Ga0496119_0067292_991_1434 | 146 |
| 887 | 3300048922 | Ga0496119_0176859 | Ga0496119_0176859_267_710 | 146 |
| 888 | 3300048922 | Ga0496119_0518252 | Ga0496119_0518252_47_490 | 146 |
| 889 | 3300048923 | Ga0496120_0047735 | Ga0496120_0047735_820_1263 | 146 |
| 890 | 3300048923 | Ga0496120_0160902 | Ga0496120_0160902_71_514 | 146 |
| 891 | 3300048923 | Ga0496120_0203725 | Ga0496120_0203725_407_850 | 146 |
| 892 | 3300048923 | Ga0496120_0298681 | Ga0496120_0298681_248_691 | 146 |
| 893 | 3300048924 | Ga0496121_0001525 | Ga0496121_0001525_6900_7343 | 146 |
| 894 | 3300048924 | Ga0496121_0024780 | Ga0496121_0024780_3627_4070 | 146 |
| 895 | 3300048924 | Ga0496121_0046275 | Ga0496121_0046275_1709_2152 | 146 |
| 896 | 3300048924 | Ga0496121_0073632 | Ga0496121_0073632_678_1121 | 146 |
| 897 | 3300048924 | Ga0496121_0466128 | Ga0496121_0466128_183_626 | 146 |
| 898 | 3300048925 | Ga0496122_0019339 | Ga0496122_0019339_3354_3797 | 146 |
| 899 | 3300048926 | Ga0496123_0122239 | Ga0496123_0122239_206_649 | 146 |
| 900 | 3300048928 | Ga0496125_0005069 | Ga0496125_0005069_12199_12642 | 146 |
| 901 | 3300048928 | Ga0496125_0006742 | Ga0496125_0006742_11435_11878 | 146 |
| 902 | 3300048928 | Ga0496125_0052831 | Ga0496125_0052831_2823_3266 | 146 |
| 903 | 3300048928 | Ga0496125_0062155 | Ga0496125_0062155_1759_2202 | 146 |
| 904 | 3300048928 | Ga0496125_0185417 | Ga0496125_0185417_689_1132 | 146 |
| 905 | 3300048929 | Ga0496126_0057330 | Ga0496126_0057330_2008_2448 | 146 |
| 906 | 3300048929 | Ga0496126_0181549 | Ga0496126_0181549_1243_1686 | 146 |
| 907 | 3300048929 | Ga0496126_0239831 | Ga0496126_0239831_510_953 | 146 |
| 908 | 3300048929 | Ga0496126_0269900 | Ga0496126_0269900_935_1378 | 146 |
| 909 | 3300048929 | Ga0496126_0285276 | Ga0496126_0285276_606_1049 | 146 |
| 910 | 3300048929 | Ga0496126_0401272 | Ga0496126_0401272_297_740 | 146 |
| 911 | 3300048929 | Ga0496126_0448340 | Ga0496126_0448340_48_491 | 146 |
| 912 | 3300048929 | Ga0496126_1010394 | Ga0496126_1010394_79_522 | 146 |
| 913 | 3300049460 | Ga0495682_0005291 | Ga0495682_0005291_4893_5336 | 146 |
| 914 | 3300049568 | Ga0501031_0006238 | Ga0501031_0006238_5359_5802 | 146 |
| 915 | 3300049568 | Ga0501031_0180667 | Ga0501031_0180667_269_712 | 146 |
| 916 | 3300049568 | Ga0501031_0219289 | Ga0501031_0219289_137_580 | 146 |
| 917 | 3300049569 | Ga0501032_0000196 | Ga0501032_0000196_47564_48007 | 146 |
| 918 | 3300049569 | Ga0501032_0215503 | Ga0501032_0215503_187_630 | 146 |
| 919 | 3300049570 | Ga0501033_0003550 | Ga0501033_0003550_6512_6955 | 146 |
| 920 | 3300049570 | Ga0501033_0014112 | Ga0501033_0014112_4352_4795 | 146 |
| 921 | 3300049570 | Ga0501033_0019071 | Ga0501033_0019071_4167_4610 | 146 |
| 922 | 3300049570 | Ga0501033_0019990 | Ga0501033_0019990_1968_2411 | 146 |
| 923 | 3300049571 | Ga0501034_0000157 | Ga0501034_0000157_11028_11471 | 146 |
| 924 | 3300049571 | Ga0501034_0120911 | Ga0501034_0120911_873_1316 | 146 |
| 925 | 3300049571 | Ga0501034_0197332 | Ga0501034_0197332_694_1137 | 146 |
| 926 | 3300049571 | Ga0501034_0219819 | Ga0501034_0219819_1280_1723 | 146 |
| 927 | 3300049572 | Ga0501036_0000440 | Ga0501036_0000440_22528_22971 | 146 |
| 928 | 3300049572 | Ga0501036_0056112 | Ga0501036_0056112_242_685 | 146 |
| 929 | 3300049572 | Ga0501036_0252312 | Ga0501036_0252312_303_749 | 146 |
| 930 | 3300049572 | Ga0501036_0286433 | Ga0501036_0286433_621_1064 | 146 |
| 931 | 3300049572 | Ga0501036_0452612 | Ga0501036_0452612_342_785 | 146 |
| 932 | 3300049572 | Ga0501036_1242480 | Ga0501036_1242480_77_520 | 146 |
| 933 | 3300049573 | Ga0501037_0000969 | Ga0501037_0000969_1159_1602 | 146 |
| 934 | 3300049573 | Ga0501037_0030622 | Ga0501037_0030622_2858_3301 | 146 |
| 935 | 3300049573 | Ga0501037_0223896 | Ga0501037_0223896_232_678 | 146 |
| 936 | 3300049573 | Ga0501037_0295852 | Ga0501037_0295852_411_854 | 146 |
| 937 | 3300049574 | Ga0501038_0000473 | Ga0501038_0000473_10900_11343 | 146 |
| 938 | 3300049574 | Ga0501038_0018346 | Ga0501038_0018346_325_771 | 146 |
| 939 | 3300049574 | Ga0501038_0074628 | Ga0501038_0074628_1146_1589 | 146 |
| 940 | 3300049574 | Ga0501038_0501563 | Ga0501038_0501563_433_876 | 146 |
| 941 | 3300049575 | Ga0501039_0007468 | Ga0501039_0007468_4724_5167 | 146 |
| 942 | 3300049575 | Ga0501039_0046128 | Ga0501039_0046128_1644_2087 | 146 |
| 943 | 3300049575 | Ga0501039_0237689 | Ga0501039_0237689_840_1286 | 146 |
| 944 | 3300049576 | Ga0501040_0105092 | Ga0501040_0105092_155_598 | 146 |
| 945 | 3300049577 | Ga0501041_0413570 | Ga0501041_0413570_332_775 | 146 |
| 946 | 3300049578 | Ga0501042_0299817 | Ga0501042_0299817_513_956 | 146 |
| 947 | 3300049578 | Ga0501042_0559523 | Ga0501042_0559523_314_760 | 146 |
| 948 | 3300049579 | Ga0501043_0001087 | Ga0501043_0001087_14425_14868 | 146 |
| 949 | 3300049579 | Ga0501043_0121043 | Ga0501043_0121043_330_773 | 146 |
| 950 | 3300049579 | Ga0501043_0186149 | Ga0501043_0186149_331_777 | 146 |
| 951 | 3300049579 | Ga0501043_0290933 | Ga0501043_0290933_235_678 | 146 |
| 952 | 3300049579 | Ga0501043_0328292 | Ga0501043_0328292_422_880 | 146 |
| 953 | 3300049579 | Ga0501043_0420700 | Ga0501043_0420700_321_764 | 146 |
| 954 | 3300049580 | Ga0501046_0000181 | Ga0501046_0000181_47564_48007 | 146 |
| 955 | 3300049580 | Ga0501046_0031149 | Ga0501046_0031149_1601_2044 | 146 |
| 956 | 3300049580 | Ga0501046_0191740 | Ga0501046_0191740_940_1383 | 146 |
| 957 | 3300049580 | Ga0501046_0344245 | Ga0501046_0344245_52_495 | 146 |
| 958 | 3300049580 | Ga0501046_0728723 | Ga0501046_0728723_156_602 | 146 |
| 959 | 3300049580 | Ga0501046_0755960 | Ga0501046_0755960_72_515 | 146 |
| 960 | 3300049581 | Ga0501047_0000419 | Ga0501047_0000419_29883_30326 | 146 |
| 961 | 3300049581 | Ga0501047_0130491 | Ga0501047_0130491_391_834 | 146 |
| 962 | 3300049581 | Ga0501047_0200477 | Ga0501047_0200477_1290_1733 | 146 |
| 963 | 3300049581 | Ga0501047_0578520 | Ga0501047_0578520_218_661 | 146 |
| 964 | 3300049582 | Ga0501048_0000057 | Ga0501048_0000057_19786_20229 | 146 |
| 965 | 3300049582 | Ga0501048_0022093 | Ga0501048_0022093_2771_3214 | 146 |
| 966 | 3300049582 | Ga0501048_0473884 | Ga0501048_0473884_122_565 | 146 |
| 967 | 3300049583 | Ga0501067_0000507 | Ga0501067_0000507_2874_3317 | 146 |
| 968 | 3300049583 | Ga0501067_0116833 | Ga0501067_0116833_938_1381 | 146 |
| 969 | 3300049583 | Ga0501067_0547468 | Ga0501067_0547468_20_463 | 146 |
| 970 | 3300049584 | Ga0501068_0001808 | Ga0501068_0001808_8334_8777 | 146 |
| 971 | 3300049584 | Ga0501068_0050540 | Ga0501068_0050540_635_1078 | 146 |
| 972 | 3300049584 | Ga0501068_0200698 | Ga0501068_0200698_540_983 | 146 |
| 973 | 3300049585 | Ga0501069_0001596 | Ga0501069_0001596_6349_6792 | 146 |
| 974 | 3300049585 | Ga0501069_0069376 | Ga0501069_0069376_1191_1634 | 146 |
| 975 | 3300049585 | Ga0501069_0508927 | Ga0501069_0508927_133_576 | 146 |
| 976 | 3300049586 | Ga0501070_0003003 | Ga0501070_0003003_13453_13896 | 146 |
| 977 | 3300049586 | Ga0501070_0218868 | Ga0501070_0218868_1094_1537 | 146 |
| 978 | 3300049586 | Ga0501070_0601426 | Ga0501070_0601426_247_690 | 146 |
| 979 | 3300049586 | Ga0501070_0772540 | Ga0501070_0772540_29_472 | 146 |
| 980 | 3300049587 | Ga0501071_0094604 | Ga0501071_0094604_316_759 | 146 |
| 981 | 3300049587 | Ga0501071_0171754 | Ga0501071_0171754_426_869 | 146 |
| 982 | 3300049588 | Ga0501072_0009854 | Ga0501072_0009854_1025_1468 | 146 |
| 983 | 3300049588 | Ga0501072_0142587 | Ga0501072_0142587_688_1131 | 146 |
| 984 | 3300049588 | Ga0501072_0530948 | Ga0501072_0530948_303_749 | 146 |
| 985 | 3300049588 | Ga0501072_0543533 | Ga0501072_0543533_78_521 | 146 |
| 986 | 3300049589 | Ga0501073_0000027 | Ga0501073_0000027_48607_49050 | 146 |
| 987 | 3300049589 | Ga0501073_0007901 | Ga0501073_0007901_330_773 | 146 |
| 988 | 3300049590 | Ga0501074_0000081 | Ga0501074_0000081_23027_23470 | 146 |
| 989 | 3300049591 | Ga0501075_0355693 | Ga0501075_0355693_229_672 | 146 |
| 990 | 3300049592 | Ga0501076_0158314 | Ga0501076_0158314_593_1036 | 146 |
| 991 | 3300049592 | Ga0501076_0219954 | Ga0501076_0219954_17_460 | 146 |
| 992 | 3300049593 | Ga0501077_0031980 | Ga0501077_0031980_1739_2182 | 146 |
| 993 | 3300049593 | Ga0501077_0940908 | Ga0501077_0940908_61_504 | 146 |
| 994 | 3300049741 | Ga0501079_0013289 | Ga0501079_0013289_199_642 | 146 |
| 995 | 3300049741 | Ga0501079_0037393 | Ga0501079_0037393_2678_3121 | 146 |
| 996 | 3300049741 | Ga0501079_0905066 | Ga0501079_0905066_11_454 | 146 |
| 997 | 3300049742 | Ga0501080_0003534 | Ga0501080_0003534_3281_3724 | 146 |
| 998 | 3300049742 | Ga0501080_0482214 | Ga0501080_0482214_394_840 | 146 |
| 999 | 3300049743 | Ga0501081_0879697 | Ga0501081_0879697_60_503 | 146 |
| 1000 | 3300049744 | Ga0501083_0000947 | Ga0501083_0000947_2581_3024 | 146 |
| 1001 | 3300049744 | Ga0501083_0018670 | Ga0501083_0018670_2885_3328 | 146 |
| 1002 | 3300049822 | Ga0501035_0000145 | Ga0501035_0000145_5028_5471 | 146 |
| 1003 | 3300049822 | Ga0501035_0055322 | Ga0501035_0055322_2742_3185 | 146 |
| 1004 | 3300049822 | Ga0501035_0244481 | Ga0501035_0244481_617_1060 | 146 |
| 1005 | 3300049822 | Ga0501035_0259523 | Ga0501035_0259523_129_572 | 146 |
| 1006 | 3300049822 | Ga0501035_0360854 | Ga0501035_0360854_490_936 | 146 |
| 1007 | 3300049822 | Ga0501035_1010306 | Ga0501035_1010306_129_572 | 146 |
| 1008 | 3300049823 | Ga0501044_0002483 | Ga0501044_0002483_2873_3316 | 146 |
| 1009 | 3300049823 | Ga0501044_0089955 | Ga0501044_0089955_1631_2074 | 146 |
| 1010 | 3300049823 | Ga0501044_0102043 | Ga0501044_0102043_1929_2372 | 146 |
| 1011 | 3300049823 | Ga0501044_0253597 | Ga0501044_0253597_715_1158 | 146 |
| 1012 | 3300049823 | Ga0501044_0256245 | Ga0501044_0256245_150_593 | 146 |
| 1013 | 3300049823 | Ga0501044_0952317 | Ga0501044_0952317_159_602 | 146 |
| 1014 | 3300049823 | Ga0501044_0974664 | Ga0501044_0974664_171_614 | 146 |
| 1015 | 3300049823 | Ga0501044_1027689 | Ga0501044_1027689_86_529 | 146 |
| 1016 | 3300049824 | Ga0501045_0008413 | Ga0501045_0008413_3914_4357 | 146 |
| 1017 | 3300049824 | Ga0501045_0230564 | Ga0501045_0230564_315_758 | 146 |
| 1018 | 3300050489 | nmdc:mga03683_118349_c1 | nmdc:mga03683_118349_c1_704_1147 | 146 |
| 1019 | 3300050489 | nmdc:mga03683_138655_c1 | nmdc:mga03683_138655_c1_205_648 | 146 |
| 1020 | 3300050489 | nmdc:mga03683_24639_c1 | nmdc:mga03683_24639_c1_801_1247 | 146 |
| 1021 | 3300050489 | nmdc:mga03683_397877_c1 | nmdc:mga03683_397877_c1_93_536 | 146 |
| 1022 | 3300050490 | nmdc:mga03n38_145495_c1 | nmdc:mga03n38_145495_c1_127_570 | 146 |
| 1023 | 3300050490 | nmdc:mga03n38_55894_c1 | nmdc:mga03n38_55894_c1_563_1009 | 146 |
| 1024 | 3300050491 | nmdc:mga00v17_20987_c1 | nmdc:mga00v17_20987_c1_3115_3558 | 146 |
| 1025 | 3300050491 | nmdc:mga00v17_34141_c1 | nmdc:mga00v17_34141_c1_1571_2017 | 146 |
| 1026 | 3300050491 | nmdc:mga00v17_367578_c1 | nmdc:mga00v17_367578_c1_473_916 | 146 |
| 1027 | 3300050491 | nmdc:mga00v17_372647_c1 | nmdc:mga00v17_372647_c1_16_459 | 146 |
| 1028 | 3300050491 | nmdc:mga00v17_64124_c1 | nmdc:mga00v17_64124_c1_1283_1726 | 146 |
| 1029 | 3300050492 | nmdc:mga0yw44_20554_c1 | nmdc:mga0yw44_20554_c1_717_1160 | 146 |
| 1030 | 3300050492 | nmdc:mga0yw44_5981_c1 | nmdc:mga0yw44_5981_c1_2974_3417 | 146 |
| 1031 | 3300050492 | nmdc:mga0yw44_78818_c1 | nmdc:mga0yw44_78818_c1_1562_2005 | 146 |
| 1032 | 3300050492 | nmdc:mga0yw44_80808_c1 | nmdc:mga0yw44_80808_c1_1543_1986 | 146 |
| 1033 | 3300050492 | nmdc:mga0yw44_8586_c1 | nmdc:mga0yw44_8586_c1_2055_2498 | 146 |
| 1034 | 3300050493 | nmdc:mga0k408_12582_c1 | nmdc:mga0k408_12582_c1_3619_4062 | 146 |
| 1035 | 3300050493 | nmdc:mga0k408_145062_c1 | nmdc:mga0k408_145062_c1_576_1019 | 146 |
| 1036 | 3300050493 | nmdc:mga0k408_9579_c1 | nmdc:mga0k408_9579_c1_1688_2134 | 146 |
| 1037 | 3300050494 | nmdc:mga06z11_356224_c1 | nmdc:mga06z11_356224_c1_289_732 | 146 |
| 1038 | 3300050494 | nmdc:mga06z11_394799_c1 | nmdc:mga06z11_394799_c1_239_682 | 146 |
| 1039 | 3300050494 | nmdc:mga06z11_538023_c1 | nmdc:mga06z11_538023_c1_230_673 | 146 |
| 1040 | 3300050494 | nmdc:mga06z11_69049_c1 | nmdc:mga06z11_69049_c1_107_553 | 146 |
| 1041 | 3300050494 | nmdc:mga06z11_919732_c1 | nmdc:mga06z11_919732_c1_49_492 | 146 |
| 1042 | 3300050495 | nmdc:mga04h51_71852_c1 | nmdc:mga04h51_71852_c1_350_793 | 146 |
| 1043 | 3300050496 | nmdc:mga07m45_179963_c1 | nmdc:mga07m45_179963_c1_240_683 | 146 |
| 1044 | 3300050496 | nmdc:mga07m45_429412_c1 | nmdc:mga07m45_429412_c1_246_689 | 146 |
| 1045 | 3300050496 | nmdc:mga07m45_45899_c1 | nmdc:mga07m45_45899_c1_1858_2301 | 146 |
| 1046 | 3300050496 | nmdc:mga07m45_56187_c1 | nmdc:mga07m45_56187_c1_1718_2161 | 146 |
| 1047 | 3300050496 | nmdc:mga07m45_747047_c1 | nmdc:mga07m45_747047_c1_61_504 | 146 |
| 1048 | 3300050507 | nmdc:mga05p37_72861_c1 | nmdc:mga05p37_72861_c1_2627_3070 | 146 |
| 1049 | 3300050509 | nmdc:mga0qj67_1071363_c1 | nmdc:mga0qj67_1071363_c1_19_483 | 146 |
| 1050 | 3300050509 | nmdc:mga0qj67_41057_c1 | nmdc:mga0qj67_41057_c1_1876_2319 | 146 |
| 1051 | 3300050510 | nmdc:mga06r32_1021692_c1 | nmdc:mga06r32_1021692_c1_92_535 | 146 |
| 1052 | 3300050511 | nmdc:mga08y16_165438_c1 | nmdc:mga08y16_165438_c1_1228_1692 | 146 |
| 1053 | 3300050511 | nmdc:mga08y16_470105_c1 | nmdc:mga08y16_470105_c1_419_895 | 146 |
| 1054 | 3300050514 | nmdc:mga08x19_738350_c1 | nmdc:mga08x19_738350_c1_29_478 | 146 |
| 1055 | 3300050516 | nmdc:mga0sz30_21539_c1 | nmdc:mga0sz30_21539_c1_1080_1523 | 146 |
| 1056 | 3300050516 | nmdc:mga0sz30_218645_c1 | nmdc:mga0sz30_218645_c1_363_806 | 146 |
| 1057 | 3300050516 | nmdc:mga0sz30_3415_c1 | nmdc:mga0sz30_3415_c1_350_793 | 146 |
| 1058 | 3300050516 | nmdc:mga0sz30_48337_c1 | nmdc:mga0sz30_48337_c1_374_817 | 146 |
| 1059 | 3300050516 | nmdc:mga0sz30_59309_c1 | nmdc:mga0sz30_59309_c1_1038_1481 | 146 |
| 1060 | 3300053077 | Ga0495601_0291664 | Ga0495601_0291664_222_671 | 146 |
| 1061 | 3300053077 | Ga0495601_0407803 | Ga0495601_0407803_138_581 | 146 |
| 1062 | 3300053077 | Ga0495601_0844451 | Ga0495601_0844451_33_476 | 146 |
| 1063 | 3300053080 | Ga0500635_0001095 | Ga0500635_0001095_3999_4442 | 146 |
| 1064 | 3300053080 | Ga0500635_0345415 | Ga0500635_0345415_89_532 | 146 |
| 1065 | 3300053083 | Ga0495655_0178982 | Ga0495655_0178982_46_489 | 146 |
| 1066 | 3300053084 | Ga0495595_0493234 | Ga0495595_0493234_25_468 | 146 |
| 1067 | 3300053085 | Ga0495619_0145887 | Ga0495619_0145887_960_1403 | 146 |
| 1068 | 3300053085 | Ga0495619_1110296 | Ga0495619_1110296_41_490 | 146 |
| 1069 | 3300053087 | Ga0500643_000052 | Ga0500643_000052_70934_71377 | 146 |
| 1070 | 3300053088 | Ga0500644_0107119 | Ga0500644_0107119_618_1061 | 146 |
| 1071 | 3300053089 | Ga0500581_209572 | Ga0500581_209572_79_522 | 146 |
| 1072 | 3300053090 | Ga0500646_0104548 | Ga0500646_0104548_75_518 | 146 |
| 1073 | 3300053092 | Ga0500583_0155343 | Ga0500583_0155343_326_769 | 146 |
| 1074 | 3300053092 | Ga0500583_0351899 | Ga0500583_0351899_94_537 | 146 |
| 1075 | 3300053093 | Ga0500651_0002435 | Ga0500651_0002435_3544_3987 | 146 |
| 1076 | 3300053093 | Ga0500651_0040927 | Ga0500651_0040927_722_1165 | 146 |
| 1077 | 3300053093 | Ga0500651_0143448 | Ga0500651_0143448_310_753 | 146 |
| 1078 | 3300053093 | Ga0500651_0273696 | Ga0500651_0273696_341_784 | 146 |
| 1079 | 3300053094 | Ga0500566_0000113 | Ga0500566_0000113_1494_1937 | 146 |
| 1080 | 3300053094 | Ga0500566_0001807 | Ga0500566_0001807_9104_9547 | 146 |
| 1081 | 3300053094 | Ga0500566_0018844 | Ga0500566_0018844_559_1002 | 146 |
| 1082 | 3300053095 | Ga0500640_004118 | Ga0500640_004118_4170_4613 | 146 |
| 1083 | 3300053095 | Ga0500640_273821 | Ga0500640_273821_62_505 | 146 |
| 1084 | 3300053096 | Ga0500641_0195775 | Ga0500641_0195775_30_473 | 146 |
| 1085 | 3300053096 | Ga0500641_0349270 | Ga0500641_0349270_66_509 | 146 |
| 1086 | 3300053098 | Ga0500650_0000211 | Ga0500650_0000211_10310_10753 | 146 |
| 1087 | 3300053098 | Ga0500650_0385404 | Ga0500650_0385404_33_476 | 146 |
| 1088 | 3300053103 | Ga0500555_003023 | Ga0500555_003023_4307_4750 | 146 |
| 1089 | 3300053104 | Ga0500556_0000035 | Ga0500556_0000035_64899_65342 | 146 |
| 1090 | 3300053104 | Ga0500556_0270398 | Ga0500556_0270398_79_522 | 146 |
| 1091 | 3300053105 | Ga0500557_000057 | Ga0500557_000057_9325_9768 | 146 |
| 1092 | 3300053108 | Ga0500562_063601 | Ga0500562_063601_123_566 | 146 |
| 1093 | 3300053109 | Ga0500569_011160 | Ga0500569_011160_932_1375 | 146 |
| 1094 | 3300053109 | Ga0500569_019952 | Ga0500569_019952_1191_1634 | 146 |
| 1095 | 3300053111 | Ga0500572_000626 | Ga0500572_000626_4129_4572 | 146 |
| 1096 | 3300053111 | Ga0500572_150885 | Ga0500572_150885_101_544 | 146 |
| 1097 | 3300053115 | Ga0500591_030004 | Ga0500591_030004_738_1181 | 146 |
| 1098 | 3300053116 | Ga0500592_002833 | Ga0500592_002833_918_1361 | 146 |
| 1099 | 3300053118 | Ga0500594_0078228 | Ga0500594_0078228_162_605 | 146 |
| 1100 | 3300053119 | Ga0500595_005291 | Ga0500595_005291_1125_1568 | 146 |
| 1101 | 3300053119 | Ga0500595_020996 | Ga0500595_020996_1768_2211 | 146 |
| 1102 | 3300053119 | Ga0500595_036027 | Ga0500595_036027_561_1004 | 146 |
| 1103 | 3300053121 | Ga0500607_231258 | Ga0500607_231258_298_741 | 146 |
| 1104 | 3300053121 | Ga0500607_268513 | Ga0500607_268513_41_484 | 146 |
| 1105 | 3300053122 | Ga0500608_000655 | Ga0500608_000655_3689_4132 | 146 |
| 1106 | 3300053122 | Ga0500608_009359 | Ga0500608_009359_166_609 | 146 |
| 1107 | 3300053123 | Ga0500614_010315 | Ga0500614_010315_468_911 | 146 |
| 1108 | 3300053125 | Ga0500618_001755 | Ga0500618_001755_2971_3414 | 146 |
| 1109 | 3300053128 | Ga0500626_100377 | Ga0500626_100377_201_644 | 146 |
| 1110 | 3300053130 | Ga0500642_0000027 | Ga0500642_0000027_80292_80735 | 146 |
| 1111 | 3300053130 | Ga0500642_0093206 | Ga0500642_0093206_124_567 | 146 |
| 1112 | 3300053130 | Ga0500642_0190691 | Ga0500642_0190691_39_482 | 146 |
| 1113 | 3300053130 | Ga0500642_0496599 | Ga0500642_0496599_47_490 | 146 |
| 1114 | 3300053131 | Ga0500652_000244 | Ga0500652_000244_15945_16388 | 146 |
| 1115 | 3300053134 | Ga0500658_0160164 | Ga0500658_0160164_563_1006 | 146 |
| 1116 | 3300053134 | Ga0500658_0256067 | Ga0500658_0256067_47_490 | 146 |
| 1117 | 3300053134 | Ga0500658_0551072 | Ga0500658_0551072_58_501 | 146 |
| 1118 | 3300053136 | Ga0500559_0000064 | Ga0500559_0000064_33182_33625 | 146 |
| 1119 | 3300053136 | Ga0500559_0004501 | Ga0500559_0004501_2027_2470 | 146 |
| 1120 | 3300053136 | Ga0500559_0039467 | Ga0500559_0039467_1483_1926 | 146 |
| 1121 | 3300053136 | Ga0500559_0139069 | Ga0500559_0139069_157_600 | 146 |
| 1122 | 3300053136 | Ga0500559_0434627 | Ga0500559_0434627_111_554 | 146 |
| 1123 | 3300053139 | Ga0500568_0000443 | Ga0500568_0000443_1696_2139 | 146 |
| 1124 | 3300053139 | Ga0500568_0016857 | Ga0500568_0016857_2483_2926 | 146 |
| 1125 | 3300053139 | Ga0500568_0109108 | Ga0500568_0109108_302_745 | 146 |
| 1126 | 3300053142 | Ga0500577_0004109 | Ga0500577_0004109_185_628 | 146 |
| 1127 | 3300053145 | Ga0500586_004396 | Ga0500586_004396_1325_1768 | 146 |
| 1128 | 3300053148 | Ga0500590_027615 | Ga0500590_027615_2478_2921 | 146 |
| 1129 | 3300053150 | Ga0500603_000215 | Ga0500603_000215_10332_10775 | 146 |
| 1130 | 3300053151 | Ga0500604_0009467 | Ga0500604_0009467_564_1007 | 146 |
| 1131 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_407602_408045 | 146 |
| 1132 | 3300053153 | Ga0500616_0000054 | Ga0500616_0000054_221784_222227 | 146 |
| 1133 | 3300053155 | Ga0500620_000883 | Ga0500620_000883_3020_3463 | 146 |
| 1134 | 3300053156 | Ga0500622_0003283 | Ga0500622_0003283_5751_6194 | 146 |
| 1135 | 3300053156 | Ga0500622_0009279 | Ga0500622_0009279_1547_1990 | 146 |
| 1136 | 3300053158 | Ga0500627_0011595 | Ga0500627_0011595_1407_1850 | 146 |
| 1137 | 3300053158 | Ga0500627_0327533 | Ga0500627_0327533_79_522 | 146 |
| 1138 | 3300053158 | Ga0500627_0484747 | Ga0500627_0484747_58_501 | 146 |
| 1139 | 3300053159 | Ga0500630_000802 | Ga0500630_000802_4128_4571 | 146 |
| 1140 | 3300053161 | Ga0500634_0200378 | Ga0500634_0200378_262_705 | 146 |
| 1141 | 3300053162 | Ga0500638_038121 | Ga0500638_038121_425_868 | 146 |
| 1142 | 3300053163 | Ga0500639_000899 | Ga0500639_000899_14331_14774 | 146 |
| 1143 | 3300053163 | Ga0500639_098582 | Ga0500639_098582_710_1153 | 146 |
| 1144 | 3300053177 | Ga0500636_0000594 | Ga0500636_0000594_6749_7192 | 146 |
| 1145 | 3300053177 | Ga0500636_0000823 | Ga0500636_0000823_1242_1685 | 146 |
| 1146 | 3300053177 | Ga0500636_0168364 | Ga0500636_0168364_414_857 | 146 |
| 1147 | 3300053177 | Ga0500636_0476856 | Ga0500636_0476856_63_506 | 146 |
| 1148 | 3300053178 | Ga0500637_0085474 | Ga0500637_0085474_374_817 | 146 |
| 1149 | 3300053178 | Ga0500637_0124117 | Ga0500637_0124117_647_1090 | 146 |
| 1150 | 3300053178 | Ga0500637_0301275 | Ga0500637_0301275_395_838 | 146 |
| 1151 | 3300053724 | Ga0500570_219005 | Ga0500570_219005_17_460 | 146 |
| 1152 | 3300053729 | Ga0500625_036943 | Ga0500625_036943_940_1383 | 146 |
| 1153 | 3300053730 | Ga0500645_046197 | Ga0500645_046197_222_665 | 146 |
| 1154 | 3300053735 | Ga0500596_001109 | Ga0500596_001109_4128_4571 | 146 |
| 1155 | 3300053736 | Ga0500599_009363 | Ga0500599_009363_209_652 | 146 |
| 1156 | 3300053737 | Ga0500601_000119 | Ga0500601_000119_5098_5541 | 146 |
| 1157 | 3300054114 | Ga0501084_0011359 | Ga0501084_0011359_2312_2755 | 146 |
| 1158 | 3300054114 | Ga0501084_0022705 | Ga0501084_0022705_2745_3188 | 146 |
| 1159 | 3300055283 | Ga0500661_007552 | Ga0500661_007552_1478_1921 | 146 |
| 1160 | 3300055283 | Ga0500661_123637 | Ga0500661_123637_44_487 | 146 |
| 1161 | 3300060353 | Ga0501082_0008590 | Ga0501082_0008590_6277_6720 | 146 |
| 1162 | 3300060353 | Ga0501082_0059486 | Ga0501082_0059486_159_602 | 146 |
| 1163 | 3300060353 | Ga0501082_1396245 | Ga0501082_1396245_114_557 | 146 |
| 1164 | 3300061734 | Ga0530510_0488741 | Ga0530510_0488741_111_554 | 146 |
| 1165 | iso_pu_bacteria | 2824696289 | 2824699011 | 146 |
| 1166 | iso_pu_bacteria | 2838122688 | 2838126118 | 146 |
| 1167 | iso_pu_bacteria | 2841983080 | 2841984509 | 146 |
| 1168 | iso_pu_bacteria | 2847939898 | 2847943302 | 146 |
| 1169 | 3300001990 | JGI24737J22298_10017720 | JGI24737J22298_100177202 | 147 |
| 1170 | 3300002075 | JGI24738J21930_10061017 | JGI24738J21930_100610171 | 147 |
| 1171 | 3300003322 | rootL2_10122270 | rootL2_101222703 | 147 |
| 1172 | 3300005293 | Ga0065715_10650476 | Ga0065715_106504762 | 147 |
| 1173 | 3300005327 | Ga0070658_10582973 | Ga0070658_105829732 | 147 |
| 1174 | 3300005329 | Ga0070683_100023213 | Ga0070683_1000232133 | 147 |
| 1175 | 3300005329 | Ga0070683_100032795 | Ga0070683_1000327954 | 147 |
| 1176 | 3300005329 | Ga0070683_100234015 | Ga0070683_1002340152 | 147 |
| 1177 | 3300005330 | Ga0070690_100188781 | Ga0070690_1001887812 | 147 |
| 1178 | 3300005334 | Ga0068869_100165004 | Ga0068869_1001650042 | 147 |
| 1179 | 3300005336 | Ga0070680_100011781 | Ga0070680_1000117815 | 147 |
| 1180 | 3300005336 | Ga0070680_100067141 | Ga0070680_1000671412 | 147 |
| 1181 | 3300005336 | Ga0070680_100380436 | Ga0070680_1003804362 | 147 |
| 1182 | 3300005336 | Ga0070680_100652933 | Ga0070680_1006529331 | 147 |
| 1183 | 3300005341 | Ga0070691_10223404 | Ga0070691_102234042 | 147 |
| 1184 | 3300005344 | Ga0070661_100572100 | Ga0070661_1005721002 | 147 |
| 1185 | 3300005347 | Ga0070668_101239926 | Ga0070668_1012399262 | 147 |
| 1186 | 3300005365 | Ga0070688_100970253 | Ga0070688_1009702532 | 147 |
| 1187 | 3300005434 | Ga0070709_10001491 | Ga0070709_100014917 | 147 |
| 1188 | 3300005434 | Ga0070709_10029857 | Ga0070709_100298573 | 147 |
| 1189 | 3300005435 | Ga0070714_100034604 | Ga0070714_1000346044 | 147 |
| 1190 | 3300005435 | Ga0070714_100567260 | Ga0070714_1005672602 | 147 |
| 1191 | 3300005436 | Ga0070713_100065716 | Ga0070713_1000657163 | 147 |
| 1192 | 3300005439 | Ga0070711_100606493 | Ga0070711_1006064932 | 147 |
| 1193 | 3300005445 | Ga0070708_100704916 | Ga0070708_1007049161 | 147 |
| 1194 | 3300005445 | Ga0070708_101189968 | Ga0070708_1011899681 | 147 |
| 1195 | 3300005455 | Ga0070663_100144426 | Ga0070663_1001444262 | 147 |
| 1196 | 3300005455 | Ga0070663_100531847 | Ga0070663_1005318472 | 147 |
| 1197 | 3300005458 | Ga0070681_10057744 | Ga0070681_100577442 | 147 |
| 1198 | 3300005458 | Ga0070681_10165152 | Ga0070681_101651523 | 147 |
| 1199 | 3300005471 | Ga0070698_100107615 | Ga0070698_1001076152 | 147 |
| 1200 | 3300005518 | Ga0070699_100211008 | Ga0070699_1002110083 | 147 |
| 1201 | 3300005530 | Ga0070679_100028212 | Ga0070679_1000282123 | 147 |
| 1202 | 3300005530 | Ga0070679_100234226 | Ga0070679_1002342262 | 147 |
| 1203 | 3300005530 | Ga0070679_100681058 | Ga0070679_1006810581 | 147 |
| 1204 | 3300005535 | Ga0070684_100073878 | Ga0070684_1000738783 | 147 |
| 1205 | 3300005539 | Ga0068853_100018531 | Ga0068853_1000185316 | 147 |
| 1206 | 3300005539 | Ga0068853_100085139 | Ga0068853_1000851394 | 147 |
| 1207 | 3300005539 | Ga0068853_100196279 | Ga0068853_1001962792 | 147 |
| 1208 | 3300005539 | Ga0068853_100201713 | Ga0068853_1002017132 | 147 |
| 1209 | 3300005548 | Ga0070665_100052241 | Ga0070665_1000522412 | 147 |
| 1210 | 3300005563 | Ga0068855_100092439 | Ga0068855_1000924394 | 147 |
| 1211 | 3300005563 | Ga0068855_100432527 | Ga0068855_1004325272 | 147 |
| 1212 | 3300005563 | Ga0068855_100480265 | Ga0068855_1004802653 | 147 |
| 1213 | 3300005563 | Ga0068855_100496985 | Ga0068855_1004969853 | 147 |
| 1214 | 3300005564 | Ga0070664_100893368 | Ga0070664_1008933681 | 147 |
| 1215 | 3300005577 | Ga0068857_100017449 | Ga0068857_1000174494 | 147 |
| 1216 | 3300005577 | Ga0068857_100059766 | Ga0068857_1000597663 | 147 |
| 1217 | 3300005577 | Ga0068857_100262105 | Ga0068857_1002621052 | 147 |
| 1218 | 3300005578 | Ga0068854_100023883 | Ga0068854_1000238832 | 147 |
| 1219 | 3300005578 | Ga0068854_100081520 | Ga0068854_1000815202 | 147 |
| 1220 | 3300005614 | Ga0068856_100000522 | Ga0068856_10000052241 | 147 |
| 1221 | 3300005614 | Ga0068856_100021340 | Ga0068856_1000213404 | 147 |
| 1222 | 3300005614 | Ga0068856_100433270 | Ga0068856_1004332701 | 147 |
| 1223 | 3300005615 | Ga0070702_100655043 | Ga0070702_1006550432 | 147 |
| 1224 | 3300005616 | Ga0068852_100384269 | Ga0068852_1003842692 | 147 |
| 1225 | 3300005616 | Ga0068852_100663802 | Ga0068852_1006638022 | 147 |
| 1226 | 3300005617 | Ga0068859_101477533 | Ga0068859_1014775332 | 147 |
| 1227 | 3300005618 | Ga0068864_101100723 | Ga0068864_1011007232 | 147 |
| 1228 | 3300005618 | Ga0068864_101274626 | Ga0068864_1012746261 | 147 |
| 1229 | 3300005842 | Ga0068858_100173954 | Ga0068858_1001739542 | 147 |
| 1230 | 3300005983 | Ga0081540_1100218 | Ga0081540_11002182 | 147 |
| 1231 | 3300005985 | Ga0081539_10165408 | Ga0081539_101654082 | 147 |
| 1232 | 3300006038 | Ga0075365_10119918 | Ga0075365_101199182 | 147 |
| 1233 | 3300006852 | Ga0075433_10813894 | Ga0075433_108138942 | 147 |
| 1234 | 3300006871 | Ga0075434_100011477 | Ga0075434_1000114777 | 147 |
| 1235 | 3300006931 | Ga0097620_101477702 | Ga0097620_1014777022 | 147 |
| 1236 | 3300007265 | Ga0099794_10009479 | Ga0099794_100094794 | 147 |
| 1237 | 3300007265 | Ga0099794_10030878 | Ga0099794_100308782 | 147 |
| 1238 | 3300007265 | Ga0099794_10085976 | Ga0099794_100859764 | 147 |
| 1239 | 3300007265 | Ga0099794_10194323 | Ga0099794_101943231 | 147 |
| 1240 | 3300007265 | Ga0099794_10712929 | Ga0099794_107129291 | 147 |
| 1241 | 3300007788 | Ga0099795_10075316 | Ga0099795_100753162 | 147 |
| 1242 | 3300007788 | Ga0099795_10086383 | Ga0099795_100863832 | 147 |
| 1243 | 3300007788 | Ga0099795_10117559 | Ga0099795_101175592 | 147 |
| 1244 | 3300007788 | Ga0099795_10258586 | Ga0099795_102585862 | 147 |
| 1245 | 3300009093 | Ga0105240_10130068 | Ga0105240_101300684 | 147 |
| 1246 | 3300009093 | Ga0105240_10202953 | Ga0105240_102029534 | 147 |
| 1247 | 3300009093 | Ga0105240_10616178 | Ga0105240_106161781 | 147 |
| 1248 | 3300009093 | Ga0105240_12214333 | Ga0105240_122143331 | 147 |
| 1249 | 3300009098 | Ga0105245_11254512 | Ga0105245_112545122 | 147 |
| 1250 | 3300009101 | Ga0105247_10123534 | Ga0105247_101235342 | 147 |
| 1251 | 3300009148 | Ga0105243_11060030 | Ga0105243_110600302 | 147 |
| 1252 | 3300009174 | Ga0105241_10423280 | Ga0105241_104232802 | 147 |
| 1253 | 3300009174 | Ga0105241_12671599 | Ga0105241_126715991 | 147 |
| 1254 | 3300009545 | Ga0105237_10078738 | Ga0105237_100787384 | 147 |
| 1255 | 3300009545 | Ga0105237_10091332 | Ga0105237_100913324 | 147 |
| 1256 | 3300009545 | Ga0105237_11082359 | Ga0105237_110823592 | 147 |
| 1257 | 3300009545 | Ga0105237_11222030 | Ga0105237_112220301 | 147 |
| 1258 | 3300009551 | Ga0105238_10062524 | Ga0105238_100625241 | 147 |
| 1259 | 3300009551 | Ga0105238_10597818 | Ga0105238_105978182 | 147 |
| 1260 | 3300009553 | Ga0105249_12004761 | Ga0105249_120047611 | 147 |
| 1261 | 3300009553 | Ga0105249_12039160 | Ga0105249_120391601 | 147 |
| 1262 | 3300010159 | Ga0099796_10058503 | Ga0099796_100585031 | 147 |
| 1263 | 3300010159 | Ga0099796_10220192 | Ga0099796_102201922 | 147 |
| 1264 | 3300010375 | Ga0105239_10025680 | Ga0105239_100256804 | 147 |
| 1265 | 3300012483 | Ga0157337_1006390 | Ga0157337_10063902 | 147 |
| 1266 | 3300012515 | Ga0157338_1052413 | Ga0157338_10524131 | 147 |
| 1267 | 3300013104 | Ga0157370_10901211 | Ga0157370_109012111 | 147 |
| 1268 | 3300013105 | Ga0157369_10021285 | Ga0157369_100212853 | 147 |
| 1269 | 3300013105 | Ga0157369_10049503 | Ga0157369_100495035 | 147 |
| 1270 | 3300013105 | Ga0157369_10091698 | Ga0157369_100916985 | 147 |
| 1271 | 3300013307 | Ga0157372_10240295 | Ga0157372_102402952 | 147 |
| 1272 | 3300014968 | Ga0157379_10921933 | Ga0157379_109219332 | 147 |
| 1273 | 3300017792 | Ga0163161_10407128 | Ga0163161_104071282 | 147 |
| 1274 | 3300020069 | Ga0197907_10373094 | Ga0197907_103730941 | 147 |
| 1275 | 3300020070 | Ga0206356_11321139 | Ga0206356_113211392 | 147 |
| 1276 | 3300020082 | Ga0206353_10549197 | Ga0206353_105491972 | 147 |
| 1277 | 3300021388 | Ga0213875_10099466 | Ga0213875_100994662 | 147 |
| 1278 | 3300022467 | Ga0224712_10023785 | Ga0224712_100237852 | 147 |
| 1279 | 3300025261 | Ga0209233_1013847 | Ga0209233_10138473 | 147 |
| 1280 | 3300025321 | Ga0207656_10060841 | Ga0207656_100608411 | 147 |
| 1281 | 3300025904 | Ga0207647_10011565 | Ga0207647_100115655 | 147 |
| 1282 | 3300025911 | Ga0207654_10794375 | Ga0207654_107943752 | 147 |
| 1283 | 3300025912 | Ga0207707_10002648 | Ga0207707_1000264818 | 147 |
| 1284 | 3300025912 | Ga0207707_10140285 | Ga0207707_101402852 | 147 |
| 1285 | 3300025912 | Ga0207707_10249254 | Ga0207707_102492543 | 147 |
| 1286 | 3300025913 | Ga0207695_10387936 | Ga0207695_103879362 | 147 |
| 1287 | 3300025914 | Ga0207671_10109212 | Ga0207671_101092121 | 147 |
| 1288 | 3300025914 | Ga0207671_10354156 | Ga0207671_103541562 | 147 |
| 1289 | 3300025915 | Ga0207693_11048918 | Ga0207693_110489181 | 147 |
| 1290 | 3300025916 | Ga0207663_10139368 | Ga0207663_101393682 | 147 |
| 1291 | 3300025916 | Ga0207663_10679740 | Ga0207663_106797401 | 147 |
| 1292 | 3300025916 | Ga0207663_10794519 | Ga0207663_107945192 | 147 |
| 1293 | 3300025917 | Ga0207660_10050359 | Ga0207660_100503593 | 147 |
| 1294 | 3300025917 | Ga0207660_10134958 | Ga0207660_101349583 | 147 |
| 1295 | 3300025920 | Ga0207649_10232413 | Ga0207649_102324132 | 147 |
| 1296 | 3300025921 | Ga0207652_10175065 | Ga0207652_101750652 | 147 |
| 1297 | 3300025924 | Ga0207694_10115714 | Ga0207694_101157144 | 147 |
| 1298 | 3300025924 | Ga0207694_10325138 | Ga0207694_103251382 | 147 |
| 1299 | 3300025932 | Ga0207690_11276392 | Ga0207690_112763922 | 147 |
| 1300 | 3300025939 | Ga0207665_11678446 | Ga0207665_116784461 | 147 |
| 1301 | 3300025944 | Ga0207661_10088916 | Ga0207661_100889162 | 147 |
| 1302 | 3300025945 | Ga0207679_11054894 | Ga0207679_110548942 | 147 |
| 1303 | 3300025949 | Ga0207667_10031470 | Ga0207667_100314702 | 147 |
| 1304 | 3300025949 | Ga0207667_10058763 | Ga0207667_100587633 | 147 |
| 1305 | 3300025949 | Ga0207667_10429077 | Ga0207667_104290773 | 147 |
| 1306 | 3300025949 | Ga0207667_10840498 | Ga0207667_108404981 | 147 |
| 1307 | 3300025961 | Ga0207712_11171341 | Ga0207712_111713412 | 147 |
| 1308 | 3300025981 | Ga0207640_10017622 | Ga0207640_100176222 | 147 |
| 1309 | 3300025981 | Ga0207640_10082467 | Ga0207640_100824672 | 147 |
| 1310 | 3300025981 | Ga0207640_12136635 | Ga0207640_121366351 | 147 |
| 1311 | 3300026023 | Ga0207677_10435302 | Ga0207677_104353022 | 147 |
| 1312 | 3300026041 | Ga0207639_10074387 | Ga0207639_100743874 | 147 |
| 1313 | 3300026041 | Ga0207639_10163104 | Ga0207639_101631043 | 147 |
| 1314 | 3300026067 | Ga0207678_10062712 | Ga0207678_100627124 | 147 |
| 1315 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014239 | 147 |
| 1316 | 3300026078 | Ga0207702_10064516 | Ga0207702_100645162 | 147 |
| 1317 | 3300026088 | Ga0207641_11437068 | Ga0207641_114370681 | 147 |
| 1318 | 3300026116 | Ga0207674_10040618 | Ga0207674_100406182 | 147 |
| 1319 | 3300026116 | Ga0207674_10118208 | Ga0207674_101182082 | 147 |
| 1320 | 3300026116 | Ga0207674_10200513 | Ga0207674_102005133 | 147 |
| 1321 | 3300026142 | Ga0207698_10326911 | Ga0207698_103269112 | 147 |
| 1322 | 3300027512 | Ga0209179_1006250 | Ga0209179_10062502 | 147 |
| 1323 | 3300027512 | Ga0209179_1053771 | Ga0209179_10537712 | 147 |
| 1324 | 3300027671 | Ga0209588_1013388 | Ga0209588_10133883 | 147 |
| 1325 | 3300027671 | Ga0209588_1017488 | Ga0209588_10174883 | 147 |
| 1326 | 3300031235 | Ga0265330_10057547 | Ga0265330_100575472 | 147 |
| 1327 | 3300031235 | Ga0265330_10116263 | Ga0265330_101162632 | 147 |
| 1328 | 3300031235 | Ga0265330_10155745 | Ga0265330_101557451 | 147 |
| 1329 | 3300031238 | Ga0265332_10015930 | Ga0265332_100159302 | 147 |
| 1330 | 3300031238 | Ga0265332_10068107 | Ga0265332_100681072 | 147 |
| 1331 | 3300031241 | Ga0265325_10002521 | Ga0265325_100025213 | 147 |
| 1332 | 3300031247 | Ga0265340_10011977 | Ga0265340_100119772 | 147 |
| 1333 | 3300031249 | Ga0265339_10031947 | Ga0265339_100319473 | 147 |
| 1334 | 3300031249 | Ga0265339_10207940 | Ga0265339_102079402 | 147 |
| 1335 | 3300031250 | Ga0265331_10099252 | Ga0265331_100992522 | 147 |
| 1336 | 3300031616 | Ga0307508_10096491 | Ga0307508_100964912 | 147 |
| 1337 | 3300031711 | Ga0265314_10151638 | Ga0265314_101516381 | 147 |
| 1338 | 3300031711 | Ga0265314_10252968 | Ga0265314_102529682 | 147 |
| 1339 | 3300031712 | Ga0265342_10006957 | Ga0265342_100069572 | 147 |
| 1340 | 3300031712 | Ga0265342_10120079 | Ga0265342_101200791 | 147 |
| 1341 | 3300031712 | Ga0265342_10250025 | Ga0265342_102500251 | 147 |
| 1342 | 3300031712 | Ga0265342_10524670 | Ga0265342_105246702 | 147 |
| 1343 | 3300033180 | Ga0307510_10186963 | Ga0307510_101869632 | 147 |
| 1344 | 3300033180 | Ga0307510_10215149 | Ga0307510_102151492 | 147 |
| 1345 | 3300034820 | Ga0373959_0025704 | Ga0373959_0025704_658_1104 | 147 |
| 1346 | 3300035111 | Ga0373923_0027673 | Ga0373923_0027673_129_575 | 147 |
| 1347 | 3300035111 | Ga0373923_0029745 | Ga0373923_0029745_1716_2162 | 147 |
| 1348 | 3300035111 | Ga0373923_0188601 | Ga0373923_0188601_475_921 | 147 |
| 1349 | 3300035113 | Ga0373936_0093376 | Ga0373936_0093376_764_1210 | 147 |
| 1350 | 3300035116 | Ga0373945_0045919 | Ga0373945_0045919_935_1381 | 147 |
| 1351 | 3300035117 | Ga0373953_0010951 | Ga0373953_0010951_2608_3054 | 147 |
| 1352 | 3300035117 | Ga0373953_0067760 | Ga0373953_0067760_875_1321 | 147 |
| 1353 | 3300035118 | Ga0373954_0007579 | Ga0373954_0007579_2209_2655 | 147 |
| 1354 | 3300035118 | Ga0373954_0074160 | Ga0373954_0074160_994_1440 | 147 |
| 1355 | 3300035118 | Ga0373954_0083207 | Ga0373954_0083207_232_678 | 147 |
| 1356 | 3300035119 | Ga0373956_0015887 | Ga0373956_0015887_2097_2543 | 147 |
| 1357 | 3300035119 | Ga0373956_0074826 | Ga0373956_0074826_326_772 | 147 |
| 1358 | 3300035120 | Ga0373957_0002603 | Ga0373957_0002603_2584_3030 | 147 |
| 1359 | 3300035120 | Ga0373957_0078627 | Ga0373957_0078627_749_1195 | 147 |
| 1360 | 3300035171 | Ga0373946_0002066 | Ga0373946_0002066_3033_3479 | 147 |
| 1361 | 3300035172 | Ga0373955_0005384 | Ga0373955_0005384_2846_3292 | 147 |
| 1362 | 3300035172 | Ga0373955_0026687 | Ga0373955_0026687_2371_2817 | 147 |
| 1363 | 3300035172 | Ga0373955_0171001 | Ga0373955_0171001_725_1171 | 147 |
| 1364 | 3300035172 | Ga0373955_0302418 | Ga0373955_0302418_20_466 | 147 |
| 1365 | 3300035410 | Ga0373924_0067023 | Ga0373924_0067023_286_732 | 147 |
| 1366 | 3300035692 | Ga0373935_0000354 | Ga0373935_0000354_19831_20277 | 147 |
| 1367 | 3300035692 | Ga0373935_0680437 | Ga0373935_0680437_210_656 | 147 |
| 1368 | 3300035695 | Ga0373927_0004375 | Ga0373927_0004375_196_642 | 147 |
| 1369 | 3300035724 | Ga0373933_0010862 | Ga0373933_0010862_3248_3694 | 147 |
| 1370 | 3300035724 | Ga0373933_0024661 | Ga0373933_0024661_1869_2315 | 147 |
| 1371 | 3300035724 | Ga0373933_0373654 | Ga0373933_0373654_27_473 | 147 |
| 1372 | 3300035724 | Ga0373933_0745430 | Ga0373933_0745430_135_581 | 147 |
| 1373 | 3300035725 | Ga0373947_0003434 | Ga0373947_0003434_5805_6251 | 147 |
| 1374 | 3300036401 | Ga0373937_0071808 | Ga0373937_0071808_2002_2448 | 147 |
| 1375 | 3300036401 | Ga0373937_0318803 | Ga0373937_0318803_375_821 | 147 |
| 1376 | 3300036401 | Ga0373937_0434940 | Ga0373937_0434940_418_864 | 147 |
| 1377 | 3300036401 | Ga0373937_0949714 | Ga0373937_0949714_304_750 | 147 |
| 1378 | 3300037068 | Ga0373925_0009064 | Ga0373925_0009064_3911_4357 | 147 |
| 1379 | 3300037068 | Ga0373925_0032743 | Ga0373925_0032743_1378_1824 | 147 |
| 1380 | 3300037068 | Ga0373925_0709685 | Ga0373925_0709685_336_782 | 147 |
| 1381 | 3300037853 | Ga0436364_0211323 | Ga0436364_0211323_1375_1827 | 147 |
| 1382 | 3300037853 | Ga0436364_0252830 | Ga0436364_0252830_47_493 | 147 |
| 1383 | 3300037853 | Ga0436364_0729467 | Ga0436364_0729467_492_944 | 147 |
| 1384 | 3300037853 | Ga0436364_0854930 | Ga0436364_0854930_1181_1627 | 147 |
| 1385 | 3300037853 | Ga0436364_1011261 | Ga0436364_1011261_469_915 | 147 |
| 1386 | 3300039437 | Ga0436365_0258439 | Ga0436365_0258439_535_981 | 147 |
| 1387 | 3300039447 | Ga0436361_0261667 | Ga0436361_0261667_41_499 | 147 |
| 1388 | 3300039447 | Ga0436361_0374357 | Ga0436361_0374357_37_483 | 147 |
| 1389 | 3300039450 | Ga0436363_1391982 | Ga0436363_1391982_147_593 | 147 |
| 1390 | 3300044656 | Ga0466969_0106171 | Ga0466969_0106171_496_942 | 147 |
| 1391 | 3300044735 | Ga0466968_0187516 | Ga0466968_0187516_72_518 | 147 |
| 1392 | 3300044842 | Ga0466957_0217646 | Ga0466957_0217646_50_496 | 147 |
| 1393 | 3300045836 | Ga0466958_0078895 | Ga0466958_0078895_803_1249 | 147 |
| 1394 | 3300045976 | Ga0466967_0285436 | Ga0466967_0285436_104_550 | 147 |
| 1395 | 3300045976 | Ga0466967_0521371 | Ga0466967_0521371_678_1124 | 147 |
| 1396 | 3300045976 | Ga0466967_1390278 | Ga0466967_1390278_56_502 | 147 |
| 1397 | 3300046454 | Ga0495592_0062845 | Ga0495592_0062845_1953_2399 | 147 |
| 1398 | 3300046455 | Ga0495603_0002779 | Ga0495603_0002779_6686_7132 | 147 |
| 1399 | 3300046459 | Ga0495629_0000416 | Ga0495629_0000416_3163_3609 | 147 |
| 1400 | 3300046459 | Ga0495629_0033833 | Ga0495629_0033833_1989_2435 | 147 |
| 1401 | 3300046459 | Ga0495629_0096054 | Ga0495629_0096054_643_1089 | 147 |
| 1402 | 3300046461 | Ga0495641_0008565 | Ga0495641_0008565_2571_3017 | 147 |
| 1403 | 3300046462 | Ga0495651_0269265 | Ga0495651_0269265_616_1062 | 147 |
| 1404 | 3300046463 | Ga0495653_0098531 | Ga0495653_0098531_488_934 | 147 |
| 1405 | 3300046472 | Ga0495580_0004213 | Ga0495580_0004213_10565_11011 | 147 |
| 1406 | 3300046473 | Ga0495582_0000497 | Ga0495582_0000497_17942_18388 | 147 |
| 1407 | 3300046475 | Ga0495639_0000087 | Ga0495639_0000087_5347_5793 | 147 |
| 1408 | 3300046476 | Ga0495662_0000367 | Ga0495662_0000367_16049_16495 | 147 |
| 1409 | 3300046477 | Ga0495664_0010747 | Ga0495664_0010747_3482_3928 | 147 |
| 1410 | 3300046499 | Ga0495594_0000194 | Ga0495594_0000194_86_532 | 147 |
| 1411 | 3300046511 | Ga0495608_0031497 | Ga0495608_0031497_1357_1803 | 147 |
| 1412 | 3300046511 | Ga0495608_0342143 | Ga0495608_0342143_94_540 | 147 |
| 1413 | 3300046514 | Ga0495618_0180936 | Ga0495618_0180936_875_1321 | 147 |
| 1414 | 3300046514 | Ga0495618_0489658 | Ga0495618_0489658_154_600 | 147 |
| 1415 | 3300046516 | Ga0495628_0043501 | Ga0495628_0043501_163_609 | 147 |
| 1416 | 3300046516 | Ga0495628_0053601 | Ga0495628_0053601_1141_1587 | 147 |
| 1417 | 3300046517 | Ga0495630_0003691 | Ga0495630_0003691_3833_4279 | 147 |
| 1418 | 3300046525 | Ga0495663_0100245 | Ga0495663_0100245_139_585 | 147 |
| 1419 | 3300046526 | Ga0495666_0250781 | Ga0495666_0250781_293_739 | 147 |
| 1420 | 3300046529 | Ga0495652_0037315 | Ga0495652_0037315_316_762 | 147 |
| 1421 | 3300046529 | Ga0495652_0043038 | Ga0495652_0043038_2258_2704 | 147 |
| 1422 | 3300046529 | Ga0495652_0116213 | Ga0495652_0116213_17_463 | 147 |
| 1423 | 3300046529 | Ga0495652_0646890 | Ga0495652_0646890_188_634 | 147 |
| 1424 | 3300046531 | Ga0495665_0003980 | Ga0495665_0003980_1146_1592 | 147 |
| 1425 | 3300046533 | Ga0495640_0014526 | Ga0495640_0014526_495_941 | 147 |
| 1426 | 3300046533 | Ga0495640_0033520 | Ga0495640_0033520_3103_3549 | 147 |
| 1427 | 3300046536 | Ga0495587_0026501 | Ga0495587_0026501_1158_1604 | 147 |
| 1428 | 3300046543 | Ga0495645_0061773 | Ga0495645_0061773_2169_2615 | 147 |
| 1429 | 3300046557 | Ga0495622_0018728 | Ga0495622_0018728_624_1070 | 147 |
| 1430 | 3300046559 | Ga0495667_0036362 | Ga0495667_0036362_1171_1617 | 147 |
| 1431 | 3300046559 | Ga0495667_0101512 | Ga0495667_0101512_1373_1819 | 147 |
| 1432 | 3300046615 | Ga0495656_0170379 | Ga0495656_0170379_243_689 | 147 |
| 1433 | 3300046642 | Ga0495634_0000602 | Ga0495634_0000602_31244_31690 | 147 |
| 1434 | 3300046642 | Ga0495634_0020925 | Ga0495634_0020925_1907_2353 | 147 |
| 1435 | 3300046642 | Ga0495634_0035236 | Ga0495634_0035236_2796_3242 | 147 |
| 1436 | 3300046648 | Ga0495611_0050541 | Ga0495611_0050541_256_702 | 147 |
| 1437 | 3300046663 | Ga0495635_0012357 | Ga0495635_0012357_3244_3690 | 147 |
| 1438 | 3300046663 | Ga0495635_0022635 | Ga0495635_0022635_2755_3201 | 147 |
| 1439 | 3300046663 | Ga0495635_0098604 | Ga0495635_0098604_776_1222 | 147 |
| 1440 | 3300046674 | Ga0495588_0492009 | Ga0495588_0492009_109_555 | 147 |
| 1441 | 3300046675 | Ga0495657_0013190 | Ga0495657_0013190_4312_4758 | 147 |
| 1442 | 3300046675 | Ga0495657_0021986 | Ga0495657_0021986_1413_1859 | 147 |
| 1443 | 3300046678 | Ga0495599_0003392 | Ga0495599_0003392_1997_2443 | 147 |
| 1444 | 3300046678 | Ga0495599_0031175 | Ga0495599_0031175_1178_1624 | 147 |
| 1445 | 3300046678 | Ga0495599_0081377 | Ga0495599_0081377_1529_1975 | 147 |
| 1446 | 3300046679 | Ga0495623_0024198 | Ga0495623_0024198_222_668 | 147 |
| 1447 | 3300046680 | Ga0495646_0034243 | Ga0495646_0034243_541_987 | 147 |
| 1448 | 3300046680 | Ga0495646_0102487 | Ga0495646_0102487_1101_1547 | 147 |
| 1449 | 3300046680 | Ga0495646_0294721 | Ga0495646_0294721_237_683 | 147 |
| 1450 | 3300046681 | Ga0495647_0000694 | Ga0495647_0000694_6383_6829 | 147 |
| 1451 | 3300046683 | Ga0495658_0000593 | Ga0495658_0000593_19295_19741 | 147 |
| 1452 | 3300046689 | Ga0495613_0051126 | Ga0495613_0051126_2114_2560 | 147 |
| 1453 | 3300046690 | Ga0495624_0004068 | Ga0495624_0004068_7141_7587 | 147 |
| 1454 | 3300046809 | Ga0495600_0017947 | Ga0495600_0017947_2195_2641 | 147 |
| 1455 | 3300047315 | Ga0495581_0000133 | Ga0495581_0000133_28348_28794 | 147 |
| 1456 | 3300047317 | Ga0495604_0021586 | Ga0495604_0021586_2195_2641 | 147 |
| 1457 | 3300047317 | Ga0495604_0187671 | Ga0495604_0187671_94_540 | 147 |
| 1458 | 3300047319 | Ga0495674_0000874 | Ga0495674_0000874_3141_3587 | 147 |
| 1459 | 3300047319 | Ga0495674_0055959 | Ga0495674_0055959_939_1385 | 147 |
| 1460 | 3300047319 | Ga0495674_1340353 | Ga0495674_1340353_70_516 | 147 |
| 1461 | 3300047320 | Ga0495672_0263461 | Ga0495672_0263461_270_722 | 147 |
| 1462 | 3300047322 | Ga0495680_0075333 | Ga0495680_0075333_309_755 | 147 |
| 1463 | 3300047322 | Ga0495680_0125751 | Ga0495680_0125751_254_700 | 147 |
| 1464 | 3300047444 | Ga0495675_0045534 | Ga0495675_0045534_395_841 | 147 |
| 1465 | 3300047469 | Ga0495673_0064070 | Ga0495673_0064070_249_695 | 147 |
| 1466 | 3300047470 | Ga0495681_0225750 | Ga0495681_0225750_276_722 | 147 |
| 1467 | 3300047471 | Ga0495684_0046162 | Ga0495684_0046162_161_607 | 147 |
| 1468 | 3300047471 | Ga0495684_0048321 | Ga0495684_0048321_2761_3207 | 147 |
| 1469 | 3300047673 | Ga0495593_0000022 | Ga0495593_0000022_30990_31436 | 147 |
| 1470 | 3300047673 | Ga0495593_0029769 | Ga0495593_0029769_1831_2277 | 147 |
| 1471 | 3300047673 | Ga0495593_0400060 | Ga0495593_0400060_170_616 | 147 |
| 1472 | 3300048088 | Ga0495602_0102994 | Ga0495602_0102994_1671_2117 | 147 |
| 1473 | 3300048903 | Ga0496100_1408556 | Ga0496100_1408556_71_517 | 147 |
| 1474 | 3300048904 | Ga0496101_0445125 | Ga0496101_0445125_188_631 | 147 |
| 1475 | 3300048905 | Ga0496102_1518183 | Ga0496102_1518183_70_516 | 147 |
| 1476 | 3300048906 | Ga0496103_0213094 | Ga0496103_0213094_614_1060 | 147 |
| 1477 | 3300048907 | Ga0496104_0045777 | Ga0496104_0045777_3297_3743 | 147 |
| 1478 | 3300048908 | Ga0496105_0160170 | Ga0496105_0160170_65_511 | 147 |
| 1479 | 3300048909 | Ga0496106_0768700 | Ga0496106_0768700_57_500 | 147 |
| 1480 | 3300048910 | Ga0496107_0359152 | Ga0496107_0359152_336_782 | 147 |
| 1481 | 3300048911 | Ga0496108_0389500 | Ga0496108_0389500_406_852 | 147 |
| 1482 | 3300048912 | Ga0496109_0981334 | Ga0496109_0981334_277_723 | 147 |
| 1483 | 3300048913 | Ga0496110_0637285 | Ga0496110_0637285_49_495 | 147 |
| 1484 | 3300048913 | Ga0496110_1769793 | Ga0496110_1769793_38_484 | 147 |
| 1485 | 3300048914 | Ga0496111_0298459 | Ga0496111_0298459_450_896 | 147 |
| 1486 | 3300048915 | Ga0496112_0206095 | Ga0496112_0206095_821_1267 | 147 |
| 1487 | 3300048916 | Ga0496113_0255541 | Ga0496113_0255541_229_675 | 147 |
| 1488 | 3300048924 | Ga0496121_0082049 | Ga0496121_0082049_1278_1724 | 147 |
| 1489 | 3300048929 | Ga0496126_0047835 | Ga0496126_0047835_1585_2028 | 147 |
| 1490 | 3300048929 | Ga0496126_0123849 | Ga0496126_0123849_434_880 | 147 |
| 1491 | 3300048929 | Ga0496126_0175444 | Ga0496126_0175444_47_493 | 147 |
| 1492 | 3300048929 | Ga0496126_0221075 | Ga0496126_0221075_684_1130 | 147 |
| 1493 | 3300048929 | Ga0496126_0228930 | Ga0496126_0228930_295_741 | 147 |
| 1494 | 3300048929 | Ga0496126_0903775 | Ga0496126_0903775_131_577 | 147 |
| 1495 | 3300050507 | nmdc:mga05p37_1609438_c1 | nmdc:mga05p37_1609438_c1_170_619 | 147 |
| 1496 | 3300050512 | nmdc:mga0n895_10129_c1 | nmdc:mga0n895_10129_c1_589_1032 | 147 |
| 1497 | 3300050512 | nmdc:mga0n895_648364_c1 | nmdc:mga0n895_648364_c1_554_1000 | 147 |
| 1498 | 3300050515 | nmdc:mga0a205_445443_c1 | nmdc:mga0a205_445443_c1_568_1011 | 147 |
| 1499 | 3300053077 | Ga0495601_0022629 | Ga0495601_0022629_1267_1713 | 147 |
| 1500 | 3300053077 | Ga0495601_0244131 | Ga0495601_0244131_601_1047 | 147 |
| 1501 | 3300053078 | Ga0495612_0011436 | Ga0495612_0011436_3102_3548 | 147 |
| 1502 | 3300053078 | Ga0495612_0028665 | Ga0495612_0028665_868_1314 | 147 |
| 1503 | 3300053078 | Ga0495612_0209187 | Ga0495612_0209187_33_479 | 147 |
| 1504 | 3300053080 | Ga0500635_0006128 | Ga0500635_0006128_2047_2493 | 147 |
| 1505 | 3300053084 | Ga0495595_0004815 | Ga0495595_0004815_1799_2272 | 147 |
| 1506 | 3300053084 | Ga0495595_0009867 | Ga0495595_0009867_338_784 | 147 |
| 1507 | 3300053084 | Ga0495595_0375009 | Ga0495595_0375009_16_462 | 147 |
| 1508 | 3300053085 | Ga0495619_0016828 | Ga0495619_0016828_2388_2834 | 147 |
| 1509 | 3300053085 | Ga0495619_0029722 | Ga0495619_0029722_326_772 | 147 |
| 1510 | 3300053085 | Ga0495619_0504910 | Ga0495619_0504910_55_501 | 147 |
| 1511 | 3300053094 | Ga0500566_0514724 | Ga0500566_0514724_19_465 | 147 |
| 1512 | 3300053102 | Ga0500554_018039 | Ga0500554_018039_1409_1855 | 147 |
| 1513 | 3300053150 | Ga0500603_001657 | Ga0500603_001657_2999_3445 | 147 |
| 1514 | 3300061719 | Ga0466962_0065345 | Ga0466962_0065345_327_773 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cp0-assembly1.cif.gz_A | crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum | 0.8441 | 89 | 144 |
| 2k5h-assembly1.cif.gz_A | solution nmr structure of protein encoded by mth693 from methanobacterium thermoautotrophicum: northeast structural genomics consortium target tt824a | 0.8339 | 90 | 145 |
| 3wwv-assembly1.cif.gz_A-2 | c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii | 0.8305 | 89 | 145 |
| 2exd-assembly1.cif.gz_A | the solution structure of the c-terminal domain of a nfed homolog from pyrococcus horikoshii | 0.8048 | 92 | 145 |
| 1wa7-assembly1.cif.gz_A | sh3 domain of human lyn tyrosine kinase in complex with a herpesviral ligand | 0.7614 | 94 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAS3_95_152_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.97 | 92 | 145 | 2.40.50.140 |
| af_P0AAS3_95_152_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8903 | 92 | 145 | 2.40.50.140 |
| af_P0AAS3_1_89_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8776 | 1 | 75 | 1.10.287.70 |
| af_Q58236_70_138_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8757 | 91 | 145 | 2.40.50.140 |
| af_P71767_83_144_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8543 | 91 | 145 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317HXF2-F1-model_v4 | deleted | 0.9956 | 83 | 145 |
|
| AF-H0SGX8-F1-model_v4 | NfeD-like C-terminal domain-containing protein | 0.9768 | 79 | 145 |
|
| AF-A0A7C1MG96-F1-model_v4 | deleted | 0.9712 | 82 | 145 |
|
| AF-A0A7V6PHG3-F1-model_v4 | NfeD family protein | 0.9452 | 83 | 145 |
|
| AF-A0A7Y4J6A4-F1-model_v4 | deleted | 0.9382 | 79 | 145 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar