F494476
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1511 | 426 | 3022 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300050514|nmdc:mga08x19_34133_c1|nmdc:mga08x19_34133_c1_441_1376 |
| Length | 311 |
| Sequence | MGILLADPGDSSAVGGSGFLACVRVVSSAMMPVTEAVMTTTQSDKAARFRALHQAPGAFVIPNPWDAGSARLLAGLGFQALATSSGASAGTLGRRDGKVTREEALAHARAIVNATDLPVSADLEKGFGDAPEAAAETIRQAAGVGLVGGSIEDASGDPQRPIYDFNHAVERVAAAVQAARALPFAFTLTARAEGQLRGQPDLDEIIRRLQAFEKAGTDVLMAPGLPDLAAVRRLCAAVSKPVNFMAGIKGKSFTVAELAAAGVKRISLATSLYRAAMTAVRDAAAEVKDKGSFGYLDRSLATPELNAFMKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 142 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 145 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 227 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 228 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 229 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 233 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 236 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 243 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 278 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 279 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 280 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 281 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 285 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 286 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 287 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 288 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 289 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 290 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 291 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 292 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 293 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 294 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 295 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 296 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 297 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 298 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 299 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 302 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 303 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 304 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 392 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 410 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 412 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 413 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 416 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 417 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 420 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 421 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 422 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 423 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 424 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 425 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 426 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.47 |
| Metatranscriptomes | 0.07 |
| Isolates | 0.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.58 |
| Nodule | 0 |
| Rhizoplane | 1.39 |
| Rhizosphere | 92.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga08x19_34133_c1 | 3300050514 | Bacteria | 3214 |
| 2 | JGI25152J39213_1000939 | 3300002773 | Bacteria | 14304 |
| 3 | JGI25406J46586_10001733 | 3300003203 | Bacteria | 10249 |
| 4 | JGI25153J46596_10001552 | 3300003215 | Bacteria | 13648 |
| 5 | JGI25153J46596_10003443 | 3300003215 | Bacteria | 8863 |
| 6 | rootH2_10084913 | 3300003320 | Bacteria | 2275 |
| 7 | rootH1_10073293 | 3300003323 | Bacteria | 9625 |
| 8 | JGI26141J51220_1000238 | 3300003503 | Bacteria | 2901 |
| 9 | Ga0055526_1002279 | 3300003771 | Bacteria | 13101 |
| 10 | Ga0058863_11399723 | 3300004799 | Bacteria | 1061 |
| 11 | Ga0065165_1001161 | 3300005262 | Bacteria | 30703 |
| 12 | Ga0065715_10293307 | 3300005293 | Unclassified | 1056 |
| 13 | Ga0065707_10082160 | 3300005295 | Bacteria | 20515 |
| 14 | Ga0065707_10090228 | 3300005295 | Bacteria | 4185 |
| 15 | Ga0065707_10097617 | 3300005295 | Unclassified | 3159 |
| 16 | Ga0065707_10119844 | 3300005295 | Unclassified | 2149 |
| 17 | Ga0070658_10013839 | 3300005327 | Bacteria | 6474 |
| 18 | Ga0070658_10089989 | 3300005327 | Bacteria | 2528 |
| 19 | Ga0070676_10000180 | 3300005328 | Bacteria | 26224 |
| 20 | Ga0070676_10044286 | 3300005328 | Bacteria | 2589 |
| 21 | Ga0070676_10154421 | 3300005328 | Bacteria | 1472 |
| 22 | Ga0070676_10244069 | 3300005328 | Bacteria | 1196 |
| 23 | Ga0070683_100035870 | 3300005329 | Bacteria | 4535 |
| 24 | Ga0070683_100044269 | 3300005329 | Bacteria | 4104 |
| 25 | Ga0070683_100433481 | 3300005329 | Bacteria | 1254 |
| 26 | Ga0070690_100002966 | 3300005330 | Bacteria | 9179 |
| 27 | Ga0070690_100084329 | 3300005330 | Unclassified | 2083 |
| 28 | Ga0070690_100112277 | 3300005330 | Bacteria | 1820 |
| 29 | Ga0070690_100151416 | 3300005330 | Bacteria | 1583 |
| 30 | Ga0070690_100166718 | 3300005330 | Bacteria | 1513 |
| 31 | Ga0070670_100006716 | 3300005331 | Bacteria | 9751 |
| 32 | Ga0070670_100030466 | 3300005331 | Bacteria | 4646 |
| 33 | Ga0070677_10000480 | 3300005333 | Bacteria | 13662 |
| 34 | Ga0070677_10002340 | 3300005333 | Bacteria | 6057 |
| 35 | Ga0068869_100000690 | 3300005334 | Bacteria | 19082 |
| 36 | Ga0068869_100008882 | 3300005334 | Bacteria | 6501 |
| 37 | Ga0068869_100043111 | 3300005334 | Bacteria | 3239 |
| 38 | Ga0068869_100174215 | 3300005334 | Bacteria | 1683 |
| 39 | Ga0068869_100342139 | 3300005334 | Bacteria | 1217 |
| 40 | Ga0070666_10008877 | 3300005335 | Bacteria | 6249 |
| 41 | Ga0070680_100017550 | 3300005336 | Bacteria | 5645 |
| 42 | Ga0070680_100024240 | 3300005336 | Bacteria | 4843 |
| 43 | Ga0070680_100034153 | 3300005336 | Bacteria | 4101 |
| 44 | Ga0070680_100045760 | 3300005336 | Bacteria | 3558 |
| 45 | Ga0070680_100076002 | 3300005336 | Bacteria | 2765 |
| 46 | Ga0070680_100116938 | 3300005336 | Bacteria | 2223 |
| 47 | Ga0070680_100352912 | 3300005336 | Bacteria | 1251 |
| 48 | Ga0070680_100402838 | 3300005336 | Bacteria | 1166 |
| 49 | Ga0070682_100000622 | 3300005337 | Bacteria | 21584 |
| 50 | Ga0070682_100115528 | 3300005337 | Bacteria | 1794 |
| 51 | Ga0070682_100187034 | 3300005337 | Bacteria | 1451 |
| 52 | Ga0068868_100015578 | 3300005338 | Bacteria | 5627 |
| 53 | Ga0068868_100018830 | 3300005338 | Bacteria | 5166 |
| 54 | Ga0068868_100051604 | 3300005338 | Bacteria | 3236 |
| 55 | Ga0068868_100207196 | 3300005338 | Bacteria | 1637 |
| 56 | Ga0070660_100002171 | 3300005339 | Bacteria | 13520 |
| 57 | Ga0070689_100008079 | 3300005340 | Bacteria | 7392 |
| 58 | Ga0070689_100136889 | 3300005340 | Bacteria | 1967 |
| 59 | Ga0070689_100246919 | 3300005340 | Bacteria | 1472 |
| 60 | Ga0070689_100257639 | 3300005340 | Bacteria | 1441 |
| 61 | Ga0070689_100358301 | 3300005340 | Bacteria | 1225 |
| 62 | Ga0070691_10005153 | 3300005341 | Bacteria | 5938 |
| 63 | Ga0070691_10054987 | 3300005341 | Bacteria | 1906 |
| 64 | Ga0070687_100018481 | 3300005343 | Bacteria | 3226 |
| 65 | Ga0070687_100033727 | 3300005343 | Bacteria | 2529 |
| 66 | Ga0070687_100088303 | 3300005343 | Bacteria | 1709 |
| 67 | Ga0070687_100371871 | 3300005343 | Bacteria | 929 |
| 68 | Ga0070661_100000211 | 3300005344 | Bacteria | 48345 |
| 69 | Ga0070692_10000947 | 3300005345 | Bacteria | 9859 |
| 70 | Ga0070692_10013082 | 3300005345 | Bacteria | 3861 |
| 71 | Ga0070692_10019539 | 3300005345 | Bacteria | 3270 |
| 72 | Ga0070668_100011684 | 3300005347 | Bacteria | 6537 |
| 73 | Ga0070668_100221811 | 3300005347 | Bacteria | 1560 |
| 74 | Ga0070668_100249268 | 3300005347 | Bacteria | 1474 |
| 75 | Ga0070668_100293832 | 3300005347 | Bacteria | 1361 |
| 76 | Ga0070669_100003321 | 3300005353 | Bacteria | 11563 |
| 77 | Ga0070669_100005282 | 3300005353 | Bacteria | 9326 |
| 78 | Ga0070669_100018574 | 3300005353 | Bacteria | 4969 |
| 79 | Ga0070669_100092920 | 3300005353 | Bacteria | 2265 |
| 80 | Ga0070669_100150638 | 3300005353 | Bacteria | 1800 |
| 81 | Ga0070669_100187096 | 3300005353 | Bacteria | 1623 |
| 82 | Ga0070669_100241301 | 3300005353 | Bacteria | 1436 |
| 83 | Ga0070675_100000264 | 3300005354 | Bacteria | 34442 |
| 84 | Ga0070675_100011030 | 3300005354 | Bacteria | 7075 |
| 85 | Ga0070675_100043352 | 3300005354 | Bacteria | 3676 |
| 86 | Ga0070675_100049356 | 3300005354 | Unclassified | 3454 |
| 87 | Ga0070675_100071363 | 3300005354 | Bacteria | 2881 |
| 88 | Ga0070675_100137477 | 3300005354 | Bacteria | 2086 |
| 89 | Ga0070671_100005985 | 3300005355 | Bacteria | 9694 |
| 90 | Ga0070671_100202226 | 3300005355 | Bacteria | 1685 |
| 91 | Ga0070671_100334959 | 3300005355 | Bacteria | 1290 |
| 92 | Ga0070674_100016275 | 3300005356 | Bacteria | 4660 |
| 93 | Ga0070674_100017024 | 3300005356 | Bacteria | 4563 |
| 94 | Ga0070674_100070264 | 3300005356 | Unclassified | 2473 |
| 95 | Ga0070673_100001370 | 3300005364 | Bacteria | 14240 |
| 96 | Ga0070673_100001462 | 3300005364 | Bacteria | 13820 |
| 97 | Ga0070673_100048928 | 3300005364 | Bacteria | 3299 |
| 98 | Ga0070673_100205809 | 3300005364 | Bacteria | 1697 |
| 99 | Ga0070673_100356931 | 3300005364 | Unclassified | 1298 |
| 100 | Ga0070659_100000204 | 3300005366 | Bacteria | 46050 |
| 101 | Ga0070659_100230076 | 3300005366 | Bacteria | 1532 |
| 102 | Ga0070659_100407722 | 3300005366 | Bacteria | 1148 |
| 103 | Ga0070667_100712302 | 3300005367 | Unclassified | 929 |
| 104 | Ga0070703_10043743 | 3300005406 | Bacteria | 1406 |
| 105 | Ga0070703_10055704 | 3300005406 | Bacteria | 1278 |
| 106 | Ga0070703_10061922 | 3300005406 | Bacteria | 1227 |
| 107 | Ga0070709_10009910 | 3300005434 | Bacteria | 5267 |
| 108 | Ga0070709_10274103 | 3300005434 | Bacteria | 1223 |
| 109 | Ga0070709_10378568 | 3300005434 | Bacteria | 1052 |
| 110 | Ga0070714_100058375 | 3300005435 | Bacteria | 3305 |
| 111 | Ga0070714_100257428 | 3300005435 | Bacteria | 1615 |
| 112 | Ga0070713_100114080 | 3300005436 | Bacteria | 2360 |
| 113 | Ga0070713_100197773 | 3300005436 | Bacteria | 1814 |
| 114 | Ga0070713_100222856 | 3300005436 | Unclassified | 1711 |
| 115 | Ga0070713_100224955 | 3300005436 | Bacteria | 1703 |
| 116 | Ga0070713_100351136 | 3300005436 | Unclassified | 1368 |
| 117 | Ga0070713_100558597 | 3300005436 | Bacteria | 1084 |
| 118 | Ga0070710_10003930 | 3300005437 | Bacteria | 7042 |
| 119 | Ga0070710_10044950 | 3300005437 | Bacteria | 2453 |
| 120 | Ga0070710_10130912 | 3300005437 | Unclassified | 1529 |
| 121 | Ga0070711_100022847 | 3300005439 | Bacteria | 4059 |
| 122 | Ga0070711_100084682 | 3300005439 | Bacteria | 2268 |
| 123 | Ga0070711_100085919 | 3300005439 | Bacteria | 2254 |
| 124 | Ga0070711_100397929 | 3300005439 | Bacteria | 1117 |
| 125 | Ga0070705_100001378 | 3300005440 | Bacteria | 12938 |
| 126 | Ga0070705_100010637 | 3300005440 | Bacteria | 4613 |
| 127 | Ga0070705_100016819 | 3300005440 | Bacteria | 3808 |
| 128 | Ga0070705_100065129 | 3300005440 | Bacteria | 2180 |
| 129 | Ga0070705_100065685 | 3300005440 | Bacteria | 2173 |
| 130 | Ga0070705_100111033 | 3300005440 | Bacteria | 1752 |
| 131 | Ga0070705_100124781 | 3300005440 | Bacteria | 1669 |
| 132 | Ga0070705_100147131 | 3300005440 | Bacteria | 1558 |
| 133 | Ga0070700_100000457 | 3300005441 | Bacteria | 20564 |
| 134 | Ga0070700_100051555 | 3300005441 | Bacteria | 2561 |
| 135 | Ga0070700_100061077 | 3300005441 | Bacteria | 2377 |
| 136 | Ga0070700_100315083 | 3300005441 | Bacteria | 1147 |
| 137 | Ga0070700_100339503 | 3300005441 | Bacteria | 1110 |
| 138 | Ga0070700_100485839 | 3300005441 | Bacteria | 947 |
| 139 | Ga0070694_100001824 | 3300005444 | Bacteria | 12612 |
| 140 | Ga0070694_100022369 | 3300005444 | Bacteria | 4050 |
| 141 | Ga0070694_100078589 | 3300005444 | Bacteria | 2289 |
| 142 | Ga0070694_100082460 | 3300005444 | Bacteria | 2239 |
| 143 | Ga0070694_100460556 | 3300005444 | Bacteria | 1005 |
| 144 | Ga0070694_100472064 | 3300005444 | Bacteria | 994 |
| 145 | Ga0070708_100003247 | 3300005445 | Bacteria | 12688 |
| 146 | Ga0070708_100003792 | 3300005445 | Bacteria | 11861 |
| 147 | Ga0070708_100011346 | 3300005445 | Bacteria | 7246 |
| 148 | Ga0070708_100018954 | 3300005445 | Bacteria | 5768 |
| 149 | Ga0070708_100032371 | 3300005445 | Bacteria | 4535 |
| 150 | Ga0070708_100037361 | 3300005445 | Bacteria | 4236 |
| 151 | Ga0070708_100048798 | 3300005445 | Bacteria | 3744 |
| 152 | Ga0070708_100066557 | 3300005445 | Bacteria | 3234 |
| 153 | Ga0070708_100079649 | 3300005445 | Bacteria | 2964 |
| 154 | Ga0070708_100089268 | 3300005445 | Bacteria | 2804 |
| 155 | Ga0070708_100148809 | 3300005445 | Bacteria | 2176 |
| 156 | Ga0070708_100151811 | 3300005445 | Bacteria | 2155 |
| 157 | Ga0070708_100435779 | 3300005445 | Bacteria | 1236 |
| 158 | Ga0070708_100587542 | 3300005445 | Bacteria | 1050 |
| 159 | Ga0070663_100000167 | 3300005455 | Bacteria | 33014 |
| 160 | Ga0070678_100080846 | 3300005456 | Bacteria | 2462 |
| 161 | Ga0070678_100423761 | 3300005456 | Unclassified | 1161 |
| 162 | Ga0070662_100001464 | 3300005457 | Bacteria | 14536 |
| 163 | Ga0070662_100017049 | 3300005457 | Bacteria | 4888 |
| 164 | Ga0070662_100197858 | 3300005457 | Bacteria | 1593 |
| 165 | Ga0070662_100428938 | 3300005457 | Bacteria | 1095 |
| 166 | Ga0070662_100446237 | 3300005457 | Unclassified | 1073 |
| 167 | Ga0070681_10000852 | 3300005458 | Bacteria | 25625 |
| 168 | Ga0070681_10000898 | 3300005458 | Bacteria | 25185 |
| 169 | Ga0070681_10017554 | 3300005458 | Bacteria | 7150 |
| 170 | Ga0070681_10051632 | 3300005458 | Bacteria | 4101 |
| 171 | Ga0070681_10131120 | 3300005458 | Bacteria | 2439 |
| 172 | Ga0070681_10165696 | 3300005458 | Bacteria | 2133 |
| 173 | Ga0070681_10171698 | 3300005458 | Bacteria | 2090 |
| 174 | Ga0068867_100000347 | 3300005459 | Bacteria | 30690 |
| 175 | Ga0068867_100000382 | 3300005459 | Bacteria | 29543 |
| 176 | Ga0068867_100002024 | 3300005459 | Bacteria | 14172 |
| 177 | Ga0068867_100003059 | 3300005459 | Bacteria | 11791 |
| 178 | Ga0068867_100007232 | 3300005459 | Bacteria | 7850 |
| 179 | Ga0068867_100113394 | 3300005459 | Bacteria | 2086 |
| 180 | Ga0068867_100138568 | 3300005459 | Bacteria | 1899 |
| 181 | Ga0070685_10174139 | 3300005466 | Bacteria | 1381 |
| 182 | Ga0070706_100001137 | 3300005467 | Bacteria | 28677 |
| 183 | Ga0070706_100027332 | 3300005467 | Bacteria | 5251 |
| 184 | Ga0070706_100084951 | 3300005467 | Bacteria | 2932 |
| 185 | Ga0070706_100106706 | 3300005467 | Bacteria | 2605 |
| 186 | Ga0070706_100202883 | 3300005467 | Bacteria | 1852 |
| 187 | Ga0070706_100267098 | 3300005467 | Bacteria | 1597 |
| 188 | Ga0070706_100279348 | 3300005467 | Bacteria | 1558 |
| 189 | Ga0070706_100287849 | 3300005467 | Bacteria | 1533 |
| 190 | Ga0070706_100325790 | 3300005467 | Bacteria | 1433 |
| 191 | Ga0070707_100011824 | 3300005468 | Bacteria | 8151 |
| 192 | Ga0070707_100065984 | 3300005468 | Bacteria | 3478 |
| 193 | Ga0070707_100138676 | 3300005468 | Bacteria | 2366 |
| 194 | Ga0070707_100259735 | 3300005468 | Bacteria | 1690 |
| 195 | Ga0070707_100364113 | 3300005468 | Bacteria | 1405 |
| 196 | Ga0070707_100541240 | 3300005468 | Bacteria | 1126 |
| 197 | Ga0070698_100000110 | 3300005471 | Bacteria | 69016 |
| 198 | Ga0070698_100019877 | 3300005471 | Bacteria | 7044 |
| 199 | Ga0070698_100027252 | 3300005471 | Bacteria | 5945 |
| 200 | Ga0070698_100034483 | 3300005471 | Bacteria | 5237 |
| 201 | Ga0070698_100078815 | 3300005471 | Bacteria | 3292 |
| 202 | Ga0070698_100160715 | 3300005471 | Bacteria | 2190 |
| 203 | Ga0070698_100264545 | 3300005471 | Bacteria | 1652 |
| 204 | Ga0070698_100312851 | 3300005471 | Bacteria | 1501 |
| 205 | Ga0070698_100387468 | 3300005471 | Bacteria | 1330 |
| 206 | Ga0070699_100005810 | 3300005518 | Bacteria | 10793 |
| 207 | Ga0070699_100008560 | 3300005518 | Bacteria | 8863 |
| 208 | Ga0070699_100020042 | 3300005518 | Bacteria | 5762 |
| 209 | Ga0070699_100027987 | 3300005518 | Bacteria | 4861 |
| 210 | Ga0070699_100032281 | 3300005518 | Bacteria | 4521 |
| 211 | Ga0070699_100063068 | 3300005518 | Unclassified | 3213 |
| 212 | Ga0070699_100063336 | 3300005518 | Bacteria | 3206 |
| 213 | Ga0070699_100066277 | 3300005518 | Bacteria | 3134 |
| 214 | Ga0070699_100067475 | 3300005518 | Bacteria | 3107 |
| 215 | Ga0070699_100096606 | 3300005518 | Bacteria | 2587 |
| 216 | Ga0070699_100190308 | 3300005518 | Bacteria | 1822 |
| 217 | Ga0070699_100211156 | 3300005518 | Bacteria | 1728 |
| 218 | Ga0070699_100611799 | 3300005518 | Bacteria | 994 |
| 219 | Ga0070679_100002929 | 3300005530 | Bacteria | 15538 |
| 220 | Ga0070679_100025321 | 3300005530 | Bacteria | 5821 |
| 221 | Ga0070679_100054381 | 3300005530 | Bacteria | 3985 |
| 222 | Ga0070679_100209658 | 3300005530 | Bacteria | 1912 |
| 223 | Ga0070679_100373855 | 3300005530 | Bacteria | 1372 |
| 224 | Ga0070684_100004515 | 3300005535 | Bacteria | 10598 |
| 225 | Ga0070684_100013751 | 3300005535 | Bacteria | 6534 |
| 226 | Ga0070684_100161967 | 3300005535 | Bacteria | 2030 |
| 227 | Ga0070684_100195039 | 3300005535 | Bacteria | 1844 |
| 228 | Ga0070684_100330729 | 3300005535 | Bacteria | 1400 |
| 229 | Ga0070697_100003309 | 3300005536 | Bacteria | 12379 |
| 230 | Ga0070697_100004392 | 3300005536 | Bacteria | 10824 |
| 231 | Ga0070697_100012817 | 3300005536 | Bacteria | 6567 |
| 232 | Ga0070697_100018719 | 3300005536 | Bacteria | 5464 |
| 233 | Ga0070697_100040479 | 3300005536 | Bacteria | 3771 |
| 234 | Ga0070697_100066526 | 3300005536 | Bacteria | 2946 |
| 235 | Ga0070697_100099968 | 3300005536 | Bacteria | 2408 |
| 236 | Ga0070697_100414712 | 3300005536 | Bacteria | 1170 |
| 237 | Ga0070697_100501839 | 3300005536 | Bacteria | 1061 |
| 238 | Ga0068853_100035390 | 3300005539 | Bacteria | 4242 |
| 239 | Ga0068853_100043288 | 3300005539 | Bacteria | 3852 |
| 240 | Ga0068853_100139823 | 3300005539 | Bacteria | 2173 |
| 241 | Ga0068853_100159097 | 3300005539 | Bacteria | 2037 |
| 242 | Ga0070672_100001028 | 3300005543 | Bacteria | 16972 |
| 243 | Ga0070672_100003113 | 3300005543 | Bacteria | 10704 |
| 244 | Ga0070672_100007023 | 3300005543 | Bacteria | 7614 |
| 245 | Ga0070672_100062063 | 3300005543 | Bacteria | 2948 |
| 246 | Ga0070672_100072867 | 3300005543 | Bacteria | 2736 |
| 247 | Ga0070672_100194672 | 3300005543 | Bacteria | 1694 |
| 248 | Ga0070686_100000394 | 3300005544 | Bacteria | 27646 |
| 249 | Ga0070686_100073790 | 3300005544 | Bacteria | 2241 |
| 250 | Ga0070686_100464332 | 3300005544 | Bacteria | 976 |
| 251 | Ga0070695_100000724 | 3300005545 | Bacteria | 17616 |
| 252 | Ga0070695_100009703 | 3300005545 | Bacteria | 5733 |
| 253 | Ga0070695_100021490 | 3300005545 | Bacteria | 3950 |
| 254 | Ga0070695_100045572 | 3300005545 | Bacteria | 2796 |
| 255 | Ga0070695_100076356 | 3300005545 | Bacteria | 2206 |
| 256 | Ga0070695_100082344 | 3300005545 | Bacteria | 2131 |
| 257 | Ga0070695_100119075 | 3300005545 | Bacteria | 1804 |
| 258 | Ga0070695_100164901 | 3300005545 | Bacteria | 1559 |
| 259 | Ga0070696_100002440 | 3300005546 | Bacteria | 12318 |
| 260 | Ga0070696_100024923 | 3300005546 | Bacteria | 4065 |
| 261 | Ga0070696_100059206 | 3300005546 | Bacteria | 2676 |
| 262 | Ga0070696_100085964 | 3300005546 | Bacteria | 2232 |
| 263 | Ga0070696_100112452 | 3300005546 | Bacteria | 1962 |
| 264 | Ga0070696_100272708 | 3300005546 | Bacteria | 1287 |
| 265 | Ga0070696_100299714 | 3300005546 | Bacteria | 1231 |
| 266 | Ga0070696_100305090 | 3300005546 | Bacteria | 1220 |
| 267 | Ga0070696_100366072 | 3300005546 | Bacteria | 1120 |
| 268 | Ga0070693_100000530 | 3300005547 | Bacteria | 17134 |
| 269 | Ga0070693_100028206 | 3300005547 | Bacteria | 3050 |
| 270 | Ga0070665_100053465 | 3300005548 | Bacteria | 4050 |
| 271 | Ga0070665_100289904 | 3300005548 | Unclassified | 1639 |
| 272 | Ga0070665_100537584 | 3300005548 | Unclassified | 1181 |
| 273 | Ga0070704_100030815 | 3300005549 | Bacteria | 3598 |
| 274 | Ga0070704_100044729 | 3300005549 | Bacteria | 3078 |
| 275 | Ga0070704_100046332 | 3300005549 | Bacteria | 3031 |
| 276 | Ga0070704_100053519 | 3300005549 | Bacteria | 2853 |
| 277 | Ga0070704_100312001 | 3300005549 | Bacteria | 1314 |
| 278 | Ga0068855_100000221 | 3300005563 | Bacteria | 72860 |
| 279 | Ga0068855_100000319 | 3300005563 | Bacteria | 59802 |
| 280 | Ga0068855_100001074 | 3300005563 | Bacteria | 33944 |
| 281 | Ga0068855_100030553 | 3300005563 | Bacteria | 6442 |
| 282 | Ga0070664_100028129 | 3300005564 | Bacteria | 4675 |
| 283 | Ga0070664_100107053 | 3300005564 | Unclassified | 2437 |
| 284 | Ga0070664_100169494 | 3300005564 | Bacteria | 1936 |
| 285 | Ga0070664_100265485 | 3300005564 | Bacteria | 1545 |
| 286 | Ga0070664_100310117 | 3300005564 | Bacteria | 1428 |
| 287 | Ga0068857_100003125 | 3300005577 | Bacteria | 13696 |
| 288 | Ga0068857_100011491 | 3300005577 | Bacteria | 7702 |
| 289 | Ga0068857_100039971 | 3300005577 | Bacteria | 4158 |
| 290 | Ga0068857_100209496 | 3300005577 | Bacteria | 1778 |
| 291 | Ga0068857_100665956 | 3300005577 | Unclassified | 987 |
| 292 | Ga0068854_100002450 | 3300005578 | Bacteria | 11480 |
| 293 | Ga0068854_100017860 | 3300005578 | Bacteria | 4755 |
| 294 | Ga0068854_100027688 | 3300005578 | Bacteria | 3909 |
| 295 | Ga0068854_100029699 | 3300005578 | Bacteria | 3786 |
| 296 | Ga0068856_100000395 | 3300005614 | Bacteria | 47760 |
| 297 | Ga0068856_100000702 | 3300005614 | Bacteria | 36313 |
| 298 | Ga0068856_100006539 | 3300005614 | Bacteria | 11424 |
| 299 | Ga0068856_100071442 | 3300005614 | Bacteria | 3436 |
| 300 | Ga0068856_100110613 | 3300005614 | Bacteria | 2744 |
| 301 | Ga0068856_100172230 | 3300005614 | Bacteria | 2177 |
| 302 | Ga0070702_100005045 | 3300005615 | Bacteria | 6101 |
| 303 | Ga0070702_100074608 | 3300005615 | Bacteria | 2013 |
| 304 | Ga0070702_100083189 | 3300005615 | Bacteria | 1922 |
| 305 | Ga0070702_100351757 | 3300005615 | Bacteria | 1038 |
| 306 | Ga0070702_100426519 | 3300005615 | Bacteria | 956 |
| 307 | Ga0068852_100013672 | 3300005616 | Bacteria | 6218 |
| 308 | Ga0068852_100057047 | 3300005616 | Bacteria | 3378 |
| 309 | Ga0068852_100363435 | 3300005616 | Bacteria | 1416 |
| 310 | Ga0068859_100005562 | 3300005617 | Bacteria | 12835 |
| 311 | Ga0068859_100052175 | 3300005617 | Bacteria | 4111 |
| 312 | Ga0068859_100315399 | 3300005617 | Bacteria | 1657 |
| 313 | Ga0068859_100368890 | 3300005617 | Bacteria | 1531 |
| 314 | Ga0068859_100524675 | 3300005617 | Unclassified | 1279 |
| 315 | Ga0068864_100009783 | 3300005618 | Bacteria | 7905 |
| 316 | Ga0068864_100019686 | 3300005618 | Bacteria | 5644 |
| 317 | Ga0068864_100088825 | 3300005618 | Bacteria | 2722 |
| 318 | Ga0068864_100536979 | 3300005618 | Bacteria | 1129 |
| 319 | Ga0068866_10047771 | 3300005718 | Bacteria | 2160 |
| 320 | Ga0068866_10115925 | 3300005718 | Bacteria | 1502 |
| 321 | Ga0068861_100000215 | 3300005719 | Bacteria | 31072 |
| 322 | Ga0068861_100020438 | 3300005719 | Bacteria | 4743 |
| 323 | Ga0068861_100065067 | 3300005719 | Bacteria | 2807 |
| 324 | Ga0068861_100114297 | 3300005719 | Bacteria | 2167 |
| 325 | Ga0068861_100127163 | 3300005719 | Bacteria | 2064 |
| 326 | Ga0068861_100197654 | 3300005719 | Bacteria | 1686 |
| 327 | Ga0068861_100414240 | 3300005719 | Bacteria | 1199 |
| 328 | Ga0068870_10005277 | 3300005840 | Bacteria | 5629 |
| 329 | Ga0068870_10075049 | 3300005840 | Bacteria | 1854 |
| 330 | Ga0068870_10307629 | 3300005840 | Bacteria | 1003 |
| 331 | Ga0068863_100011479 | 3300005841 | Bacteria | 8566 |
| 332 | Ga0068863_100620379 | 3300005841 | Bacteria | 1071 |
| 333 | Ga0068858_100012272 | 3300005842 | Bacteria | 8080 |
| 334 | Ga0068858_100014856 | 3300005842 | Bacteria | 7325 |
| 335 | Ga0068858_100062959 | 3300005842 | Bacteria | 3431 |
| 336 | Ga0068860_100005361 | 3300005843 | Bacteria | 13014 |
| 337 | Ga0068860_100006217 | 3300005843 | Bacteria | 12008 |
| 338 | Ga0068860_100172082 | 3300005843 | Bacteria | 2092 |
| 339 | Ga0068860_100364306 | 3300005843 | Bacteria | 1425 |
| 340 | Ga0068860_100385768 | 3300005843 | Bacteria | 1383 |
| 341 | Ga0068860_100411011 | 3300005843 | Bacteria | 1340 |
| 342 | Ga0068860_100446116 | 3300005843 | Bacteria | 1286 |
| 343 | Ga0068860_100468211 | 3300005843 | Bacteria | 1255 |
| 344 | Ga0068860_100624064 | 3300005843 | Bacteria | 1084 |
| 345 | Ga0068862_100000487 | 3300005844 | Bacteria | 42413 |
| 346 | Ga0068862_100004802 | 3300005844 | Bacteria | 11378 |
| 347 | Ga0068862_100005359 | 3300005844 | Bacteria | 10743 |
| 348 | Ga0068862_100007938 | 3300005844 | Bacteria | 8778 |
| 349 | Ga0068862_100008356 | 3300005844 | Bacteria | 8566 |
| 350 | Ga0068862_100482258 | 3300005844 | Bacteria | 1174 |
| 351 | Ga0081455_10009207 | 3300005937 | Bacteria | 10175 |
| 352 | Ga0081455_10012540 | 3300005937 | Bacteria | 8456 |
| 353 | Ga0081538_10002955 | 3300005981 | Bacteria | 16226 |
| 354 | Ga0081540_1009165 | 3300005983 | Bacteria | 6828 |
| 355 | Ga0081540_1022020 | 3300005983 | Bacteria | 3772 |
| 356 | Ga0081539_10000005 | 3300005985 | Bacteria | 549026 |
| 357 | Ga0081539_10010818 | 3300005985 | Bacteria | 7339 |
| 358 | Ga0070717_10030630 | 3300006028 | Bacteria | 4322 |
| 359 | Ga0070717_10031603 | 3300006028 | Bacteria | 4260 |
| 360 | Ga0070717_10076240 | 3300006028 | Bacteria | 2806 |
| 361 | Ga0070717_10081475 | 3300006028 | Bacteria | 2717 |
| 362 | Ga0070717_10259026 | 3300006028 | Bacteria | 1539 |
| 363 | Ga0070717_10445543 | 3300006028 | Bacteria | 1166 |
| 364 | Ga0075365_10059939 | 3300006038 | Bacteria | 2538 |
| 365 | Ga0075365_10209186 | 3300006038 | Bacteria | 1367 |
| 366 | Ga0075364_10141433 | 3300006051 | Bacteria | 1619 |
| 367 | Ga0070715_10033522 | 3300006163 | Unclassified | 2099 |
| 368 | Ga0070715_10199334 | 3300006163 | Bacteria | 1016 |
| 369 | Ga0070716_100011844 | 3300006173 | Bacteria | 4401 |
| 370 | Ga0070716_100013575 | 3300006173 | Bacteria | 4155 |
| 371 | Ga0070716_100066523 | 3300006173 | Bacteria | 2102 |
| 372 | Ga0070712_100002462 | 3300006175 | Bacteria | 11411 |
| 373 | Ga0070712_100074986 | 3300006175 | Bacteria | 2432 |
| 374 | Ga0070712_100198168 | 3300006175 | Bacteria | 1576 |
| 375 | Ga0070712_100202754 | 3300006175 | Bacteria | 1559 |
| 376 | Ga0075362_10032693 | 3300006177 | Bacteria | 2259 |
| 377 | Ga0075367_10038686 | 3300006178 | Bacteria | 2777 |
| 378 | Ga0075366_10020461 | 3300006195 | Bacteria | 3840 |
| 379 | Ga0097621_100000655 | 3300006237 | Bacteria | 24396 |
| 380 | Ga0097621_100000712 | 3300006237 | Bacteria | 23346 |
| 381 | Ga0097621_100001381 | 3300006237 | Bacteria | 16690 |
| 382 | Ga0097621_100009385 | 3300006237 | Bacteria | 7099 |
| 383 | Ga0097621_100075788 | 3300006237 | Unclassified | 2789 |
| 384 | Ga0097621_100109456 | 3300006237 | Bacteria | 2334 |
| 385 | Ga0075370_10018571 | 3300006353 | Bacteria | 3775 |
| 386 | Ga0068871_100000128 | 3300006358 | Bacteria | 48140 |
| 387 | Ga0068871_100004305 | 3300006358 | Bacteria | 9886 |
| 388 | Ga0068871_100006933 | 3300006358 | Bacteria | 8071 |
| 389 | Ga0068871_100009068 | 3300006358 | Bacteria | 7185 |
| 390 | Ga0068871_100034070 | 3300006358 | Bacteria | 4038 |
| 391 | Ga0068871_100202301 | 3300006358 | Bacteria | 1715 |
| 392 | Ga0075428_100000470 | 3300006844 | Bacteria | 40579 |
| 393 | Ga0075428_100001407 | 3300006844 | Bacteria | 25617 |
| 394 | Ga0075428_100004438 | 3300006844 | Bacteria | 15494 |
| 395 | Ga0075428_100035695 | 3300006844 | Bacteria | 5479 |
| 396 | Ga0075428_100044380 | 3300006844 | Bacteria | 4885 |
| 397 | Ga0075428_100091286 | 3300006844 | Bacteria | 3322 |
| 398 | Ga0075428_100093715 | 3300006844 | Bacteria | 3274 |
| 399 | Ga0075428_100190009 | 3300006844 | Bacteria | 2221 |
| 400 | Ga0075428_100315065 | 3300006844 | Bacteria | 1682 |
| 401 | Ga0075430_100000104 | 3300006846 | Bacteria | 50931 |
| 402 | Ga0075430_100002874 | 3300006846 | Bacteria | 14412 |
| 403 | Ga0075430_100027546 | 3300006846 | Bacteria | 4827 |
| 404 | Ga0075430_100028790 | 3300006846 | Bacteria | 4718 |
| 405 | Ga0075430_100094421 | 3300006846 | Bacteria | 2500 |
| 406 | Ga0075430_100217736 | 3300006846 | Bacteria | 1584 |
| 407 | Ga0075430_100330233 | 3300006846 | Bacteria | 1260 |
| 408 | Ga0075430_100483120 | 3300006846 | Bacteria | 1022 |
| 409 | Ga0075431_100001472 | 3300006847 | Bacteria | 21746 |
| 410 | Ga0075431_100002983 | 3300006847 | Bacteria | 16384 |
| 411 | Ga0075431_100012897 | 3300006847 | Bacteria | 8435 |
| 412 | Ga0075431_100021273 | 3300006847 | Bacteria | 6629 |
| 413 | Ga0075431_100032096 | 3300006847 | Bacteria | 5412 |
| 414 | Ga0075431_100040701 | 3300006847 | Bacteria | 4789 |
| 415 | Ga0075431_100053715 | 3300006847 | Bacteria | 4153 |
| 416 | Ga0075431_100058876 | 3300006847 | Bacteria | 3964 |
| 417 | Ga0075431_100066441 | 3300006847 | Bacteria | 3723 |
| 418 | Ga0075431_100068550 | 3300006847 | Bacteria | 3661 |
| 419 | Ga0075431_100076627 | 3300006847 | Bacteria | 3451 |
| 420 | Ga0075431_100080694 | 3300006847 | Bacteria | 3359 |
| 421 | Ga0075431_100151068 | 3300006847 | Bacteria | 2391 |
| 422 | Ga0075431_100186840 | 3300006847 | Bacteria | 2125 |
| 423 | Ga0075431_100324220 | 3300006847 | Bacteria | 1552 |
| 424 | Ga0075431_100328467 | 3300006847 | Bacteria | 1541 |
| 425 | Ga0075431_100410262 | 3300006847 | Bacteria | 1355 |
| 426 | Ga0075431_100482244 | 3300006847 | Bacteria | 1233 |
| 427 | Ga0075433_10001635 | 3300006852 | Bacteria | 16632 |
| 428 | Ga0075433_10011551 | 3300006852 | Bacteria | 7113 |
| 429 | Ga0075433_10022370 | 3300006852 | Bacteria | 5307 |
| 430 | Ga0075433_10041400 | 3300006852 | Bacteria | 3991 |
| 431 | Ga0075433_10050516 | 3300006852 | Bacteria | 3620 |
| 432 | Ga0075433_10056028 | 3300006852 | Bacteria | 3443 |
| 433 | Ga0075433_10125059 | 3300006852 | Bacteria | 2284 |
| 434 | Ga0075433_10334463 | 3300006852 | Bacteria | 1339 |
| 435 | Ga0075433_10362395 | 3300006852 | Bacteria | 1280 |
| 436 | Ga0075433_10483842 | 3300006852 | Bacteria | 1090 |
| 437 | Ga0075434_100000469 | 3300006871 | Bacteria | 30196 |
| 438 | Ga0075434_100015709 | 3300006871 | Bacteria | 7265 |
| 439 | Ga0075434_100022371 | 3300006871 | Bacteria | 6157 |
| 440 | Ga0075434_100035465 | 3300006871 | Bacteria | 4931 |
| 441 | Ga0075434_100049436 | 3300006871 | Bacteria | 4175 |
| 442 | Ga0075434_100068018 | 3300006871 | Bacteria | 3548 |
| 443 | Ga0075434_100069888 | 3300006871 | Bacteria | 3501 |
| 444 | Ga0075434_100071588 | 3300006871 | Bacteria | 3458 |
| 445 | Ga0075434_100192190 | 3300006871 | Bacteria | 2062 |
| 446 | Ga0075434_100378399 | 3300006871 | Bacteria | 1436 |
| 447 | Ga0075434_100389325 | 3300006871 | Bacteria | 1415 |
| 448 | Ga0075434_100416613 | 3300006871 | Bacteria | 1364 |
| 449 | Ga0075434_100666726 | 3300006871 | Bacteria | 1058 |
| 450 | Ga0075429_100001259 | 3300006880 | Bacteria | 20601 |
| 451 | Ga0075429_100013498 | 3300006880 | Bacteria | 7087 |
| 452 | Ga0075429_100020898 | 3300006880 | Bacteria | 5680 |
| 453 | Ga0075429_100027791 | 3300006880 | Bacteria | 4910 |
| 454 | Ga0075429_100033913 | 3300006880 | Bacteria | 4435 |
| 455 | Ga0075429_100138986 | 3300006880 | Bacteria | 2126 |
| 456 | Ga0075429_100174171 | 3300006880 | Bacteria | 1885 |
| 457 | Ga0075429_100220591 | 3300006880 | Bacteria | 1661 |
| 458 | Ga0075429_100370296 | 3300006880 | Unclassified | 1254 |
| 459 | Ga0075429_100485962 | 3300006880 | Bacteria | 1082 |
| 460 | Ga0075429_100491243 | 3300006880 | Bacteria | 1075 |
| 461 | Ga0068865_100004568 | 3300006881 | Bacteria | 8355 |
| 462 | Ga0068865_100084502 | 3300006881 | Bacteria | 2287 |
| 463 | Ga0068865_100222464 | 3300006881 | Unclassified | 1476 |
| 464 | Ga0075436_100004214 | 3300006914 | Bacteria | 9869 |
| 465 | Ga0075436_100010262 | 3300006914 | Bacteria | 6411 |
| 466 | Ga0075436_100010910 | 3300006914 | Bacteria | 6235 |
| 467 | Ga0075436_100013523 | 3300006914 | Bacteria | 5590 |
| 468 | Ga0075436_100031727 | 3300006914 | Bacteria | 3640 |
| 469 | Ga0075436_100124658 | 3300006914 | Bacteria | 1804 |
| 470 | Ga0075436_100138472 | 3300006914 | Bacteria | 1710 |
| 471 | Ga0097620_100005562 | 3300006931 | Bacteria | 12835 |
| 472 | Ga0097620_100052175 | 3300006931 | Bacteria | 4111 |
| 473 | Ga0097620_100315384 | 3300006931 | Bacteria | 1657 |
| 474 | Ga0097620_100368908 | 3300006931 | Bacteria | 1531 |
| 475 | Ga0097620_100524687 | 3300006931 | Unclassified | 1279 |
| 476 | Ga0075435_100009432 | 3300007076 | Bacteria | 7066 |
| 477 | Ga0075435_100016130 | 3300007076 | Bacteria | 5628 |
| 478 | Ga0075435_100016853 | 3300007076 | Bacteria | 5516 |
| 479 | Ga0075435_100083146 | 3300007076 | Bacteria | 2632 |
| 480 | Ga0075435_100137537 | 3300007076 | Bacteria | 2047 |
| 481 | Ga0075435_100167259 | 3300007076 | Bacteria | 1854 |
| 482 | Ga0075435_100424984 | 3300007076 | Bacteria | 1144 |
| 483 | Ga0075435_100523447 | 3300007076 | Bacteria | 1026 |
| 484 | Ga0075435_100630789 | 3300007076 | Bacteria | 930 |
| 485 | Ga0099794_10000310 | 3300007265 | Bacteria | 16625 |
| 486 | Ga0099794_10013939 | 3300007265 | Bacteria | 3510 |
| 487 | Ga0105240_10003938 | 3300009093 | Bacteria | 22942 |
| 488 | Ga0105240_10004517 | 3300009093 | Bacteria | 21153 |
| 489 | Ga0105240_10019165 | 3300009093 | Bacteria | 9148 |
| 490 | Ga0105240_10168563 | 3300009093 | Bacteria | 2595 |
| 491 | Ga0105240_10334195 | 3300009093 | Bacteria | 1723 |
| 492 | Ga0111539_10000033 | 3300009094 | Bacteria | 154510 |
| 493 | Ga0111539_10004735 | 3300009094 | Bacteria | 17776 |
| 494 | Ga0111539_10006679 | 3300009094 | Bacteria | 14856 |
| 495 | Ga0111539_10006843 | 3300009094 | Bacteria | 14647 |
| 496 | Ga0111539_10032915 | 3300009094 | Bacteria | 6295 |
| 497 | Ga0111539_10070895 | 3300009094 | Unclassified | 4113 |
| 498 | Ga0111539_10077464 | 3300009094 | Bacteria | 3913 |
| 499 | Ga0105245_10000523 | 3300009098 | Bacteria | 35137 |
| 500 | Ga0105245_10072099 | 3300009098 | Bacteria | 3137 |
| 501 | Ga0105245_10516721 | 3300009098 | Bacteria | 1212 |
| 502 | Ga0105245_10565861 | 3300009098 | Bacteria | 1160 |
| 503 | Ga0105245_10626589 | 3300009098 | Unclassified | 1104 |
| 504 | Ga0114129_10000042 | 3300009147 | Bacteria | 107385 |
| 505 | Ga0114129_10006838 | 3300009147 | Bacteria | 16206 |
| 506 | Ga0114129_10015964 | 3300009147 | Bacteria | 10679 |
| 507 | Ga0114129_10024796 | 3300009147 | Bacteria | 8502 |
| 508 | Ga0114129_10042802 | 3300009147 | Bacteria | 6373 |
| 509 | Ga0114129_10043209 | 3300009147 | Bacteria | 6341 |
| 510 | Ga0114129_10065592 | 3300009147 | Bacteria | 5067 |
| 511 | Ga0114129_10073438 | 3300009147 | Bacteria | 4765 |
| 512 | Ga0114129_10076908 | 3300009147 | Bacteria | 4645 |
| 513 | Ga0114129_10118118 | 3300009147 | Unclassified | 3653 |
| 514 | Ga0114129_10166304 | 3300009147 | Bacteria | 3010 |
| 515 | Ga0114129_10183534 | 3300009147 | Bacteria | 2845 |
| 516 | Ga0114129_10188671 | 3300009147 | Bacteria | 2801 |
| 517 | Ga0114129_10205366 | 3300009147 | Bacteria | 2666 |
| 518 | Ga0114129_10318525 | 3300009147 | Bacteria | 2068 |
| 519 | Ga0114129_10586621 | 3300009147 | Bacteria | 1446 |
| 520 | Ga0114129_10713969 | 3300009147 | Bacteria | 1287 |
| 521 | Ga0114129_11091238 | 3300009147 | Bacteria | 1000 |
| 522 | Ga0114129_11193471 | 3300009147 | Bacteria | 948 |
| 523 | Ga0105243_10014982 | 3300009148 | Bacteria | 5869 |
| 524 | Ga0105243_10057957 | 3300009148 | Bacteria | 3086 |
| 525 | Ga0105243_10067344 | 3300009148 | Bacteria | 2882 |
| 526 | Ga0105243_10273085 | 3300009148 | Bacteria | 1519 |
| 527 | Ga0105243_10515795 | 3300009148 | Bacteria | 1136 |
| 528 | Ga0105241_10001179 | 3300009174 | Bacteria | 19931 |
| 529 | Ga0105241_10045989 | 3300009174 | Bacteria | 3313 |
| 530 | Ga0105241_10120680 | 3300009174 | Bacteria | 2110 |
| 531 | Ga0105242_10004792 | 3300009176 | Bacteria | 10466 |
| 532 | Ga0105242_10013473 | 3300009176 | Bacteria | 6322 |
| 533 | Ga0105242_10056164 | 3300009176 | Bacteria | 3221 |
| 534 | Ga0105242_10284374 | 3300009176 | Unclassified | 1503 |
| 535 | Ga0105242_10452761 | 3300009176 | Bacteria | 1210 |
| 536 | Ga0105248_10021019 | 3300009177 | Bacteria | 7232 |
| 537 | Ga0105248_10121987 | 3300009177 | Bacteria | 2940 |
| 538 | Ga0105248_10624575 | 3300009177 | Bacteria | 1216 |
| 539 | Ga0105238_10003209 | 3300009551 | Bacteria | 16328 |
| 540 | Ga0105238_10285683 | 3300009551 | Bacteria | 1632 |
| 541 | Ga0105238_10553300 | 3300009551 | Bacteria | 1155 |
| 542 | Ga0105249_10052101 | 3300009553 | Bacteria | 3736 |
| 543 | Ga0105249_10059101 | 3300009553 | Bacteria | 3515 |
| 544 | Ga0105249_10082803 | 3300009553 | Bacteria | 2985 |
| 545 | Ga0105249_10122364 | 3300009553 | Bacteria | 2474 |
| 546 | Ga0105249_10349543 | 3300009553 | Bacteria | 1497 |
| 547 | Ga0099796_10037372 | 3300010159 | Bacteria | 1623 |
| 548 | Ga0099796_10134529 | 3300010159 | Bacteria | 961 |
| 549 | Ga0105239_10051935 | 3300010375 | Bacteria | 4494 |
| 550 | Ga0105239_10109037 | 3300010375 | Bacteria | 3067 |
| 551 | Ga0105239_10177529 | 3300010375 | Bacteria | 2382 |
| 552 | Ga0105239_10183842 | 3300010375 | Bacteria | 2339 |
| 553 | Ga0105239_10213971 | 3300010375 | Bacteria | 2160 |
| 554 | Ga0105239_10240618 | 3300010375 | Bacteria | 2031 |
| 555 | Ga0105246_10017101 | 3300011119 | Bacteria | 4606 |
| 556 | Ga0105246_10176928 | 3300011119 | Bacteria | 1639 |
| 557 | Ga0157373_10004022 | 3300013100 | Bacteria | 11085 |
| 558 | Ga0157373_10253554 | 3300013100 | Bacteria | 1245 |
| 559 | Ga0157371_10083170 | 3300013102 | Bacteria | 2266 |
| 560 | Ga0157370_10201223 | 3300013104 | Bacteria | 1848 |
| 561 | Ga0157369_10000253 | 3300013105 | Bacteria | 73101 |
| 562 | Ga0157369_10135847 | 3300013105 | Bacteria | 2604 |
| 563 | Ga0157369_10428501 | 3300013105 | Bacteria | 1371 |
| 564 | Ga0157374_10000185 | 3300013296 | Bacteria | 58240 |
| 565 | Ga0157374_10000555 | 3300013296 | Bacteria | 33308 |
| 566 | Ga0157374_10083217 | 3300013296 | Bacteria | 3040 |
| 567 | Ga0157378_10000245 | 3300013297 | Bacteria | 53230 |
| 568 | Ga0157378_10000256 | 3300013297 | Bacteria | 52148 |
| 569 | Ga0157378_10013281 | 3300013297 | Bacteria | 7201 |
| 570 | Ga0157378_10341480 | 3300013297 | Bacteria | 1460 |
| 571 | Ga0157378_10565132 | 3300013297 | Bacteria | 1145 |
| 572 | Ga0163162_10042496 | 3300013306 | Bacteria | 4549 |
| 573 | Ga0163162_10274934 | 3300013306 | Bacteria | 1816 |
| 574 | Ga0163162_10991681 | 3300013306 | Bacteria | 949 |
| 575 | Ga0157372_10000310 | 3300013307 | Bacteria | 53854 |
| 576 | Ga0157372_10000704 | 3300013307 | Bacteria | 36761 |
| 577 | Ga0157372_10006181 | 3300013307 | Bacteria | 12733 |
| 578 | Ga0157372_10444242 | 3300013307 | Unclassified | 1512 |
| 579 | Ga0157375_10060541 | 3300013308 | Bacteria | 3755 |
| 580 | Ga0157375_10103512 | 3300013308 | Bacteria | 2934 |
| 581 | Ga0157375_10103719 | 3300013308 | Bacteria | 2931 |
| 582 | Ga0157375_10103752 | 3300013308 | Bacteria | 2931 |
| 583 | Ga0157375_10233222 | 3300013308 | Bacteria | 1999 |
| 584 | Ga0157375_10404091 | 3300013308 | Bacteria | 1532 |
| 585 | Ga0157375_10432545 | 3300013308 | Bacteria | 1482 |
| 586 | Ga0157375_10747566 | 3300013308 | Bacteria | 1129 |
| 587 | Ga0163163_10000629 | 3300014325 | Bacteria | 30399 |
| 588 | Ga0163163_10010981 | 3300014325 | Bacteria | 8185 |
| 589 | Ga0163163_10013691 | 3300014325 | Bacteria | 7431 |
| 590 | Ga0163163_10648426 | 3300014325 | Bacteria | 1119 |
| 591 | Ga0157380_10000622 | 3300014326 | Bacteria | 21784 |
| 592 | Ga0157380_10018733 | 3300014326 | Bacteria | 5145 |
| 593 | Ga0157380_10128589 | 3300014326 | Bacteria | 2157 |
| 594 | Ga0182008_10063456 | 3300014497 | Bacteria | 1820 |
| 595 | Ga0157377_10204822 | 3300014745 | Bacteria | 1255 |
| 596 | Ga0157379_10466371 | 3300014968 | Bacteria | 1167 |
| 597 | Ga0157376_10061590 | 3300014969 | Bacteria | 3155 |
| 598 | Ga0157376_10112309 | 3300014969 | Bacteria | 2400 |
| 599 | Ga0157376_10185298 | 3300014969 | Unclassified | 1905 |
| 600 | Ga0163161_10013549 | 3300017792 | Bacteria | 5676 |
| 601 | Ga0163161_10019586 | 3300017792 | Bacteria | 4747 |
| 602 | Ga0213872_10191890 | 3300021361 | Bacteria | 879 |
| 603 | Ga0213874_10054643 | 3300021377 | Bacteria | 1235 |
| 604 | Ga0213875_10000031 | 3300021388 | Bacteria | 176367 |
| 605 | Ga0213875_10011074 | 3300021388 | Bacteria | 4500 |
| 606 | Ga0213875_10031100 | 3300021388 | Bacteria | 2526 |
| 607 | Ga0213871_10003108 | 3300021441 | Bacteria | 3158 |
| 608 | Ga0213871_10010785 | 3300021441 | Bacteria | 2082 |
| 609 | Ga0207425_1001394 | 3300025245 | Bacteria | 10201 |
| 610 | Ga0209129_1000038 | 3300025258 | Bacteria | 322778 |
| 611 | Ga0209673_1006212 | 3300025273 | Bacteria | 5829 |
| 612 | Ga0209564_1000162 | 3300025295 | Bacteria | 162265 |
| 613 | Ga0209758_1000152 | 3300025297 | Bacteria | 162418 |
| 614 | Ga0209758_1000268 | 3300025297 | Bacteria | 103231 |
| 615 | Ga0209050_1000634 | 3300025298 | Bacteria | 54624 |
| 616 | Ga0209051_1018684 | 3300025303 | Bacteria | 3058 |
| 617 | Ga0207653_10044668 | 3300025885 | Bacteria | 1461 |
| 618 | Ga0207682_10001827 | 3300025893 | Bacteria | 9687 |
| 619 | Ga0207682_10002442 | 3300025893 | Bacteria | 8338 |
| 620 | Ga0207682_10006763 | 3300025893 | Bacteria | 4604 |
| 621 | Ga0207692_10033945 | 3300025898 | Bacteria | 2467 |
| 622 | Ga0207692_10068775 | 3300025898 | Bacteria | 1858 |
| 623 | Ga0207642_10090708 | 3300025899 | Bacteria | 1509 |
| 624 | Ga0207642_10263416 | 3300025899 | Bacteria | 984 |
| 625 | Ga0207680_10091210 | 3300025903 | Bacteria | 1938 |
| 626 | Ga0207680_10253565 | 3300025903 | Bacteria | 1216 |
| 627 | Ga0207685_10083535 | 3300025905 | Unclassified | 1328 |
| 628 | Ga0207685_10132727 | 3300025905 | Bacteria | 1107 |
| 629 | Ga0207699_10068254 | 3300025906 | Bacteria | 2165 |
| 630 | Ga0207699_10097440 | 3300025906 | Bacteria | 1859 |
| 631 | Ga0207699_10188398 | 3300025906 | Bacteria | 1391 |
| 632 | Ga0207699_10254006 | 3300025906 | Bacteria | 1212 |
| 633 | Ga0207645_10003940 | 3300025907 | Bacteria | 11084 |
| 634 | Ga0207645_10007209 | 3300025907 | Bacteria | 7877 |
| 635 | Ga0207645_10047526 | 3300025907 | Bacteria | 2740 |
| 636 | Ga0207645_10048214 | 3300025907 | Bacteria | 2720 |
| 637 | Ga0207645_10085051 | 3300025907 | Bacteria | 2030 |
| 638 | Ga0207645_10086119 | 3300025907 | Bacteria | 2018 |
| 639 | Ga0207645_10143787 | 3300025907 | Bacteria | 1554 |
| 640 | Ga0207643_10007922 | 3300025908 | Bacteria | 5702 |
| 641 | Ga0207643_10021697 | 3300025908 | Bacteria | 3531 |
| 642 | Ga0207643_10042997 | 3300025908 | Bacteria | 2548 |
| 643 | Ga0207643_10047414 | 3300025908 | Bacteria | 2431 |
| 644 | Ga0207684_10004374 | 3300025910 | Bacteria | 13343 |
| 645 | Ga0207684_10018218 | 3300025910 | Bacteria | 6014 |
| 646 | Ga0207684_10041285 | 3300025910 | Bacteria | 3912 |
| 647 | Ga0207684_10050770 | 3300025910 | Bacteria | 3519 |
| 648 | Ga0207684_10127314 | 3300025910 | Bacteria | 2186 |
| 649 | Ga0207684_10141148 | 3300025910 | Bacteria | 2071 |
| 650 | Ga0207684_10292087 | 3300025910 | Bacteria | 1405 |
| 651 | Ga0207684_10391272 | 3300025910 | Bacteria | 1195 |
| 652 | Ga0207684_10616467 | 3300025910 | Bacteria | 926 |
| 653 | Ga0207654_10023921 | 3300025911 | Bacteria | 3278 |
| 654 | Ga0207654_10453108 | 3300025911 | Bacteria | 900 |
| 655 | Ga0207707_10000116 | 3300025912 | Bacteria | 81364 |
| 656 | Ga0207707_10002125 | 3300025912 | Bacteria | 17942 |
| 657 | Ga0207707_10009719 | 3300025912 | Bacteria | 8343 |
| 658 | Ga0207707_10151516 | 3300025912 | Bacteria | 2027 |
| 659 | Ga0207707_10389240 | 3300025912 | Bacteria | 1198 |
| 660 | Ga0207707_10425421 | 3300025912 | Bacteria | 1138 |
| 661 | Ga0207695_10013936 | 3300025913 | Bacteria | 9557 |
| 662 | Ga0207695_10064783 | 3300025913 | Bacteria | 3760 |
| 663 | Ga0207695_10213574 | 3300025913 | Bacteria | 1839 |
| 664 | Ga0207695_10355295 | 3300025913 | Bacteria | 1352 |
| 665 | Ga0207693_10001378 | 3300025915 | Bacteria | 21558 |
| 666 | Ga0207693_10003875 | 3300025915 | Bacteria | 12745 |
| 667 | Ga0207693_10009321 | 3300025915 | Bacteria | 8004 |
| 668 | Ga0207693_10081766 | 3300025915 | Bacteria | 2529 |
| 669 | Ga0207693_10421476 | 3300025915 | Bacteria | 1043 |
| 670 | Ga0207663_10032599 | 3300025916 | Bacteria | 3094 |
| 671 | Ga0207663_10064800 | 3300025916 | Bacteria | 2333 |
| 672 | Ga0207663_10391143 | 3300025916 | Bacteria | 1061 |
| 673 | Ga0207663_10433675 | 3300025916 | Unclassified | 1011 |
| 674 | Ga0207663_10441364 | 3300025916 | Bacteria | 1002 |
| 675 | Ga0207660_10002889 | 3300025917 | Bacteria | 11226 |
| 676 | Ga0207660_10003241 | 3300025917 | Bacteria | 10654 |
| 677 | Ga0207660_10027825 | 3300025917 | Bacteria | 3862 |
| 678 | Ga0207660_10065156 | 3300025917 | Bacteria | 2632 |
| 679 | Ga0207660_10075335 | 3300025917 | Bacteria | 2465 |
| 680 | Ga0207660_10090695 | 3300025917 | Bacteria | 2265 |
| 681 | Ga0207660_10107783 | 3300025917 | Bacteria | 2091 |
| 682 | Ga0207660_10154842 | 3300025917 | Bacteria | 1764 |
| 683 | Ga0207662_10021154 | 3300025918 | Bacteria | 3715 |
| 684 | Ga0207662_10036540 | 3300025918 | Bacteria | 2872 |
| 685 | Ga0207662_10050184 | 3300025918 | Bacteria | 2478 |
| 686 | Ga0207662_10187918 | 3300025918 | Bacteria | 1332 |
| 687 | Ga0207657_10002084 | 3300025919 | Bacteria | 21638 |
| 688 | Ga0207649_10001837 | 3300025920 | Bacteria | 12126 |
| 689 | Ga0207652_10003098 | 3300025921 | Bacteria | 13862 |
| 690 | Ga0207652_10003188 | 3300025921 | Bacteria | 13630 |
| 691 | Ga0207646_10005516 | 3300025922 | Bacteria | 13296 |
| 692 | Ga0207646_10006384 | 3300025922 | Bacteria | 12193 |
| 693 | Ga0207646_10019430 | 3300025922 | Bacteria | 6315 |
| 694 | Ga0207646_10073368 | 3300025922 | Bacteria | 3057 |
| 695 | Ga0207646_10083553 | 3300025922 | Bacteria | 2856 |
| 696 | Ga0207646_10087386 | 3300025922 | Bacteria | 2790 |
| 697 | Ga0207646_10112231 | 3300025922 | Bacteria | 2447 |
| 698 | Ga0207646_10303599 | 3300025922 | Bacteria | 1442 |
| 699 | Ga0207646_10366230 | 3300025922 | Bacteria | 1302 |
| 700 | Ga0207681_10005697 | 3300025923 | Bacteria | 7645 |
| 701 | Ga0207681_10006234 | 3300025923 | Bacteria | 7313 |
| 702 | Ga0207681_10040017 | 3300025923 | Bacteria | 3116 |
| 703 | Ga0207681_10046721 | 3300025923 | Bacteria | 2913 |
| 704 | Ga0207681_10071471 | 3300025923 | Bacteria | 2421 |
| 705 | Ga0207681_10076841 | 3300025923 | Bacteria | 2346 |
| 706 | Ga0207694_10000808 | 3300025924 | Bacteria | 27977 |
| 707 | Ga0207650_10000551 | 3300025925 | Bacteria | 30436 |
| 708 | Ga0207650_10168712 | 3300025925 | Bacteria | 1738 |
| 709 | Ga0207650_10208399 | 3300025925 | Bacteria | 1569 |
| 710 | Ga0207659_10001103 | 3300025926 | Bacteria | 16006 |
| 711 | Ga0207659_10021669 | 3300025926 | Bacteria | 4270 |
| 712 | Ga0207659_10040215 | 3300025926 | Bacteria | 3268 |
| 713 | Ga0207659_10138628 | 3300025926 | Bacteria | 1886 |
| 714 | Ga0207659_10154218 | 3300025926 | Bacteria | 1797 |
| 715 | Ga0207687_10034986 | 3300025927 | Bacteria | 3414 |
| 716 | Ga0207687_10163810 | 3300025927 | Unclassified | 1709 |
| 717 | Ga0207687_10173737 | 3300025927 | Bacteria | 1664 |
| 718 | Ga0207687_10456197 | 3300025927 | Bacteria | 1061 |
| 719 | Ga0207700_10106401 | 3300025928 | Bacteria | 2249 |
| 720 | Ga0207700_10197787 | 3300025928 | Bacteria | 1692 |
| 721 | Ga0207700_10298235 | 3300025928 | Bacteria | 1391 |
| 722 | Ga0207700_10348275 | 3300025928 | Unclassified | 1289 |
| 723 | Ga0207700_10369071 | 3300025928 | Bacteria | 1253 |
| 724 | Ga0207664_10010521 | 3300025929 | Bacteria | 6533 |
| 725 | Ga0207664_10314345 | 3300025929 | Bacteria | 1381 |
| 726 | Ga0207664_10338440 | 3300025929 | Bacteria | 1330 |
| 727 | Ga0207664_10447763 | 3300025929 | Bacteria | 1152 |
| 728 | Ga0207644_10052722 | 3300025931 | Bacteria | 2924 |
| 729 | Ga0207690_10063370 | 3300025932 | Bacteria | 2520 |
| 730 | Ga0207690_10303445 | 3300025932 | Bacteria | 1250 |
| 731 | Ga0207706_10005422 | 3300025933 | Bacteria | 11888 |
| 732 | Ga0207706_10020088 | 3300025933 | Bacteria | 6002 |
| 733 | Ga0207706_10088092 | 3300025933 | Bacteria | 2730 |
| 734 | Ga0207706_10481303 | 3300025933 | Unclassified | 1073 |
| 735 | Ga0207686_10046404 | 3300025934 | Bacteria | 2679 |
| 736 | Ga0207686_10137838 | 3300025934 | Bacteria | 1682 |
| 737 | Ga0207709_10002771 | 3300025935 | Bacteria | 10805 |
| 738 | Ga0207670_10060075 | 3300025936 | Bacteria | 2588 |
| 739 | Ga0207670_10100406 | 3300025936 | Bacteria | 2066 |
| 740 | Ga0207670_10176697 | 3300025936 | Bacteria | 1605 |
| 741 | Ga0207670_10496473 | 3300025936 | Bacteria | 990 |
| 742 | Ga0207669_10011554 | 3300025937 | Bacteria | 4302 |
| 743 | Ga0207669_10140907 | 3300025937 | Bacteria | 1674 |
| 744 | Ga0207669_10198706 | 3300025937 | Bacteria | 1453 |
| 745 | Ga0207704_10011150 | 3300025938 | Bacteria | 4413 |
| 746 | Ga0207704_10015163 | 3300025938 | Bacteria | 3918 |
| 747 | Ga0207704_10068996 | 3300025938 | Bacteria | 2231 |
| 748 | Ga0207704_10102662 | 3300025938 | Bacteria | 1910 |
| 749 | Ga0207665_10022420 | 3300025939 | Bacteria | 4154 |
| 750 | Ga0207665_10025098 | 3300025939 | Bacteria | 3931 |
| 751 | Ga0207665_10033065 | 3300025939 | Bacteria | 3426 |
| 752 | Ga0207691_10000654 | 3300025940 | Bacteria | 34208 |
| 753 | Ga0207691_10004065 | 3300025940 | Bacteria | 14192 |
| 754 | Ga0207691_10010593 | 3300025940 | Bacteria | 8843 |
| 755 | Ga0207691_10011146 | 3300025940 | Bacteria | 8628 |
| 756 | Ga0207691_10015804 | 3300025940 | Bacteria | 7172 |
| 757 | Ga0207691_10031435 | 3300025940 | Bacteria | 4955 |
| 758 | Ga0207691_10094413 | 3300025940 | Bacteria | 2677 |
| 759 | Ga0207691_10157805 | 3300025940 | Bacteria | 1991 |
| 760 | Ga0207711_10063130 | 3300025941 | Bacteria | 3197 |
| 761 | Ga0207711_10131113 | 3300025941 | Bacteria | 2248 |
| 762 | Ga0207711_10174551 | 3300025941 | Bacteria | 1952 |
| 763 | Ga0207711_10202260 | 3300025941 | Bacteria | 1813 |
| 764 | Ga0207711_10297236 | 3300025941 | Bacteria | 1489 |
| 765 | Ga0207689_10000058 | 3300025942 | Bacteria | 86234 |
| 766 | Ga0207689_10002032 | 3300025942 | Bacteria | 19115 |
| 767 | Ga0207689_10012451 | 3300025942 | Bacteria | 7267 |
| 768 | Ga0207689_10116569 | 3300025942 | Bacteria | 2195 |
| 769 | Ga0207661_10018061 | 3300025944 | Bacteria | 5236 |
| 770 | Ga0207661_10046145 | 3300025944 | Bacteria | 3454 |
| 771 | Ga0207661_10329958 | 3300025944 | Bacteria | 1373 |
| 772 | Ga0207661_10437998 | 3300025944 | Bacteria | 1189 |
| 773 | Ga0207679_10002446 | 3300025945 | Bacteria | 11435 |
| 774 | Ga0207679_10214720 | 3300025945 | Bacteria | 1615 |
| 775 | Ga0207679_10265414 | 3300025945 | Bacteria | 1466 |
| 776 | Ga0207679_10445513 | 3300025945 | Bacteria | 1147 |
| 777 | Ga0207667_10000302 | 3300025949 | Bacteria | 68245 |
| 778 | Ga0207667_10000342 | 3300025949 | Bacteria | 63745 |
| 779 | Ga0207667_10007687 | 3300025949 | Bacteria | 12903 |
| 780 | Ga0207667_10077943 | 3300025949 | Bacteria | 3435 |
| 781 | Ga0207667_10878921 | 3300025949 | Bacteria | 889 |
| 782 | Ga0207651_10002536 | 3300025960 | Bacteria | 8722 |
| 783 | Ga0207651_10026438 | 3300025960 | Bacteria | 3626 |
| 784 | Ga0207651_10216807 | 3300025960 | Bacteria | 1544 |
| 785 | Ga0207651_10453664 | 3300025960 | Unclassified | 1100 |
| 786 | Ga0207712_10030656 | 3300025961 | Bacteria | 3617 |
| 787 | Ga0207712_10067792 | 3300025961 | Bacteria | 2555 |
| 788 | Ga0207712_10096187 | 3300025961 | Bacteria | 2191 |
| 789 | Ga0207712_10178009 | 3300025961 | Bacteria | 1668 |
| 790 | Ga0207668_10006404 | 3300025972 | Bacteria | 6960 |
| 791 | Ga0207668_10076748 | 3300025972 | Bacteria | 2407 |
| 792 | Ga0207668_10121854 | 3300025972 | Bacteria | 1976 |
| 793 | Ga0207640_10009617 | 3300025981 | Bacteria | 5420 |
| 794 | Ga0207640_10037075 | 3300025981 | Bacteria | 3065 |
| 795 | Ga0207640_10083073 | 3300025981 | Bacteria | 2195 |
| 796 | Ga0207640_10224167 | 3300025981 | Bacteria | 1441 |
| 797 | Ga0207658_10006276 | 3300025986 | Bacteria | 8125 |
| 798 | Ga0207677_10045251 | 3300026023 | Bacteria | 2938 |
| 799 | Ga0207677_10047631 | 3300026023 | Bacteria | 2880 |
| 800 | Ga0207677_10178073 | 3300026023 | Bacteria | 1670 |
| 801 | Ga0207703_10009410 | 3300026035 | Bacteria | 7677 |
| 802 | Ga0207703_10065489 | 3300026035 | Bacteria | 2987 |
| 803 | Ga0207703_10112267 | 3300026035 | Bacteria | 2328 |
| 804 | Ga0207639_10013319 | 3300026041 | Bacteria | 5753 |
| 805 | Ga0207639_10104608 | 3300026041 | Bacteria | 2295 |
| 806 | Ga0207678_10000501 | 3300026067 | Bacteria | 35486 |
| 807 | Ga0207708_10030161 | 3300026075 | Bacteria | 4113 |
| 808 | Ga0207708_10035592 | 3300026075 | Bacteria | 3789 |
| 809 | Ga0207708_10075312 | 3300026075 | Bacteria | 2588 |
| 810 | Ga0207708_10090592 | 3300026075 | Bacteria | 2357 |
| 811 | Ga0207708_10094789 | 3300026075 | Bacteria | 2304 |
| 812 | Ga0207708_10124614 | 3300026075 | Bacteria | 2010 |
| 813 | Ga0207708_10204446 | 3300026075 | Bacteria | 1576 |
| 814 | Ga0207708_10341087 | 3300026075 | Bacteria | 1227 |
| 815 | Ga0207708_10401329 | 3300026075 | Bacteria | 1134 |
| 816 | Ga0207702_10001675 | 3300026078 | Bacteria | 21899 |
| 817 | Ga0207702_10007641 | 3300026078 | Bacteria | 9202 |
| 818 | Ga0207702_10219058 | 3300026078 | Bacteria | 1773 |
| 819 | Ga0207702_10507216 | 3300026078 | Bacteria | 1176 |
| 820 | Ga0207641_10011020 | 3300026088 | Bacteria | 7415 |
| 821 | Ga0207641_10016259 | 3300026088 | Bacteria | 6094 |
| 822 | Ga0207641_10317891 | 3300026088 | Bacteria | 1475 |
| 823 | Ga0207641_10333839 | 3300026088 | Unclassified | 1441 |
| 824 | Ga0207641_10555287 | 3300026088 | Bacteria | 1120 |
| 825 | Ga0207648_10000911 | 3300026089 | Bacteria | 33297 |
| 826 | Ga0207648_10002647 | 3300026089 | Bacteria | 19109 |
| 827 | Ga0207648_10005445 | 3300026089 | Bacteria | 12824 |
| 828 | Ga0207648_10006801 | 3300026089 | Bacteria | 11336 |
| 829 | Ga0207648_10017555 | 3300026089 | Bacteria | 6503 |
| 830 | Ga0207648_10062711 | 3300026089 | Bacteria | 3240 |
| 831 | Ga0207648_10171772 | 3300026089 | Bacteria | 1916 |
| 832 | Ga0207648_10274668 | 3300026089 | Bacteria | 1506 |
| 833 | Ga0207648_10399345 | 3300026089 | Bacteria | 1245 |
| 834 | Ga0207648_10479842 | 3300026089 | Bacteria | 1135 |
| 835 | Ga0207648_10698200 | 3300026089 | Bacteria | 940 |
| 836 | Ga0207676_10006658 | 3300026095 | Bacteria | 8169 |
| 837 | Ga0207676_10240206 | 3300026095 | Bacteria | 1625 |
| 838 | Ga0207674_10002881 | 3300026116 | Bacteria | 21377 |
| 839 | Ga0207674_10036930 | 3300026116 | Bacteria | 5084 |
| 840 | Ga0207674_10042118 | 3300026116 | Bacteria | 4719 |
| 841 | Ga0207674_10622043 | 3300026116 | Bacteria | 1043 |
| 842 | Ga0207675_100003808 | 3300026118 | Bacteria | 14700 |
| 843 | Ga0207675_100015304 | 3300026118 | Bacteria | 7157 |
| 844 | Ga0207675_100023622 | 3300026118 | Bacteria | 5719 |
| 845 | Ga0207675_100027113 | 3300026118 | Bacteria | 5335 |
| 846 | Ga0207675_100039299 | 3300026118 | Bacteria | 4416 |
| 847 | Ga0207675_100061603 | 3300026118 | Bacteria | 3502 |
| 848 | Ga0207675_100101064 | 3300026118 | Bacteria | 2717 |
| 849 | Ga0207675_100419755 | 3300026118 | Bacteria | 1321 |
| 850 | Ga0207683_10074474 | 3300026121 | Bacteria | 3003 |
| 851 | Ga0207683_10106798 | 3300026121 | Bacteria | 2504 |
| 852 | Ga0207683_10209681 | 3300026121 | Bacteria | 1773 |
| 853 | Ga0207683_10362433 | 3300026121 | Bacteria | 1331 |
| 854 | Ga0207698_10007876 | 3300026142 | Bacteria | 6706 |
| 855 | Ga0207698_10286670 | 3300026142 | Bacteria | 1526 |
| 856 | Ga0207698_10316826 | 3300026142 | Bacteria | 1459 |
| 857 | Ga0209969_1004713 | 3300027360 | Bacteria | 1905 |
| 858 | Ga0210000_1001017 | 3300027462 | Bacteria | 3910 |
| 859 | Ga0210000_1006743 | 3300027462 | Bacteria | 1674 |
| 860 | Ga0209982_1012689 | 3300027552 | Bacteria | 1266 |
| 861 | Ga0209588_1003957 | 3300027671 | Bacteria | 4144 |
| 862 | Ga0209588_1034994 | 3300027671 | Bacteria | 1614 |
| 863 | Ga0209974_10011645 | 3300027876 | Bacteria | 2951 |
| 864 | Ga0207428_10000001 | 3300027907 | Bacteria | 1034622 |
| 865 | Ga0207428_10000214 | 3300027907 | Bacteria | 80012 |
| 866 | Ga0207428_10000794 | 3300027907 | Bacteria | 35722 |
| 867 | Ga0207428_10030615 | 3300027907 | Bacteria | 4448 |
| 868 | Ga0207428_10394614 | 3300027907 | Bacteria | 1014 |
| 869 | Ga0268266_10006285 | 3300028379 | Bacteria | 10894 |
| 870 | Ga0268266_10088977 | 3300028379 | Bacteria | 2703 |
| 871 | Ga0268265_10000291 | 3300028380 | Bacteria | 56604 |
| 872 | Ga0268265_10011760 | 3300028380 | Bacteria | 5920 |
| 873 | Ga0268265_10026086 | 3300028380 | Bacteria | 4154 |
| 874 | Ga0268265_10037529 | 3300028380 | Bacteria | 3557 |
| 875 | Ga0268265_10079564 | 3300028380 | Bacteria | 2582 |
| 876 | Ga0268265_10092699 | 3300028380 | Bacteria | 2418 |
| 877 | Ga0268265_10710430 | 3300028380 | Bacteria | 972 |
| 878 | Ga0268264_10010180 | 3300028381 | Bacteria | 7783 |
| 879 | Ga0268264_10011418 | 3300028381 | Bacteria | 7336 |
| 880 | Ga0268264_10102819 | 3300028381 | Bacteria | 2487 |
| 881 | Ga0268264_10283031 | 3300028381 | Unclassified | 1554 |
| 882 | Ga0268264_10283953 | 3300028381 | Bacteria | 1552 |
| 883 | Ga0268264_10340659 | 3300028381 | Bacteria | 1424 |
| 884 | Ga0268264_10378744 | 3300028381 | Bacteria | 1354 |
| 885 | Ga0265323_10030400 | 3300028653 | Bacteria | 2012 |
| 886 | Ga0265336_10005326 | 3300028666 | Bacteria | 4763 |
| 887 | Ga0307515_10000567 | 3300028794 | Bacteria | 87086 |
| 888 | Ga0307515_10001764 | 3300028794 | Bacteria | 48206 |
| 889 | Ga0307515_10017612 | 3300028794 | Bacteria | 12995 |
| 890 | Ga0307515_10154994 | 3300028794 | Bacteria | 2370 |
| 891 | Ga0265338_10116832 | 3300028800 | Bacteria | 2136 |
| 892 | Ga0265338_10179064 | 3300028800 | Bacteria | 1618 |
| 893 | Ga0265338_10272559 | 3300028800 | Bacteria | 1240 |
| 894 | Ga0307511_10110826 | 3300030521 | Bacteria | 1747 |
| 895 | Ga0307512_10056794 | 3300030522 | Bacteria | 3069 |
| 896 | Ga0307512_10152899 | 3300030522 | Bacteria | 1374 |
| 897 | Ga0307512_10180443 | 3300030522 | Bacteria | 1187 |
| 898 | Ga0265330_10034444 | 3300031235 | Bacteria | 2262 |
| 899 | Ga0265320_10006970 | 3300031240 | Bacteria | 7050 |
| 900 | Ga0265339_10001307 | 3300031249 | Bacteria | 18672 |
| 901 | Ga0265331_10061874 | 3300031250 | Bacteria | 1767 |
| 902 | Ga0307513_10019225 | 3300031456 | Bacteria | 8137 |
| 903 | Ga0307513_10023508 | 3300031456 | Bacteria | 7198 |
| 904 | Ga0307513_10025089 | 3300031456 | Bacteria | 6918 |
| 905 | Ga0307513_10028304 | 3300031456 | Bacteria | 6410 |
| 906 | Ga0307513_10029096 | 3300031456 | Bacteria | 6305 |
| 907 | Ga0307513_10060082 | 3300031456 | Bacteria | 4031 |
| 908 | Ga0307513_10141846 | 3300031456 | Bacteria | 2328 |
| 909 | Ga0307513_10148595 | 3300031456 | Bacteria | 2257 |
| 910 | Ga0307513_10286647 | 3300031456 | Bacteria | 1421 |
| 911 | Ga0307509_10018664 | 3300031507 | Bacteria | 7945 |
| 912 | Ga0307408_100056367 | 3300031548 | Bacteria | 2850 |
| 913 | Ga0307408_100321120 | 3300031548 | Bacteria | 1304 |
| 914 | Ga0307408_100469400 | 3300031548 | Bacteria | 1095 |
| 915 | Ga0307408_100580272 | 3300031548 | Bacteria | 993 |
| 916 | Ga0307508_10000133 | 3300031616 | Bacteria | 87867 |
| 917 | Ga0307514_10038864 | 3300031649 | Bacteria | 3761 |
| 918 | Ga0265314_10019470 | 3300031711 | Bacteria | 5260 |
| 919 | Ga0265342_10007004 | 3300031712 | Bacteria | 8327 |
| 920 | Ga0307516_10000747 | 3300031730 | Bacteria | 44219 |
| 921 | Ga0307516_10002063 | 3300031730 | Bacteria | 27367 |
| 922 | Ga0307405_10233057 | 3300031731 | Bacteria | 1358 |
| 923 | Ga0307413_10011267 | 3300031824 | Bacteria | 4386 |
| 924 | Ga0307518_10215546 | 3300031838 | Bacteria | 1259 |
| 925 | Ga0307410_10002475 | 3300031852 | Bacteria | 8924 |
| 926 | Ga0307406_10056580 | 3300031901 | Bacteria | 2512 |
| 927 | Ga0307407_10319380 | 3300031903 | Bacteria | 1089 |
| 928 | Ga0307412_10021440 | 3300031911 | Bacteria | 3947 |
| 929 | Ga0307409_100020905 | 3300031995 | Bacteria | 4474 |
| 930 | Ga0307409_100042172 | 3300031995 | Bacteria | 3415 |
| 931 | Ga0307409_100647996 | 3300031995 | Bacteria | 1050 |
| 932 | Ga0307416_100042240 | 3300032002 | Bacteria | 3558 |
| 933 | Ga0307416_100125061 | 3300032002 | Bacteria | 2302 |
| 934 | Ga0307416_100150289 | 3300032002 | Bacteria | 2135 |
| 935 | Ga0307416_100157725 | 3300032002 | Bacteria | 2092 |
| 936 | Ga0307416_100359489 | 3300032002 | Bacteria | 1477 |
| 937 | Ga0307416_100382521 | 3300032002 | Bacteria | 1438 |
| 938 | Ga0307416_100390082 | 3300032002 | Bacteria | 1426 |
| 939 | Ga0307411_10005848 | 3300032005 | Bacteria | 6097 |
| 940 | Ga0307411_10046909 | 3300032005 | Bacteria | 2789 |
| 941 | Ga0307411_10061891 | 3300032005 | Bacteria | 2494 |
| 942 | Ga0307411_10136279 | 3300032005 | Bacteria | 1803 |
| 943 | Ga0307411_10360116 | 3300032005 | Bacteria | 1189 |
| 944 | Ga0307507_10034086 | 3300033179 | Bacteria | 5270 |
| 945 | Ga0307510_10010883 | 3300033180 | Bacteria | 10809 |
| 946 | Ga0373930_0042092 | 3300034816 | Bacteria | 976 |
| 947 | Ga0373948_0002801 | 3300034817 | Bacteria | 2617 |
| 948 | Ga0373940_0009756 | 3300035088 | Bacteria | 2240 |
| 949 | Ga0373940_0052833 | 3300035088 | Bacteria | 1145 |
| 950 | Ga0373952_0028271 | 3300035092 | Bacteria | 1229 |
| 951 | Ga0373939_0060273 | 3300035114 | Bacteria | 1206 |
| 952 | Ga0373953_0004130 | 3300035117 | Unclassified | 4605 |
| 953 | Ga0373953_0008528 | 3300035117 | Bacteria | 3485 |
| 954 | Ga0373953_0018486 | 3300035117 | Bacteria | 2580 |
| 955 | Ga0373953_0092861 | 3300035117 | Unclassified | 1264 |
| 956 | Ga0373954_0000006 | 3300035118 | Bacteria | 98573 |
| 957 | Ga0373954_0013401 | 3300035118 | Bacteria | 3654 |
| 958 | Ga0373954_0063985 | 3300035118 | Bacteria | 1739 |
| 959 | Ga0373954_0253192 | 3300035118 | Unclassified | 867 |
| 960 | Ga0373956_0022127 | 3300035119 | Bacteria | 2717 |
| 961 | Ga0373957_0007206 | 3300035120 | Bacteria | 3549 |
| 962 | Ga0373957_0026624 | 3300035120 | Bacteria | 2094 |
| 963 | Ga0373955_0022552 | 3300035172 | Bacteria | 3195 |
| 964 | Ga0373955_0032155 | 3300035172 | Bacteria | 2752 |
| 965 | Ga0373942_0037600 | 3300035207 | Bacteria | 1309 |
| 966 | Ga0373961_0010428 | 3300035241 | Bacteria | 2290 |
| 967 | Ga0373924_0016868 | 3300035410 | Bacteria | 2793 |
| 968 | Ga0373924_0040131 | 3300035410 | Bacteria | 1915 |
| 969 | Ga0373924_0051486 | 3300035410 | Bacteria | 1707 |
| 970 | Ga0373924_0105168 | 3300035410 | Bacteria | 1217 |
| 971 | Ga0373931_0008116 | 3300035691 | Bacteria | 4973 |
| 972 | Ga0373931_0152358 | 3300035691 | Bacteria | 1349 |
| 973 | Ga0373931_0230415 | 3300035691 | Bacteria | 1119 |
| 974 | Ga0373927_0054967 | 3300035695 | Bacteria | 2575 |
| 975 | Ga0373927_0094975 | 3300035695 | Bacteria | 1938 |
| 976 | Ga0373933_0002554 | 3300035724 | Bacteria | 10210 |
| 977 | Ga0373933_0006374 | 3300035724 | Bacteria | 6421 |
| 978 | Ga0373933_0088149 | 3300035724 | Bacteria | 1912 |
| 979 | Ga0373937_0000595 | 3300036401 | Bacteria | 32029 |
| 980 | Ga0373937_0004857 | 3300036401 | Bacteria | 11425 |
| 981 | Ga0373937_0014930 | 3300036401 | Bacteria | 6859 |
| 982 | Ga0373937_0019178 | 3300036401 | Bacteria | 6122 |
| 983 | Ga0373937_0064219 | 3300036401 | Bacteria | 3377 |
| 984 | Ga0373937_0093528 | 3300036401 | Unclassified | 2788 |
| 985 | Ga0373937_0099029 | 3300036401 | Bacteria | 2704 |
| 986 | Ga0373937_0222136 | 3300036401 | Bacteria | 1778 |
| 987 | Ga0373937_0304898 | 3300036401 | Bacteria | 1506 |
| 988 | Ga0373937_0612699 | 3300036401 | Bacteria | 1033 |
| 989 | Ga0373937_0713218 | 3300036401 | Bacteria | 950 |
| 990 | Ga0373925_0033853 | 3300037068 | Bacteria | 3765 |
| 991 | Ga0373925_0036520 | 3300037068 | Bacteria | 3626 |
| 992 | Ga0373925_0128455 | 3300037068 | Bacteria | 1974 |
| 993 | Ga0373925_0187086 | 3300037068 | Unclassified | 1642 |
| 994 | Ga0373925_0224930 | 3300037068 | Unclassified | 1499 |
| 995 | Ga0373925_0278656 | 3300037068 | Unclassified | 1346 |
| 996 | Ga0373925_0328246 | 3300037068 | Bacteria | 1239 |
| 997 | Ga0395899_0009901 | 3300037312 | Bacteria | 7311 |
| 998 | Ga0395900_0007096 | 3300037418 | Bacteria | 11609 |
| 999 | Ga0395900_0008202 | 3300037418 | Bacteria | 10752 |
| 1000 | Ga0395900_0061683 | 3300037418 | Bacteria | 3855 |
| 1001 | Ga0395900_0110984 | 3300037418 | Bacteria | 2817 |
| 1002 | Ga0395898_0009370 | 3300037466 | Bacteria | 10284 |
| 1003 | Ga0395898_0124971 | 3300037466 | Bacteria | 2464 |
| 1004 | Ga0395905_0031024 | 3300037471 | Bacteria | 5034 |
| 1005 | Ga0395905_0439309 | 3300037471 | Bacteria | 1202 |
| 1006 | Ga0436364_0143816 | 3300037853 | Unclassified | 1877 |
| 1007 | Ga0436364_0257301 | 3300037853 | Bacteria | 1674 |
| 1008 | Ga0436364_0793438 | 3300037853 | Bacteria | 64960 |
| 1009 | Ga0436364_0818873 | 3300037853 | Unclassified | 2373 |
| 1010 | Ga0436364_1066269 | 3300037853 | Bacteria | 2123 |
| 1011 | Ga0436364_1318842 | 3300037853 | Bacteria | 1250 |
| 1012 | Ga0395901_0004642 | 3300038443 | Bacteria | 13858 |
| 1013 | Ga0395901_0012050 | 3300038443 | Bacteria | 8771 |
| 1014 | Ga0395901_0013096 | 3300038443 | Bacteria | 8417 |
| 1015 | Ga0395901_0068491 | 3300038443 | Bacteria | 3697 |
| 1016 | Ga0436365_0177547 | 3300039437 | Bacteria | 6176 |
| 1017 | Ga0436365_0425373 | 3300039437 | Bacteria | 2395 |
| 1018 | Ga0436365_0681786 | 3300039437 | Bacteria | 3529 |
| 1019 | Ga0436365_0868950 | 3300039437 | Bacteria | 3012 |
| 1020 | Ga0436360_0061449 | 3300039438 | Bacteria | 894 |
| 1021 | Ga0436360_0486209 | 3300039438 | Unclassified | 1010 |
| 1022 | Ga0436360_0793917 | 3300039438 | Bacteria | 2689 |
| 1023 | Ga0436360_1074955 | 3300039438 | Bacteria | 1653 |
| 1024 | Ga0436360_1280092 | 3300039438 | Bacteria | 3781 |
| 1025 | Ga0436360_1290437 | 3300039438 | Bacteria | 3382 |
| 1026 | Ga0436361_1006987 | 3300039447 | Bacteria | 1752 |
| 1027 | Ga0436363_0911403 | 3300039450 | Bacteria | 1237 |
| 1028 | Ga0436363_1073413 | 3300039450 | Bacteria | 6104 |
| 1029 | Ga0436362_0481759 | 3300039453 | Unclassified | 1365 |
| 1030 | Ga0436362_1028638 | 3300039453 | Bacteria | 2409 |
| 1031 | Ga0451793_1545139 | 3300041452 | Bacteria | 1558 |
| 1032 | Ga0451802_1112197 | 3300041460 | Bacteria | 1514 |
| 1033 | Ga0451807_0499581 | 3300041486 | Bacteria | 2671 |
| 1034 | Ga0451807_1253711 | 3300041486 | Bacteria | 5473 |
| 1035 | Ga0451849_0276976 | 3300041505 | Bacteria | 1604 |
| 1036 | Ga0451851_0523242 | 3300041507 | Bacteria | 1921 |
| 1037 | Ga0439431_0016250 | 3300041997 | Bacteria | 1740 |
| 1038 | Ga0439441_006088 | 3300042001 | Bacteria | 1899 |
| 1039 | Ga0439441_016519 | 3300042001 | Bacteria | 1317 |
| 1040 | Ga0439448_0001756 | 3300042005 | Bacteria | 5729 |
| 1041 | Ga0439448_0011271 | 3300042005 | Bacteria | 2663 |
| 1042 | Ga0439450_009064 | 3300042008 | Bacteria | 1877 |
| 1043 | Ga0439455_0013004 | 3300042012 | Bacteria | 1878 |
| 1044 | Ga0450889_001382 | 3300042144 | Bacteria | 2501 |
| 1045 | Ga0439458_0009129 | 3300042157 | Bacteria | 2209 |
| 1046 | Ga0439459_0000152 | 3300042438 | Bacteria | 7120 |
| 1047 | Ga0439464_0004171 | 3300042439 | Bacteria | 3680 |
| 1048 | Ga0439460_0001159 | 3300042461 | Bacteria | 6184 |
| 1049 | Ga0439460_0088558 | 3300042461 | Bacteria | 981 |
| 1050 | Ga0451577_0029889 | 3300042876 | Bacteria | 4923 |
| 1051 | Ga0451577_0041449 | 3300042876 | Bacteria | 4132 |
| 1052 | Ga0451577_0088469 | 3300042876 | Bacteria | 2763 |
| 1053 | Ga0466969_0009411 | 3300044656 | Bacteria | 5179 |
| 1054 | Ga0453683_0004609 | 3300044673 | Bacteria | 9738 |
| 1055 | Ga0453683_0098926 | 3300044673 | Bacteria | 1831 |
| 1056 | Ga0453684_0010525 | 3300044712 | Bacteria | 15792 |
| 1057 | Ga0453684_0115564 | 3300044712 | Bacteria | 3251 |
| 1058 | Ga0453684_0312292 | 3300044712 | Bacteria | 1783 |
| 1059 | Ga0453684_0583733 | 3300044712 | Bacteria | 1227 |
| 1060 | Ga0466959_0014401 | 3300045049 | Bacteria | 5745 |
| 1061 | Ga0451576_0003738 | 3300045051 | Bacteria | 20571 |
| 1062 | Ga0451576_0012679 | 3300045051 | Bacteria | 9463 |
| 1063 | Ga0451576_0095383 | 3300045051 | Bacteria | 3094 |
| 1064 | Ga0451576_0231551 | 3300045051 | Bacteria | 1930 |
| 1065 | Ga0451576_0245856 | 3300045051 | Bacteria | 1869 |
| 1066 | Ga0451576_0298432 | 3300045051 | Bacteria | 1685 |
| 1067 | Ga0451576_0378546 | 3300045051 | Bacteria | 1484 |
| 1068 | Ga0451576_0414902 | 3300045051 | Bacteria | 1412 |
| 1069 | Ga0466958_0088800 | 3300045836 | Unclassified | 1910 |
| 1070 | Ga0466958_0091092 | 3300045836 | Bacteria | 1887 |
| 1071 | Ga0466967_0213926 | 3300045976 | Bacteria | 1829 |
| 1072 | Ga0466967_0413470 | 3300045976 | Bacteria | 1314 |
| 1073 | Ga0495592_0000160 | 3300046454 | Bacteria | 59404 |
| 1074 | Ga0495592_0000928 | 3300046454 | Bacteria | 20345 |
| 1075 | Ga0495603_0132468 | 3300046455 | Bacteria | 1451 |
| 1076 | Ga0495590_0111461 | 3300046457 | Bacteria | 977 |
| 1077 | Ga0495629_0401303 | 3300046459 | Bacteria | 932 |
| 1078 | Ga0495638_0001008 | 3300046460 | Bacteria | 28102 |
| 1079 | Ga0495638_0043046 | 3300046460 | Bacteria | 2850 |
| 1080 | Ga0495638_0103625 | 3300046460 | Bacteria | 1698 |
| 1081 | Ga0495651_0079219 | 3300046462 | Bacteria | 2483 |
| 1082 | Ga0495651_0109338 | 3300046462 | Bacteria | 2046 |
| 1083 | Ga0495653_0316980 | 3300046463 | Bacteria | 1012 |
| 1084 | Ga0495580_0037801 | 3300046472 | Bacteria | 3461 |
| 1085 | Ga0495580_0077357 | 3300046472 | Bacteria | 2320 |
| 1086 | Ga0495580_0104380 | 3300046472 | Unclassified | 1970 |
| 1087 | Ga0495582_0015221 | 3300046473 | Bacteria | 4230 |
| 1088 | Ga0495582_0055355 | 3300046473 | Unclassified | 2187 |
| 1089 | Ga0495582_0147220 | 3300046473 | Bacteria | 1336 |
| 1090 | Ga0495662_0009907 | 3300046476 | Bacteria | 4680 |
| 1091 | Ga0495608_0001288 | 3300046511 | Bacteria | 17801 |
| 1092 | Ga0495608_0015622 | 3300046511 | Bacteria | 5259 |
| 1093 | Ga0495610_0055629 | 3300046512 | Bacteria | 1906 |
| 1094 | Ga0495620_0070385 | 3300046515 | Bacteria | 1433 |
| 1095 | Ga0495620_0090246 | 3300046515 | Bacteria | 1230 |
| 1096 | Ga0495628_0001997 | 3300046516 | Bacteria | 18485 |
| 1097 | Ga0495628_0049177 | 3300046516 | Bacteria | 3339 |
| 1098 | Ga0495628_0179249 | 3300046516 | Bacteria | 1603 |
| 1099 | Ga0495630_0001497 | 3300046517 | Bacteria | 16145 |
| 1100 | Ga0495630_0010529 | 3300046517 | Bacteria | 6681 |
| 1101 | Ga0495630_0077680 | 3300046517 | Unclassified | 2503 |
| 1102 | Ga0495630_0157346 | 3300046517 | Bacteria | 1729 |
| 1103 | Ga0495630_0315901 | 3300046517 | Bacteria | 1194 |
| 1104 | Ga0495632_0024686 | 3300046519 | Bacteria | 3189 |
| 1105 | Ga0495632_0054487 | 3300046519 | Bacteria | 1960 |
| 1106 | Ga0495632_0141651 | 3300046519 | Bacteria | 1115 |
| 1107 | Ga0495666_0001472 | 3300046526 | Bacteria | 11492 |
| 1108 | Ga0495666_0020433 | 3300046526 | Bacteria | 3281 |
| 1109 | Ga0495642_0116589 | 3300046528 | Bacteria | 1144 |
| 1110 | Ga0495652_0050184 | 3300046529 | Bacteria | 3569 |
| 1111 | Ga0495640_0000622 | 3300046533 | Bacteria | 26156 |
| 1112 | Ga0495640_0041479 | 3300046533 | Bacteria | 3216 |
| 1113 | Ga0495640_0086660 | 3300046533 | Bacteria | 2073 |
| 1114 | Ga0495586_0001804 | 3300046535 | Bacteria | 11704 |
| 1115 | Ga0495586_0011239 | 3300046535 | Bacteria | 4760 |
| 1116 | Ga0495586_0011452 | 3300046535 | Bacteria | 4715 |
| 1117 | Ga0495586_0022520 | 3300046535 | Unclassified | 3363 |
| 1118 | Ga0495586_0173157 | 3300046535 | Bacteria | 1220 |
| 1119 | Ga0495587_0016321 | 3300046536 | Bacteria | 4621 |
| 1120 | Ga0495587_0055134 | 3300046536 | Bacteria | 2342 |
| 1121 | Ga0495645_0056608 | 3300046543 | Bacteria | 2847 |
| 1122 | Ga0495667_0004436 | 3300046559 | Bacteria | 9471 |
| 1123 | Ga0495667_0008992 | 3300046559 | Bacteria | 6788 |
| 1124 | Ga0495667_0036472 | 3300046559 | Bacteria | 3282 |
| 1125 | Ga0495634_0004756 | 3300046642 | Bacteria | 10560 |
| 1126 | Ga0495634_0048623 | 3300046642 | Bacteria | 2855 |
| 1127 | Ga0495634_0075662 | 3300046642 | Bacteria | 2211 |
| 1128 | Ga0495625_0000452 | 3300046660 | Bacteria | 61641 |
| 1129 | Ga0495625_0005241 | 3300046660 | Bacteria | 11930 |
| 1130 | Ga0495625_0034663 | 3300046660 | Unclassified | 3724 |
| 1131 | Ga0495635_0018825 | 3300046663 | Bacteria | 4819 |
| 1132 | Ga0495635_0128061 | 3300046663 | Bacteria | 1731 |
| 1133 | Ga0495659_0007967 | 3300046664 | Bacteria | 3362 |
| 1134 | Ga0495659_0011969 | 3300046664 | Bacteria | 2800 |
| 1135 | Ga0495599_0007711 | 3300046678 | Bacteria | 6536 |
| 1136 | Ga0495599_0031262 | 3300046678 | Bacteria | 3342 |
| 1137 | Ga0495599_0079319 | 3300046678 | Bacteria | 2050 |
| 1138 | Ga0495599_0094923 | 3300046678 | Unclassified | 1860 |
| 1139 | Ga0495647_0026811 | 3300046681 | Unclassified | 2114 |
| 1140 | Ga0495658_0043624 | 3300046683 | Bacteria | 2510 |
| 1141 | Ga0495658_0083815 | 3300046683 | Bacteria | 1876 |
| 1142 | Ga0495669_0022956 | 3300046684 | Bacteria | 2712 |
| 1143 | Ga0495669_0038652 | 3300046684 | Bacteria | 2114 |
| 1144 | Ga0495669_0128026 | 3300046684 | Bacteria | 1194 |
| 1145 | Ga0495613_0016058 | 3300046689 | Bacteria | 5574 |
| 1146 | Ga0495624_0032623 | 3300046690 | Bacteria | 3376 |
| 1147 | Ga0495600_0008015 | 3300046809 | Bacteria | 6473 |
| 1148 | Ga0495604_0001281 | 3300047317 | Bacteria | 20561 |
| 1149 | Ga0495636_0020840 | 3300047318 | Bacteria | 2643 |
| 1150 | Ga0495674_0007664 | 3300047319 | Bacteria | 10310 |
| 1151 | Ga0495674_0077092 | 3300047319 | Bacteria | 2866 |
| 1152 | Ga0495674_0080808 | 3300047319 | Bacteria | 2789 |
| 1153 | Ga0495674_0118630 | 3300047319 | Unclassified | 2237 |
| 1154 | Ga0495680_0000665 | 3300047322 | Bacteria | 38471 |
| 1155 | Ga0495680_0093768 | 3300047322 | Bacteria | 2247 |
| 1156 | Ga0495675_0016482 | 3300047444 | Bacteria | 4674 |
| 1157 | Ga0495675_0146396 | 3300047444 | Bacteria | 1461 |
| 1158 | Ga0495684_0322337 | 3300047471 | Bacteria | 1104 |
| 1159 | Ga0495593_0210636 | 3300047673 | Bacteria | 976 |
| 1160 | Ga0495602_0003699 | 3300048088 | Bacteria | 15868 |
| 1161 | Ga0495602_0083243 | 3300048088 | Bacteria | 2682 |
| 1162 | Ga0495614_0092830 | 3300048089 | Bacteria | 1314 |
| 1163 | Ga0496100_0207965 | 3300048903 | Bacteria | 1430 |
| 1164 | Ga0496102_0009055 | 3300048905 | Bacteria | 8543 |
| 1165 | Ga0496102_0018920 | 3300048905 | Bacteria | 6060 |
| 1166 | Ga0496102_0047527 | 3300048905 | Bacteria | 3901 |
| 1167 | Ga0496102_0317890 | 3300048905 | Bacteria | 1467 |
| 1168 | Ga0496104_0041740 | 3300048907 | Bacteria | 4303 |
| 1169 | Ga0496104_0289822 | 3300048907 | Bacteria | 1549 |
| 1170 | Ga0496106_0083474 | 3300048909 | Bacteria | 2457 |
| 1171 | Ga0496106_0162961 | 3300048909 | Bacteria | 1764 |
| 1172 | Ga0496106_0365983 | 3300048909 | Unclassified | 1158 |
| 1173 | Ga0496107_0090270 | 3300048910 | Bacteria | 2238 |
| 1174 | Ga0496109_0546403 | 3300048912 | Bacteria | 1093 |
| 1175 | Ga0496112_0003733 | 3300048915 | Bacteria | 12718 |
| 1176 | Ga0496112_0140233 | 3300048915 | Bacteria | 2387 |
| 1177 | Ga0496112_0181338 | 3300048915 | Bacteria | 2070 |
| 1178 | Ga0496112_0513735 | 3300048915 | Bacteria | 1133 |
| 1179 | Ga0496112_0873636 | 3300048915 | Bacteria | 822 |
| 1180 | Ga0496118_0037802 | 3300048921 | Bacteria | 3879 |
| 1181 | Ga0496119_0014528 | 3300048922 | Bacteria | 6152 |
| 1182 | Ga0496121_0092816 | 3300048924 | Bacteria | 2352 |
| 1183 | Ga0496126_0001339 | 3300048929 | Bacteria | 39084 |
| 1184 | Ga0501031_0001671 | 3300049568 | Bacteria | 13924 |
| 1185 | Ga0501031_0006567 | 3300049568 | Bacteria | 7589 |
| 1186 | Ga0501031_0067526 | 3300049568 | Bacteria | 2329 |
| 1187 | Ga0501032_0012640 | 3300049569 | Bacteria | 6024 |
| 1188 | Ga0501032_0199448 | 3300049569 | Bacteria | 1306 |
| 1189 | Ga0501032_0331132 | 3300049569 | Bacteria | 982 |
| 1190 | Ga0501033_0028548 | 3300049570 | Bacteria | 4191 |
| 1191 | Ga0501033_0049310 | 3300049570 | Bacteria | 3125 |
| 1192 | Ga0501033_0059948 | 3300049570 | Bacteria | 2809 |
| 1193 | Ga0501033_0076679 | 3300049570 | Bacteria | 2454 |
| 1194 | Ga0501033_0102784 | 3300049570 | Bacteria | 2084 |
| 1195 | Ga0501036_0010791 | 3300049572 | Bacteria | 7550 |
| 1196 | Ga0501036_0111897 | 3300049572 | Bacteria | 2307 |
| 1197 | Ga0501036_0181883 | 3300049572 | Bacteria | 1770 |
| 1198 | Ga0501036_0211748 | 3300049572 | Bacteria | 1628 |
| 1199 | Ga0501037_0123723 | 3300049573 | Bacteria | 1858 |
| 1200 | Ga0501037_0224693 | 3300049573 | Bacteria | 1320 |
| 1201 | Ga0501038_0006982 | 3300049574 | Bacteria | 10428 |
| 1202 | Ga0501038_0008494 | 3300049574 | Bacteria | 9441 |
| 1203 | Ga0501038_0071944 | 3300049574 | Bacteria | 2932 |
| 1204 | Ga0501038_0112166 | 3300049574 | Bacteria | 2258 |
| 1205 | Ga0501038_0146862 | 3300049574 | Bacteria | 1925 |
| 1206 | Ga0501038_0235050 | 3300049574 | Bacteria | 1457 |
| 1207 | Ga0501039_0003897 | 3300049575 | Bacteria | 11205 |
| 1208 | Ga0501039_0008458 | 3300049575 | Bacteria | 7843 |
| 1209 | Ga0501039_0015965 | 3300049575 | Bacteria | 5749 |
| 1210 | Ga0501039_0305649 | 3300049575 | Bacteria | 1250 |
| 1211 | Ga0501039_0458236 | 3300049575 | Bacteria | 1001 |
| 1212 | Ga0501040_0003299 | 3300049576 | Bacteria | 10431 |
| 1213 | Ga0501040_0004167 | 3300049576 | Bacteria | 9410 |
| 1214 | Ga0501040_0005119 | 3300049576 | Bacteria | 8477 |
| 1215 | Ga0501040_0054080 | 3300049576 | Bacteria | 2752 |
| 1216 | Ga0501040_0060566 | 3300049576 | Bacteria | 2601 |
| 1217 | Ga0501040_0061276 | 3300049576 | Bacteria | 2587 |
| 1218 | Ga0501040_0075062 | 3300049576 | Bacteria | 2336 |
| 1219 | Ga0501040_0161860 | 3300049576 | Bacteria | 1582 |
| 1220 | Ga0501040_0169605 | 3300049576 | Bacteria | 1545 |
| 1221 | Ga0501040_0213272 | 3300049576 | Bacteria | 1373 |
| 1222 | Ga0501040_0216139 | 3300049576 | Bacteria | 1363 |
| 1223 | Ga0501040_0362779 | 3300049576 | Bacteria | 1038 |
| 1224 | Ga0501041_0003324 | 3300049577 | Bacteria | 9252 |
| 1225 | Ga0501041_0008148 | 3300049577 | Bacteria | 6165 |
| 1226 | Ga0501041_0036481 | 3300049577 | Bacteria | 2978 |
| 1227 | Ga0501041_0044144 | 3300049577 | Bacteria | 2710 |
| 1228 | Ga0501041_0152210 | 3300049577 | Bacteria | 1444 |
| 1229 | Ga0501041_0200804 | 3300049577 | Bacteria | 1250 |
| 1230 | Ga0501041_0234544 | 3300049577 | Bacteria | 1152 |
| 1231 | Ga0501041_0289759 | 3300049577 | Bacteria | 1031 |
| 1232 | Ga0501042_0002578 | 3300049578 | Bacteria | 11146 |
| 1233 | Ga0501042_0038435 | 3300049578 | Bacteria | 3399 |
| 1234 | Ga0501042_0048793 | 3300049578 | Bacteria | 3019 |
| 1235 | Ga0501042_0063642 | 3300049578 | Bacteria | 2636 |
| 1236 | Ga0501042_0106511 | 3300049578 | Bacteria | 2018 |
| 1237 | Ga0501042_0120172 | 3300049578 | Bacteria | 1891 |
| 1238 | Ga0501043_0033960 | 3300049579 | Bacteria | 4013 |
| 1239 | Ga0501043_0105080 | 3300049579 | Bacteria | 2219 |
| 1240 | Ga0501043_0107629 | 3300049579 | Bacteria | 2190 |
| 1241 | Ga0501043_0481151 | 3300049579 | Bacteria | 930 |
| 1242 | Ga0501046_0001962 | 3300049580 | Bacteria | 19557 |
| 1243 | Ga0501046_0004982 | 3300049580 | Bacteria | 11922 |
| 1244 | Ga0501046_0006823 | 3300049580 | Bacteria | 10072 |
| 1245 | Ga0501046_0030364 | 3300049580 | Bacteria | 4386 |
| 1246 | Ga0501046_0095204 | 3300049580 | Unclassified | 2288 |
| 1247 | Ga0501047_0035034 | 3300049581 | Bacteria | 4848 |
| 1248 | Ga0501048_0010923 | 3300049582 | Bacteria | 6774 |
| 1249 | Ga0501048_0011694 | 3300049582 | Bacteria | 6548 |
| 1250 | Ga0501048_0075735 | 3300049582 | Bacteria | 2375 |
| 1251 | Ga0501048_0144139 | 3300049582 | Bacteria | 1685 |
| 1252 | Ga0501048_0151340 | 3300049582 | Bacteria | 1641 |
| 1253 | Ga0501048_0198638 | 3300049582 | Bacteria | 1421 |
| 1254 | Ga0501048_0304650 | 3300049582 | Bacteria | 1134 |
| 1255 | Ga0501068_0003456 | 3300049584 | Bacteria | 8508 |
| 1256 | Ga0501068_0080825 | 3300049584 | Bacteria | 1994 |
| 1257 | Ga0501070_0237117 | 3300049586 | Bacteria | 1494 |
| 1258 | Ga0501070_0295479 | 3300049586 | Bacteria | 1320 |
| 1259 | Ga0501071_0000244 | 3300049587 | Bacteria | 25138 |
| 1260 | Ga0501071_0057203 | 3300049587 | Bacteria | 2818 |
| 1261 | Ga0501071_0077946 | 3300049587 | Bacteria | 2421 |
| 1262 | Ga0501072_0002603 | 3300049588 | Bacteria | 13517 |
| 1263 | Ga0501072_0010608 | 3300049588 | Bacteria | 7016 |
| 1264 | Ga0501072_0043509 | 3300049588 | Bacteria | 3529 |
| 1265 | Ga0501072_0095782 | 3300049588 | Bacteria | 2359 |
| 1266 | Ga0501072_0134650 | 3300049588 | Bacteria | 1970 |
| 1267 | Ga0501072_0139603 | 3300049588 | Bacteria | 1932 |
| 1268 | Ga0501072_0147679 | 3300049588 | Bacteria | 1874 |
| 1269 | Ga0501072_0256715 | 3300049588 | Bacteria | 1392 |
| 1270 | Ga0501072_0441104 | 3300049588 | Bacteria | 1031 |
| 1271 | Ga0501073_0176181 | 3300049589 | Bacteria | 1480 |
| 1272 | Ga0501074_0007388 | 3300049590 | Bacteria | 7947 |
| 1273 | Ga0501074_0011907 | 3300049590 | Bacteria | 6325 |
| 1274 | Ga0501074_0094026 | 3300049590 | Bacteria | 2147 |
| 1275 | Ga0501074_0105750 | 3300049590 | Bacteria | 2015 |
| 1276 | Ga0501074_0160007 | 3300049590 | Bacteria | 1608 |
| 1277 | Ga0501075_0002670 | 3300049591 | Bacteria | 11923 |
| 1278 | Ga0501075_0004621 | 3300049591 | Bacteria | 9342 |
| 1279 | Ga0501075_0014543 | 3300049591 | Bacteria | 5640 |
| 1280 | Ga0501075_0017637 | 3300049591 | Bacteria | 5155 |
| 1281 | Ga0501075_0018540 | 3300049591 | Bacteria | 5038 |
| 1282 | Ga0501075_0023006 | 3300049591 | Bacteria | 4558 |
| 1283 | Ga0501075_0053090 | 3300049591 | Bacteria | 3048 |
| 1284 | Ga0501075_0061150 | 3300049591 | Bacteria | 2838 |
| 1285 | Ga0501075_0073459 | 3300049591 | Bacteria | 2586 |
| 1286 | Ga0501075_0092811 | 3300049591 | Bacteria | 2291 |
| 1287 | Ga0501075_0100270 | 3300049591 | Bacteria | 2199 |
| 1288 | Ga0501075_0110137 | 3300049591 | Bacteria | 2094 |
| 1289 | Ga0501075_0135693 | 3300049591 | Bacteria | 1875 |
| 1290 | Ga0501075_0281805 | 3300049591 | Bacteria | 1266 |
| 1291 | Ga0501076_0000941 | 3300049592 | Bacteria | 18993 |
| 1292 | Ga0501076_0001068 | 3300049592 | Bacteria | 17988 |
| 1293 | Ga0501076_0008483 | 3300049592 | Bacteria | 7530 |
| 1294 | Ga0501076_0023984 | 3300049592 | Bacteria | 4709 |
| 1295 | Ga0501076_0032035 | 3300049592 | Bacteria | 4102 |
| 1296 | Ga0501076_0035412 | 3300049592 | Bacteria | 3906 |
| 1297 | Ga0501076_0062674 | 3300049592 | Bacteria | 2962 |
| 1298 | Ga0501076_0123523 | 3300049592 | Bacteria | 2096 |
| 1299 | Ga0501076_0191079 | 3300049592 | Bacteria | 1671 |
| 1300 | Ga0501076_0397988 | 3300049592 | Bacteria | 1132 |
| 1301 | Ga0501077_0001148 | 3300049593 | Bacteria | 16004 |
| 1302 | Ga0501077_0001199 | 3300049593 | Bacteria | 15656 |
| 1303 | Ga0501077_0006228 | 3300049593 | Bacteria | 7293 |
| 1304 | Ga0501077_0007712 | 3300049593 | Bacteria | 6643 |
| 1305 | Ga0501077_0023151 | 3300049593 | Bacteria | 3938 |
| 1306 | Ga0501077_0024656 | 3300049593 | Bacteria | 3819 |
| 1307 | Ga0501077_0027849 | 3300049593 | Bacteria | 3589 |
| 1308 | Ga0501077_0143405 | 3300049593 | Bacteria | 1515 |
| 1309 | Ga0501077_0219633 | 3300049593 | Bacteria | 1208 |
| 1310 | Ga0501079_0000911 | 3300049741 | Bacteria | 20299 |
| 1311 | Ga0501079_0007952 | 3300049741 | Bacteria | 8040 |
| 1312 | Ga0501079_0015315 | 3300049741 | Bacteria | 5849 |
| 1313 | Ga0501079_0031397 | 3300049741 | Bacteria | 4083 |
| 1314 | Ga0501079_0098538 | 3300049741 | Bacteria | 2266 |
| 1315 | Ga0501079_0165532 | 3300049741 | Bacteria | 1724 |
| 1316 | Ga0501079_0170630 | 3300049741 | Bacteria | 1696 |
| 1317 | Ga0501079_0197258 | 3300049741 | Bacteria | 1571 |
| 1318 | Ga0501079_0349818 | 3300049741 | Bacteria | 1158 |
| 1319 | Ga0501079_0493282 | 3300049741 | Bacteria | 963 |
| 1320 | Ga0501080_0003304 | 3300049742 | Bacteria | 14254 |
| 1321 | Ga0501080_0047991 | 3300049742 | Bacteria | 3976 |
| 1322 | Ga0501080_0057118 | 3300049742 | Bacteria | 3634 |
| 1323 | Ga0501080_0123805 | 3300049742 | Bacteria | 2395 |
| 1324 | Ga0501080_0153994 | 3300049742 | Bacteria | 2124 |
| 1325 | Ga0501080_0208191 | 3300049742 | Bacteria | 1793 |
| 1326 | Ga0501080_0234960 | 3300049742 | Bacteria | 1675 |
| 1327 | Ga0501080_0545622 | 3300049742 | Bacteria | 1033 |
| 1328 | Ga0501080_0587237 | 3300049742 | Bacteria | 990 |
| 1329 | Ga0501081_0001515 | 3300049743 | Bacteria | 14277 |
| 1330 | Ga0501081_0002460 | 3300049743 | Bacteria | 11684 |
| 1331 | Ga0501081_0002931 | 3300049743 | Bacteria | 10823 |
| 1332 | Ga0501081_0005008 | 3300049743 | Bacteria | 8526 |
| 1333 | Ga0501081_0009379 | 3300049743 | Bacteria | 6376 |
| 1334 | Ga0501081_0013240 | 3300049743 | Bacteria | 5425 |
| 1335 | Ga0501081_0026018 | 3300049743 | Bacteria | 3942 |
| 1336 | Ga0501081_0038170 | 3300049743 | Bacteria | 3280 |
| 1337 | Ga0501081_0060570 | 3300049743 | Bacteria | 2623 |
| 1338 | Ga0501081_0078747 | 3300049743 | Bacteria | 2304 |
| 1339 | Ga0501081_0129766 | 3300049743 | Bacteria | 1800 |
| 1340 | Ga0501081_0154530 | 3300049743 | Bacteria | 1650 |
| 1341 | Ga0501081_0269858 | 3300049743 | Bacteria | 1244 |
| 1342 | Ga0501081_0456872 | 3300049743 | Bacteria | 949 |
| 1343 | Ga0501083_0023161 | 3300049744 | Bacteria | 4309 |
| 1344 | Ga0501083_0071249 | 3300049744 | Bacteria | 2311 |
| 1345 | Ga0501035_0018384 | 3300049822 | Bacteria | 6440 |
| 1346 | Ga0501035_0067862 | 3300049822 | Bacteria | 3163 |
| 1347 | Ga0501035_0159062 | 3300049822 | Bacteria | 1956 |
| 1348 | Ga0501035_0165729 | 3300049822 | Bacteria | 1911 |
| 1349 | Ga0501044_0007157 | 3300049823 | Bacteria | 12273 |
| 1350 | Ga0501044_0118648 | 3300049823 | Bacteria | 2648 |
| 1351 | Ga0501045_0001177 | 3300049824 | Bacteria | 17367 |
| 1352 | Ga0501045_0003250 | 3300049824 | Bacteria | 11098 |
| 1353 | Ga0501045_0041224 | 3300049824 | Bacteria | 3360 |
| 1354 | Ga0501045_0078303 | 3300049824 | Bacteria | 2437 |
| 1355 | Ga0501045_0078916 | 3300049824 | Bacteria | 2427 |
| 1356 | Ga0501045_0082145 | 3300049824 | Bacteria | 2376 |
| 1357 | Ga0501045_0120718 | 3300049824 | Bacteria | 1946 |
| 1358 | Ga0501045_0123408 | 3300049824 | Bacteria | 1923 |
| 1359 | nmdc:mga03683_1672_c1 | 3300050489 | Bacteria | 6677 |
| 1360 | nmdc:mga03683_58571_c1 | 3300050489 | Bacteria | 1623 |
| 1361 | nmdc:mga0yw44_25904_c1 | 3300050492 | Bacteria | 3343 |
| 1362 | nmdc:mga0k408_91632_c1 | 3300050493 | Bacteria | 1786 |
| 1363 | nmdc:mga06z11_171635_c1 | 3300050494 | Bacteria | 1246 |
| 1364 | nmdc:mga07m45_21154_c1 | 3300050496 | Bacteria | 3539 |
| 1365 | nmdc:mga05p37_12411_c1 | 3300050507 | Bacteria | 10174 |
| 1366 | nmdc:mga05p37_14151_c1 | 3300050507 | Bacteria | 9575 |
| 1367 | nmdc:mga05p37_15548_c1 | 3300050507 | Bacteria | 9147 |
| 1368 | nmdc:mga05p37_175126_c1 | 3300050507 | Bacteria | 2614 |
| 1369 | nmdc:mga05p37_241719_c1 | 3300050507 | Bacteria | 2170 |
| 1370 | nmdc:mga05p37_353904_c1 | 3300050507 | Bacteria | 1728 |
| 1371 | nmdc:mga05p37_374430_c1 | 3300050507 | Bacteria | 1670 |
| 1372 | nmdc:mga05p37_38570_c1 | 3300050507 | Bacteria | 5861 |
| 1373 | nmdc:mga05p37_50332_c1 | 3300050507 | Bacteria | 5123 |
| 1374 | nmdc:mga05p37_53612_c1 | 3300050507 | Bacteria | 4960 |
| 1375 | nmdc:mga05p37_62345_c1 | 3300050507 | Bacteria | 4589 |
| 1376 | nmdc:mga05p37_627_c1 | 3300050507 | Bacteria | 39076 |
| 1377 | nmdc:mga05p37_66785_c1 | 3300050507 | Bacteria | 4424 |
| 1378 | nmdc:mga05p37_75279_c1 | 3300050507 | Bacteria | 4155 |
| 1379 | nmdc:mga05p37_94602_c1 | 3300050507 | Unclassified | 3681 |
| 1380 | nmdc:mga05p37_99443_c1 | 3300050507 | Bacteria | 3583 |
| 1381 | nmdc:mga09592_11897_c1 | 3300050508 | Bacteria | 7079 |
| 1382 | nmdc:mga09592_134798_c1 | 3300050508 | Bacteria | 2127 |
| 1383 | nmdc:mga09592_176518_c1 | 3300050508 | Bacteria | 1848 |
| 1384 | nmdc:mga09592_184865_c1 | 3300050508 | Unclassified | 1803 |
| 1385 | nmdc:mga09592_20769_c1 | 3300050508 | Bacteria | 5405 |
| 1386 | nmdc:mga09592_279637_c1 | 3300050508 | Bacteria | 1448 |
| 1387 | nmdc:mga09592_407385_c1 | 3300050508 | Bacteria | 1175 |
| 1388 | nmdc:mga09592_408506_c1 | 3300050508 | Bacteria | 1173 |
| 1389 | nmdc:mga09592_50607_c1 | 3300050508 | Bacteria | 3504 |
| 1390 | nmdc:mga09592_618701_c1 | 3300050508 | Bacteria | 927 |
| 1391 | nmdc:mga09592_65955_c1 | 3300050508 | Bacteria | 3067 |
| 1392 | nmdc:mga0qj67_112928_c1 | 3300050509 | Bacteria | 2194 |
| 1393 | nmdc:mga0qj67_11455_c1 | 3300050509 | Bacteria | 6645 |
| 1394 | nmdc:mga0qj67_19615_c1 | 3300050509 | Bacteria | 5168 |
| 1395 | nmdc:mga0qj67_379815_c1 | 3300050509 | Bacteria | 1141 |
| 1396 | nmdc:mga0qj67_51140_c1 | 3300050509 | Bacteria | 3267 |
| 1397 | nmdc:mga0qj67_60678_c1 | 3300050509 | Bacteria | 3001 |
| 1398 | nmdc:mga0qj67_737_c1 | 3300050509 | Bacteria | 22272 |
| 1399 | nmdc:mga0qj67_771_c1 | 3300050509 | Bacteria | 21805 |
| 1400 | nmdc:mga0qj67_87339_c1 | 3300050509 | Bacteria | 2503 |
| 1401 | nmdc:mga06r32_1149_c1 | 3300050510 | Bacteria | 23807 |
| 1402 | nmdc:mga06r32_132780_c1 | 3300050510 | Bacteria | 2463 |
| 1403 | nmdc:mga06r32_13803_c1 | 3300050510 | Bacteria | 7328 |
| 1404 | nmdc:mga06r32_211578_c1 | 3300050510 | Bacteria | 1927 |
| 1405 | nmdc:mga06r32_212603_c1 | 3300050510 | Bacteria | 1922 |
| 1406 | nmdc:mga06r32_235728_c1 | 3300050510 | Bacteria | 1817 |
| 1407 | nmdc:mga06r32_2878_c1 | 3300050510 | Bacteria | 15445 |
| 1408 | nmdc:mga06r32_379548_c1 | 3300050510 | Bacteria | 1396 |
| 1409 | nmdc:mga06r32_44035_c1 | 3300050510 | Bacteria | 4249 |
| 1410 | nmdc:mga06r32_76406_c1 | 3300050510 | Bacteria | 3252 |
| 1411 | nmdc:mga06r32_78818_c1 | 3300050510 | Bacteria | 3203 |
| 1412 | nmdc:mga08y16_19421_c1 | 3300050511 | Bacteria | 7165 |
| 1413 | nmdc:mga08y16_1_c1 | 3300050511 | Bacteria | 1034622 |
| 1414 | nmdc:mga08y16_2040_c1 | 3300050511 | Bacteria | 20703 |
| 1415 | nmdc:mga08y16_20667_c1 | 3300050511 | Bacteria | 6948 |
| 1416 | nmdc:mga08y16_338265_c1 | 3300050511 | Bacteria | 1547 |
| 1417 | nmdc:mga08y16_38688_c1 | 3300050511 | Bacteria | 5007 |
| 1418 | nmdc:mga08y16_499791_c1 | 3300050511 | Bacteria | 1236 |
| 1419 | nmdc:mga08y16_57849_c2 | 3300050511 | Unclassified | 2587 |
| 1420 | nmdc:mga08y16_74958_c1 | 3300050511 | Bacteria | 3527 |
| 1421 | nmdc:mga0n895_14201_c1 | 3300050512 | Bacteria | 7223 |
| 1422 | nmdc:mga0n895_144738_c1 | 3300050512 | Bacteria | 2406 |
| 1423 | nmdc:mga0n895_14800_c1 | 3300050512 | Bacteria | 7098 |
| 1424 | nmdc:mga0n895_160454_c1 | 3300050512 | Bacteria | 2280 |
| 1425 | nmdc:mga0n895_18707_c1 | 3300050512 | Bacteria | 6418 |
| 1426 | nmdc:mga0n895_191716_c1 | 3300050512 | Bacteria | 2075 |
| 1427 | nmdc:mga0n895_20812_c1 | 3300050512 | Bacteria | 6126 |
| 1428 | nmdc:mga0n895_28969_c1 | 3300050512 | Bacteria | 5275 |
| 1429 | nmdc:mga0n895_429560_c1 | 3300050512 | Bacteria | 1335 |
| 1430 | nmdc:mga0n895_46394_c1 | 3300050512 | Bacteria | 4245 |
| 1431 | nmdc:mga0n895_58009_c1 | 3300050512 | Bacteria | 3817 |
| 1432 | nmdc:mga0n895_59351_c1 | 3300050512 | Bacteria | 3774 |
| 1433 | nmdc:mga0n895_647719_c1 | 3300050512 | Bacteria | 1056 |
| 1434 | nmdc:mga0n895_81789_c1 | 3300050512 | Bacteria | 3219 |
| 1435 | nmdc:mga0n895_9124_c1 | 3300050512 | Bacteria | 8657 |
| 1436 | nmdc:mga0rr50_106603_c1 | 3300050513 | Bacteria | 2211 |
| 1437 | nmdc:mga0rr50_146101_c1 | 3300050513 | Bacteria | 1907 |
| 1438 | nmdc:mga0rr50_149029_c1 | 3300050513 | Bacteria | 1889 |
| 1439 | nmdc:mga0rr50_164753_c1 | 3300050513 | Bacteria | 1802 |
| 1440 | nmdc:mga0rr50_167347_c1 | 3300050513 | Bacteria | 1788 |
| 1441 | nmdc:mga0rr50_220573_c1 | 3300050513 | Bacteria | 1566 |
| 1442 | nmdc:mga0rr50_36415_c1 | 3300050513 | Bacteria | 3544 |
| 1443 | nmdc:mga08x19_127633_c1 | 3300050514 | Bacteria | 1709 |
| 1444 | nmdc:mga08x19_1493_c1 | 3300050514 | Bacteria | 14477 |
| 1445 | nmdc:mga08x19_181647_c1 | 3300050514 | Bacteria | 1436 |
| 1446 | nmdc:mga08x19_349013_c1 | 3300050514 | Bacteria | 1033 |
| 1447 | nmdc:mga08x19_34912_c1 | 3300050514 | Bacteria | 3181 |
| 1448 | nmdc:mga08x19_39695_c1 | 3300050514 | Bacteria | 2993 |
| 1449 | nmdc:mga0a205_12082_c1 | 3300050515 | Bacteria | 7978 |
| 1450 | nmdc:mga0a205_123200_c1 | 3300050515 | Bacteria | 2492 |
| 1451 | nmdc:mga0a205_21728_c1 | 3300050515 | Bacteria | 6068 |
| 1452 | nmdc:mga0a205_246361_c1 | 3300050515 | Bacteria | 1667 |
| 1453 | nmdc:mga0a205_333772_c1 | 3300050515 | Bacteria | 1386 |
| 1454 | nmdc:mga0a205_349618_c1 | 3300050515 | Bacteria | 1346 |
| 1455 | nmdc:mga0a205_452501_c1 | 3300050515 | Bacteria | 1144 |
| 1456 | nmdc:mga0a205_46959_c1 | 3300050515 | Unclassified | 4165 |
| 1457 | nmdc:mga0a205_50570_c1 | 3300050515 | Bacteria | 4012 |
| 1458 | nmdc:mga0a205_525647_c1 | 3300050515 | Bacteria | 1039 |
| 1459 | nmdc:mga0a205_5345_c1 | 3300050515 | Bacteria | 11575 |
| 1460 | nmdc:mga0a205_616575_c1 | 3300050515 | Bacteria | 937 |
| 1461 | nmdc:mga0a205_897_c1 | 3300050515 | Bacteria | 24481 |
| 1462 | nmdc:mga0a205_95351_c1 | 3300050515 | Bacteria | 2874 |
| 1463 | nmdc:mga0sz30_16033_c1 | 3300050516 | Bacteria | 2968 |
| 1464 | Ga0495601_0036178 | 3300053077 | Bacteria | 3082 |
| 1465 | Ga0495601_0051457 | 3300053077 | Bacteria | 2599 |
| 1466 | Ga0495612_0002393 | 3300053078 | Bacteria | 7735 |
| 1467 | Ga0495619_0039627 | 3300053085 | Bacteria | 3076 |
| 1468 | Ga0495619_0144377 | 3300053085 | Bacteria | 1640 |
| 1469 | Ga0495619_0219744 | 3300053085 | Bacteria | 1316 |
| 1470 | Ga0500578_0000028 | 3300053086 | Bacteria | 144081 |
| 1471 | Ga0500644_0006411 | 3300053088 | Bacteria | 3014 |
| 1472 | Ga0500644_0076356 | 3300053088 | Bacteria | 1221 |
| 1473 | Ga0500641_0014986 | 3300053096 | Bacteria | 2869 |
| 1474 | Ga0500650_0135466 | 3300053098 | Bacteria | 1143 |
| 1475 | Ga0500658_0006100 | 3300053134 | Bacteria | 4483 |
| 1476 | Ga0500559_0000864 | 3300053136 | Bacteria | 19467 |
| 1477 | Ga0500568_0035313 | 3300053139 | Bacteria | 2040 |
| 1478 | Ga0500604_0010329 | 3300053151 | Bacteria | 2496 |
| 1479 | Ga0500619_020654 | 3300053154 | Bacteria | 1886 |
| 1480 | Ga0500620_092511 | 3300053155 | Bacteria | 1055 |
| 1481 | Ga0500622_0017751 | 3300053156 | Bacteria | 3785 |
| 1482 | Ga0501084_0000224 | 3300054114 | Bacteria | 42957 |
| 1483 | Ga0501084_0001053 | 3300054114 | Bacteria | 21449 |
| 1484 | Ga0501084_0051966 | 3300054114 | Bacteria | 3429 |
| 1485 | Ga0501084_0056339 | 3300054114 | Bacteria | 3289 |
| 1486 | Ga0501084_0082746 | 3300054114 | Bacteria | 2694 |
| 1487 | Ga0501084_0098446 | 3300054114 | Bacteria | 2456 |
| 1488 | Ga0501084_0142189 | 3300054114 | Bacteria | 2021 |
| 1489 | Ga0501084_0178502 | 3300054114 | Bacteria | 1793 |
| 1490 | Ga0501084_0313761 | 3300054114 | Bacteria | 1324 |
| 1491 | Ga0501082_0000354 | 3300060353 | Bacteria | 40464 |
| 1492 | Ga0501082_0002209 | 3300060353 | Bacteria | 17017 |
| 1493 | Ga0501082_0003064 | 3300060353 | Bacteria | 14587 |
| 1494 | Ga0501082_0028497 | 3300060353 | Bacteria | 4811 |
| 1495 | Ga0501082_0033174 | 3300060353 | Bacteria | 4453 |
| 1496 | Ga0501082_0066666 | 3300060353 | Bacteria | 3100 |
| 1497 | Ga0501082_0076523 | 3300060353 | Bacteria | 2885 |
| 1498 | Ga0501082_0129443 | 3300060353 | Bacteria | 2190 |
| 1499 | Ga0501082_0195142 | 3300060353 | Bacteria | 1761 |
| 1500 | Ga0530510_0000710 | 3300061734 | Bacteria | 21611 |
| 1501 | Ga0530510_0002646 | 3300061734 | Bacteria | 12307 |
| 1502 | Ga0530510_0005735 | 3300061734 | Bacteria | 8603 |
| 1503 | Ga0530510_0048449 | 3300061734 | Bacteria | 3071 |
| 1504 | Ga0530510_0203698 | 3300061734 | Bacteria | 1470 |
| 1505 | 2587728612 | 2585428057 | Bacteria | 6737412 |
| 1506 | 2587732428 | 2585428058 | Bacteria | 6853932 |
| 1507 | 2587757769 | 2585428062 | Bacteria | 6842168 |
| 1508 | 2588291972 | 2588253510 | Bacteria | 6901809 |
| 1509 | 2643971378 | 2643221592 | Bacteria | 6608788 |
| 1510 | 2644140913 | 2643221625 | Bacteria | 6512927 |
| 1511 | 2644276705 | 2643221648 | Bacteria | 6521465 |
| 1512 | nmdc:mga08x19_34133_c1 | |||
| 1513 | JGI25152J39213_1000939 | |||
| 1514 | JGI25406J46586_10001733 | |||
| 1515 | JGI25153J46596_10001552 | |||
| 1516 | JGI25153J46596_10003443 | |||
| 1517 | rootH2_10084913 | |||
| 1518 | rootH1_10073293 | |||
| 1519 | JGI26141J51220_1000238 | |||
| 1520 | Ga0055526_1002279 | |||
| 1521 | Ga0058863_11399723 | |||
| 1522 | Ga0065165_1001161 | |||
| 1523 | Ga0065715_10293307 | |||
| 1524 | Ga0065707_10082160 | |||
| 1525 | Ga0065707_10090228 | |||
| 1526 | Ga0065707_10097617 | |||
| 1527 | Ga0065707_10119844 | |||
| 1528 | Ga0070658_10013839 | |||
| 1529 | Ga0070658_10089989 | |||
| 1530 | Ga0070676_10000180 | |||
| 1531 | Ga0070676_10044286 | |||
| 1532 | Ga0070676_10154421 | |||
| 1533 | Ga0070676_10244069 | |||
| 1534 | Ga0070683_100035870 | |||
| 1535 | Ga0070683_100044269 | |||
| 1536 | Ga0070683_100433481 | |||
| 1537 | Ga0070690_100002966 | |||
| 1538 | Ga0070690_100084329 | |||
| 1539 | Ga0070690_100112277 | |||
| 1540 | Ga0070690_100151416 | |||
| 1541 | Ga0070690_100166718 | |||
| 1542 | Ga0070670_100006716 | |||
| 1543 | Ga0070670_100030466 | |||
| 1544 | Ga0070677_10000480 | |||
| 1545 | Ga0070677_10002340 | |||
| 1546 | Ga0068869_100000690 | |||
| 1547 | Ga0068869_100008882 | |||
| 1548 | Ga0068869_100043111 | |||
| 1549 | Ga0068869_100174215 | |||
| 1550 | Ga0068869_100342139 | |||
| 1551 | Ga0070666_10008877 | |||
| 1552 | Ga0070680_100017550 | |||
| 1553 | Ga0070680_100024240 | |||
| 1554 | Ga0070680_100034153 | |||
| 1555 | Ga0070680_100045760 | |||
| 1556 | Ga0070680_100076002 | |||
| 1557 | Ga0070680_100116938 | |||
| 1558 | Ga0070680_100352912 | |||
| 1559 | Ga0070680_100402838 | |||
| 1560 | Ga0070682_100000622 | |||
| 1561 | Ga0070682_100115528 | |||
| 1562 | Ga0070682_100187034 | |||
| 1563 | Ga0068868_100015578 | |||
| 1564 | Ga0068868_100018830 | |||
| 1565 | Ga0068868_100051604 | |||
| 1566 | Ga0068868_100207196 | |||
| 1567 | Ga0070660_100002171 | |||
| 1568 | Ga0070689_100008079 | |||
| 1569 | Ga0070689_100136889 | |||
| 1570 | Ga0070689_100246919 | |||
| 1571 | Ga0070689_100257639 | |||
| 1572 | Ga0070689_100358301 | |||
| 1573 | Ga0070691_10005153 | |||
| 1574 | Ga0070691_10054987 | |||
| 1575 | Ga0070687_100018481 | |||
| 1576 | Ga0070687_100033727 | |||
| 1577 | Ga0070687_100088303 | |||
| 1578 | Ga0070687_100371871 | |||
| 1579 | Ga0070661_100000211 | |||
| 1580 | Ga0070692_10000947 | |||
| 1581 | Ga0070692_10013082 | |||
| 1582 | Ga0070692_10019539 | |||
| 1583 | Ga0070668_100011684 | |||
| 1584 | Ga0070668_100221811 | |||
| 1585 | Ga0070668_100249268 | |||
| 1586 | Ga0070668_100293832 | |||
| 1587 | Ga0070669_100003321 | |||
| 1588 | Ga0070669_100005282 | |||
| 1589 | Ga0070669_100018574 | |||
| 1590 | Ga0070669_100092920 | |||
| 1591 | Ga0070669_100150638 | |||
| 1592 | Ga0070669_100187096 | |||
| 1593 | Ga0070669_100241301 | |||
| 1594 | Ga0070675_100000264 | |||
| 1595 | Ga0070675_100011030 | |||
| 1596 | Ga0070675_100043352 | |||
| 1597 | Ga0070675_100049356 | |||
| 1598 | Ga0070675_100071363 | |||
| 1599 | Ga0070675_100137477 | |||
| 1600 | Ga0070671_100005985 | |||
| 1601 | Ga0070671_100202226 | |||
| 1602 | Ga0070671_100334959 | |||
| 1603 | Ga0070674_100016275 | |||
| 1604 | Ga0070674_100017024 | |||
| 1605 | Ga0070674_100070264 | |||
| 1606 | Ga0070673_100001370 | |||
| 1607 | Ga0070673_100001462 | |||
| 1608 | Ga0070673_100048928 | |||
| 1609 | Ga0070673_100205809 | |||
| 1610 | Ga0070673_100356931 | |||
| 1611 | Ga0070659_100000204 | |||
| 1612 | Ga0070659_100230076 | |||
| 1613 | Ga0070659_100407722 | |||
| 1614 | Ga0070667_100712302 | |||
| 1615 | Ga0070703_10043743 | |||
| 1616 | Ga0070703_10055704 | |||
| 1617 | Ga0070703_10061922 | |||
| 1618 | Ga0070709_10009910 | |||
| 1619 | Ga0070709_10274103 | |||
| 1620 | Ga0070709_10378568 | |||
| 1621 | Ga0070714_100058375 | |||
| 1622 | Ga0070714_100257428 | |||
| 1623 | Ga0070713_100114080 | |||
| 1624 | Ga0070713_100197773 | |||
| 1625 | Ga0070713_100222856 | |||
| 1626 | Ga0070713_100224955 | |||
| 1627 | Ga0070713_100351136 | |||
| 1628 | Ga0070713_100558597 | |||
| 1629 | Ga0070710_10003930 | |||
| 1630 | Ga0070710_10044950 | |||
| 1631 | Ga0070710_10130912 | |||
| 1632 | Ga0070711_100022847 | |||
| 1633 | Ga0070711_100084682 | |||
| 1634 | Ga0070711_100085919 | |||
| 1635 | Ga0070711_100397929 | |||
| 1636 | Ga0070705_100001378 | |||
| 1637 | Ga0070705_100010637 | |||
| 1638 | Ga0070705_100016819 | |||
| 1639 | Ga0070705_100065129 | |||
| 1640 | Ga0070705_100065685 | |||
| 1641 | Ga0070705_100111033 | |||
| 1642 | Ga0070705_100124781 | |||
| 1643 | Ga0070705_100147131 | |||
| 1644 | Ga0070700_100000457 | |||
| 1645 | Ga0070700_100051555 | |||
| 1646 | Ga0070700_100061077 | |||
| 1647 | Ga0070700_100315083 | |||
| 1648 | Ga0070700_100339503 | |||
| 1649 | Ga0070700_100485839 | |||
| 1650 | Ga0070694_100001824 | |||
| 1651 | Ga0070694_100022369 | |||
| 1652 | Ga0070694_100078589 | |||
| 1653 | Ga0070694_100082460 | |||
| 1654 | Ga0070694_100460556 | |||
| 1655 | Ga0070694_100472064 | |||
| 1656 | Ga0070708_100003247 | |||
| 1657 | Ga0070708_100003792 | |||
| 1658 | Ga0070708_100011346 | |||
| 1659 | Ga0070708_100018954 | |||
| 1660 | Ga0070708_100032371 | |||
| 1661 | Ga0070708_100037361 | |||
| 1662 | Ga0070708_100048798 | |||
| 1663 | Ga0070708_100066557 | |||
| 1664 | Ga0070708_100079649 | |||
| 1665 | Ga0070708_100089268 | |||
| 1666 | Ga0070708_100148809 | |||
| 1667 | Ga0070708_100151811 | |||
| 1668 | Ga0070708_100435779 | |||
| 1669 | Ga0070708_100587542 | |||
| 1670 | Ga0070663_100000167 | |||
| 1671 | Ga0070678_100080846 | |||
| 1672 | Ga0070678_100423761 | |||
| 1673 | Ga0070662_100001464 | |||
| 1674 | Ga0070662_100017049 | |||
| 1675 | Ga0070662_100197858 | |||
| 1676 | Ga0070662_100428938 | |||
| 1677 | Ga0070662_100446237 | |||
| 1678 | Ga0070681_10000852 | |||
| 1679 | Ga0070681_10000898 | |||
| 1680 | Ga0070681_10017554 | |||
| 1681 | Ga0070681_10051632 | |||
| 1682 | Ga0070681_10131120 | |||
| 1683 | Ga0070681_10165696 | |||
| 1684 | Ga0070681_10171698 | |||
| 1685 | Ga0068867_100000347 | |||
| 1686 | Ga0068867_100000382 | |||
| 1687 | Ga0068867_100002024 | |||
| 1688 | Ga0068867_100003059 | |||
| 1689 | Ga0068867_100007232 | |||
| 1690 | Ga0068867_100113394 | |||
| 1691 | Ga0068867_100138568 | |||
| 1692 | Ga0070685_10174139 | |||
| 1693 | Ga0070706_100001137 | |||
| 1694 | Ga0070706_100027332 | |||
| 1695 | Ga0070706_100084951 | |||
| 1696 | Ga0070706_100106706 | |||
| 1697 | Ga0070706_100202883 | |||
| 1698 | Ga0070706_100267098 | |||
| 1699 | Ga0070706_100279348 | |||
| 1700 | Ga0070706_100287849 | |||
| 1701 | Ga0070706_100325790 | |||
| 1702 | Ga0070707_100011824 | |||
| 1703 | Ga0070707_100065984 | |||
| 1704 | Ga0070707_100138676 | |||
| 1705 | Ga0070707_100259735 | |||
| 1706 | Ga0070707_100364113 | |||
| 1707 | Ga0070707_100541240 | |||
| 1708 | Ga0070698_100000110 | |||
| 1709 | Ga0070698_100019877 | |||
| 1710 | Ga0070698_100027252 | |||
| 1711 | Ga0070698_100034483 | |||
| 1712 | Ga0070698_100078815 | |||
| 1713 | Ga0070698_100160715 | |||
| 1714 | Ga0070698_100264545 | |||
| 1715 | Ga0070698_100312851 | |||
| 1716 | Ga0070698_100387468 | |||
| 1717 | Ga0070699_100005810 | |||
| 1718 | Ga0070699_100008560 | |||
| 1719 | Ga0070699_100020042 | |||
| 1720 | Ga0070699_100027987 | |||
| 1721 | Ga0070699_100032281 | |||
| 1722 | Ga0070699_100063068 | |||
| 1723 | Ga0070699_100063336 | |||
| 1724 | Ga0070699_100066277 | |||
| 1725 | Ga0070699_100067475 | |||
| 1726 | Ga0070699_100096606 | |||
| 1727 | Ga0070699_100190308 | |||
| 1728 | Ga0070699_100211156 | |||
| 1729 | Ga0070699_100611799 | |||
| 1730 | Ga0070679_100002929 | |||
| 1731 | Ga0070679_100025321 | |||
| 1732 | Ga0070679_100054381 | |||
| 1733 | Ga0070679_100209658 | |||
| 1734 | Ga0070679_100373855 | |||
| 1735 | Ga0070684_100004515 | |||
| 1736 | Ga0070684_100013751 | |||
| 1737 | Ga0070684_100161967 | |||
| 1738 | Ga0070684_100195039 | |||
| 1739 | Ga0070684_100330729 | |||
| 1740 | Ga0070697_100003309 | |||
| 1741 | Ga0070697_100004392 | |||
| 1742 | Ga0070697_100012817 | |||
| 1743 | Ga0070697_100018719 | |||
| 1744 | Ga0070697_100040479 | |||
| 1745 | Ga0070697_100066526 | |||
| 1746 | Ga0070697_100099968 | |||
| 1747 | Ga0070697_100414712 | |||
| 1748 | Ga0070697_100501839 | |||
| 1749 | Ga0068853_100035390 | |||
| 1750 | Ga0068853_100043288 | |||
| 1751 | Ga0068853_100139823 | |||
| 1752 | Ga0068853_100159097 | |||
| 1753 | Ga0070672_100001028 | |||
| 1754 | Ga0070672_100003113 | |||
| 1755 | Ga0070672_100007023 | |||
| 1756 | Ga0070672_100062063 | |||
| 1757 | Ga0070672_100072867 | |||
| 1758 | Ga0070672_100194672 | |||
| 1759 | Ga0070686_100000394 | |||
| 1760 | Ga0070686_100073790 | |||
| 1761 | Ga0070686_100464332 | |||
| 1762 | Ga0070695_100000724 | |||
| 1763 | Ga0070695_100009703 | |||
| 1764 | Ga0070695_100021490 | |||
| 1765 | Ga0070695_100045572 | |||
| 1766 | Ga0070695_100076356 | |||
| 1767 | Ga0070695_100082344 | |||
| 1768 | Ga0070695_100119075 | |||
| 1769 | Ga0070695_100164901 | |||
| 1770 | Ga0070696_100002440 | |||
| 1771 | Ga0070696_100024923 | |||
| 1772 | Ga0070696_100059206 | |||
| 1773 | Ga0070696_100085964 | |||
| 1774 | Ga0070696_100112452 | |||
| 1775 | Ga0070696_100272708 | |||
| 1776 | Ga0070696_100299714 | |||
| 1777 | Ga0070696_100305090 | |||
| 1778 | Ga0070696_100366072 | |||
| 1779 | Ga0070693_100000530 | |||
| 1780 | Ga0070693_100028206 | |||
| 1781 | Ga0070665_100053465 | |||
| 1782 | Ga0070665_100289904 | |||
| 1783 | Ga0070665_100537584 | |||
| 1784 | Ga0070704_100030815 | |||
| 1785 | Ga0070704_100044729 | |||
| 1786 | Ga0070704_100046332 | |||
| 1787 | Ga0070704_100053519 | |||
| 1788 | Ga0070704_100312001 | |||
| 1789 | Ga0068855_100000221 | |||
| 1790 | Ga0068855_100000319 | |||
| 1791 | Ga0068855_100001074 | |||
| 1792 | Ga0068855_100030553 | |||
| 1793 | Ga0070664_100028129 | |||
| 1794 | Ga0070664_100107053 | |||
| 1795 | Ga0070664_100169494 | |||
| 1796 | Ga0070664_100265485 | |||
| 1797 | Ga0070664_100310117 | |||
| 1798 | Ga0068857_100003125 | |||
| 1799 | Ga0068857_100011491 | |||
| 1800 | Ga0068857_100039971 | |||
| 1801 | Ga0068857_100209496 | |||
| 1802 | Ga0068857_100665956 | |||
| 1803 | Ga0068854_100002450 | |||
| 1804 | Ga0068854_100017860 | |||
| 1805 | Ga0068854_100027688 | |||
| 1806 | Ga0068854_100029699 | |||
| 1807 | Ga0068856_100000395 | |||
| 1808 | Ga0068856_100000702 | |||
| 1809 | Ga0068856_100006539 | |||
| 1810 | Ga0068856_100071442 | |||
| 1811 | Ga0068856_100110613 | |||
| 1812 | Ga0068856_100172230 | |||
| 1813 | Ga0070702_100005045 | |||
| 1814 | Ga0070702_100074608 | |||
| 1815 | Ga0070702_100083189 | |||
| 1816 | Ga0070702_100351757 | |||
| 1817 | Ga0070702_100426519 | |||
| 1818 | Ga0068852_100013672 | |||
| 1819 | Ga0068852_100057047 | |||
| 1820 | Ga0068852_100363435 | |||
| 1821 | Ga0068859_100005562 | |||
| 1822 | Ga0068859_100052175 | |||
| 1823 | Ga0068859_100315399 | |||
| 1824 | Ga0068859_100368890 | |||
| 1825 | Ga0068859_100524675 | |||
| 1826 | Ga0068864_100009783 | |||
| 1827 | Ga0068864_100019686 | |||
| 1828 | Ga0068864_100088825 | |||
| 1829 | Ga0068864_100536979 | |||
| 1830 | Ga0068866_10047771 | |||
| 1831 | Ga0068866_10115925 | |||
| 1832 | Ga0068861_100000215 | |||
| 1833 | Ga0068861_100020438 | |||
| 1834 | Ga0068861_100065067 | |||
| 1835 | Ga0068861_100114297 | |||
| 1836 | Ga0068861_100127163 | |||
| 1837 | Ga0068861_100197654 | |||
| 1838 | Ga0068861_100414240 | |||
| 1839 | Ga0068870_10005277 | |||
| 1840 | Ga0068870_10075049 | |||
| 1841 | Ga0068870_10307629 | |||
| 1842 | Ga0068863_100011479 | |||
| 1843 | Ga0068863_100620379 | |||
| 1844 | Ga0068858_100012272 | |||
| 1845 | Ga0068858_100014856 | |||
| 1846 | Ga0068858_100062959 | |||
| 1847 | Ga0068860_100005361 | |||
| 1848 | Ga0068860_100006217 | |||
| 1849 | Ga0068860_100172082 | |||
| 1850 | Ga0068860_100364306 | |||
| 1851 | Ga0068860_100385768 | |||
| 1852 | Ga0068860_100411011 | |||
| 1853 | Ga0068860_100446116 | |||
| 1854 | Ga0068860_100468211 | |||
| 1855 | Ga0068860_100624064 | |||
| 1856 | Ga0068862_100000487 | |||
| 1857 | Ga0068862_100004802 | |||
| 1858 | Ga0068862_100005359 | |||
| 1859 | Ga0068862_100007938 | |||
| 1860 | Ga0068862_100008356 | |||
| 1861 | Ga0068862_100482258 | |||
| 1862 | Ga0081455_10009207 | |||
| 1863 | Ga0081455_10012540 | |||
| 1864 | Ga0081538_10002955 | |||
| 1865 | Ga0081540_1009165 | |||
| 1866 | Ga0081540_1022020 | |||
| 1867 | Ga0081539_10000005 | |||
| 1868 | Ga0081539_10010818 | |||
| 1869 | Ga0070717_10030630 | |||
| 1870 | Ga0070717_10031603 | |||
| 1871 | Ga0070717_10076240 | |||
| 1872 | Ga0070717_10081475 | |||
| 1873 | Ga0070717_10259026 | |||
| 1874 | Ga0070717_10445543 | |||
| 1875 | Ga0075365_10059939 | |||
| 1876 | Ga0075365_10209186 | |||
| 1877 | Ga0075364_10141433 | |||
| 1878 | Ga0070715_10033522 | |||
| 1879 | Ga0070715_10199334 | |||
| 1880 | Ga0070716_100011844 | |||
| 1881 | Ga0070716_100013575 | |||
| 1882 | Ga0070716_100066523 | |||
| 1883 | Ga0070712_100002462 | |||
| 1884 | Ga0070712_100074986 | |||
| 1885 | Ga0070712_100198168 | |||
| 1886 | Ga0070712_100202754 | |||
| 1887 | Ga0075362_10032693 | |||
| 1888 | Ga0075367_10038686 | |||
| 1889 | Ga0075366_10020461 | |||
| 1890 | Ga0097621_100000655 | |||
| 1891 | Ga0097621_100000712 | |||
| 1892 | Ga0097621_100001381 | |||
| 1893 | Ga0097621_100009385 | |||
| 1894 | Ga0097621_100075788 | |||
| 1895 | Ga0097621_100109456 | |||
| 1896 | Ga0075370_10018571 | |||
| 1897 | Ga0068871_100000128 | |||
| 1898 | Ga0068871_100004305 | |||
| 1899 | Ga0068871_100006933 | |||
| 1900 | Ga0068871_100009068 | |||
| 1901 | Ga0068871_100034070 | |||
| 1902 | Ga0068871_100202301 | |||
| 1903 | Ga0075428_100000470 | |||
| 1904 | Ga0075428_100001407 | |||
| 1905 | Ga0075428_100004438 | |||
| 1906 | Ga0075428_100035695 | |||
| 1907 | Ga0075428_100044380 | |||
| 1908 | Ga0075428_100091286 | |||
| 1909 | Ga0075428_100093715 | |||
| 1910 | Ga0075428_100190009 | |||
| 1911 | Ga0075428_100315065 | |||
| 1912 | Ga0075430_100000104 | |||
| 1913 | Ga0075430_100002874 | |||
| 1914 | Ga0075430_100027546 | |||
| 1915 | Ga0075430_100028790 | |||
| 1916 | Ga0075430_100094421 | |||
| 1917 | Ga0075430_100217736 | |||
| 1918 | Ga0075430_100330233 | |||
| 1919 | Ga0075430_100483120 | |||
| 1920 | Ga0075431_100001472 | |||
| 1921 | Ga0075431_100002983 | |||
| 1922 | Ga0075431_100012897 | |||
| 1923 | Ga0075431_100021273 | |||
| 1924 | Ga0075431_100032096 | |||
| 1925 | Ga0075431_100040701 | |||
| 1926 | Ga0075431_100053715 | |||
| 1927 | Ga0075431_100058876 | |||
| 1928 | Ga0075431_100066441 | |||
| 1929 | Ga0075431_100068550 | |||
| 1930 | Ga0075431_100076627 | |||
| 1931 | Ga0075431_100080694 | |||
| 1932 | Ga0075431_100151068 | |||
| 1933 | Ga0075431_100186840 | |||
| 1934 | Ga0075431_100324220 | |||
| 1935 | Ga0075431_100328467 | |||
| 1936 | Ga0075431_100410262 | |||
| 1937 | Ga0075431_100482244 | |||
| 1938 | Ga0075433_10001635 | |||
| 1939 | Ga0075433_10011551 | |||
| 1940 | Ga0075433_10022370 | |||
| 1941 | Ga0075433_10041400 | |||
| 1942 | Ga0075433_10050516 | |||
| 1943 | Ga0075433_10056028 | |||
| 1944 | Ga0075433_10125059 | |||
| 1945 | Ga0075433_10334463 | |||
| 1946 | Ga0075433_10362395 | |||
| 1947 | Ga0075433_10483842 | |||
| 1948 | Ga0075434_100000469 | |||
| 1949 | Ga0075434_100015709 | |||
| 1950 | Ga0075434_100022371 | |||
| 1951 | Ga0075434_100035465 | |||
| 1952 | Ga0075434_100049436 | |||
| 1953 | Ga0075434_100068018 | |||
| 1954 | Ga0075434_100069888 | |||
| 1955 | Ga0075434_100071588 | |||
| 1956 | Ga0075434_100192190 | |||
| 1957 | Ga0075434_100378399 | |||
| 1958 | Ga0075434_100389325 | |||
| 1959 | Ga0075434_100416613 | |||
| 1960 | Ga0075434_100666726 | |||
| 1961 | Ga0075429_100001259 | |||
| 1962 | Ga0075429_100013498 | |||
| 1963 | Ga0075429_100020898 | |||
| 1964 | Ga0075429_100027791 | |||
| 1965 | Ga0075429_100033913 | |||
| 1966 | Ga0075429_100138986 | |||
| 1967 | Ga0075429_100174171 | |||
| 1968 | Ga0075429_100220591 | |||
| 1969 | Ga0075429_100370296 | |||
| 1970 | Ga0075429_100485962 | |||
| 1971 | Ga0075429_100491243 | |||
| 1972 | Ga0068865_100004568 | |||
| 1973 | Ga0068865_100084502 | |||
| 1974 | Ga0068865_100222464 | |||
| 1975 | Ga0075436_100004214 | |||
| 1976 | Ga0075436_100010262 | |||
| 1977 | Ga0075436_100010910 | |||
| 1978 | Ga0075436_100013523 | |||
| 1979 | Ga0075436_100031727 | |||
| 1980 | Ga0075436_100124658 | |||
| 1981 | Ga0075436_100138472 | |||
| 1982 | Ga0097620_100005562 | |||
| 1983 | Ga0097620_100052175 | |||
| 1984 | Ga0097620_100315384 | |||
| 1985 | Ga0097620_100368908 | |||
| 1986 | Ga0097620_100524687 | |||
| 1987 | Ga0075435_100009432 | |||
| 1988 | Ga0075435_100016130 | |||
| 1989 | Ga0075435_100016853 | |||
| 1990 | Ga0075435_100083146 | |||
| 1991 | Ga0075435_100137537 | |||
| 1992 | Ga0075435_100167259 | |||
| 1993 | Ga0075435_100424984 | |||
| 1994 | Ga0075435_100523447 | |||
| 1995 | Ga0075435_100630789 | |||
| 1996 | Ga0099794_10000310 | |||
| 1997 | Ga0099794_10013939 | |||
| 1998 | Ga0105240_10003938 | |||
| 1999 | Ga0105240_10004517 | |||
| 2000 | Ga0105240_10019165 | |||
| 2001 | Ga0105240_10168563 | |||
| 2002 | Ga0105240_10334195 | |||
| 2003 | Ga0111539_10000033 | |||
| 2004 | Ga0111539_10004735 | |||
| 2005 | Ga0111539_10006679 | |||
| 2006 | Ga0111539_10006843 | |||
| 2007 | Ga0111539_10032915 | |||
| 2008 | Ga0111539_10070895 | |||
| 2009 | Ga0111539_10077464 | |||
| 2010 | Ga0105245_10000523 | |||
| 2011 | Ga0105245_10072099 | |||
| 2012 | Ga0105245_10516721 | |||
| 2013 | Ga0105245_10565861 | |||
| 2014 | Ga0105245_10626589 | |||
| 2015 | Ga0114129_10000042 | |||
| 2016 | Ga0114129_10006838 | |||
| 2017 | Ga0114129_10015964 | |||
| 2018 | Ga0114129_10024796 | |||
| 2019 | Ga0114129_10042802 | |||
| 2020 | Ga0114129_10043209 | |||
| 2021 | Ga0114129_10065592 | |||
| 2022 | Ga0114129_10073438 | |||
| 2023 | Ga0114129_10076908 | |||
| 2024 | Ga0114129_10118118 | |||
| 2025 | Ga0114129_10166304 | |||
| 2026 | Ga0114129_10183534 | |||
| 2027 | Ga0114129_10188671 | |||
| 2028 | Ga0114129_10205366 | |||
| 2029 | Ga0114129_10318525 | |||
| 2030 | Ga0114129_10586621 | |||
| 2031 | Ga0114129_10713969 | |||
| 2032 | Ga0114129_11091238 | |||
| 2033 | Ga0114129_11193471 | |||
| 2034 | Ga0105243_10014982 | |||
| 2035 | Ga0105243_10057957 | |||
| 2036 | Ga0105243_10067344 | |||
| 2037 | Ga0105243_10273085 | |||
| 2038 | Ga0105243_10515795 | |||
| 2039 | Ga0105241_10001179 | |||
| 2040 | Ga0105241_10045989 | |||
| 2041 | Ga0105241_10120680 | |||
| 2042 | Ga0105242_10004792 | |||
| 2043 | Ga0105242_10013473 | |||
| 2044 | Ga0105242_10056164 | |||
| 2045 | Ga0105242_10284374 | |||
| 2046 | Ga0105242_10452761 | |||
| 2047 | Ga0105248_10021019 | |||
| 2048 | Ga0105248_10121987 | |||
| 2049 | Ga0105248_10624575 | |||
| 2050 | Ga0105238_10003209 | |||
| 2051 | Ga0105238_10285683 | |||
| 2052 | Ga0105238_10553300 | |||
| 2053 | Ga0105249_10052101 | |||
| 2054 | Ga0105249_10059101 | |||
| 2055 | Ga0105249_10082803 | |||
| 2056 | Ga0105249_10122364 | |||
| 2057 | Ga0105249_10349543 | |||
| 2058 | Ga0099796_10037372 | |||
| 2059 | Ga0099796_10134529 | |||
| 2060 | Ga0105239_10051935 | |||
| 2061 | Ga0105239_10109037 | |||
| 2062 | Ga0105239_10177529 | |||
| 2063 | Ga0105239_10183842 | |||
| 2064 | Ga0105239_10213971 | |||
| 2065 | Ga0105239_10240618 | |||
| 2066 | Ga0105246_10017101 | |||
| 2067 | Ga0105246_10176928 | |||
| 2068 | Ga0157373_10004022 | |||
| 2069 | Ga0157373_10253554 | |||
| 2070 | Ga0157371_10083170 | |||
| 2071 | Ga0157370_10201223 | |||
| 2072 | Ga0157369_10000253 | |||
| 2073 | Ga0157369_10135847 | |||
| 2074 | Ga0157369_10428501 | |||
| 2075 | Ga0157374_10000185 | |||
| 2076 | Ga0157374_10000555 | |||
| 2077 | Ga0157374_10083217 | |||
| 2078 | Ga0157378_10000245 | |||
| 2079 | Ga0157378_10000256 | |||
| 2080 | Ga0157378_10013281 | |||
| 2081 | Ga0157378_10341480 | |||
| 2082 | Ga0157378_10565132 | |||
| 2083 | Ga0163162_10042496 | |||
| 2084 | Ga0163162_10274934 | |||
| 2085 | Ga0163162_10991681 | |||
| 2086 | Ga0157372_10000310 | |||
| 2087 | Ga0157372_10000704 | |||
| 2088 | Ga0157372_10006181 | |||
| 2089 | Ga0157372_10444242 | |||
| 2090 | Ga0157375_10060541 | |||
| 2091 | Ga0157375_10103512 | |||
| 2092 | Ga0157375_10103719 | |||
| 2093 | Ga0157375_10103752 | |||
| 2094 | Ga0157375_10233222 | |||
| 2095 | Ga0157375_10404091 | |||
| 2096 | Ga0157375_10432545 | |||
| 2097 | Ga0157375_10747566 | |||
| 2098 | Ga0163163_10000629 | |||
| 2099 | Ga0163163_10010981 | |||
| 2100 | Ga0163163_10013691 | |||
| 2101 | Ga0163163_10648426 | |||
| 2102 | Ga0157380_10000622 | |||
| 2103 | Ga0157380_10018733 | |||
| 2104 | Ga0157380_10128589 | |||
| 2105 | Ga0182008_10063456 | |||
| 2106 | Ga0157377_10204822 | |||
| 2107 | Ga0157379_10466371 | |||
| 2108 | Ga0157376_10061590 | |||
| 2109 | Ga0157376_10112309 | |||
| 2110 | Ga0157376_10185298 | |||
| 2111 | Ga0163161_10013549 | |||
| 2112 | Ga0163161_10019586 | |||
| 2113 | Ga0213872_10191890 | |||
| 2114 | Ga0213874_10054643 | |||
| 2115 | Ga0213875_10000031 | |||
| 2116 | Ga0213875_10011074 | |||
| 2117 | Ga0213875_10031100 | |||
| 2118 | Ga0213871_10003108 | |||
| 2119 | Ga0213871_10010785 | |||
| 2120 | Ga0207425_1001394 | |||
| 2121 | Ga0209129_1000038 | |||
| 2122 | Ga0209673_1006212 | |||
| 2123 | Ga0209564_1000162 | |||
| 2124 | Ga0209758_1000152 | |||
| 2125 | Ga0209758_1000268 | |||
| 2126 | Ga0209050_1000634 | |||
| 2127 | Ga0209051_1018684 | |||
| 2128 | Ga0207653_10044668 | |||
| 2129 | Ga0207682_10001827 | |||
| 2130 | Ga0207682_10002442 | |||
| 2131 | Ga0207682_10006763 | |||
| 2132 | Ga0207692_10033945 | |||
| 2133 | Ga0207692_10068775 | |||
| 2134 | Ga0207642_10090708 | |||
| 2135 | Ga0207642_10263416 | |||
| 2136 | Ga0207680_10091210 | |||
| 2137 | Ga0207680_10253565 | |||
| 2138 | Ga0207685_10083535 | |||
| 2139 | Ga0207685_10132727 | |||
| 2140 | Ga0207699_10068254 | |||
| 2141 | Ga0207699_10097440 | |||
| 2142 | Ga0207699_10188398 | |||
| 2143 | Ga0207699_10254006 | |||
| 2144 | Ga0207645_10003940 | |||
| 2145 | Ga0207645_10007209 | |||
| 2146 | Ga0207645_10047526 | |||
| 2147 | Ga0207645_10048214 | |||
| 2148 | Ga0207645_10085051 | |||
| 2149 | Ga0207645_10086119 | |||
| 2150 | Ga0207645_10143787 | |||
| 2151 | Ga0207643_10007922 | |||
| 2152 | Ga0207643_10021697 | |||
| 2153 | Ga0207643_10042997 | |||
| 2154 | Ga0207643_10047414 | |||
| 2155 | Ga0207684_10004374 | |||
| 2156 | Ga0207684_10018218 | |||
| 2157 | Ga0207684_10041285 | |||
| 2158 | Ga0207684_10050770 | |||
| 2159 | Ga0207684_10127314 | |||
| 2160 | Ga0207684_10141148 | |||
| 2161 | Ga0207684_10292087 | |||
| 2162 | Ga0207684_10391272 | |||
| 2163 | Ga0207684_10616467 | |||
| 2164 | Ga0207654_10023921 | |||
| 2165 | Ga0207654_10453108 | |||
| 2166 | Ga0207707_10000116 | |||
| 2167 | Ga0207707_10002125 | |||
| 2168 | Ga0207707_10009719 | |||
| 2169 | Ga0207707_10151516 | |||
| 2170 | Ga0207707_10389240 | |||
| 2171 | Ga0207707_10425421 | |||
| 2172 | Ga0207695_10013936 | |||
| 2173 | Ga0207695_10064783 | |||
| 2174 | Ga0207695_10213574 | |||
| 2175 | Ga0207695_10355295 | |||
| 2176 | Ga0207693_10001378 | |||
| 2177 | Ga0207693_10003875 | |||
| 2178 | Ga0207693_10009321 | |||
| 2179 | Ga0207693_10081766 | |||
| 2180 | Ga0207693_10421476 | |||
| 2181 | Ga0207663_10032599 | |||
| 2182 | Ga0207663_10064800 | |||
| 2183 | Ga0207663_10391143 | |||
| 2184 | Ga0207663_10433675 | |||
| 2185 | Ga0207663_10441364 | |||
| 2186 | Ga0207660_10002889 | |||
| 2187 | Ga0207660_10003241 | |||
| 2188 | Ga0207660_10027825 | |||
| 2189 | Ga0207660_10065156 | |||
| 2190 | Ga0207660_10075335 | |||
| 2191 | Ga0207660_10090695 | |||
| 2192 | Ga0207660_10107783 | |||
| 2193 | Ga0207660_10154842 | |||
| 2194 | Ga0207662_10021154 | |||
| 2195 | Ga0207662_10036540 | |||
| 2196 | Ga0207662_10050184 | |||
| 2197 | Ga0207662_10187918 | |||
| 2198 | Ga0207657_10002084 | |||
| 2199 | Ga0207649_10001837 | |||
| 2200 | Ga0207652_10003098 | |||
| 2201 | Ga0207652_10003188 | |||
| 2202 | Ga0207646_10005516 | |||
| 2203 | Ga0207646_10006384 | |||
| 2204 | Ga0207646_10019430 | |||
| 2205 | Ga0207646_10073368 | |||
| 2206 | Ga0207646_10083553 | |||
| 2207 | Ga0207646_10087386 | |||
| 2208 | Ga0207646_10112231 | |||
| 2209 | Ga0207646_10303599 | |||
| 2210 | Ga0207646_10366230 | |||
| 2211 | Ga0207681_10005697 | |||
| 2212 | Ga0207681_10006234 | |||
| 2213 | Ga0207681_10040017 | |||
| 2214 | Ga0207681_10046721 | |||
| 2215 | Ga0207681_10071471 | |||
| 2216 | Ga0207681_10076841 | |||
| 2217 | Ga0207694_10000808 | |||
| 2218 | Ga0207650_10000551 | |||
| 2219 | Ga0207650_10168712 | |||
| 2220 | Ga0207650_10208399 | |||
| 2221 | Ga0207659_10001103 | |||
| 2222 | Ga0207659_10021669 | |||
| 2223 | Ga0207659_10040215 | |||
| 2224 | Ga0207659_10138628 | |||
| 2225 | Ga0207659_10154218 | |||
| 2226 | Ga0207687_10034986 | |||
| 2227 | Ga0207687_10163810 | |||
| 2228 | Ga0207687_10173737 | |||
| 2229 | Ga0207687_10456197 | |||
| 2230 | Ga0207700_10106401 | |||
| 2231 | Ga0207700_10197787 | |||
| 2232 | Ga0207700_10298235 | |||
| 2233 | Ga0207700_10348275 | |||
| 2234 | Ga0207700_10369071 | |||
| 2235 | Ga0207664_10010521 | |||
| 2236 | Ga0207664_10314345 | |||
| 2237 | Ga0207664_10338440 | |||
| 2238 | Ga0207664_10447763 | |||
| 2239 | Ga0207644_10052722 | |||
| 2240 | Ga0207690_10063370 | |||
| 2241 | Ga0207690_10303445 | |||
| 2242 | Ga0207706_10005422 | |||
| 2243 | Ga0207706_10020088 | |||
| 2244 | Ga0207706_10088092 | |||
| 2245 | Ga0207706_10481303 | |||
| 2246 | Ga0207686_10046404 | |||
| 2247 | Ga0207686_10137838 | |||
| 2248 | Ga0207709_10002771 | |||
| 2249 | Ga0207670_10060075 | |||
| 2250 | Ga0207670_10100406 | |||
| 2251 | Ga0207670_10176697 | |||
| 2252 | Ga0207670_10496473 | |||
| 2253 | Ga0207669_10011554 | |||
| 2254 | Ga0207669_10140907 | |||
| 2255 | Ga0207669_10198706 | |||
| 2256 | Ga0207704_10011150 | |||
| 2257 | Ga0207704_10015163 | |||
| 2258 | Ga0207704_10068996 | |||
| 2259 | Ga0207704_10102662 | |||
| 2260 | Ga0207665_10022420 | |||
| 2261 | Ga0207665_10025098 | |||
| 2262 | Ga0207665_10033065 | |||
| 2263 | Ga0207691_10000654 | |||
| 2264 | Ga0207691_10004065 | |||
| 2265 | Ga0207691_10010593 | |||
| 2266 | Ga0207691_10011146 | |||
| 2267 | Ga0207691_10015804 | |||
| 2268 | Ga0207691_10031435 | |||
| 2269 | Ga0207691_10094413 | |||
| 2270 | Ga0207691_10157805 | |||
| 2271 | Ga0207711_10063130 | |||
| 2272 | Ga0207711_10131113 | |||
| 2273 | Ga0207711_10174551 | |||
| 2274 | Ga0207711_10202260 | |||
| 2275 | Ga0207711_10297236 | |||
| 2276 | Ga0207689_10000058 | |||
| 2277 | Ga0207689_10002032 | |||
| 2278 | Ga0207689_10012451 | |||
| 2279 | Ga0207689_10116569 | |||
| 2280 | Ga0207661_10018061 | |||
| 2281 | Ga0207661_10046145 | |||
| 2282 | Ga0207661_10329958 | |||
| 2283 | Ga0207661_10437998 | |||
| 2284 | Ga0207679_10002446 | |||
| 2285 | Ga0207679_10214720 | |||
| 2286 | Ga0207679_10265414 | |||
| 2287 | Ga0207679_10445513 | |||
| 2288 | Ga0207667_10000302 | |||
| 2289 | Ga0207667_10000342 | |||
| 2290 | Ga0207667_10007687 | |||
| 2291 | Ga0207667_10077943 | |||
| 2292 | Ga0207667_10878921 | |||
| 2293 | Ga0207651_10002536 | |||
| 2294 | Ga0207651_10026438 | |||
| 2295 | Ga0207651_10216807 | |||
| 2296 | Ga0207651_10453664 | |||
| 2297 | Ga0207712_10030656 | |||
| 2298 | Ga0207712_10067792 | |||
| 2299 | Ga0207712_10096187 | |||
| 2300 | Ga0207712_10178009 | |||
| 2301 | Ga0207668_10006404 | |||
| 2302 | Ga0207668_10076748 | |||
| 2303 | Ga0207668_10121854 | |||
| 2304 | Ga0207640_10009617 | |||
| 2305 | Ga0207640_10037075 | |||
| 2306 | Ga0207640_10083073 | |||
| 2307 | Ga0207640_10224167 | |||
| 2308 | Ga0207658_10006276 | |||
| 2309 | Ga0207677_10045251 | |||
| 2310 | Ga0207677_10047631 | |||
| 2311 | Ga0207677_10178073 | |||
| 2312 | Ga0207703_10009410 | |||
| 2313 | Ga0207703_10065489 | |||
| 2314 | Ga0207703_10112267 | |||
| 2315 | Ga0207639_10013319 | |||
| 2316 | Ga0207639_10104608 | |||
| 2317 | Ga0207678_10000501 | |||
| 2318 | Ga0207708_10030161 | |||
| 2319 | Ga0207708_10035592 | |||
| 2320 | Ga0207708_10075312 | |||
| 2321 | Ga0207708_10090592 | |||
| 2322 | Ga0207708_10094789 | |||
| 2323 | Ga0207708_10124614 | |||
| 2324 | Ga0207708_10204446 | |||
| 2325 | Ga0207708_10341087 | |||
| 2326 | Ga0207708_10401329 | |||
| 2327 | Ga0207702_10001675 | |||
| 2328 | Ga0207702_10007641 | |||
| 2329 | Ga0207702_10219058 | |||
| 2330 | Ga0207702_10507216 | |||
| 2331 | Ga0207641_10011020 | |||
| 2332 | Ga0207641_10016259 | |||
| 2333 | Ga0207641_10317891 | |||
| 2334 | Ga0207641_10333839 | |||
| 2335 | Ga0207641_10555287 | |||
| 2336 | Ga0207648_10000911 | |||
| 2337 | Ga0207648_10002647 | |||
| 2338 | Ga0207648_10005445 | |||
| 2339 | Ga0207648_10006801 | |||
| 2340 | Ga0207648_10017555 | |||
| 2341 | Ga0207648_10062711 | |||
| 2342 | Ga0207648_10171772 | |||
| 2343 | Ga0207648_10274668 | |||
| 2344 | Ga0207648_10399345 | |||
| 2345 | Ga0207648_10479842 | |||
| 2346 | Ga0207648_10698200 | |||
| 2347 | Ga0207676_10006658 | |||
| 2348 | Ga0207676_10240206 | |||
| 2349 | Ga0207674_10002881 | |||
| 2350 | Ga0207674_10036930 | |||
| 2351 | Ga0207674_10042118 | |||
| 2352 | Ga0207674_10622043 | |||
| 2353 | Ga0207675_100003808 | |||
| 2354 | Ga0207675_100015304 | |||
| 2355 | Ga0207675_100023622 | |||
| 2356 | Ga0207675_100027113 | |||
| 2357 | Ga0207675_100039299 | |||
| 2358 | Ga0207675_100061603 | |||
| 2359 | Ga0207675_100101064 | |||
| 2360 | Ga0207675_100419755 | |||
| 2361 | Ga0207683_10074474 | |||
| 2362 | Ga0207683_10106798 | |||
| 2363 | Ga0207683_10209681 | |||
| 2364 | Ga0207683_10362433 | |||
| 2365 | Ga0207698_10007876 | |||
| 2366 | Ga0207698_10286670 | |||
| 2367 | Ga0207698_10316826 | |||
| 2368 | Ga0209969_1004713 | |||
| 2369 | Ga0210000_1001017 | |||
| 2370 | Ga0210000_1006743 | |||
| 2371 | Ga0209982_1012689 | |||
| 2372 | Ga0209588_1003957 | |||
| 2373 | Ga0209588_1034994 | |||
| 2374 | Ga0209974_10011645 | |||
| 2375 | Ga0207428_10000001 | |||
| 2376 | Ga0207428_10000214 | |||
| 2377 | Ga0207428_10000794 | |||
| 2378 | Ga0207428_10030615 | |||
| 2379 | Ga0207428_10394614 | |||
| 2380 | Ga0268266_10006285 | |||
| 2381 | Ga0268266_10088977 | |||
| 2382 | Ga0268265_10000291 | |||
| 2383 | Ga0268265_10011760 | |||
| 2384 | Ga0268265_10026086 | |||
| 2385 | Ga0268265_10037529 | |||
| 2386 | Ga0268265_10079564 | |||
| 2387 | Ga0268265_10092699 | |||
| 2388 | Ga0268265_10710430 | |||
| 2389 | Ga0268264_10010180 | |||
| 2390 | Ga0268264_10011418 | |||
| 2391 | Ga0268264_10102819 | |||
| 2392 | Ga0268264_10283031 | |||
| 2393 | Ga0268264_10283953 | |||
| 2394 | Ga0268264_10340659 | |||
| 2395 | Ga0268264_10378744 | |||
| 2396 | Ga0265323_10030400 | |||
| 2397 | Ga0265336_10005326 | |||
| 2398 | Ga0307515_10000567 | |||
| 2399 | Ga0307515_10001764 | |||
| 2400 | Ga0307515_10017612 | |||
| 2401 | Ga0307515_10154994 | |||
| 2402 | Ga0265338_10116832 | |||
| 2403 | Ga0265338_10179064 | |||
| 2404 | Ga0265338_10272559 | |||
| 2405 | Ga0307511_10110826 | |||
| 2406 | Ga0307512_10056794 | |||
| 2407 | Ga0307512_10152899 | |||
| 2408 | Ga0307512_10180443 | |||
| 2409 | Ga0265330_10034444 | |||
| 2410 | Ga0265320_10006970 | |||
| 2411 | Ga0265339_10001307 | |||
| 2412 | Ga0265331_10061874 | |||
| 2413 | Ga0307513_10019225 | |||
| 2414 | Ga0307513_10023508 | |||
| 2415 | Ga0307513_10025089 | |||
| 2416 | Ga0307513_10028304 | |||
| 2417 | Ga0307513_10029096 | |||
| 2418 | Ga0307513_10060082 | |||
| 2419 | Ga0307513_10141846 | |||
| 2420 | Ga0307513_10148595 | |||
| 2421 | Ga0307513_10286647 | |||
| 2422 | Ga0307509_10018664 | |||
| 2423 | Ga0307408_100056367 | |||
| 2424 | Ga0307408_100321120 | |||
| 2425 | Ga0307408_100469400 | |||
| 2426 | Ga0307408_100580272 | |||
| 2427 | Ga0307508_10000133 | |||
| 2428 | Ga0307514_10038864 | |||
| 2429 | Ga0265314_10019470 | |||
| 2430 | Ga0265342_10007004 | |||
| 2431 | Ga0307516_10000747 | |||
| 2432 | Ga0307516_10002063 | |||
| 2433 | Ga0307405_10233057 | |||
| 2434 | Ga0307413_10011267 | |||
| 2435 | Ga0307518_10215546 | |||
| 2436 | Ga0307410_10002475 | |||
| 2437 | Ga0307406_10056580 | |||
| 2438 | Ga0307407_10319380 | |||
| 2439 | Ga0307412_10021440 | |||
| 2440 | Ga0307409_100020905 | |||
| 2441 | Ga0307409_100042172 | |||
| 2442 | Ga0307409_100647996 | |||
| 2443 | Ga0307416_100042240 | |||
| 2444 | Ga0307416_100125061 | |||
| 2445 | Ga0307416_100150289 | |||
| 2446 | Ga0307416_100157725 | |||
| 2447 | Ga0307416_100359489 | |||
| 2448 | Ga0307416_100382521 | |||
| 2449 | Ga0307416_100390082 | |||
| 2450 | Ga0307411_10005848 | |||
| 2451 | Ga0307411_10046909 | |||
| 2452 | Ga0307411_10061891 | |||
| 2453 | Ga0307411_10136279 | |||
| 2454 | Ga0307411_10360116 | |||
| 2455 | Ga0307507_10034086 | |||
| 2456 | Ga0307510_10010883 | |||
| 2457 | Ga0373930_0042092 | |||
| 2458 | Ga0373948_0002801 | |||
| 2459 | Ga0373940_0009756 | |||
| 2460 | Ga0373940_0052833 | |||
| 2461 | Ga0373952_0028271 | |||
| 2462 | Ga0373939_0060273 | |||
| 2463 | Ga0373953_0004130 | |||
| 2464 | Ga0373953_0008528 | |||
| 2465 | Ga0373953_0018486 | |||
| 2466 | Ga0373953_0092861 | |||
| 2467 | Ga0373954_0000006 | |||
| 2468 | Ga0373954_0013401 | |||
| 2469 | Ga0373954_0063985 | |||
| 2470 | Ga0373954_0253192 | |||
| 2471 | Ga0373956_0022127 | |||
| 2472 | Ga0373957_0007206 | |||
| 2473 | Ga0373957_0026624 | |||
| 2474 | Ga0373955_0022552 | |||
| 2475 | Ga0373955_0032155 | |||
| 2476 | Ga0373942_0037600 | |||
| 2477 | Ga0373961_0010428 | |||
| 2478 | Ga0373924_0016868 | |||
| 2479 | Ga0373924_0040131 | |||
| 2480 | Ga0373924_0051486 | |||
| 2481 | Ga0373924_0105168 | |||
| 2482 | Ga0373931_0008116 | |||
| 2483 | Ga0373931_0152358 | |||
| 2484 | Ga0373931_0230415 | |||
| 2485 | Ga0373927_0054967 | |||
| 2486 | Ga0373927_0094975 | |||
| 2487 | Ga0373933_0002554 | |||
| 2488 | Ga0373933_0006374 | |||
| 2489 | Ga0373933_0088149 | |||
| 2490 | Ga0373937_0000595 | |||
| 2491 | Ga0373937_0004857 | |||
| 2492 | Ga0373937_0014930 | |||
| 2493 | Ga0373937_0019178 | |||
| 2494 | Ga0373937_0064219 | |||
| 2495 | Ga0373937_0093528 | |||
| 2496 | Ga0373937_0099029 | |||
| 2497 | Ga0373937_0222136 | |||
| 2498 | Ga0373937_0304898 | |||
| 2499 | Ga0373937_0612699 | |||
| 2500 | Ga0373937_0713218 | |||
| 2501 | Ga0373925_0033853 | |||
| 2502 | Ga0373925_0036520 | |||
| 2503 | Ga0373925_0128455 | |||
| 2504 | Ga0373925_0187086 | |||
| 2505 | Ga0373925_0224930 | |||
| 2506 | Ga0373925_0278656 | |||
| 2507 | Ga0373925_0328246 | |||
| 2508 | Ga0395899_0009901 | |||
| 2509 | Ga0395900_0007096 | |||
| 2510 | Ga0395900_0008202 | |||
| 2511 | Ga0395900_0061683 | |||
| 2512 | Ga0395900_0110984 | |||
| 2513 | Ga0395898_0009370 | |||
| 2514 | Ga0395898_0124971 | |||
| 2515 | Ga0395905_0031024 | |||
| 2516 | Ga0395905_0439309 | |||
| 2517 | Ga0436364_0143816 | |||
| 2518 | Ga0436364_0257301 | |||
| 2519 | Ga0436364_0793438 | |||
| 2520 | Ga0436364_0818873 | |||
| 2521 | Ga0436364_1066269 | |||
| 2522 | Ga0436364_1318842 | |||
| 2523 | Ga0395901_0004642 | |||
| 2524 | Ga0395901_0012050 | |||
| 2525 | Ga0395901_0013096 | |||
| 2526 | Ga0395901_0068491 | |||
| 2527 | Ga0436365_0177547 | |||
| 2528 | Ga0436365_0425373 | |||
| 2529 | Ga0436365_0681786 | |||
| 2530 | Ga0436365_0868950 | |||
| 2531 | Ga0436360_0061449 | |||
| 2532 | Ga0436360_0486209 | |||
| 2533 | Ga0436360_0793917 | |||
| 2534 | Ga0436360_1074955 | |||
| 2535 | Ga0436360_1280092 | |||
| 2536 | Ga0436360_1290437 | |||
| 2537 | Ga0436361_1006987 | |||
| 2538 | Ga0436363_0911403 | |||
| 2539 | Ga0436363_1073413 | |||
| 2540 | Ga0436362_0481759 | |||
| 2541 | Ga0436362_1028638 | |||
| 2542 | Ga0451793_1545139 | |||
| 2543 | Ga0451802_1112197 | |||
| 2544 | Ga0451807_0499581 | |||
| 2545 | Ga0451807_1253711 | |||
| 2546 | Ga0451849_0276976 | |||
| 2547 | Ga0451851_0523242 | |||
| 2548 | Ga0439431_0016250 | |||
| 2549 | Ga0439441_006088 | |||
| 2550 | Ga0439441_016519 | |||
| 2551 | Ga0439448_0001756 | |||
| 2552 | Ga0439448_0011271 | |||
| 2553 | Ga0439450_009064 | |||
| 2554 | Ga0439455_0013004 | |||
| 2555 | Ga0450889_001382 | |||
| 2556 | Ga0439458_0009129 | |||
| 2557 | Ga0439459_0000152 | |||
| 2558 | Ga0439464_0004171 | |||
| 2559 | Ga0439460_0001159 | |||
| 2560 | Ga0439460_0088558 | |||
| 2561 | Ga0451577_0029889 | |||
| 2562 | Ga0451577_0041449 | |||
| 2563 | Ga0451577_0088469 | |||
| 2564 | Ga0466969_0009411 | |||
| 2565 | Ga0453683_0004609 | |||
| 2566 | Ga0453683_0098926 | |||
| 2567 | Ga0453684_0010525 | |||
| 2568 | Ga0453684_0115564 | |||
| 2569 | Ga0453684_0312292 | |||
| 2570 | Ga0453684_0583733 | |||
| 2571 | Ga0466959_0014401 | |||
| 2572 | Ga0451576_0003738 | |||
| 2573 | Ga0451576_0012679 | |||
| 2574 | Ga0451576_0095383 | |||
| 2575 | Ga0451576_0231551 | |||
| 2576 | Ga0451576_0245856 | |||
| 2577 | Ga0451576_0298432 | |||
| 2578 | Ga0451576_0378546 | |||
| 2579 | Ga0451576_0414902 | |||
| 2580 | Ga0466958_0088800 | |||
| 2581 | Ga0466958_0091092 | |||
| 2582 | Ga0466967_0213926 | |||
| 2583 | Ga0466967_0413470 | |||
| 2584 | Ga0495592_0000160 | |||
| 2585 | Ga0495592_0000928 | |||
| 2586 | Ga0495603_0132468 | |||
| 2587 | Ga0495590_0111461 | |||
| 2588 | Ga0495629_0401303 | |||
| 2589 | Ga0495638_0001008 | |||
| 2590 | Ga0495638_0043046 | |||
| 2591 | Ga0495638_0103625 | |||
| 2592 | Ga0495651_0079219 | |||
| 2593 | Ga0495651_0109338 | |||
| 2594 | Ga0495653_0316980 | |||
| 2595 | Ga0495580_0037801 | |||
| 2596 | Ga0495580_0077357 | |||
| 2597 | Ga0495580_0104380 | |||
| 2598 | Ga0495582_0015221 | |||
| 2599 | Ga0495582_0055355 | |||
| 2600 | Ga0495582_0147220 | |||
| 2601 | Ga0495662_0009907 | |||
| 2602 | Ga0495608_0001288 | |||
| 2603 | Ga0495608_0015622 | |||
| 2604 | Ga0495610_0055629 | |||
| 2605 | Ga0495620_0070385 | |||
| 2606 | Ga0495620_0090246 | |||
| 2607 | Ga0495628_0001997 | |||
| 2608 | Ga0495628_0049177 | |||
| 2609 | Ga0495628_0179249 | |||
| 2610 | Ga0495630_0001497 | |||
| 2611 | Ga0495630_0010529 | |||
| 2612 | Ga0495630_0077680 | |||
| 2613 | Ga0495630_0157346 | |||
| 2614 | Ga0495630_0315901 | |||
| 2615 | Ga0495632_0024686 | |||
| 2616 | Ga0495632_0054487 | |||
| 2617 | Ga0495632_0141651 | |||
| 2618 | Ga0495666_0001472 | |||
| 2619 | Ga0495666_0020433 | |||
| 2620 | Ga0495642_0116589 | |||
| 2621 | Ga0495652_0050184 | |||
| 2622 | Ga0495640_0000622 | |||
| 2623 | Ga0495640_0041479 | |||
| 2624 | Ga0495640_0086660 | |||
| 2625 | Ga0495586_0001804 | |||
| 2626 | Ga0495586_0011239 | |||
| 2627 | Ga0495586_0011452 | |||
| 2628 | Ga0495586_0022520 | |||
| 2629 | Ga0495586_0173157 | |||
| 2630 | Ga0495587_0016321 | |||
| 2631 | Ga0495587_0055134 | |||
| 2632 | Ga0495645_0056608 | |||
| 2633 | Ga0495667_0004436 | |||
| 2634 | Ga0495667_0008992 | |||
| 2635 | Ga0495667_0036472 | |||
| 2636 | Ga0495634_0004756 | |||
| 2637 | Ga0495634_0048623 | |||
| 2638 | Ga0495634_0075662 | |||
| 2639 | Ga0495625_0000452 | |||
| 2640 | Ga0495625_0005241 | |||
| 2641 | Ga0495625_0034663 | |||
| 2642 | Ga0495635_0018825 | |||
| 2643 | Ga0495635_0128061 | |||
| 2644 | Ga0495659_0007967 | |||
| 2645 | Ga0495659_0011969 | |||
| 2646 | Ga0495599_0007711 | |||
| 2647 | Ga0495599_0031262 | |||
| 2648 | Ga0495599_0079319 | |||
| 2649 | Ga0495599_0094923 | |||
| 2650 | Ga0495647_0026811 | |||
| 2651 | Ga0495658_0043624 | |||
| 2652 | Ga0495658_0083815 | |||
| 2653 | Ga0495669_0022956 | |||
| 2654 | Ga0495669_0038652 | |||
| 2655 | Ga0495669_0128026 | |||
| 2656 | Ga0495613_0016058 | |||
| 2657 | Ga0495624_0032623 | |||
| 2658 | Ga0495600_0008015 | |||
| 2659 | Ga0495604_0001281 | |||
| 2660 | Ga0495636_0020840 | |||
| 2661 | Ga0495674_0007664 | |||
| 2662 | Ga0495674_0077092 | |||
| 2663 | Ga0495674_0080808 | |||
| 2664 | Ga0495674_0118630 | |||
| 2665 | Ga0495680_0000665 | |||
| 2666 | Ga0495680_0093768 | |||
| 2667 | Ga0495675_0016482 | |||
| 2668 | Ga0495675_0146396 | |||
| 2669 | Ga0495684_0322337 | |||
| 2670 | Ga0495593_0210636 | |||
| 2671 | Ga0495602_0003699 | |||
| 2672 | Ga0495602_0083243 | |||
| 2673 | Ga0495614_0092830 | |||
| 2674 | Ga0496100_0207965 | |||
| 2675 | Ga0496102_0009055 | |||
| 2676 | Ga0496102_0018920 | |||
| 2677 | Ga0496102_0047527 | |||
| 2678 | Ga0496102_0317890 | |||
| 2679 | Ga0496104_0041740 | |||
| 2680 | Ga0496104_0289822 | |||
| 2681 | Ga0496106_0083474 | |||
| 2682 | Ga0496106_0162961 | |||
| 2683 | Ga0496106_0365983 | |||
| 2684 | Ga0496107_0090270 | |||
| 2685 | Ga0496109_0546403 | |||
| 2686 | Ga0496112_0003733 | |||
| 2687 | Ga0496112_0140233 | |||
| 2688 | Ga0496112_0181338 | |||
| 2689 | Ga0496112_0513735 | |||
| 2690 | Ga0496112_0873636 | |||
| 2691 | Ga0496118_0037802 | |||
| 2692 | Ga0496119_0014528 | |||
| 2693 | Ga0496121_0092816 | |||
| 2694 | Ga0496126_0001339 | |||
| 2695 | Ga0501031_0001671 | |||
| 2696 | Ga0501031_0006567 | |||
| 2697 | Ga0501031_0067526 | |||
| 2698 | Ga0501032_0012640 | |||
| 2699 | Ga0501032_0199448 | |||
| 2700 | Ga0501032_0331132 | |||
| 2701 | Ga0501033_0028548 | |||
| 2702 | Ga0501033_0049310 | |||
| 2703 | Ga0501033_0059948 | |||
| 2704 | Ga0501033_0076679 | |||
| 2705 | Ga0501033_0102784 | |||
| 2706 | Ga0501036_0010791 | |||
| 2707 | Ga0501036_0111897 | |||
| 2708 | Ga0501036_0181883 | |||
| 2709 | Ga0501036_0211748 | |||
| 2710 | Ga0501037_0123723 | |||
| 2711 | Ga0501037_0224693 | |||
| 2712 | Ga0501038_0006982 | |||
| 2713 | Ga0501038_0008494 | |||
| 2714 | Ga0501038_0071944 | |||
| 2715 | Ga0501038_0112166 | |||
| 2716 | Ga0501038_0146862 | |||
| 2717 | Ga0501038_0235050 | |||
| 2718 | Ga0501039_0003897 | |||
| 2719 | Ga0501039_0008458 | |||
| 2720 | Ga0501039_0015965 | |||
| 2721 | Ga0501039_0305649 | |||
| 2722 | Ga0501039_0458236 | |||
| 2723 | Ga0501040_0003299 | |||
| 2724 | Ga0501040_0004167 | |||
| 2725 | Ga0501040_0005119 | |||
| 2726 | Ga0501040_0054080 | |||
| 2727 | Ga0501040_0060566 | |||
| 2728 | Ga0501040_0061276 | |||
| 2729 | Ga0501040_0075062 | |||
| 2730 | Ga0501040_0161860 | |||
| 2731 | Ga0501040_0169605 | |||
| 2732 | Ga0501040_0213272 | |||
| 2733 | Ga0501040_0216139 | |||
| 2734 | Ga0501040_0362779 | |||
| 2735 | Ga0501041_0003324 | |||
| 2736 | Ga0501041_0008148 | |||
| 2737 | Ga0501041_0036481 | |||
| 2738 | Ga0501041_0044144 | |||
| 2739 | Ga0501041_0152210 | |||
| 2740 | Ga0501041_0200804 | |||
| 2741 | Ga0501041_0234544 | |||
| 2742 | Ga0501041_0289759 | |||
| 2743 | Ga0501042_0002578 | |||
| 2744 | Ga0501042_0038435 | |||
| 2745 | Ga0501042_0048793 | |||
| 2746 | Ga0501042_0063642 | |||
| 2747 | Ga0501042_0106511 | |||
| 2748 | Ga0501042_0120172 | |||
| 2749 | Ga0501043_0033960 | |||
| 2750 | Ga0501043_0105080 | |||
| 2751 | Ga0501043_0107629 | |||
| 2752 | Ga0501043_0481151 | |||
| 2753 | Ga0501046_0001962 | |||
| 2754 | Ga0501046_0004982 | |||
| 2755 | Ga0501046_0006823 | |||
| 2756 | Ga0501046_0030364 | |||
| 2757 | Ga0501046_0095204 | |||
| 2758 | Ga0501047_0035034 | |||
| 2759 | Ga0501048_0010923 | |||
| 2760 | Ga0501048_0011694 | |||
| 2761 | Ga0501048_0075735 | |||
| 2762 | Ga0501048_0144139 | |||
| 2763 | Ga0501048_0151340 | |||
| 2764 | Ga0501048_0198638 | |||
| 2765 | Ga0501048_0304650 | |||
| 2766 | Ga0501068_0003456 | |||
| 2767 | Ga0501068_0080825 | |||
| 2768 | Ga0501070_0237117 | |||
| 2769 | Ga0501070_0295479 | |||
| 2770 | Ga0501071_0000244 | |||
| 2771 | Ga0501071_0057203 | |||
| 2772 | Ga0501071_0077946 | |||
| 2773 | Ga0501072_0002603 | |||
| 2774 | Ga0501072_0010608 | |||
| 2775 | Ga0501072_0043509 | |||
| 2776 | Ga0501072_0095782 | |||
| 2777 | Ga0501072_0134650 | |||
| 2778 | Ga0501072_0139603 | |||
| 2779 | Ga0501072_0147679 | |||
| 2780 | Ga0501072_0256715 | |||
| 2781 | Ga0501072_0441104 | |||
| 2782 | Ga0501073_0176181 | |||
| 2783 | Ga0501074_0007388 | |||
| 2784 | Ga0501074_0011907 | |||
| 2785 | Ga0501074_0094026 | |||
| 2786 | Ga0501074_0105750 | |||
| 2787 | Ga0501074_0160007 | |||
| 2788 | Ga0501075_0002670 | |||
| 2789 | Ga0501075_0004621 | |||
| 2790 | Ga0501075_0014543 | |||
| 2791 | Ga0501075_0017637 | |||
| 2792 | Ga0501075_0018540 | |||
| 2793 | Ga0501075_0023006 | |||
| 2794 | Ga0501075_0053090 | |||
| 2795 | Ga0501075_0061150 | |||
| 2796 | Ga0501075_0073459 | |||
| 2797 | Ga0501075_0092811 | |||
| 2798 | Ga0501075_0100270 | |||
| 2799 | Ga0501075_0110137 | |||
| 2800 | Ga0501075_0135693 | |||
| 2801 | Ga0501075_0281805 | |||
| 2802 | Ga0501076_0000941 | |||
| 2803 | Ga0501076_0001068 | |||
| 2804 | Ga0501076_0008483 | |||
| 2805 | Ga0501076_0023984 | |||
| 2806 | Ga0501076_0032035 | |||
| 2807 | Ga0501076_0035412 | |||
| 2808 | Ga0501076_0062674 | |||
| 2809 | Ga0501076_0123523 | |||
| 2810 | Ga0501076_0191079 | |||
| 2811 | Ga0501076_0397988 | |||
| 2812 | Ga0501077_0001148 | |||
| 2813 | Ga0501077_0001199 | |||
| 2814 | Ga0501077_0006228 | |||
| 2815 | Ga0501077_0007712 | |||
| 2816 | Ga0501077_0023151 | |||
| 2817 | Ga0501077_0024656 | |||
| 2818 | Ga0501077_0027849 | |||
| 2819 | Ga0501077_0143405 | |||
| 2820 | Ga0501077_0219633 | |||
| 2821 | Ga0501079_0000911 | |||
| 2822 | Ga0501079_0007952 | |||
| 2823 | Ga0501079_0015315 | |||
| 2824 | Ga0501079_0031397 | |||
| 2825 | Ga0501079_0098538 | |||
| 2826 | Ga0501079_0165532 | |||
| 2827 | Ga0501079_0170630 | |||
| 2828 | Ga0501079_0197258 | |||
| 2829 | Ga0501079_0349818 | |||
| 2830 | Ga0501079_0493282 | |||
| 2831 | Ga0501080_0003304 | |||
| 2832 | Ga0501080_0047991 | |||
| 2833 | Ga0501080_0057118 | |||
| 2834 | Ga0501080_0123805 | |||
| 2835 | Ga0501080_0153994 | |||
| 2836 | Ga0501080_0208191 | |||
| 2837 | Ga0501080_0234960 | |||
| 2838 | Ga0501080_0545622 | |||
| 2839 | Ga0501080_0587237 | |||
| 2840 | Ga0501081_0001515 | |||
| 2841 | Ga0501081_0002460 | |||
| 2842 | Ga0501081_0002931 | |||
| 2843 | Ga0501081_0005008 | |||
| 2844 | Ga0501081_0009379 | |||
| 2845 | Ga0501081_0013240 | |||
| 2846 | Ga0501081_0026018 | |||
| 2847 | Ga0501081_0038170 | |||
| 2848 | Ga0501081_0060570 | |||
| 2849 | Ga0501081_0078747 | |||
| 2850 | Ga0501081_0129766 | |||
| 2851 | Ga0501081_0154530 | |||
| 2852 | Ga0501081_0269858 | |||
| 2853 | Ga0501081_0456872 | |||
| 2854 | Ga0501083_0023161 | |||
| 2855 | Ga0501083_0071249 | |||
| 2856 | Ga0501035_0018384 | |||
| 2857 | Ga0501035_0067862 | |||
| 2858 | Ga0501035_0159062 | |||
| 2859 | Ga0501035_0165729 | |||
| 2860 | Ga0501044_0007157 | |||
| 2861 | Ga0501044_0118648 | |||
| 2862 | Ga0501045_0001177 | |||
| 2863 | Ga0501045_0003250 | |||
| 2864 | Ga0501045_0041224 | |||
| 2865 | Ga0501045_0078303 | |||
| 2866 | Ga0501045_0078916 | |||
| 2867 | Ga0501045_0082145 | |||
| 2868 | Ga0501045_0120718 | |||
| 2869 | Ga0501045_0123408 | |||
| 2870 | nmdc:mga03683_1672_c1 | |||
| 2871 | nmdc:mga03683_58571_c1 | |||
| 2872 | nmdc:mga0yw44_25904_c1 | |||
| 2873 | nmdc:mga0k408_91632_c1 | |||
| 2874 | nmdc:mga06z11_171635_c1 | |||
| 2875 | nmdc:mga07m45_21154_c1 | |||
| 2876 | nmdc:mga05p37_12411_c1 | |||
| 2877 | nmdc:mga05p37_14151_c1 | |||
| 2878 | nmdc:mga05p37_15548_c1 | |||
| 2879 | nmdc:mga05p37_175126_c1 | |||
| 2880 | nmdc:mga05p37_241719_c1 | |||
| 2881 | nmdc:mga05p37_353904_c1 | |||
| 2882 | nmdc:mga05p37_374430_c1 | |||
| 2883 | nmdc:mga05p37_38570_c1 | |||
| 2884 | nmdc:mga05p37_50332_c1 | |||
| 2885 | nmdc:mga05p37_53612_c1 | |||
| 2886 | nmdc:mga05p37_62345_c1 | |||
| 2887 | nmdc:mga05p37_627_c1 | |||
| 2888 | nmdc:mga05p37_66785_c1 | |||
| 2889 | nmdc:mga05p37_75279_c1 | |||
| 2890 | nmdc:mga05p37_94602_c1 | |||
| 2891 | nmdc:mga05p37_99443_c1 | |||
| 2892 | nmdc:mga09592_11897_c1 | |||
| 2893 | nmdc:mga09592_134798_c1 | |||
| 2894 | nmdc:mga09592_176518_c1 | |||
| 2895 | nmdc:mga09592_184865_c1 | |||
| 2896 | nmdc:mga09592_20769_c1 | |||
| 2897 | nmdc:mga09592_279637_c1 | |||
| 2898 | nmdc:mga09592_407385_c1 | |||
| 2899 | nmdc:mga09592_408506_c1 | |||
| 2900 | nmdc:mga09592_50607_c1 | |||
| 2901 | nmdc:mga09592_618701_c1 | |||
| 2902 | nmdc:mga09592_65955_c1 | |||
| 2903 | nmdc:mga0qj67_112928_c1 | |||
| 2904 | nmdc:mga0qj67_11455_c1 | |||
| 2905 | nmdc:mga0qj67_19615_c1 | |||
| 2906 | nmdc:mga0qj67_379815_c1 | |||
| 2907 | nmdc:mga0qj67_51140_c1 | |||
| 2908 | nmdc:mga0qj67_60678_c1 | |||
| 2909 | nmdc:mga0qj67_737_c1 | |||
| 2910 | nmdc:mga0qj67_771_c1 | |||
| 2911 | nmdc:mga0qj67_87339_c1 | |||
| 2912 | nmdc:mga06r32_1149_c1 | |||
| 2913 | nmdc:mga06r32_132780_c1 | |||
| 2914 | nmdc:mga06r32_13803_c1 | |||
| 2915 | nmdc:mga06r32_211578_c1 | |||
| 2916 | nmdc:mga06r32_212603_c1 | |||
| 2917 | nmdc:mga06r32_235728_c1 | |||
| 2918 | nmdc:mga06r32_2878_c1 | |||
| 2919 | nmdc:mga06r32_379548_c1 | |||
| 2920 | nmdc:mga06r32_44035_c1 | |||
| 2921 | nmdc:mga06r32_76406_c1 | |||
| 2922 | nmdc:mga06r32_78818_c1 | |||
| 2923 | nmdc:mga08y16_19421_c1 | |||
| 2924 | nmdc:mga08y16_1_c1 | |||
| 2925 | nmdc:mga08y16_2040_c1 | |||
| 2926 | nmdc:mga08y16_20667_c1 | |||
| 2927 | nmdc:mga08y16_338265_c1 | |||
| 2928 | nmdc:mga08y16_38688_c1 | |||
| 2929 | nmdc:mga08y16_499791_c1 | |||
| 2930 | nmdc:mga08y16_57849_c2 | |||
| 2931 | nmdc:mga08y16_74958_c1 | |||
| 2932 | nmdc:mga0n895_14201_c1 | |||
| 2933 | nmdc:mga0n895_144738_c1 | |||
| 2934 | nmdc:mga0n895_14800_c1 | |||
| 2935 | nmdc:mga0n895_160454_c1 | |||
| 2936 | nmdc:mga0n895_18707_c1 | |||
| 2937 | nmdc:mga0n895_191716_c1 | |||
| 2938 | nmdc:mga0n895_20812_c1 | |||
| 2939 | nmdc:mga0n895_28969_c1 | |||
| 2940 | nmdc:mga0n895_429560_c1 | |||
| 2941 | nmdc:mga0n895_46394_c1 | |||
| 2942 | nmdc:mga0n895_58009_c1 | |||
| 2943 | nmdc:mga0n895_59351_c1 | |||
| 2944 | nmdc:mga0n895_647719_c1 | |||
| 2945 | nmdc:mga0n895_81789_c1 | |||
| 2946 | nmdc:mga0n895_9124_c1 | |||
| 2947 | nmdc:mga0rr50_106603_c1 | |||
| 2948 | nmdc:mga0rr50_146101_c1 | |||
| 2949 | nmdc:mga0rr50_149029_c1 | |||
| 2950 | nmdc:mga0rr50_164753_c1 | |||
| 2951 | nmdc:mga0rr50_167347_c1 | |||
| 2952 | nmdc:mga0rr50_220573_c1 | |||
| 2953 | nmdc:mga0rr50_36415_c1 | |||
| 2954 | nmdc:mga08x19_127633_c1 | |||
| 2955 | nmdc:mga08x19_1493_c1 | |||
| 2956 | nmdc:mga08x19_181647_c1 | |||
| 2957 | nmdc:mga08x19_349013_c1 | |||
| 2958 | nmdc:mga08x19_34912_c1 | |||
| 2959 | nmdc:mga08x19_39695_c1 | |||
| 2960 | nmdc:mga0a205_12082_c1 | |||
| 2961 | nmdc:mga0a205_123200_c1 | |||
| 2962 | nmdc:mga0a205_21728_c1 | |||
| 2963 | nmdc:mga0a205_246361_c1 | |||
| 2964 | nmdc:mga0a205_333772_c1 | |||
| 2965 | nmdc:mga0a205_349618_c1 | |||
| 2966 | nmdc:mga0a205_452501_c1 | |||
| 2967 | nmdc:mga0a205_46959_c1 | |||
| 2968 | nmdc:mga0a205_50570_c1 | |||
| 2969 | nmdc:mga0a205_525647_c1 | |||
| 2970 | nmdc:mga0a205_5345_c1 | |||
| 2971 | nmdc:mga0a205_616575_c1 | |||
| 2972 | nmdc:mga0a205_897_c1 | |||
| 2973 | nmdc:mga0a205_95351_c1 | |||
| 2974 | nmdc:mga0sz30_16033_c1 | |||
| 2975 | Ga0495601_0036178 | |||
| 2976 | Ga0495601_0051457 | |||
| 2977 | Ga0495612_0002393 | |||
| 2978 | Ga0495619_0039627 | |||
| 2979 | Ga0495619_0144377 | |||
| 2980 | Ga0495619_0219744 | |||
| 2981 | Ga0500578_0000028 | |||
| 2982 | Ga0500644_0006411 | |||
| 2983 | Ga0500644_0076356 | |||
| 2984 | Ga0500641_0014986 | |||
| 2985 | Ga0500650_0135466 | |||
| 2986 | Ga0500658_0006100 | |||
| 2987 | Ga0500559_0000864 | |||
| 2988 | Ga0500568_0035313 | |||
| 2989 | Ga0500604_0010329 | |||
| 2990 | Ga0500619_020654 | |||
| 2991 | Ga0500620_092511 | |||
| 2992 | Ga0500622_0017751 | |||
| 2993 | Ga0501084_0000224 | |||
| 2994 | Ga0501084_0001053 | |||
| 2995 | Ga0501084_0051966 | |||
| 2996 | Ga0501084_0056339 | |||
| 2997 | Ga0501084_0082746 | |||
| 2998 | Ga0501084_0098446 | |||
| 2999 | Ga0501084_0142189 | |||
| 3000 | Ga0501084_0178502 | |||
| 3001 | Ga0501084_0313761 | |||
| 3002 | Ga0501082_0000354 | |||
| 3003 | Ga0501082_0002209 | |||
| 3004 | Ga0501082_0003064 | |||
| 3005 | Ga0501082_0028497 | |||
| 3006 | Ga0501082_0033174 | |||
| 3007 | Ga0501082_0066666 | |||
| 3008 | Ga0501082_0076523 | |||
| 3009 | Ga0501082_0129443 | |||
| 3010 | Ga0501082_0195142 | |||
| 3011 | Ga0530510_0000710 | |||
| 3012 | Ga0530510_0002646 | |||
| 3013 | Ga0530510_0005735 | |||
| 3014 | Ga0530510_0048449 | |||
| 3015 | Ga0530510_0203698 | |||
| 3016 | 2587728612 | |||
| 3017 | 2587732428 | |||
| 3018 | 2587757769 | |||
| 3019 | 2588291972 | |||
| 3020 | 2643971378 | |||
| 3021 | 2644140913 | |||
| 3022 | 2644276705 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lsb-assembly1.cif.gz_A | crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 | 0.9823 | 4 | 255 |
| 4lsb-assembly1.cif.gz_B | crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 | 0.9799 | 4 | 257 |
| 4lsb-assembly1.cif.gz_B | crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 | 0.9648 | 4 | 257 |
| 4lsb-assembly1.cif.gz_A | crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 | 0.9597 | 4 | 255 |
| 2ze3-assembly1.cif.gz_A-2 | crystal structure of dfa0005 complexed with alpha-ketoglutarate: a novel member of the icl/pepm superfamily from alkali-tolerant deinococcus ficus | 0.9116 | 1 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lsbB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9818 | 4 | 226 | 3.20.20.60 |
| 4lsbB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9481 | 4 | 226 | 3.20.20.60 |
| af_Q8GYI4_58_362_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9204 | 1 | 247 | 3.20.20.60 |
| 2ze3A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9198 | 1 | 226 | 3.20.20.60 |
| af_P9WLN9_1_257_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9167 | 8 | 247 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6PFR3-F1-model_v4 | 2-methylisocitrate lyase | 0.9958 | 20 | 175 |
GO:0016829
|
| AF-A0A7V8BJQ6-F1-model_v4 | Isocitrate lyase/phosphoenolpyruvate mutase family protein | 0.9957 | 76 | 257 |
GO:0016829
|
| AF-A0A536SY66-F1-model_v4 | Isocitrate lyase/phosphoenolpyruvate mutase family protein | 0.995 | 4 | 257 |
GO:0016829
|
| AF-A0A524Q9N9-F1-model_v4 | Isocitrate lyase/phosphoenolpyruvate mutase family protein | 0.9947 | 4 | 188 |
GO:0016829
|
| AF-A0A7Y5GCF5-F1-model_v4 | Isocitrate lyase/phosphoenolpyruvate mutase family protein | 0.992 | 4 | 257 |
GO:0016829
|