F494476

General Info

Members Datasets Scaffolds Average Seq Length
1511 426 3022 270

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_34133_c1|nmdc:mga08x19_34133_c1_441_1376
Length 311
Sequence MGILLADPGDSSAVGGSGFLACVRVVSSAMMPVTEAVMTTTQSDKAARFRALHQAPGAFVIPNPWDAGSARLLAGLGFQALATSSGASAGTLGRRDGKVTREEALAHARAIVNATDLPVSADLEKGFGDAPEAAAETIRQAAGVGLVGGSIEDASGDPQRPIYDFNHAVERVAAAVQAARALPFAFTLTARAEGQLRGQPDLDEIIRRLQAFEKAGTDVLMAPGLPDLAAVRRLCAAVSKPVNFMAGIKGKSFTVAELAAAGVKRISLATSLYRAAMTAVRDAAAEVKDKGSFGYLDRSLATPELNAFMKE

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
145 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
229 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
236 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
243 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
254 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
255 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
258 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
259 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
282 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
283 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
284 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
285 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
286 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
287 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
288 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
289 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
290 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
291 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
292 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
293 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
294 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
295 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
296 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
297 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
298 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
299 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
310 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
313 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
314 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
315 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
380 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
381 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
385 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
407 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
408 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
409 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
410 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
411 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
414 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
415 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
416 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
417 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
420 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
421 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
422 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
423 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
424 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
425 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
426 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.07
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 0
Rhizoplane 1.39
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_34133_c1 3300050514 Bacteria 3214
2 JGI25152J39213_1000939 3300002773 Bacteria 14304
3 JGI25406J46586_10001733 3300003203 Bacteria 10249
4 JGI25153J46596_10001552 3300003215 Bacteria 13648
5 JGI25153J46596_10003443 3300003215 Bacteria 8863
6 rootH2_10084913 3300003320 Bacteria 2275
7 rootH1_10073293 3300003323 Bacteria 9625
8 JGI26141J51220_1000238 3300003503 Bacteria 2901
9 Ga0055526_1002279 3300003771 Bacteria 13101
10 Ga0058863_11399723 3300004799 Bacteria 1061
11 Ga0065165_1001161 3300005262 Bacteria 30703
12 Ga0065715_10293307 3300005293 Unclassified 1056
13 Ga0065707_10082160 3300005295 Bacteria 20515
14 Ga0065707_10090228 3300005295 Bacteria 4185
15 Ga0065707_10097617 3300005295 Unclassified 3159
16 Ga0065707_10119844 3300005295 Unclassified 2149
17 Ga0070658_10013839 3300005327 Bacteria 6474
18 Ga0070658_10089989 3300005327 Bacteria 2528
19 Ga0070676_10000180 3300005328 Bacteria 26224
20 Ga0070676_10044286 3300005328 Bacteria 2589
21 Ga0070676_10154421 3300005328 Bacteria 1472
22 Ga0070676_10244069 3300005328 Bacteria 1196
23 Ga0070683_100035870 3300005329 Bacteria 4535
24 Ga0070683_100044269 3300005329 Bacteria 4104
25 Ga0070683_100433481 3300005329 Bacteria 1254
26 Ga0070690_100002966 3300005330 Bacteria 9179
27 Ga0070690_100084329 3300005330 Unclassified 2083
28 Ga0070690_100112277 3300005330 Bacteria 1820
29 Ga0070690_100151416 3300005330 Bacteria 1583
30 Ga0070690_100166718 3300005330 Bacteria 1513
31 Ga0070670_100006716 3300005331 Bacteria 9751
32 Ga0070670_100030466 3300005331 Bacteria 4646
33 Ga0070677_10000480 3300005333 Bacteria 13662
34 Ga0070677_10002340 3300005333 Bacteria 6057
35 Ga0068869_100000690 3300005334 Bacteria 19082
36 Ga0068869_100008882 3300005334 Bacteria 6501
37 Ga0068869_100043111 3300005334 Bacteria 3239
38 Ga0068869_100174215 3300005334 Bacteria 1683
39 Ga0068869_100342139 3300005334 Bacteria 1217
40 Ga0070666_10008877 3300005335 Bacteria 6249
41 Ga0070680_100017550 3300005336 Bacteria 5645
42 Ga0070680_100024240 3300005336 Bacteria 4843
43 Ga0070680_100034153 3300005336 Bacteria 4101
44 Ga0070680_100045760 3300005336 Bacteria 3558
45 Ga0070680_100076002 3300005336 Bacteria 2765
46 Ga0070680_100116938 3300005336 Bacteria 2223
47 Ga0070680_100352912 3300005336 Bacteria 1251
48 Ga0070680_100402838 3300005336 Bacteria 1166
49 Ga0070682_100000622 3300005337 Bacteria 21584
50 Ga0070682_100115528 3300005337 Bacteria 1794
51 Ga0070682_100187034 3300005337 Bacteria 1451
52 Ga0068868_100015578 3300005338 Bacteria 5627
53 Ga0068868_100018830 3300005338 Bacteria 5166
54 Ga0068868_100051604 3300005338 Bacteria 3236
55 Ga0068868_100207196 3300005338 Bacteria 1637
56 Ga0070660_100002171 3300005339 Bacteria 13520
57 Ga0070689_100008079 3300005340 Bacteria 7392
58 Ga0070689_100136889 3300005340 Bacteria 1967
59 Ga0070689_100246919 3300005340 Bacteria 1472
60 Ga0070689_100257639 3300005340 Bacteria 1441
61 Ga0070689_100358301 3300005340 Bacteria 1225
62 Ga0070691_10005153 3300005341 Bacteria 5938
63 Ga0070691_10054987 3300005341 Bacteria 1906
64 Ga0070687_100018481 3300005343 Bacteria 3226
65 Ga0070687_100033727 3300005343 Bacteria 2529
66 Ga0070687_100088303 3300005343 Bacteria 1709
67 Ga0070687_100371871 3300005343 Bacteria 929
68 Ga0070661_100000211 3300005344 Bacteria 48345
69 Ga0070692_10000947 3300005345 Bacteria 9859
70 Ga0070692_10013082 3300005345 Bacteria 3861
71 Ga0070692_10019539 3300005345 Bacteria 3270
72 Ga0070668_100011684 3300005347 Bacteria 6537
73 Ga0070668_100221811 3300005347 Bacteria 1560
74 Ga0070668_100249268 3300005347 Bacteria 1474
75 Ga0070668_100293832 3300005347 Bacteria 1361
76 Ga0070669_100003321 3300005353 Bacteria 11563
77 Ga0070669_100005282 3300005353 Bacteria 9326
78 Ga0070669_100018574 3300005353 Bacteria 4969
79 Ga0070669_100092920 3300005353 Bacteria 2265
80 Ga0070669_100150638 3300005353 Bacteria 1800
81 Ga0070669_100187096 3300005353 Bacteria 1623
82 Ga0070669_100241301 3300005353 Bacteria 1436
83 Ga0070675_100000264 3300005354 Bacteria 34442
84 Ga0070675_100011030 3300005354 Bacteria 7075
85 Ga0070675_100043352 3300005354 Bacteria 3676
86 Ga0070675_100049356 3300005354 Unclassified 3454
87 Ga0070675_100071363 3300005354 Bacteria 2881
88 Ga0070675_100137477 3300005354 Bacteria 2086
89 Ga0070671_100005985 3300005355 Bacteria 9694
90 Ga0070671_100202226 3300005355 Bacteria 1685
91 Ga0070671_100334959 3300005355 Bacteria 1290
92 Ga0070674_100016275 3300005356 Bacteria 4660
93 Ga0070674_100017024 3300005356 Bacteria 4563
94 Ga0070674_100070264 3300005356 Unclassified 2473
95 Ga0070673_100001370 3300005364 Bacteria 14240
96 Ga0070673_100001462 3300005364 Bacteria 13820
97 Ga0070673_100048928 3300005364 Bacteria 3299
98 Ga0070673_100205809 3300005364 Bacteria 1697
99 Ga0070673_100356931 3300005364 Unclassified 1298
100 Ga0070659_100000204 3300005366 Bacteria 46050
101 Ga0070659_100230076 3300005366 Bacteria 1532
102 Ga0070659_100407722 3300005366 Bacteria 1148
103 Ga0070667_100712302 3300005367 Unclassified 929
104 Ga0070703_10043743 3300005406 Bacteria 1406
105 Ga0070703_10055704 3300005406 Bacteria 1278
106 Ga0070703_10061922 3300005406 Bacteria 1227
107 Ga0070709_10009910 3300005434 Bacteria 5267
108 Ga0070709_10274103 3300005434 Bacteria 1223
109 Ga0070709_10378568 3300005434 Bacteria 1052
110 Ga0070714_100058375 3300005435 Bacteria 3305
111 Ga0070714_100257428 3300005435 Bacteria 1615
112 Ga0070713_100114080 3300005436 Bacteria 2360
113 Ga0070713_100197773 3300005436 Bacteria 1814
114 Ga0070713_100222856 3300005436 Unclassified 1711
115 Ga0070713_100224955 3300005436 Bacteria 1703
116 Ga0070713_100351136 3300005436 Unclassified 1368
117 Ga0070713_100558597 3300005436 Bacteria 1084
118 Ga0070710_10003930 3300005437 Bacteria 7042
119 Ga0070710_10044950 3300005437 Bacteria 2453
120 Ga0070710_10130912 3300005437 Unclassified 1529
121 Ga0070711_100022847 3300005439 Bacteria 4059
122 Ga0070711_100084682 3300005439 Bacteria 2268
123 Ga0070711_100085919 3300005439 Bacteria 2254
124 Ga0070711_100397929 3300005439 Bacteria 1117
125 Ga0070705_100001378 3300005440 Bacteria 12938
126 Ga0070705_100010637 3300005440 Bacteria 4613
127 Ga0070705_100016819 3300005440 Bacteria 3808
128 Ga0070705_100065129 3300005440 Bacteria 2180
129 Ga0070705_100065685 3300005440 Bacteria 2173
130 Ga0070705_100111033 3300005440 Bacteria 1752
131 Ga0070705_100124781 3300005440 Bacteria 1669
132 Ga0070705_100147131 3300005440 Bacteria 1558
133 Ga0070700_100000457 3300005441 Bacteria 20564
134 Ga0070700_100051555 3300005441 Bacteria 2561
135 Ga0070700_100061077 3300005441 Bacteria 2377
136 Ga0070700_100315083 3300005441 Bacteria 1147
137 Ga0070700_100339503 3300005441 Bacteria 1110
138 Ga0070700_100485839 3300005441 Bacteria 947
139 Ga0070694_100001824 3300005444 Bacteria 12612
140 Ga0070694_100022369 3300005444 Bacteria 4050
141 Ga0070694_100078589 3300005444 Bacteria 2289
142 Ga0070694_100082460 3300005444 Bacteria 2239
143 Ga0070694_100460556 3300005444 Bacteria 1005
144 Ga0070694_100472064 3300005444 Bacteria 994
145 Ga0070708_100003247 3300005445 Bacteria 12688
146 Ga0070708_100003792 3300005445 Bacteria 11861
147 Ga0070708_100011346 3300005445 Bacteria 7246
148 Ga0070708_100018954 3300005445 Bacteria 5768
149 Ga0070708_100032371 3300005445 Bacteria 4535
150 Ga0070708_100037361 3300005445 Bacteria 4236
151 Ga0070708_100048798 3300005445 Bacteria 3744
152 Ga0070708_100066557 3300005445 Bacteria 3234
153 Ga0070708_100079649 3300005445 Bacteria 2964
154 Ga0070708_100089268 3300005445 Bacteria 2804
155 Ga0070708_100148809 3300005445 Bacteria 2176
156 Ga0070708_100151811 3300005445 Bacteria 2155
157 Ga0070708_100435779 3300005445 Bacteria 1236
158 Ga0070708_100587542 3300005445 Bacteria 1050
159 Ga0070663_100000167 3300005455 Bacteria 33014
160 Ga0070678_100080846 3300005456 Bacteria 2462
161 Ga0070678_100423761 3300005456 Unclassified 1161
162 Ga0070662_100001464 3300005457 Bacteria 14536
163 Ga0070662_100017049 3300005457 Bacteria 4888
164 Ga0070662_100197858 3300005457 Bacteria 1593
165 Ga0070662_100428938 3300005457 Bacteria 1095
166 Ga0070662_100446237 3300005457 Unclassified 1073
167 Ga0070681_10000852 3300005458 Bacteria 25625
168 Ga0070681_10000898 3300005458 Bacteria 25185
169 Ga0070681_10017554 3300005458 Bacteria 7150
170 Ga0070681_10051632 3300005458 Bacteria 4101
171 Ga0070681_10131120 3300005458 Bacteria 2439
172 Ga0070681_10165696 3300005458 Bacteria 2133
173 Ga0070681_10171698 3300005458 Bacteria 2090
174 Ga0068867_100000347 3300005459 Bacteria 30690
175 Ga0068867_100000382 3300005459 Bacteria 29543
176 Ga0068867_100002024 3300005459 Bacteria 14172
177 Ga0068867_100003059 3300005459 Bacteria 11791
178 Ga0068867_100007232 3300005459 Bacteria 7850
179 Ga0068867_100113394 3300005459 Bacteria 2086
180 Ga0068867_100138568 3300005459 Bacteria 1899
181 Ga0070685_10174139 3300005466 Bacteria 1381
182 Ga0070706_100001137 3300005467 Bacteria 28677
183 Ga0070706_100027332 3300005467 Bacteria 5251
184 Ga0070706_100084951 3300005467 Bacteria 2932
185 Ga0070706_100106706 3300005467 Bacteria 2605
186 Ga0070706_100202883 3300005467 Bacteria 1852
187 Ga0070706_100267098 3300005467 Bacteria 1597
188 Ga0070706_100279348 3300005467 Bacteria 1558
189 Ga0070706_100287849 3300005467 Bacteria 1533
190 Ga0070706_100325790 3300005467 Bacteria 1433
191 Ga0070707_100011824 3300005468 Bacteria 8151
192 Ga0070707_100065984 3300005468 Bacteria 3478
193 Ga0070707_100138676 3300005468 Bacteria 2366
194 Ga0070707_100259735 3300005468 Bacteria 1690
195 Ga0070707_100364113 3300005468 Bacteria 1405
196 Ga0070707_100541240 3300005468 Bacteria 1126
197 Ga0070698_100000110 3300005471 Bacteria 69016
198 Ga0070698_100019877 3300005471 Bacteria 7044
199 Ga0070698_100027252 3300005471 Bacteria 5945
200 Ga0070698_100034483 3300005471 Bacteria 5237
201 Ga0070698_100078815 3300005471 Bacteria 3292
202 Ga0070698_100160715 3300005471 Bacteria 2190
203 Ga0070698_100264545 3300005471 Bacteria 1652
204 Ga0070698_100312851 3300005471 Bacteria 1501
205 Ga0070698_100387468 3300005471 Bacteria 1330
206 Ga0070699_100005810 3300005518 Bacteria 10793
207 Ga0070699_100008560 3300005518 Bacteria 8863
208 Ga0070699_100020042 3300005518 Bacteria 5762
209 Ga0070699_100027987 3300005518 Bacteria 4861
210 Ga0070699_100032281 3300005518 Bacteria 4521
211 Ga0070699_100063068 3300005518 Unclassified 3213
212 Ga0070699_100063336 3300005518 Bacteria 3206
213 Ga0070699_100066277 3300005518 Bacteria 3134
214 Ga0070699_100067475 3300005518 Bacteria 3107
215 Ga0070699_100096606 3300005518 Bacteria 2587
216 Ga0070699_100190308 3300005518 Bacteria 1822
217 Ga0070699_100211156 3300005518 Bacteria 1728
218 Ga0070699_100611799 3300005518 Bacteria 994
219 Ga0070679_100002929 3300005530 Bacteria 15538
220 Ga0070679_100025321 3300005530 Bacteria 5821
221 Ga0070679_100054381 3300005530 Bacteria 3985
222 Ga0070679_100209658 3300005530 Bacteria 1912
223 Ga0070679_100373855 3300005530 Bacteria 1372
224 Ga0070684_100004515 3300005535 Bacteria 10598
225 Ga0070684_100013751 3300005535 Bacteria 6534
226 Ga0070684_100161967 3300005535 Bacteria 2030
227 Ga0070684_100195039 3300005535 Bacteria 1844
228 Ga0070684_100330729 3300005535 Bacteria 1400
229 Ga0070697_100003309 3300005536 Bacteria 12379
230 Ga0070697_100004392 3300005536 Bacteria 10824
231 Ga0070697_100012817 3300005536 Bacteria 6567
232 Ga0070697_100018719 3300005536 Bacteria 5464
233 Ga0070697_100040479 3300005536 Bacteria 3771
234 Ga0070697_100066526 3300005536 Bacteria 2946
235 Ga0070697_100099968 3300005536 Bacteria 2408
236 Ga0070697_100414712 3300005536 Bacteria 1170
237 Ga0070697_100501839 3300005536 Bacteria 1061
238 Ga0068853_100035390 3300005539 Bacteria 4242
239 Ga0068853_100043288 3300005539 Bacteria 3852
240 Ga0068853_100139823 3300005539 Bacteria 2173
241 Ga0068853_100159097 3300005539 Bacteria 2037
242 Ga0070672_100001028 3300005543 Bacteria 16972
243 Ga0070672_100003113 3300005543 Bacteria 10704
244 Ga0070672_100007023 3300005543 Bacteria 7614
245 Ga0070672_100062063 3300005543 Bacteria 2948
246 Ga0070672_100072867 3300005543 Bacteria 2736
247 Ga0070672_100194672 3300005543 Bacteria 1694
248 Ga0070686_100000394 3300005544 Bacteria 27646
249 Ga0070686_100073790 3300005544 Bacteria 2241
250 Ga0070686_100464332 3300005544 Bacteria 976
251 Ga0070695_100000724 3300005545 Bacteria 17616
252 Ga0070695_100009703 3300005545 Bacteria 5733
253 Ga0070695_100021490 3300005545 Bacteria 3950
254 Ga0070695_100045572 3300005545 Bacteria 2796
255 Ga0070695_100076356 3300005545 Bacteria 2206
256 Ga0070695_100082344 3300005545 Bacteria 2131
257 Ga0070695_100119075 3300005545 Bacteria 1804
258 Ga0070695_100164901 3300005545 Bacteria 1559
259 Ga0070696_100002440 3300005546 Bacteria 12318
260 Ga0070696_100024923 3300005546 Bacteria 4065
261 Ga0070696_100059206 3300005546 Bacteria 2676
262 Ga0070696_100085964 3300005546 Bacteria 2232
263 Ga0070696_100112452 3300005546 Bacteria 1962
264 Ga0070696_100272708 3300005546 Bacteria 1287
265 Ga0070696_100299714 3300005546 Bacteria 1231
266 Ga0070696_100305090 3300005546 Bacteria 1220
267 Ga0070696_100366072 3300005546 Bacteria 1120
268 Ga0070693_100000530 3300005547 Bacteria 17134
269 Ga0070693_100028206 3300005547 Bacteria 3050
270 Ga0070665_100053465 3300005548 Bacteria 4050
271 Ga0070665_100289904 3300005548 Unclassified 1639
272 Ga0070665_100537584 3300005548 Unclassified 1181
273 Ga0070704_100030815 3300005549 Bacteria 3598
274 Ga0070704_100044729 3300005549 Bacteria 3078
275 Ga0070704_100046332 3300005549 Bacteria 3031
276 Ga0070704_100053519 3300005549 Bacteria 2853
277 Ga0070704_100312001 3300005549 Bacteria 1314
278 Ga0068855_100000221 3300005563 Bacteria 72860
279 Ga0068855_100000319 3300005563 Bacteria 59802
280 Ga0068855_100001074 3300005563 Bacteria 33944
281 Ga0068855_100030553 3300005563 Bacteria 6442
282 Ga0070664_100028129 3300005564 Bacteria 4675
283 Ga0070664_100107053 3300005564 Unclassified 2437
284 Ga0070664_100169494 3300005564 Bacteria 1936
285 Ga0070664_100265485 3300005564 Bacteria 1545
286 Ga0070664_100310117 3300005564 Bacteria 1428
287 Ga0068857_100003125 3300005577 Bacteria 13696
288 Ga0068857_100011491 3300005577 Bacteria 7702
289 Ga0068857_100039971 3300005577 Bacteria 4158
290 Ga0068857_100209496 3300005577 Bacteria 1778
291 Ga0068857_100665956 3300005577 Unclassified 987
292 Ga0068854_100002450 3300005578 Bacteria 11480
293 Ga0068854_100017860 3300005578 Bacteria 4755
294 Ga0068854_100027688 3300005578 Bacteria 3909
295 Ga0068854_100029699 3300005578 Bacteria 3786
296 Ga0068856_100000395 3300005614 Bacteria 47760
297 Ga0068856_100000702 3300005614 Bacteria 36313
298 Ga0068856_100006539 3300005614 Bacteria 11424
299 Ga0068856_100071442 3300005614 Bacteria 3436
300 Ga0068856_100110613 3300005614 Bacteria 2744
301 Ga0068856_100172230 3300005614 Bacteria 2177
302 Ga0070702_100005045 3300005615 Bacteria 6101
303 Ga0070702_100074608 3300005615 Bacteria 2013
304 Ga0070702_100083189 3300005615 Bacteria 1922
305 Ga0070702_100351757 3300005615 Bacteria 1038
306 Ga0070702_100426519 3300005615 Bacteria 956
307 Ga0068852_100013672 3300005616 Bacteria 6218
308 Ga0068852_100057047 3300005616 Bacteria 3378
309 Ga0068852_100363435 3300005616 Bacteria 1416
310 Ga0068859_100005562 3300005617 Bacteria 12835
311 Ga0068859_100052175 3300005617 Bacteria 4111
312 Ga0068859_100315399 3300005617 Bacteria 1657
313 Ga0068859_100368890 3300005617 Bacteria 1531
314 Ga0068859_100524675 3300005617 Unclassified 1279
315 Ga0068864_100009783 3300005618 Bacteria 7905
316 Ga0068864_100019686 3300005618 Bacteria 5644
317 Ga0068864_100088825 3300005618 Bacteria 2722
318 Ga0068864_100536979 3300005618 Bacteria 1129
319 Ga0068866_10047771 3300005718 Bacteria 2160
320 Ga0068866_10115925 3300005718 Bacteria 1502
321 Ga0068861_100000215 3300005719 Bacteria 31072
322 Ga0068861_100020438 3300005719 Bacteria 4743
323 Ga0068861_100065067 3300005719 Bacteria 2807
324 Ga0068861_100114297 3300005719 Bacteria 2167
325 Ga0068861_100127163 3300005719 Bacteria 2064
326 Ga0068861_100197654 3300005719 Bacteria 1686
327 Ga0068861_100414240 3300005719 Bacteria 1199
328 Ga0068870_10005277 3300005840 Bacteria 5629
329 Ga0068870_10075049 3300005840 Bacteria 1854
330 Ga0068870_10307629 3300005840 Bacteria 1003
331 Ga0068863_100011479 3300005841 Bacteria 8566
332 Ga0068863_100620379 3300005841 Bacteria 1071
333 Ga0068858_100012272 3300005842 Bacteria 8080
334 Ga0068858_100014856 3300005842 Bacteria 7325
335 Ga0068858_100062959 3300005842 Bacteria 3431
336 Ga0068860_100005361 3300005843 Bacteria 13014
337 Ga0068860_100006217 3300005843 Bacteria 12008
338 Ga0068860_100172082 3300005843 Bacteria 2092
339 Ga0068860_100364306 3300005843 Bacteria 1425
340 Ga0068860_100385768 3300005843 Bacteria 1383
341 Ga0068860_100411011 3300005843 Bacteria 1340
342 Ga0068860_100446116 3300005843 Bacteria 1286
343 Ga0068860_100468211 3300005843 Bacteria 1255
344 Ga0068860_100624064 3300005843 Bacteria 1084
345 Ga0068862_100000487 3300005844 Bacteria 42413
346 Ga0068862_100004802 3300005844 Bacteria 11378
347 Ga0068862_100005359 3300005844 Bacteria 10743
348 Ga0068862_100007938 3300005844 Bacteria 8778
349 Ga0068862_100008356 3300005844 Bacteria 8566
350 Ga0068862_100482258 3300005844 Bacteria 1174
351 Ga0081455_10009207 3300005937 Bacteria 10175
352 Ga0081455_10012540 3300005937 Bacteria 8456
353 Ga0081538_10002955 3300005981 Bacteria 16226
354 Ga0081540_1009165 3300005983 Bacteria 6828
355 Ga0081540_1022020 3300005983 Bacteria 3772
356 Ga0081539_10000005 3300005985 Bacteria 549026
357 Ga0081539_10010818 3300005985 Bacteria 7339
358 Ga0070717_10030630 3300006028 Bacteria 4322
359 Ga0070717_10031603 3300006028 Bacteria 4260
360 Ga0070717_10076240 3300006028 Bacteria 2806
361 Ga0070717_10081475 3300006028 Bacteria 2717
362 Ga0070717_10259026 3300006028 Bacteria 1539
363 Ga0070717_10445543 3300006028 Bacteria 1166
364 Ga0075365_10059939 3300006038 Bacteria 2538
365 Ga0075365_10209186 3300006038 Bacteria 1367
366 Ga0075364_10141433 3300006051 Bacteria 1619
367 Ga0070715_10033522 3300006163 Unclassified 2099
368 Ga0070715_10199334 3300006163 Bacteria 1016
369 Ga0070716_100011844 3300006173 Bacteria 4401
370 Ga0070716_100013575 3300006173 Bacteria 4155
371 Ga0070716_100066523 3300006173 Bacteria 2102
372 Ga0070712_100002462 3300006175 Bacteria 11411
373 Ga0070712_100074986 3300006175 Bacteria 2432
374 Ga0070712_100198168 3300006175 Bacteria 1576
375 Ga0070712_100202754 3300006175 Bacteria 1559
376 Ga0075362_10032693 3300006177 Bacteria 2259
377 Ga0075367_10038686 3300006178 Bacteria 2777
378 Ga0075366_10020461 3300006195 Bacteria 3840
379 Ga0097621_100000655 3300006237 Bacteria 24396
380 Ga0097621_100000712 3300006237 Bacteria 23346
381 Ga0097621_100001381 3300006237 Bacteria 16690
382 Ga0097621_100009385 3300006237 Bacteria 7099
383 Ga0097621_100075788 3300006237 Unclassified 2789
384 Ga0097621_100109456 3300006237 Bacteria 2334
385 Ga0075370_10018571 3300006353 Bacteria 3775
386 Ga0068871_100000128 3300006358 Bacteria 48140
387 Ga0068871_100004305 3300006358 Bacteria 9886
388 Ga0068871_100006933 3300006358 Bacteria 8071
389 Ga0068871_100009068 3300006358 Bacteria 7185
390 Ga0068871_100034070 3300006358 Bacteria 4038
391 Ga0068871_100202301 3300006358 Bacteria 1715
392 Ga0075428_100000470 3300006844 Bacteria 40579
393 Ga0075428_100001407 3300006844 Bacteria 25617
394 Ga0075428_100004438 3300006844 Bacteria 15494
395 Ga0075428_100035695 3300006844 Bacteria 5479
396 Ga0075428_100044380 3300006844 Bacteria 4885
397 Ga0075428_100091286 3300006844 Bacteria 3322
398 Ga0075428_100093715 3300006844 Bacteria 3274
399 Ga0075428_100190009 3300006844 Bacteria 2221
400 Ga0075428_100315065 3300006844 Bacteria 1682
401 Ga0075430_100000104 3300006846 Bacteria 50931
402 Ga0075430_100002874 3300006846 Bacteria 14412
403 Ga0075430_100027546 3300006846 Bacteria 4827
404 Ga0075430_100028790 3300006846 Bacteria 4718
405 Ga0075430_100094421 3300006846 Bacteria 2500
406 Ga0075430_100217736 3300006846 Bacteria 1584
407 Ga0075430_100330233 3300006846 Bacteria 1260
408 Ga0075430_100483120 3300006846 Bacteria 1022
409 Ga0075431_100001472 3300006847 Bacteria 21746
410 Ga0075431_100002983 3300006847 Bacteria 16384
411 Ga0075431_100012897 3300006847 Bacteria 8435
412 Ga0075431_100021273 3300006847 Bacteria 6629
413 Ga0075431_100032096 3300006847 Bacteria 5412
414 Ga0075431_100040701 3300006847 Bacteria 4789
415 Ga0075431_100053715 3300006847 Bacteria 4153
416 Ga0075431_100058876 3300006847 Bacteria 3964
417 Ga0075431_100066441 3300006847 Bacteria 3723
418 Ga0075431_100068550 3300006847 Bacteria 3661
419 Ga0075431_100076627 3300006847 Bacteria 3451
420 Ga0075431_100080694 3300006847 Bacteria 3359
421 Ga0075431_100151068 3300006847 Bacteria 2391
422 Ga0075431_100186840 3300006847 Bacteria 2125
423 Ga0075431_100324220 3300006847 Bacteria 1552
424 Ga0075431_100328467 3300006847 Bacteria 1541
425 Ga0075431_100410262 3300006847 Bacteria 1355
426 Ga0075431_100482244 3300006847 Bacteria 1233
427 Ga0075433_10001635 3300006852 Bacteria 16632
428 Ga0075433_10011551 3300006852 Bacteria 7113
429 Ga0075433_10022370 3300006852 Bacteria 5307
430 Ga0075433_10041400 3300006852 Bacteria 3991
431 Ga0075433_10050516 3300006852 Bacteria 3620
432 Ga0075433_10056028 3300006852 Bacteria 3443
433 Ga0075433_10125059 3300006852 Bacteria 2284
434 Ga0075433_10334463 3300006852 Bacteria 1339
435 Ga0075433_10362395 3300006852 Bacteria 1280
436 Ga0075433_10483842 3300006852 Bacteria 1090
437 Ga0075434_100000469 3300006871 Bacteria 30196
438 Ga0075434_100015709 3300006871 Bacteria 7265
439 Ga0075434_100022371 3300006871 Bacteria 6157
440 Ga0075434_100035465 3300006871 Bacteria 4931
441 Ga0075434_100049436 3300006871 Bacteria 4175
442 Ga0075434_100068018 3300006871 Bacteria 3548
443 Ga0075434_100069888 3300006871 Bacteria 3501
444 Ga0075434_100071588 3300006871 Bacteria 3458
445 Ga0075434_100192190 3300006871 Bacteria 2062
446 Ga0075434_100378399 3300006871 Bacteria 1436
447 Ga0075434_100389325 3300006871 Bacteria 1415
448 Ga0075434_100416613 3300006871 Bacteria 1364
449 Ga0075434_100666726 3300006871 Bacteria 1058
450 Ga0075429_100001259 3300006880 Bacteria 20601
451 Ga0075429_100013498 3300006880 Bacteria 7087
452 Ga0075429_100020898 3300006880 Bacteria 5680
453 Ga0075429_100027791 3300006880 Bacteria 4910
454 Ga0075429_100033913 3300006880 Bacteria 4435
455 Ga0075429_100138986 3300006880 Bacteria 2126
456 Ga0075429_100174171 3300006880 Bacteria 1885
457 Ga0075429_100220591 3300006880 Bacteria 1661
458 Ga0075429_100370296 3300006880 Unclassified 1254
459 Ga0075429_100485962 3300006880 Bacteria 1082
460 Ga0075429_100491243 3300006880 Bacteria 1075
461 Ga0068865_100004568 3300006881 Bacteria 8355
462 Ga0068865_100084502 3300006881 Bacteria 2287
463 Ga0068865_100222464 3300006881 Unclassified 1476
464 Ga0075436_100004214 3300006914 Bacteria 9869
465 Ga0075436_100010262 3300006914 Bacteria 6411
466 Ga0075436_100010910 3300006914 Bacteria 6235
467 Ga0075436_100013523 3300006914 Bacteria 5590
468 Ga0075436_100031727 3300006914 Bacteria 3640
469 Ga0075436_100124658 3300006914 Bacteria 1804
470 Ga0075436_100138472 3300006914 Bacteria 1710
471 Ga0097620_100005562 3300006931 Bacteria 12835
472 Ga0097620_100052175 3300006931 Bacteria 4111
473 Ga0097620_100315384 3300006931 Bacteria 1657
474 Ga0097620_100368908 3300006931 Bacteria 1531
475 Ga0097620_100524687 3300006931 Unclassified 1279
476 Ga0075435_100009432 3300007076 Bacteria 7066
477 Ga0075435_100016130 3300007076 Bacteria 5628
478 Ga0075435_100016853 3300007076 Bacteria 5516
479 Ga0075435_100083146 3300007076 Bacteria 2632
480 Ga0075435_100137537 3300007076 Bacteria 2047
481 Ga0075435_100167259 3300007076 Bacteria 1854
482 Ga0075435_100424984 3300007076 Bacteria 1144
483 Ga0075435_100523447 3300007076 Bacteria 1026
484 Ga0075435_100630789 3300007076 Bacteria 930
485 Ga0099794_10000310 3300007265 Bacteria 16625
486 Ga0099794_10013939 3300007265 Bacteria 3510
487 Ga0105240_10003938 3300009093 Bacteria 22942
488 Ga0105240_10004517 3300009093 Bacteria 21153
489 Ga0105240_10019165 3300009093 Bacteria 9148
490 Ga0105240_10168563 3300009093 Bacteria 2595
491 Ga0105240_10334195 3300009093 Bacteria 1723
492 Ga0111539_10000033 3300009094 Bacteria 154510
493 Ga0111539_10004735 3300009094 Bacteria 17776
494 Ga0111539_10006679 3300009094 Bacteria 14856
495 Ga0111539_10006843 3300009094 Bacteria 14647
496 Ga0111539_10032915 3300009094 Bacteria 6295
497 Ga0111539_10070895 3300009094 Unclassified 4113
498 Ga0111539_10077464 3300009094 Bacteria 3913
499 Ga0105245_10000523 3300009098 Bacteria 35137
500 Ga0105245_10072099 3300009098 Bacteria 3137
501 Ga0105245_10516721 3300009098 Bacteria 1212
502 Ga0105245_10565861 3300009098 Bacteria 1160
503 Ga0105245_10626589 3300009098 Unclassified 1104
504 Ga0114129_10000042 3300009147 Bacteria 107385
505 Ga0114129_10006838 3300009147 Bacteria 16206
506 Ga0114129_10015964 3300009147 Bacteria 10679
507 Ga0114129_10024796 3300009147 Bacteria 8502
508 Ga0114129_10042802 3300009147 Bacteria 6373
509 Ga0114129_10043209 3300009147 Bacteria 6341
510 Ga0114129_10065592 3300009147 Bacteria 5067
511 Ga0114129_10073438 3300009147 Bacteria 4765
512 Ga0114129_10076908 3300009147 Bacteria 4645
513 Ga0114129_10118118 3300009147 Unclassified 3653
514 Ga0114129_10166304 3300009147 Bacteria 3010
515 Ga0114129_10183534 3300009147 Bacteria 2845
516 Ga0114129_10188671 3300009147 Bacteria 2801
517 Ga0114129_10205366 3300009147 Bacteria 2666
518 Ga0114129_10318525 3300009147 Bacteria 2068
519 Ga0114129_10586621 3300009147 Bacteria 1446
520 Ga0114129_10713969 3300009147 Bacteria 1287
521 Ga0114129_11091238 3300009147 Bacteria 1000
522 Ga0114129_11193471 3300009147 Bacteria 948
523 Ga0105243_10014982 3300009148 Bacteria 5869
524 Ga0105243_10057957 3300009148 Bacteria 3086
525 Ga0105243_10067344 3300009148 Bacteria 2882
526 Ga0105243_10273085 3300009148 Bacteria 1519
527 Ga0105243_10515795 3300009148 Bacteria 1136
528 Ga0105241_10001179 3300009174 Bacteria 19931
529 Ga0105241_10045989 3300009174 Bacteria 3313
530 Ga0105241_10120680 3300009174 Bacteria 2110
531 Ga0105242_10004792 3300009176 Bacteria 10466
532 Ga0105242_10013473 3300009176 Bacteria 6322
533 Ga0105242_10056164 3300009176 Bacteria 3221
534 Ga0105242_10284374 3300009176 Unclassified 1503
535 Ga0105242_10452761 3300009176 Bacteria 1210
536 Ga0105248_10021019 3300009177 Bacteria 7232
537 Ga0105248_10121987 3300009177 Bacteria 2940
538 Ga0105248_10624575 3300009177 Bacteria 1216
539 Ga0105238_10003209 3300009551 Bacteria 16328
540 Ga0105238_10285683 3300009551 Bacteria 1632
541 Ga0105238_10553300 3300009551 Bacteria 1155
542 Ga0105249_10052101 3300009553 Bacteria 3736
543 Ga0105249_10059101 3300009553 Bacteria 3515
544 Ga0105249_10082803 3300009553 Bacteria 2985
545 Ga0105249_10122364 3300009553 Bacteria 2474
546 Ga0105249_10349543 3300009553 Bacteria 1497
547 Ga0099796_10037372 3300010159 Bacteria 1623
548 Ga0099796_10134529 3300010159 Bacteria 961
549 Ga0105239_10051935 3300010375 Bacteria 4494
550 Ga0105239_10109037 3300010375 Bacteria 3067
551 Ga0105239_10177529 3300010375 Bacteria 2382
552 Ga0105239_10183842 3300010375 Bacteria 2339
553 Ga0105239_10213971 3300010375 Bacteria 2160
554 Ga0105239_10240618 3300010375 Bacteria 2031
555 Ga0105246_10017101 3300011119 Bacteria 4606
556 Ga0105246_10176928 3300011119 Bacteria 1639
557 Ga0157373_10004022 3300013100 Bacteria 11085
558 Ga0157373_10253554 3300013100 Bacteria 1245
559 Ga0157371_10083170 3300013102 Bacteria 2266
560 Ga0157370_10201223 3300013104 Bacteria 1848
561 Ga0157369_10000253 3300013105 Bacteria 73101
562 Ga0157369_10135847 3300013105 Bacteria 2604
563 Ga0157369_10428501 3300013105 Bacteria 1371
564 Ga0157374_10000185 3300013296 Bacteria 58240
565 Ga0157374_10000555 3300013296 Bacteria 33308
566 Ga0157374_10083217 3300013296 Bacteria 3040
567 Ga0157378_10000245 3300013297 Bacteria 53230
568 Ga0157378_10000256 3300013297 Bacteria 52148
569 Ga0157378_10013281 3300013297 Bacteria 7201
570 Ga0157378_10341480 3300013297 Bacteria 1460
571 Ga0157378_10565132 3300013297 Bacteria 1145
572 Ga0163162_10042496 3300013306 Bacteria 4549
573 Ga0163162_10274934 3300013306 Bacteria 1816
574 Ga0163162_10991681 3300013306 Bacteria 949
575 Ga0157372_10000310 3300013307 Bacteria 53854
576 Ga0157372_10000704 3300013307 Bacteria 36761
577 Ga0157372_10006181 3300013307 Bacteria 12733
578 Ga0157372_10444242 3300013307 Unclassified 1512
579 Ga0157375_10060541 3300013308 Bacteria 3755
580 Ga0157375_10103512 3300013308 Bacteria 2934
581 Ga0157375_10103719 3300013308 Bacteria 2931
582 Ga0157375_10103752 3300013308 Bacteria 2931
583 Ga0157375_10233222 3300013308 Bacteria 1999
584 Ga0157375_10404091 3300013308 Bacteria 1532
585 Ga0157375_10432545 3300013308 Bacteria 1482
586 Ga0157375_10747566 3300013308 Bacteria 1129
587 Ga0163163_10000629 3300014325 Bacteria 30399
588 Ga0163163_10010981 3300014325 Bacteria 8185
589 Ga0163163_10013691 3300014325 Bacteria 7431
590 Ga0163163_10648426 3300014325 Bacteria 1119
591 Ga0157380_10000622 3300014326 Bacteria 21784
592 Ga0157380_10018733 3300014326 Bacteria 5145
593 Ga0157380_10128589 3300014326 Bacteria 2157
594 Ga0182008_10063456 3300014497 Bacteria 1820
595 Ga0157377_10204822 3300014745 Bacteria 1255
596 Ga0157379_10466371 3300014968 Bacteria 1167
597 Ga0157376_10061590 3300014969 Bacteria 3155
598 Ga0157376_10112309 3300014969 Bacteria 2400
599 Ga0157376_10185298 3300014969 Unclassified 1905
600 Ga0163161_10013549 3300017792 Bacteria 5676
601 Ga0163161_10019586 3300017792 Bacteria 4747
602 Ga0213872_10191890 3300021361 Bacteria 879
603 Ga0213874_10054643 3300021377 Bacteria 1235
604 Ga0213875_10000031 3300021388 Bacteria 176367
605 Ga0213875_10011074 3300021388 Bacteria 4500
606 Ga0213875_10031100 3300021388 Bacteria 2526
607 Ga0213871_10003108 3300021441 Bacteria 3158
608 Ga0213871_10010785 3300021441 Bacteria 2082
609 Ga0207425_1001394 3300025245 Bacteria 10201
610 Ga0209129_1000038 3300025258 Bacteria 322778
611 Ga0209673_1006212 3300025273 Bacteria 5829
612 Ga0209564_1000162 3300025295 Bacteria 162265
613 Ga0209758_1000152 3300025297 Bacteria 162418
614 Ga0209758_1000268 3300025297 Bacteria 103231
615 Ga0209050_1000634 3300025298 Bacteria 54624
616 Ga0209051_1018684 3300025303 Bacteria 3058
617 Ga0207653_10044668 3300025885 Bacteria 1461
618 Ga0207682_10001827 3300025893 Bacteria 9687
619 Ga0207682_10002442 3300025893 Bacteria 8338
620 Ga0207682_10006763 3300025893 Bacteria 4604
621 Ga0207692_10033945 3300025898 Bacteria 2467
622 Ga0207692_10068775 3300025898 Bacteria 1858
623 Ga0207642_10090708 3300025899 Bacteria 1509
624 Ga0207642_10263416 3300025899 Bacteria 984
625 Ga0207680_10091210 3300025903 Bacteria 1938
626 Ga0207680_10253565 3300025903 Bacteria 1216
627 Ga0207685_10083535 3300025905 Unclassified 1328
628 Ga0207685_10132727 3300025905 Bacteria 1107
629 Ga0207699_10068254 3300025906 Bacteria 2165
630 Ga0207699_10097440 3300025906 Bacteria 1859
631 Ga0207699_10188398 3300025906 Bacteria 1391
632 Ga0207699_10254006 3300025906 Bacteria 1212
633 Ga0207645_10003940 3300025907 Bacteria 11084
634 Ga0207645_10007209 3300025907 Bacteria 7877
635 Ga0207645_10047526 3300025907 Bacteria 2740
636 Ga0207645_10048214 3300025907 Bacteria 2720
637 Ga0207645_10085051 3300025907 Bacteria 2030
638 Ga0207645_10086119 3300025907 Bacteria 2018
639 Ga0207645_10143787 3300025907 Bacteria 1554
640 Ga0207643_10007922 3300025908 Bacteria 5702
641 Ga0207643_10021697 3300025908 Bacteria 3531
642 Ga0207643_10042997 3300025908 Bacteria 2548
643 Ga0207643_10047414 3300025908 Bacteria 2431
644 Ga0207684_10004374 3300025910 Bacteria 13343
645 Ga0207684_10018218 3300025910 Bacteria 6014
646 Ga0207684_10041285 3300025910 Bacteria 3912
647 Ga0207684_10050770 3300025910 Bacteria 3519
648 Ga0207684_10127314 3300025910 Bacteria 2186
649 Ga0207684_10141148 3300025910 Bacteria 2071
650 Ga0207684_10292087 3300025910 Bacteria 1405
651 Ga0207684_10391272 3300025910 Bacteria 1195
652 Ga0207684_10616467 3300025910 Bacteria 926
653 Ga0207654_10023921 3300025911 Bacteria 3278
654 Ga0207654_10453108 3300025911 Bacteria 900
655 Ga0207707_10000116 3300025912 Bacteria 81364
656 Ga0207707_10002125 3300025912 Bacteria 17942
657 Ga0207707_10009719 3300025912 Bacteria 8343
658 Ga0207707_10151516 3300025912 Bacteria 2027
659 Ga0207707_10389240 3300025912 Bacteria 1198
660 Ga0207707_10425421 3300025912 Bacteria 1138
661 Ga0207695_10013936 3300025913 Bacteria 9557
662 Ga0207695_10064783 3300025913 Bacteria 3760
663 Ga0207695_10213574 3300025913 Bacteria 1839
664 Ga0207695_10355295 3300025913 Bacteria 1352
665 Ga0207693_10001378 3300025915 Bacteria 21558
666 Ga0207693_10003875 3300025915 Bacteria 12745
667 Ga0207693_10009321 3300025915 Bacteria 8004
668 Ga0207693_10081766 3300025915 Bacteria 2529
669 Ga0207693_10421476 3300025915 Bacteria 1043
670 Ga0207663_10032599 3300025916 Bacteria 3094
671 Ga0207663_10064800 3300025916 Bacteria 2333
672 Ga0207663_10391143 3300025916 Bacteria 1061
673 Ga0207663_10433675 3300025916 Unclassified 1011
674 Ga0207663_10441364 3300025916 Bacteria 1002
675 Ga0207660_10002889 3300025917 Bacteria 11226
676 Ga0207660_10003241 3300025917 Bacteria 10654
677 Ga0207660_10027825 3300025917 Bacteria 3862
678 Ga0207660_10065156 3300025917 Bacteria 2632
679 Ga0207660_10075335 3300025917 Bacteria 2465
680 Ga0207660_10090695 3300025917 Bacteria 2265
681 Ga0207660_10107783 3300025917 Bacteria 2091
682 Ga0207660_10154842 3300025917 Bacteria 1764
683 Ga0207662_10021154 3300025918 Bacteria 3715
684 Ga0207662_10036540 3300025918 Bacteria 2872
685 Ga0207662_10050184 3300025918 Bacteria 2478
686 Ga0207662_10187918 3300025918 Bacteria 1332
687 Ga0207657_10002084 3300025919 Bacteria 21638
688 Ga0207649_10001837 3300025920 Bacteria 12126
689 Ga0207652_10003098 3300025921 Bacteria 13862
690 Ga0207652_10003188 3300025921 Bacteria 13630
691 Ga0207646_10005516 3300025922 Bacteria 13296
692 Ga0207646_10006384 3300025922 Bacteria 12193
693 Ga0207646_10019430 3300025922 Bacteria 6315
694 Ga0207646_10073368 3300025922 Bacteria 3057
695 Ga0207646_10083553 3300025922 Bacteria 2856
696 Ga0207646_10087386 3300025922 Bacteria 2790
697 Ga0207646_10112231 3300025922 Bacteria 2447
698 Ga0207646_10303599 3300025922 Bacteria 1442
699 Ga0207646_10366230 3300025922 Bacteria 1302
700 Ga0207681_10005697 3300025923 Bacteria 7645
701 Ga0207681_10006234 3300025923 Bacteria 7313
702 Ga0207681_10040017 3300025923 Bacteria 3116
703 Ga0207681_10046721 3300025923 Bacteria 2913
704 Ga0207681_10071471 3300025923 Bacteria 2421
705 Ga0207681_10076841 3300025923 Bacteria 2346
706 Ga0207694_10000808 3300025924 Bacteria 27977
707 Ga0207650_10000551 3300025925 Bacteria 30436
708 Ga0207650_10168712 3300025925 Bacteria 1738
709 Ga0207650_10208399 3300025925 Bacteria 1569
710 Ga0207659_10001103 3300025926 Bacteria 16006
711 Ga0207659_10021669 3300025926 Bacteria 4270
712 Ga0207659_10040215 3300025926 Bacteria 3268
713 Ga0207659_10138628 3300025926 Bacteria 1886
714 Ga0207659_10154218 3300025926 Bacteria 1797
715 Ga0207687_10034986 3300025927 Bacteria 3414
716 Ga0207687_10163810 3300025927 Unclassified 1709
717 Ga0207687_10173737 3300025927 Bacteria 1664
718 Ga0207687_10456197 3300025927 Bacteria 1061
719 Ga0207700_10106401 3300025928 Bacteria 2249
720 Ga0207700_10197787 3300025928 Bacteria 1692
721 Ga0207700_10298235 3300025928 Bacteria 1391
722 Ga0207700_10348275 3300025928 Unclassified 1289
723 Ga0207700_10369071 3300025928 Bacteria 1253
724 Ga0207664_10010521 3300025929 Bacteria 6533
725 Ga0207664_10314345 3300025929 Bacteria 1381
726 Ga0207664_10338440 3300025929 Bacteria 1330
727 Ga0207664_10447763 3300025929 Bacteria 1152
728 Ga0207644_10052722 3300025931 Bacteria 2924
729 Ga0207690_10063370 3300025932 Bacteria 2520
730 Ga0207690_10303445 3300025932 Bacteria 1250
731 Ga0207706_10005422 3300025933 Bacteria 11888
732 Ga0207706_10020088 3300025933 Bacteria 6002
733 Ga0207706_10088092 3300025933 Bacteria 2730
734 Ga0207706_10481303 3300025933 Unclassified 1073
735 Ga0207686_10046404 3300025934 Bacteria 2679
736 Ga0207686_10137838 3300025934 Bacteria 1682
737 Ga0207709_10002771 3300025935 Bacteria 10805
738 Ga0207670_10060075 3300025936 Bacteria 2588
739 Ga0207670_10100406 3300025936 Bacteria 2066
740 Ga0207670_10176697 3300025936 Bacteria 1605
741 Ga0207670_10496473 3300025936 Bacteria 990
742 Ga0207669_10011554 3300025937 Bacteria 4302
743 Ga0207669_10140907 3300025937 Bacteria 1674
744 Ga0207669_10198706 3300025937 Bacteria 1453
745 Ga0207704_10011150 3300025938 Bacteria 4413
746 Ga0207704_10015163 3300025938 Bacteria 3918
747 Ga0207704_10068996 3300025938 Bacteria 2231
748 Ga0207704_10102662 3300025938 Bacteria 1910
749 Ga0207665_10022420 3300025939 Bacteria 4154
750 Ga0207665_10025098 3300025939 Bacteria 3931
751 Ga0207665_10033065 3300025939 Bacteria 3426
752 Ga0207691_10000654 3300025940 Bacteria 34208
753 Ga0207691_10004065 3300025940 Bacteria 14192
754 Ga0207691_10010593 3300025940 Bacteria 8843
755 Ga0207691_10011146 3300025940 Bacteria 8628
756 Ga0207691_10015804 3300025940 Bacteria 7172
757 Ga0207691_10031435 3300025940 Bacteria 4955
758 Ga0207691_10094413 3300025940 Bacteria 2677
759 Ga0207691_10157805 3300025940 Bacteria 1991
760 Ga0207711_10063130 3300025941 Bacteria 3197
761 Ga0207711_10131113 3300025941 Bacteria 2248
762 Ga0207711_10174551 3300025941 Bacteria 1952
763 Ga0207711_10202260 3300025941 Bacteria 1813
764 Ga0207711_10297236 3300025941 Bacteria 1489
765 Ga0207689_10000058 3300025942 Bacteria 86234
766 Ga0207689_10002032 3300025942 Bacteria 19115
767 Ga0207689_10012451 3300025942 Bacteria 7267
768 Ga0207689_10116569 3300025942 Bacteria 2195
769 Ga0207661_10018061 3300025944 Bacteria 5236
770 Ga0207661_10046145 3300025944 Bacteria 3454
771 Ga0207661_10329958 3300025944 Bacteria 1373
772 Ga0207661_10437998 3300025944 Bacteria 1189
773 Ga0207679_10002446 3300025945 Bacteria 11435
774 Ga0207679_10214720 3300025945 Bacteria 1615
775 Ga0207679_10265414 3300025945 Bacteria 1466
776 Ga0207679_10445513 3300025945 Bacteria 1147
777 Ga0207667_10000302 3300025949 Bacteria 68245
778 Ga0207667_10000342 3300025949 Bacteria 63745
779 Ga0207667_10007687 3300025949 Bacteria 12903
780 Ga0207667_10077943 3300025949 Bacteria 3435
781 Ga0207667_10878921 3300025949 Bacteria 889
782 Ga0207651_10002536 3300025960 Bacteria 8722
783 Ga0207651_10026438 3300025960 Bacteria 3626
784 Ga0207651_10216807 3300025960 Bacteria 1544
785 Ga0207651_10453664 3300025960 Unclassified 1100
786 Ga0207712_10030656 3300025961 Bacteria 3617
787 Ga0207712_10067792 3300025961 Bacteria 2555
788 Ga0207712_10096187 3300025961 Bacteria 2191
789 Ga0207712_10178009 3300025961 Bacteria 1668
790 Ga0207668_10006404 3300025972 Bacteria 6960
791 Ga0207668_10076748 3300025972 Bacteria 2407
792 Ga0207668_10121854 3300025972 Bacteria 1976
793 Ga0207640_10009617 3300025981 Bacteria 5420
794 Ga0207640_10037075 3300025981 Bacteria 3065
795 Ga0207640_10083073 3300025981 Bacteria 2195
796 Ga0207640_10224167 3300025981 Bacteria 1441
797 Ga0207658_10006276 3300025986 Bacteria 8125
798 Ga0207677_10045251 3300026023 Bacteria 2938
799 Ga0207677_10047631 3300026023 Bacteria 2880
800 Ga0207677_10178073 3300026023 Bacteria 1670
801 Ga0207703_10009410 3300026035 Bacteria 7677
802 Ga0207703_10065489 3300026035 Bacteria 2987
803 Ga0207703_10112267 3300026035 Bacteria 2328
804 Ga0207639_10013319 3300026041 Bacteria 5753
805 Ga0207639_10104608 3300026041 Bacteria 2295
806 Ga0207678_10000501 3300026067 Bacteria 35486
807 Ga0207708_10030161 3300026075 Bacteria 4113
808 Ga0207708_10035592 3300026075 Bacteria 3789
809 Ga0207708_10075312 3300026075 Bacteria 2588
810 Ga0207708_10090592 3300026075 Bacteria 2357
811 Ga0207708_10094789 3300026075 Bacteria 2304
812 Ga0207708_10124614 3300026075 Bacteria 2010
813 Ga0207708_10204446 3300026075 Bacteria 1576
814 Ga0207708_10341087 3300026075 Bacteria 1227
815 Ga0207708_10401329 3300026075 Bacteria 1134
816 Ga0207702_10001675 3300026078 Bacteria 21899
817 Ga0207702_10007641 3300026078 Bacteria 9202
818 Ga0207702_10219058 3300026078 Bacteria 1773
819 Ga0207702_10507216 3300026078 Bacteria 1176
820 Ga0207641_10011020 3300026088 Bacteria 7415
821 Ga0207641_10016259 3300026088 Bacteria 6094
822 Ga0207641_10317891 3300026088 Bacteria 1475
823 Ga0207641_10333839 3300026088 Unclassified 1441
824 Ga0207641_10555287 3300026088 Bacteria 1120
825 Ga0207648_10000911 3300026089 Bacteria 33297
826 Ga0207648_10002647 3300026089 Bacteria 19109
827 Ga0207648_10005445 3300026089 Bacteria 12824
828 Ga0207648_10006801 3300026089 Bacteria 11336
829 Ga0207648_10017555 3300026089 Bacteria 6503
830 Ga0207648_10062711 3300026089 Bacteria 3240
831 Ga0207648_10171772 3300026089 Bacteria 1916
832 Ga0207648_10274668 3300026089 Bacteria 1506
833 Ga0207648_10399345 3300026089 Bacteria 1245
834 Ga0207648_10479842 3300026089 Bacteria 1135
835 Ga0207648_10698200 3300026089 Bacteria 940
836 Ga0207676_10006658 3300026095 Bacteria 8169
837 Ga0207676_10240206 3300026095 Bacteria 1625
838 Ga0207674_10002881 3300026116 Bacteria 21377
839 Ga0207674_10036930 3300026116 Bacteria 5084
840 Ga0207674_10042118 3300026116 Bacteria 4719
841 Ga0207674_10622043 3300026116 Bacteria 1043
842 Ga0207675_100003808 3300026118 Bacteria 14700
843 Ga0207675_100015304 3300026118 Bacteria 7157
844 Ga0207675_100023622 3300026118 Bacteria 5719
845 Ga0207675_100027113 3300026118 Bacteria 5335
846 Ga0207675_100039299 3300026118 Bacteria 4416
847 Ga0207675_100061603 3300026118 Bacteria 3502
848 Ga0207675_100101064 3300026118 Bacteria 2717
849 Ga0207675_100419755 3300026118 Bacteria 1321
850 Ga0207683_10074474 3300026121 Bacteria 3003
851 Ga0207683_10106798 3300026121 Bacteria 2504
852 Ga0207683_10209681 3300026121 Bacteria 1773
853 Ga0207683_10362433 3300026121 Bacteria 1331
854 Ga0207698_10007876 3300026142 Bacteria 6706
855 Ga0207698_10286670 3300026142 Bacteria 1526
856 Ga0207698_10316826 3300026142 Bacteria 1459
857 Ga0209969_1004713 3300027360 Bacteria 1905
858 Ga0210000_1001017 3300027462 Bacteria 3910
859 Ga0210000_1006743 3300027462 Bacteria 1674
860 Ga0209982_1012689 3300027552 Bacteria 1266
861 Ga0209588_1003957 3300027671 Bacteria 4144
862 Ga0209588_1034994 3300027671 Bacteria 1614
863 Ga0209974_10011645 3300027876 Bacteria 2951
864 Ga0207428_10000001 3300027907 Bacteria 1034622
865 Ga0207428_10000214 3300027907 Bacteria 80012
866 Ga0207428_10000794 3300027907 Bacteria 35722
867 Ga0207428_10030615 3300027907 Bacteria 4448
868 Ga0207428_10394614 3300027907 Bacteria 1014
869 Ga0268266_10006285 3300028379 Bacteria 10894
870 Ga0268266_10088977 3300028379 Bacteria 2703
871 Ga0268265_10000291 3300028380 Bacteria 56604
872 Ga0268265_10011760 3300028380 Bacteria 5920
873 Ga0268265_10026086 3300028380 Bacteria 4154
874 Ga0268265_10037529 3300028380 Bacteria 3557
875 Ga0268265_10079564 3300028380 Bacteria 2582
876 Ga0268265_10092699 3300028380 Bacteria 2418
877 Ga0268265_10710430 3300028380 Bacteria 972
878 Ga0268264_10010180 3300028381 Bacteria 7783
879 Ga0268264_10011418 3300028381 Bacteria 7336
880 Ga0268264_10102819 3300028381 Bacteria 2487
881 Ga0268264_10283031 3300028381 Unclassified 1554
882 Ga0268264_10283953 3300028381 Bacteria 1552
883 Ga0268264_10340659 3300028381 Bacteria 1424
884 Ga0268264_10378744 3300028381 Bacteria 1354
885 Ga0265323_10030400 3300028653 Bacteria 2012
886 Ga0265336_10005326 3300028666 Bacteria 4763
887 Ga0307515_10000567 3300028794 Bacteria 87086
888 Ga0307515_10001764 3300028794 Bacteria 48206
889 Ga0307515_10017612 3300028794 Bacteria 12995
890 Ga0307515_10154994 3300028794 Bacteria 2370
891 Ga0265338_10116832 3300028800 Bacteria 2136
892 Ga0265338_10179064 3300028800 Bacteria 1618
893 Ga0265338_10272559 3300028800 Bacteria 1240
894 Ga0307511_10110826 3300030521 Bacteria 1747
895 Ga0307512_10056794 3300030522 Bacteria 3069
896 Ga0307512_10152899 3300030522 Bacteria 1374
897 Ga0307512_10180443 3300030522 Bacteria 1187
898 Ga0265330_10034444 3300031235 Bacteria 2262
899 Ga0265320_10006970 3300031240 Bacteria 7050
900 Ga0265339_10001307 3300031249 Bacteria 18672
901 Ga0265331_10061874 3300031250 Bacteria 1767
902 Ga0307513_10019225 3300031456 Bacteria 8137
903 Ga0307513_10023508 3300031456 Bacteria 7198
904 Ga0307513_10025089 3300031456 Bacteria 6918
905 Ga0307513_10028304 3300031456 Bacteria 6410
906 Ga0307513_10029096 3300031456 Bacteria 6305
907 Ga0307513_10060082 3300031456 Bacteria 4031
908 Ga0307513_10141846 3300031456 Bacteria 2328
909 Ga0307513_10148595 3300031456 Bacteria 2257
910 Ga0307513_10286647 3300031456 Bacteria 1421
911 Ga0307509_10018664 3300031507 Bacteria 7945
912 Ga0307408_100056367 3300031548 Bacteria 2850
913 Ga0307408_100321120 3300031548 Bacteria 1304
914 Ga0307408_100469400 3300031548 Bacteria 1095
915 Ga0307408_100580272 3300031548 Bacteria 993
916 Ga0307508_10000133 3300031616 Bacteria 87867
917 Ga0307514_10038864 3300031649 Bacteria 3761
918 Ga0265314_10019470 3300031711 Bacteria 5260
919 Ga0265342_10007004 3300031712 Bacteria 8327
920 Ga0307516_10000747 3300031730 Bacteria 44219
921 Ga0307516_10002063 3300031730 Bacteria 27367
922 Ga0307405_10233057 3300031731 Bacteria 1358
923 Ga0307413_10011267 3300031824 Bacteria 4386
924 Ga0307518_10215546 3300031838 Bacteria 1259
925 Ga0307410_10002475 3300031852 Bacteria 8924
926 Ga0307406_10056580 3300031901 Bacteria 2512
927 Ga0307407_10319380 3300031903 Bacteria 1089
928 Ga0307412_10021440 3300031911 Bacteria 3947
929 Ga0307409_100020905 3300031995 Bacteria 4474
930 Ga0307409_100042172 3300031995 Bacteria 3415
931 Ga0307409_100647996 3300031995 Bacteria 1050
932 Ga0307416_100042240 3300032002 Bacteria 3558
933 Ga0307416_100125061 3300032002 Bacteria 2302
934 Ga0307416_100150289 3300032002 Bacteria 2135
935 Ga0307416_100157725 3300032002 Bacteria 2092
936 Ga0307416_100359489 3300032002 Bacteria 1477
937 Ga0307416_100382521 3300032002 Bacteria 1438
938 Ga0307416_100390082 3300032002 Bacteria 1426
939 Ga0307411_10005848 3300032005 Bacteria 6097
940 Ga0307411_10046909 3300032005 Bacteria 2789
941 Ga0307411_10061891 3300032005 Bacteria 2494
942 Ga0307411_10136279 3300032005 Bacteria 1803
943 Ga0307411_10360116 3300032005 Bacteria 1189
944 Ga0307507_10034086 3300033179 Bacteria 5270
945 Ga0307510_10010883 3300033180 Bacteria 10809
946 Ga0373930_0042092 3300034816 Bacteria 976
947 Ga0373948_0002801 3300034817 Bacteria 2617
948 Ga0373940_0009756 3300035088 Bacteria 2240
949 Ga0373940_0052833 3300035088 Bacteria 1145
950 Ga0373952_0028271 3300035092 Bacteria 1229
951 Ga0373939_0060273 3300035114 Bacteria 1206
952 Ga0373953_0004130 3300035117 Unclassified 4605
953 Ga0373953_0008528 3300035117 Bacteria 3485
954 Ga0373953_0018486 3300035117 Bacteria 2580
955 Ga0373953_0092861 3300035117 Unclassified 1264
956 Ga0373954_0000006 3300035118 Bacteria 98573
957 Ga0373954_0013401 3300035118 Bacteria 3654
958 Ga0373954_0063985 3300035118 Bacteria 1739
959 Ga0373954_0253192 3300035118 Unclassified 867
960 Ga0373956_0022127 3300035119 Bacteria 2717
961 Ga0373957_0007206 3300035120 Bacteria 3549
962 Ga0373957_0026624 3300035120 Bacteria 2094
963 Ga0373955_0022552 3300035172 Bacteria 3195
964 Ga0373955_0032155 3300035172 Bacteria 2752
965 Ga0373942_0037600 3300035207 Bacteria 1309
966 Ga0373961_0010428 3300035241 Bacteria 2290
967 Ga0373924_0016868 3300035410 Bacteria 2793
968 Ga0373924_0040131 3300035410 Bacteria 1915
969 Ga0373924_0051486 3300035410 Bacteria 1707
970 Ga0373924_0105168 3300035410 Bacteria 1217
971 Ga0373931_0008116 3300035691 Bacteria 4973
972 Ga0373931_0152358 3300035691 Bacteria 1349
973 Ga0373931_0230415 3300035691 Bacteria 1119
974 Ga0373927_0054967 3300035695 Bacteria 2575
975 Ga0373927_0094975 3300035695 Bacteria 1938
976 Ga0373933_0002554 3300035724 Bacteria 10210
977 Ga0373933_0006374 3300035724 Bacteria 6421
978 Ga0373933_0088149 3300035724 Bacteria 1912
979 Ga0373937_0000595 3300036401 Bacteria 32029
980 Ga0373937_0004857 3300036401 Bacteria 11425
981 Ga0373937_0014930 3300036401 Bacteria 6859
982 Ga0373937_0019178 3300036401 Bacteria 6122
983 Ga0373937_0064219 3300036401 Bacteria 3377
984 Ga0373937_0093528 3300036401 Unclassified 2788
985 Ga0373937_0099029 3300036401 Bacteria 2704
986 Ga0373937_0222136 3300036401 Bacteria 1778
987 Ga0373937_0304898 3300036401 Bacteria 1506
988 Ga0373937_0612699 3300036401 Bacteria 1033
989 Ga0373937_0713218 3300036401 Bacteria 950
990 Ga0373925_0033853 3300037068 Bacteria 3765
991 Ga0373925_0036520 3300037068 Bacteria 3626
992 Ga0373925_0128455 3300037068 Bacteria 1974
993 Ga0373925_0187086 3300037068 Unclassified 1642
994 Ga0373925_0224930 3300037068 Unclassified 1499
995 Ga0373925_0278656 3300037068 Unclassified 1346
996 Ga0373925_0328246 3300037068 Bacteria 1239
997 Ga0395899_0009901 3300037312 Bacteria 7311
998 Ga0395900_0007096 3300037418 Bacteria 11609
999 Ga0395900_0008202 3300037418 Bacteria 10752
1000 Ga0395900_0061683 3300037418 Bacteria 3855
1001 Ga0395900_0110984 3300037418 Bacteria 2817
1002 Ga0395898_0009370 3300037466 Bacteria 10284
1003 Ga0395898_0124971 3300037466 Bacteria 2464
1004 Ga0395905_0031024 3300037471 Bacteria 5034
1005 Ga0395905_0439309 3300037471 Bacteria 1202
1006 Ga0436364_0143816 3300037853 Unclassified 1877
1007 Ga0436364_0257301 3300037853 Bacteria 1674
1008 Ga0436364_0793438 3300037853 Bacteria 64960
1009 Ga0436364_0818873 3300037853 Unclassified 2373
1010 Ga0436364_1066269 3300037853 Bacteria 2123
1011 Ga0436364_1318842 3300037853 Bacteria 1250
1012 Ga0395901_0004642 3300038443 Bacteria 13858
1013 Ga0395901_0012050 3300038443 Bacteria 8771
1014 Ga0395901_0013096 3300038443 Bacteria 8417
1015 Ga0395901_0068491 3300038443 Bacteria 3697
1016 Ga0436365_0177547 3300039437 Bacteria 6176
1017 Ga0436365_0425373 3300039437 Bacteria 2395
1018 Ga0436365_0681786 3300039437 Bacteria 3529
1019 Ga0436365_0868950 3300039437 Bacteria 3012
1020 Ga0436360_0061449 3300039438 Bacteria 894
1021 Ga0436360_0486209 3300039438 Unclassified 1010
1022 Ga0436360_0793917 3300039438 Bacteria 2689
1023 Ga0436360_1074955 3300039438 Bacteria 1653
1024 Ga0436360_1280092 3300039438 Bacteria 3781
1025 Ga0436360_1290437 3300039438 Bacteria 3382
1026 Ga0436361_1006987 3300039447 Bacteria 1752
1027 Ga0436363_0911403 3300039450 Bacteria 1237
1028 Ga0436363_1073413 3300039450 Bacteria 6104
1029 Ga0436362_0481759 3300039453 Unclassified 1365
1030 Ga0436362_1028638 3300039453 Bacteria 2409
1031 Ga0451793_1545139 3300041452 Bacteria 1558
1032 Ga0451802_1112197 3300041460 Bacteria 1514
1033 Ga0451807_0499581 3300041486 Bacteria 2671
1034 Ga0451807_1253711 3300041486 Bacteria 5473
1035 Ga0451849_0276976 3300041505 Bacteria 1604
1036 Ga0451851_0523242 3300041507 Bacteria 1921
1037 Ga0439431_0016250 3300041997 Bacteria 1740
1038 Ga0439441_006088 3300042001 Bacteria 1899
1039 Ga0439441_016519 3300042001 Bacteria 1317
1040 Ga0439448_0001756 3300042005 Bacteria 5729
1041 Ga0439448_0011271 3300042005 Bacteria 2663
1042 Ga0439450_009064 3300042008 Bacteria 1877
1043 Ga0439455_0013004 3300042012 Bacteria 1878
1044 Ga0450889_001382 3300042144 Bacteria 2501
1045 Ga0439458_0009129 3300042157 Bacteria 2209
1046 Ga0439459_0000152 3300042438 Bacteria 7120
1047 Ga0439464_0004171 3300042439 Bacteria 3680
1048 Ga0439460_0001159 3300042461 Bacteria 6184
1049 Ga0439460_0088558 3300042461 Bacteria 981
1050 Ga0451577_0029889 3300042876 Bacteria 4923
1051 Ga0451577_0041449 3300042876 Bacteria 4132
1052 Ga0451577_0088469 3300042876 Bacteria 2763
1053 Ga0466969_0009411 3300044656 Bacteria 5179
1054 Ga0453683_0004609 3300044673 Bacteria 9738
1055 Ga0453683_0098926 3300044673 Bacteria 1831
1056 Ga0453684_0010525 3300044712 Bacteria 15792
1057 Ga0453684_0115564 3300044712 Bacteria 3251
1058 Ga0453684_0312292 3300044712 Bacteria 1783
1059 Ga0453684_0583733 3300044712 Bacteria 1227
1060 Ga0466959_0014401 3300045049 Bacteria 5745
1061 Ga0451576_0003738 3300045051 Bacteria 20571
1062 Ga0451576_0012679 3300045051 Bacteria 9463
1063 Ga0451576_0095383 3300045051 Bacteria 3094
1064 Ga0451576_0231551 3300045051 Bacteria 1930
1065 Ga0451576_0245856 3300045051 Bacteria 1869
1066 Ga0451576_0298432 3300045051 Bacteria 1685
1067 Ga0451576_0378546 3300045051 Bacteria 1484
1068 Ga0451576_0414902 3300045051 Bacteria 1412
1069 Ga0466958_0088800 3300045836 Unclassified 1910
1070 Ga0466958_0091092 3300045836 Bacteria 1887
1071 Ga0466967_0213926 3300045976 Bacteria 1829
1072 Ga0466967_0413470 3300045976 Bacteria 1314
1073 Ga0495592_0000160 3300046454 Bacteria 59404
1074 Ga0495592_0000928 3300046454 Bacteria 20345
1075 Ga0495603_0132468 3300046455 Bacteria 1451
1076 Ga0495590_0111461 3300046457 Bacteria 977
1077 Ga0495629_0401303 3300046459 Bacteria 932
1078 Ga0495638_0001008 3300046460 Bacteria 28102
1079 Ga0495638_0043046 3300046460 Bacteria 2850
1080 Ga0495638_0103625 3300046460 Bacteria 1698
1081 Ga0495651_0079219 3300046462 Bacteria 2483
1082 Ga0495651_0109338 3300046462 Bacteria 2046
1083 Ga0495653_0316980 3300046463 Bacteria 1012
1084 Ga0495580_0037801 3300046472 Bacteria 3461
1085 Ga0495580_0077357 3300046472 Bacteria 2320
1086 Ga0495580_0104380 3300046472 Unclassified 1970
1087 Ga0495582_0015221 3300046473 Bacteria 4230
1088 Ga0495582_0055355 3300046473 Unclassified 2187
1089 Ga0495582_0147220 3300046473 Bacteria 1336
1090 Ga0495662_0009907 3300046476 Bacteria 4680
1091 Ga0495608_0001288 3300046511 Bacteria 17801
1092 Ga0495608_0015622 3300046511 Bacteria 5259
1093 Ga0495610_0055629 3300046512 Bacteria 1906
1094 Ga0495620_0070385 3300046515 Bacteria 1433
1095 Ga0495620_0090246 3300046515 Bacteria 1230
1096 Ga0495628_0001997 3300046516 Bacteria 18485
1097 Ga0495628_0049177 3300046516 Bacteria 3339
1098 Ga0495628_0179249 3300046516 Bacteria 1603
1099 Ga0495630_0001497 3300046517 Bacteria 16145
1100 Ga0495630_0010529 3300046517 Bacteria 6681
1101 Ga0495630_0077680 3300046517 Unclassified 2503
1102 Ga0495630_0157346 3300046517 Bacteria 1729
1103 Ga0495630_0315901 3300046517 Bacteria 1194
1104 Ga0495632_0024686 3300046519 Bacteria 3189
1105 Ga0495632_0054487 3300046519 Bacteria 1960
1106 Ga0495632_0141651 3300046519 Bacteria 1115
1107 Ga0495666_0001472 3300046526 Bacteria 11492
1108 Ga0495666_0020433 3300046526 Bacteria 3281
1109 Ga0495642_0116589 3300046528 Bacteria 1144
1110 Ga0495652_0050184 3300046529 Bacteria 3569
1111 Ga0495640_0000622 3300046533 Bacteria 26156
1112 Ga0495640_0041479 3300046533 Bacteria 3216
1113 Ga0495640_0086660 3300046533 Bacteria 2073
1114 Ga0495586_0001804 3300046535 Bacteria 11704
1115 Ga0495586_0011239 3300046535 Bacteria 4760
1116 Ga0495586_0011452 3300046535 Bacteria 4715
1117 Ga0495586_0022520 3300046535 Unclassified 3363
1118 Ga0495586_0173157 3300046535 Bacteria 1220
1119 Ga0495587_0016321 3300046536 Bacteria 4621
1120 Ga0495587_0055134 3300046536 Bacteria 2342
1121 Ga0495645_0056608 3300046543 Bacteria 2847
1122 Ga0495667_0004436 3300046559 Bacteria 9471
1123 Ga0495667_0008992 3300046559 Bacteria 6788
1124 Ga0495667_0036472 3300046559 Bacteria 3282
1125 Ga0495634_0004756 3300046642 Bacteria 10560
1126 Ga0495634_0048623 3300046642 Bacteria 2855
1127 Ga0495634_0075662 3300046642 Bacteria 2211
1128 Ga0495625_0000452 3300046660 Bacteria 61641
1129 Ga0495625_0005241 3300046660 Bacteria 11930
1130 Ga0495625_0034663 3300046660 Unclassified 3724
1131 Ga0495635_0018825 3300046663 Bacteria 4819
1132 Ga0495635_0128061 3300046663 Bacteria 1731
1133 Ga0495659_0007967 3300046664 Bacteria 3362
1134 Ga0495659_0011969 3300046664 Bacteria 2800
1135 Ga0495599_0007711 3300046678 Bacteria 6536
1136 Ga0495599_0031262 3300046678 Bacteria 3342
1137 Ga0495599_0079319 3300046678 Bacteria 2050
1138 Ga0495599_0094923 3300046678 Unclassified 1860
1139 Ga0495647_0026811 3300046681 Unclassified 2114
1140 Ga0495658_0043624 3300046683 Bacteria 2510
1141 Ga0495658_0083815 3300046683 Bacteria 1876
1142 Ga0495669_0022956 3300046684 Bacteria 2712
1143 Ga0495669_0038652 3300046684 Bacteria 2114
1144 Ga0495669_0128026 3300046684 Bacteria 1194
1145 Ga0495613_0016058 3300046689 Bacteria 5574
1146 Ga0495624_0032623 3300046690 Bacteria 3376
1147 Ga0495600_0008015 3300046809 Bacteria 6473
1148 Ga0495604_0001281 3300047317 Bacteria 20561
1149 Ga0495636_0020840 3300047318 Bacteria 2643
1150 Ga0495674_0007664 3300047319 Bacteria 10310
1151 Ga0495674_0077092 3300047319 Bacteria 2866
1152 Ga0495674_0080808 3300047319 Bacteria 2789
1153 Ga0495674_0118630 3300047319 Unclassified 2237
1154 Ga0495680_0000665 3300047322 Bacteria 38471
1155 Ga0495680_0093768 3300047322 Bacteria 2247
1156 Ga0495675_0016482 3300047444 Bacteria 4674
1157 Ga0495675_0146396 3300047444 Bacteria 1461
1158 Ga0495684_0322337 3300047471 Bacteria 1104
1159 Ga0495593_0210636 3300047673 Bacteria 976
1160 Ga0495602_0003699 3300048088 Bacteria 15868
1161 Ga0495602_0083243 3300048088 Bacteria 2682
1162 Ga0495614_0092830 3300048089 Bacteria 1314
1163 Ga0496100_0207965 3300048903 Bacteria 1430
1164 Ga0496102_0009055 3300048905 Bacteria 8543
1165 Ga0496102_0018920 3300048905 Bacteria 6060
1166 Ga0496102_0047527 3300048905 Bacteria 3901
1167 Ga0496102_0317890 3300048905 Bacteria 1467
1168 Ga0496104_0041740 3300048907 Bacteria 4303
1169 Ga0496104_0289822 3300048907 Bacteria 1549
1170 Ga0496106_0083474 3300048909 Bacteria 2457
1171 Ga0496106_0162961 3300048909 Bacteria 1764
1172 Ga0496106_0365983 3300048909 Unclassified 1158
1173 Ga0496107_0090270 3300048910 Bacteria 2238
1174 Ga0496109_0546403 3300048912 Bacteria 1093
1175 Ga0496112_0003733 3300048915 Bacteria 12718
1176 Ga0496112_0140233 3300048915 Bacteria 2387
1177 Ga0496112_0181338 3300048915 Bacteria 2070
1178 Ga0496112_0513735 3300048915 Bacteria 1133
1179 Ga0496112_0873636 3300048915 Bacteria 822
1180 Ga0496118_0037802 3300048921 Bacteria 3879
1181 Ga0496119_0014528 3300048922 Bacteria 6152
1182 Ga0496121_0092816 3300048924 Bacteria 2352
1183 Ga0496126_0001339 3300048929 Bacteria 39084
1184 Ga0501031_0001671 3300049568 Bacteria 13924
1185 Ga0501031_0006567 3300049568 Bacteria 7589
1186 Ga0501031_0067526 3300049568 Bacteria 2329
1187 Ga0501032_0012640 3300049569 Bacteria 6024
1188 Ga0501032_0199448 3300049569 Bacteria 1306
1189 Ga0501032_0331132 3300049569 Bacteria 982
1190 Ga0501033_0028548 3300049570 Bacteria 4191
1191 Ga0501033_0049310 3300049570 Bacteria 3125
1192 Ga0501033_0059948 3300049570 Bacteria 2809
1193 Ga0501033_0076679 3300049570 Bacteria 2454
1194 Ga0501033_0102784 3300049570 Bacteria 2084
1195 Ga0501036_0010791 3300049572 Bacteria 7550
1196 Ga0501036_0111897 3300049572 Bacteria 2307
1197 Ga0501036_0181883 3300049572 Bacteria 1770
1198 Ga0501036_0211748 3300049572 Bacteria 1628
1199 Ga0501037_0123723 3300049573 Bacteria 1858
1200 Ga0501037_0224693 3300049573 Bacteria 1320
1201 Ga0501038_0006982 3300049574 Bacteria 10428
1202 Ga0501038_0008494 3300049574 Bacteria 9441
1203 Ga0501038_0071944 3300049574 Bacteria 2932
1204 Ga0501038_0112166 3300049574 Bacteria 2258
1205 Ga0501038_0146862 3300049574 Bacteria 1925
1206 Ga0501038_0235050 3300049574 Bacteria 1457
1207 Ga0501039_0003897 3300049575 Bacteria 11205
1208 Ga0501039_0008458 3300049575 Bacteria 7843
1209 Ga0501039_0015965 3300049575 Bacteria 5749
1210 Ga0501039_0305649 3300049575 Bacteria 1250
1211 Ga0501039_0458236 3300049575 Bacteria 1001
1212 Ga0501040_0003299 3300049576 Bacteria 10431
1213 Ga0501040_0004167 3300049576 Bacteria 9410
1214 Ga0501040_0005119 3300049576 Bacteria 8477
1215 Ga0501040_0054080 3300049576 Bacteria 2752
1216 Ga0501040_0060566 3300049576 Bacteria 2601
1217 Ga0501040_0061276 3300049576 Bacteria 2587
1218 Ga0501040_0075062 3300049576 Bacteria 2336
1219 Ga0501040_0161860 3300049576 Bacteria 1582
1220 Ga0501040_0169605 3300049576 Bacteria 1545
1221 Ga0501040_0213272 3300049576 Bacteria 1373
1222 Ga0501040_0216139 3300049576 Bacteria 1363
1223 Ga0501040_0362779 3300049576 Bacteria 1038
1224 Ga0501041_0003324 3300049577 Bacteria 9252
1225 Ga0501041_0008148 3300049577 Bacteria 6165
1226 Ga0501041_0036481 3300049577 Bacteria 2978
1227 Ga0501041_0044144 3300049577 Bacteria 2710
1228 Ga0501041_0152210 3300049577 Bacteria 1444
1229 Ga0501041_0200804 3300049577 Bacteria 1250
1230 Ga0501041_0234544 3300049577 Bacteria 1152
1231 Ga0501041_0289759 3300049577 Bacteria 1031
1232 Ga0501042_0002578 3300049578 Bacteria 11146
1233 Ga0501042_0038435 3300049578 Bacteria 3399
1234 Ga0501042_0048793 3300049578 Bacteria 3019
1235 Ga0501042_0063642 3300049578 Bacteria 2636
1236 Ga0501042_0106511 3300049578 Bacteria 2018
1237 Ga0501042_0120172 3300049578 Bacteria 1891
1238 Ga0501043_0033960 3300049579 Bacteria 4013
1239 Ga0501043_0105080 3300049579 Bacteria 2219
1240 Ga0501043_0107629 3300049579 Bacteria 2190
1241 Ga0501043_0481151 3300049579 Bacteria 930
1242 Ga0501046_0001962 3300049580 Bacteria 19557
1243 Ga0501046_0004982 3300049580 Bacteria 11922
1244 Ga0501046_0006823 3300049580 Bacteria 10072
1245 Ga0501046_0030364 3300049580 Bacteria 4386
1246 Ga0501046_0095204 3300049580 Unclassified 2288
1247 Ga0501047_0035034 3300049581 Bacteria 4848
1248 Ga0501048_0010923 3300049582 Bacteria 6774
1249 Ga0501048_0011694 3300049582 Bacteria 6548
1250 Ga0501048_0075735 3300049582 Bacteria 2375
1251 Ga0501048_0144139 3300049582 Bacteria 1685
1252 Ga0501048_0151340 3300049582 Bacteria 1641
1253 Ga0501048_0198638 3300049582 Bacteria 1421
1254 Ga0501048_0304650 3300049582 Bacteria 1134
1255 Ga0501068_0003456 3300049584 Bacteria 8508
1256 Ga0501068_0080825 3300049584 Bacteria 1994
1257 Ga0501070_0237117 3300049586 Bacteria 1494
1258 Ga0501070_0295479 3300049586 Bacteria 1320
1259 Ga0501071_0000244 3300049587 Bacteria 25138
1260 Ga0501071_0057203 3300049587 Bacteria 2818
1261 Ga0501071_0077946 3300049587 Bacteria 2421
1262 Ga0501072_0002603 3300049588 Bacteria 13517
1263 Ga0501072_0010608 3300049588 Bacteria 7016
1264 Ga0501072_0043509 3300049588 Bacteria 3529
1265 Ga0501072_0095782 3300049588 Bacteria 2359
1266 Ga0501072_0134650 3300049588 Bacteria 1970
1267 Ga0501072_0139603 3300049588 Bacteria 1932
1268 Ga0501072_0147679 3300049588 Bacteria 1874
1269 Ga0501072_0256715 3300049588 Bacteria 1392
1270 Ga0501072_0441104 3300049588 Bacteria 1031
1271 Ga0501073_0176181 3300049589 Bacteria 1480
1272 Ga0501074_0007388 3300049590 Bacteria 7947
1273 Ga0501074_0011907 3300049590 Bacteria 6325
1274 Ga0501074_0094026 3300049590 Bacteria 2147
1275 Ga0501074_0105750 3300049590 Bacteria 2015
1276 Ga0501074_0160007 3300049590 Bacteria 1608
1277 Ga0501075_0002670 3300049591 Bacteria 11923
1278 Ga0501075_0004621 3300049591 Bacteria 9342
1279 Ga0501075_0014543 3300049591 Bacteria 5640
1280 Ga0501075_0017637 3300049591 Bacteria 5155
1281 Ga0501075_0018540 3300049591 Bacteria 5038
1282 Ga0501075_0023006 3300049591 Bacteria 4558
1283 Ga0501075_0053090 3300049591 Bacteria 3048
1284 Ga0501075_0061150 3300049591 Bacteria 2838
1285 Ga0501075_0073459 3300049591 Bacteria 2586
1286 Ga0501075_0092811 3300049591 Bacteria 2291
1287 Ga0501075_0100270 3300049591 Bacteria 2199
1288 Ga0501075_0110137 3300049591 Bacteria 2094
1289 Ga0501075_0135693 3300049591 Bacteria 1875
1290 Ga0501075_0281805 3300049591 Bacteria 1266
1291 Ga0501076_0000941 3300049592 Bacteria 18993
1292 Ga0501076_0001068 3300049592 Bacteria 17988
1293 Ga0501076_0008483 3300049592 Bacteria 7530
1294 Ga0501076_0023984 3300049592 Bacteria 4709
1295 Ga0501076_0032035 3300049592 Bacteria 4102
1296 Ga0501076_0035412 3300049592 Bacteria 3906
1297 Ga0501076_0062674 3300049592 Bacteria 2962
1298 Ga0501076_0123523 3300049592 Bacteria 2096
1299 Ga0501076_0191079 3300049592 Bacteria 1671
1300 Ga0501076_0397988 3300049592 Bacteria 1132
1301 Ga0501077_0001148 3300049593 Bacteria 16004
1302 Ga0501077_0001199 3300049593 Bacteria 15656
1303 Ga0501077_0006228 3300049593 Bacteria 7293
1304 Ga0501077_0007712 3300049593 Bacteria 6643
1305 Ga0501077_0023151 3300049593 Bacteria 3938
1306 Ga0501077_0024656 3300049593 Bacteria 3819
1307 Ga0501077_0027849 3300049593 Bacteria 3589
1308 Ga0501077_0143405 3300049593 Bacteria 1515
1309 Ga0501077_0219633 3300049593 Bacteria 1208
1310 Ga0501079_0000911 3300049741 Bacteria 20299
1311 Ga0501079_0007952 3300049741 Bacteria 8040
1312 Ga0501079_0015315 3300049741 Bacteria 5849
1313 Ga0501079_0031397 3300049741 Bacteria 4083
1314 Ga0501079_0098538 3300049741 Bacteria 2266
1315 Ga0501079_0165532 3300049741 Bacteria 1724
1316 Ga0501079_0170630 3300049741 Bacteria 1696
1317 Ga0501079_0197258 3300049741 Bacteria 1571
1318 Ga0501079_0349818 3300049741 Bacteria 1158
1319 Ga0501079_0493282 3300049741 Bacteria 963
1320 Ga0501080_0003304 3300049742 Bacteria 14254
1321 Ga0501080_0047991 3300049742 Bacteria 3976
1322 Ga0501080_0057118 3300049742 Bacteria 3634
1323 Ga0501080_0123805 3300049742 Bacteria 2395
1324 Ga0501080_0153994 3300049742 Bacteria 2124
1325 Ga0501080_0208191 3300049742 Bacteria 1793
1326 Ga0501080_0234960 3300049742 Bacteria 1675
1327 Ga0501080_0545622 3300049742 Bacteria 1033
1328 Ga0501080_0587237 3300049742 Bacteria 990
1329 Ga0501081_0001515 3300049743 Bacteria 14277
1330 Ga0501081_0002460 3300049743 Bacteria 11684
1331 Ga0501081_0002931 3300049743 Bacteria 10823
1332 Ga0501081_0005008 3300049743 Bacteria 8526
1333 Ga0501081_0009379 3300049743 Bacteria 6376
1334 Ga0501081_0013240 3300049743 Bacteria 5425
1335 Ga0501081_0026018 3300049743 Bacteria 3942
1336 Ga0501081_0038170 3300049743 Bacteria 3280
1337 Ga0501081_0060570 3300049743 Bacteria 2623
1338 Ga0501081_0078747 3300049743 Bacteria 2304
1339 Ga0501081_0129766 3300049743 Bacteria 1800
1340 Ga0501081_0154530 3300049743 Bacteria 1650
1341 Ga0501081_0269858 3300049743 Bacteria 1244
1342 Ga0501081_0456872 3300049743 Bacteria 949
1343 Ga0501083_0023161 3300049744 Bacteria 4309
1344 Ga0501083_0071249 3300049744 Bacteria 2311
1345 Ga0501035_0018384 3300049822 Bacteria 6440
1346 Ga0501035_0067862 3300049822 Bacteria 3163
1347 Ga0501035_0159062 3300049822 Bacteria 1956
1348 Ga0501035_0165729 3300049822 Bacteria 1911
1349 Ga0501044_0007157 3300049823 Bacteria 12273
1350 Ga0501044_0118648 3300049823 Bacteria 2648
1351 Ga0501045_0001177 3300049824 Bacteria 17367
1352 Ga0501045_0003250 3300049824 Bacteria 11098
1353 Ga0501045_0041224 3300049824 Bacteria 3360
1354 Ga0501045_0078303 3300049824 Bacteria 2437
1355 Ga0501045_0078916 3300049824 Bacteria 2427
1356 Ga0501045_0082145 3300049824 Bacteria 2376
1357 Ga0501045_0120718 3300049824 Bacteria 1946
1358 Ga0501045_0123408 3300049824 Bacteria 1923
1359 nmdc:mga03683_1672_c1 3300050489 Bacteria 6677
1360 nmdc:mga03683_58571_c1 3300050489 Bacteria 1623
1361 nmdc:mga0yw44_25904_c1 3300050492 Bacteria 3343
1362 nmdc:mga0k408_91632_c1 3300050493 Bacteria 1786
1363 nmdc:mga06z11_171635_c1 3300050494 Bacteria 1246
1364 nmdc:mga07m45_21154_c1 3300050496 Bacteria 3539
1365 nmdc:mga05p37_12411_c1 3300050507 Bacteria 10174
1366 nmdc:mga05p37_14151_c1 3300050507 Bacteria 9575
1367 nmdc:mga05p37_15548_c1 3300050507 Bacteria 9147
1368 nmdc:mga05p37_175126_c1 3300050507 Bacteria 2614
1369 nmdc:mga05p37_241719_c1 3300050507 Bacteria 2170
1370 nmdc:mga05p37_353904_c1 3300050507 Bacteria 1728
1371 nmdc:mga05p37_374430_c1 3300050507 Bacteria 1670
1372 nmdc:mga05p37_38570_c1 3300050507 Bacteria 5861
1373 nmdc:mga05p37_50332_c1 3300050507 Bacteria 5123
1374 nmdc:mga05p37_53612_c1 3300050507 Bacteria 4960
1375 nmdc:mga05p37_62345_c1 3300050507 Bacteria 4589
1376 nmdc:mga05p37_627_c1 3300050507 Bacteria 39076
1377 nmdc:mga05p37_66785_c1 3300050507 Bacteria 4424
1378 nmdc:mga05p37_75279_c1 3300050507 Bacteria 4155
1379 nmdc:mga05p37_94602_c1 3300050507 Unclassified 3681
1380 nmdc:mga05p37_99443_c1 3300050507 Bacteria 3583
1381 nmdc:mga09592_11897_c1 3300050508 Bacteria 7079
1382 nmdc:mga09592_134798_c1 3300050508 Bacteria 2127
1383 nmdc:mga09592_176518_c1 3300050508 Bacteria 1848
1384 nmdc:mga09592_184865_c1 3300050508 Unclassified 1803
1385 nmdc:mga09592_20769_c1 3300050508 Bacteria 5405
1386 nmdc:mga09592_279637_c1 3300050508 Bacteria 1448
1387 nmdc:mga09592_407385_c1 3300050508 Bacteria 1175
1388 nmdc:mga09592_408506_c1 3300050508 Bacteria 1173
1389 nmdc:mga09592_50607_c1 3300050508 Bacteria 3504
1390 nmdc:mga09592_618701_c1 3300050508 Bacteria 927
1391 nmdc:mga09592_65955_c1 3300050508 Bacteria 3067
1392 nmdc:mga0qj67_112928_c1 3300050509 Bacteria 2194
1393 nmdc:mga0qj67_11455_c1 3300050509 Bacteria 6645
1394 nmdc:mga0qj67_19615_c1 3300050509 Bacteria 5168
1395 nmdc:mga0qj67_379815_c1 3300050509 Bacteria 1141
1396 nmdc:mga0qj67_51140_c1 3300050509 Bacteria 3267
1397 nmdc:mga0qj67_60678_c1 3300050509 Bacteria 3001
1398 nmdc:mga0qj67_737_c1 3300050509 Bacteria 22272
1399 nmdc:mga0qj67_771_c1 3300050509 Bacteria 21805
1400 nmdc:mga0qj67_87339_c1 3300050509 Bacteria 2503
1401 nmdc:mga06r32_1149_c1 3300050510 Bacteria 23807
1402 nmdc:mga06r32_132780_c1 3300050510 Bacteria 2463
1403 nmdc:mga06r32_13803_c1 3300050510 Bacteria 7328
1404 nmdc:mga06r32_211578_c1 3300050510 Bacteria 1927
1405 nmdc:mga06r32_212603_c1 3300050510 Bacteria 1922
1406 nmdc:mga06r32_235728_c1 3300050510 Bacteria 1817
1407 nmdc:mga06r32_2878_c1 3300050510 Bacteria 15445
1408 nmdc:mga06r32_379548_c1 3300050510 Bacteria 1396
1409 nmdc:mga06r32_44035_c1 3300050510 Bacteria 4249
1410 nmdc:mga06r32_76406_c1 3300050510 Bacteria 3252
1411 nmdc:mga06r32_78818_c1 3300050510 Bacteria 3203
1412 nmdc:mga08y16_19421_c1 3300050511 Bacteria 7165
1413 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
1414 nmdc:mga08y16_2040_c1 3300050511 Bacteria 20703
1415 nmdc:mga08y16_20667_c1 3300050511 Bacteria 6948
1416 nmdc:mga08y16_338265_c1 3300050511 Bacteria 1547
1417 nmdc:mga08y16_38688_c1 3300050511 Bacteria 5007
1418 nmdc:mga08y16_499791_c1 3300050511 Bacteria 1236
1419 nmdc:mga08y16_57849_c2 3300050511 Unclassified 2587
1420 nmdc:mga08y16_74958_c1 3300050511 Bacteria 3527
1421 nmdc:mga0n895_14201_c1 3300050512 Bacteria 7223
1422 nmdc:mga0n895_144738_c1 3300050512 Bacteria 2406
1423 nmdc:mga0n895_14800_c1 3300050512 Bacteria 7098
1424 nmdc:mga0n895_160454_c1 3300050512 Bacteria 2280
1425 nmdc:mga0n895_18707_c1 3300050512 Bacteria 6418
1426 nmdc:mga0n895_191716_c1 3300050512 Bacteria 2075
1427 nmdc:mga0n895_20812_c1 3300050512 Bacteria 6126
1428 nmdc:mga0n895_28969_c1 3300050512 Bacteria 5275
1429 nmdc:mga0n895_429560_c1 3300050512 Bacteria 1335
1430 nmdc:mga0n895_46394_c1 3300050512 Bacteria 4245
1431 nmdc:mga0n895_58009_c1 3300050512 Bacteria 3817
1432 nmdc:mga0n895_59351_c1 3300050512 Bacteria 3774
1433 nmdc:mga0n895_647719_c1 3300050512 Bacteria 1056
1434 nmdc:mga0n895_81789_c1 3300050512 Bacteria 3219
1435 nmdc:mga0n895_9124_c1 3300050512 Bacteria 8657
1436 nmdc:mga0rr50_106603_c1 3300050513 Bacteria 2211
1437 nmdc:mga0rr50_146101_c1 3300050513 Bacteria 1907
1438 nmdc:mga0rr50_149029_c1 3300050513 Bacteria 1889
1439 nmdc:mga0rr50_164753_c1 3300050513 Bacteria 1802
1440 nmdc:mga0rr50_167347_c1 3300050513 Bacteria 1788
1441 nmdc:mga0rr50_220573_c1 3300050513 Bacteria 1566
1442 nmdc:mga0rr50_36415_c1 3300050513 Bacteria 3544
1443 nmdc:mga08x19_127633_c1 3300050514 Bacteria 1709
1444 nmdc:mga08x19_1493_c1 3300050514 Bacteria 14477
1445 nmdc:mga08x19_181647_c1 3300050514 Bacteria 1436
1446 nmdc:mga08x19_349013_c1 3300050514 Bacteria 1033
1447 nmdc:mga08x19_34912_c1 3300050514 Bacteria 3181
1448 nmdc:mga08x19_39695_c1 3300050514 Bacteria 2993
1449 nmdc:mga0a205_12082_c1 3300050515 Bacteria 7978
1450 nmdc:mga0a205_123200_c1 3300050515 Bacteria 2492
1451 nmdc:mga0a205_21728_c1 3300050515 Bacteria 6068
1452 nmdc:mga0a205_246361_c1 3300050515 Bacteria 1667
1453 nmdc:mga0a205_333772_c1 3300050515 Bacteria 1386
1454 nmdc:mga0a205_349618_c1 3300050515 Bacteria 1346
1455 nmdc:mga0a205_452501_c1 3300050515 Bacteria 1144
1456 nmdc:mga0a205_46959_c1 3300050515 Unclassified 4165
1457 nmdc:mga0a205_50570_c1 3300050515 Bacteria 4012
1458 nmdc:mga0a205_525647_c1 3300050515 Bacteria 1039
1459 nmdc:mga0a205_5345_c1 3300050515 Bacteria 11575
1460 nmdc:mga0a205_616575_c1 3300050515 Bacteria 937
1461 nmdc:mga0a205_897_c1 3300050515 Bacteria 24481
1462 nmdc:mga0a205_95351_c1 3300050515 Bacteria 2874
1463 nmdc:mga0sz30_16033_c1 3300050516 Bacteria 2968
1464 Ga0495601_0036178 3300053077 Bacteria 3082
1465 Ga0495601_0051457 3300053077 Bacteria 2599
1466 Ga0495612_0002393 3300053078 Bacteria 7735
1467 Ga0495619_0039627 3300053085 Bacteria 3076
1468 Ga0495619_0144377 3300053085 Bacteria 1640
1469 Ga0495619_0219744 3300053085 Bacteria 1316
1470 Ga0500578_0000028 3300053086 Bacteria 144081
1471 Ga0500644_0006411 3300053088 Bacteria 3014
1472 Ga0500644_0076356 3300053088 Bacteria 1221
1473 Ga0500641_0014986 3300053096 Bacteria 2869
1474 Ga0500650_0135466 3300053098 Bacteria 1143
1475 Ga0500658_0006100 3300053134 Bacteria 4483
1476 Ga0500559_0000864 3300053136 Bacteria 19467
1477 Ga0500568_0035313 3300053139 Bacteria 2040
1478 Ga0500604_0010329 3300053151 Bacteria 2496
1479 Ga0500619_020654 3300053154 Bacteria 1886
1480 Ga0500620_092511 3300053155 Bacteria 1055
1481 Ga0500622_0017751 3300053156 Bacteria 3785
1482 Ga0501084_0000224 3300054114 Bacteria 42957
1483 Ga0501084_0001053 3300054114 Bacteria 21449
1484 Ga0501084_0051966 3300054114 Bacteria 3429
1485 Ga0501084_0056339 3300054114 Bacteria 3289
1486 Ga0501084_0082746 3300054114 Bacteria 2694
1487 Ga0501084_0098446 3300054114 Bacteria 2456
1488 Ga0501084_0142189 3300054114 Bacteria 2021
1489 Ga0501084_0178502 3300054114 Bacteria 1793
1490 Ga0501084_0313761 3300054114 Bacteria 1324
1491 Ga0501082_0000354 3300060353 Bacteria 40464
1492 Ga0501082_0002209 3300060353 Bacteria 17017
1493 Ga0501082_0003064 3300060353 Bacteria 14587
1494 Ga0501082_0028497 3300060353 Bacteria 4811
1495 Ga0501082_0033174 3300060353 Bacteria 4453
1496 Ga0501082_0066666 3300060353 Bacteria 3100
1497 Ga0501082_0076523 3300060353 Bacteria 2885
1498 Ga0501082_0129443 3300060353 Bacteria 2190
1499 Ga0501082_0195142 3300060353 Bacteria 1761
1500 Ga0530510_0000710 3300061734 Bacteria 21611
1501 Ga0530510_0002646 3300061734 Bacteria 12307
1502 Ga0530510_0005735 3300061734 Bacteria 8603
1503 Ga0530510_0048449 3300061734 Bacteria 3071
1504 Ga0530510_0203698 3300061734 Bacteria 1470
1505 2587728612 2585428057 Bacteria 6737412
1506 2587732428 2585428058 Bacteria 6853932
1507 2587757769 2585428062 Bacteria 6842168
1508 2588291972 2588253510 Bacteria 6901809
1509 2643971378 2643221592 Bacteria 6608788
1510 2644140913 2643221625 Bacteria 6512927
1511 2644276705 2643221648 Bacteria 6521465
1512 nmdc:mga08x19_34133_c1
1513 JGI25152J39213_1000939
1514 JGI25406J46586_10001733
1515 JGI25153J46596_10001552
1516 JGI25153J46596_10003443
1517 rootH2_10084913
1518 rootH1_10073293
1519 JGI26141J51220_1000238
1520 Ga0055526_1002279
1521 Ga0058863_11399723
1522 Ga0065165_1001161
1523 Ga0065715_10293307
1524 Ga0065707_10082160
1525 Ga0065707_10090228
1526 Ga0065707_10097617
1527 Ga0065707_10119844
1528 Ga0070658_10013839
1529 Ga0070658_10089989
1530 Ga0070676_10000180
1531 Ga0070676_10044286
1532 Ga0070676_10154421
1533 Ga0070676_10244069
1534 Ga0070683_100035870
1535 Ga0070683_100044269
1536 Ga0070683_100433481
1537 Ga0070690_100002966
1538 Ga0070690_100084329
1539 Ga0070690_100112277
1540 Ga0070690_100151416
1541 Ga0070690_100166718
1542 Ga0070670_100006716
1543 Ga0070670_100030466
1544 Ga0070677_10000480
1545 Ga0070677_10002340
1546 Ga0068869_100000690
1547 Ga0068869_100008882
1548 Ga0068869_100043111
1549 Ga0068869_100174215
1550 Ga0068869_100342139
1551 Ga0070666_10008877
1552 Ga0070680_100017550
1553 Ga0070680_100024240
1554 Ga0070680_100034153
1555 Ga0070680_100045760
1556 Ga0070680_100076002
1557 Ga0070680_100116938
1558 Ga0070680_100352912
1559 Ga0070680_100402838
1560 Ga0070682_100000622
1561 Ga0070682_100115528
1562 Ga0070682_100187034
1563 Ga0068868_100015578
1564 Ga0068868_100018830
1565 Ga0068868_100051604
1566 Ga0068868_100207196
1567 Ga0070660_100002171
1568 Ga0070689_100008079
1569 Ga0070689_100136889
1570 Ga0070689_100246919
1571 Ga0070689_100257639
1572 Ga0070689_100358301
1573 Ga0070691_10005153
1574 Ga0070691_10054987
1575 Ga0070687_100018481
1576 Ga0070687_100033727
1577 Ga0070687_100088303
1578 Ga0070687_100371871
1579 Ga0070661_100000211
1580 Ga0070692_10000947
1581 Ga0070692_10013082
1582 Ga0070692_10019539
1583 Ga0070668_100011684
1584 Ga0070668_100221811
1585 Ga0070668_100249268
1586 Ga0070668_100293832
1587 Ga0070669_100003321
1588 Ga0070669_100005282
1589 Ga0070669_100018574
1590 Ga0070669_100092920
1591 Ga0070669_100150638
1592 Ga0070669_100187096
1593 Ga0070669_100241301
1594 Ga0070675_100000264
1595 Ga0070675_100011030
1596 Ga0070675_100043352
1597 Ga0070675_100049356
1598 Ga0070675_100071363
1599 Ga0070675_100137477
1600 Ga0070671_100005985
1601 Ga0070671_100202226
1602 Ga0070671_100334959
1603 Ga0070674_100016275
1604 Ga0070674_100017024
1605 Ga0070674_100070264
1606 Ga0070673_100001370
1607 Ga0070673_100001462
1608 Ga0070673_100048928
1609 Ga0070673_100205809
1610 Ga0070673_100356931
1611 Ga0070659_100000204
1612 Ga0070659_100230076
1613 Ga0070659_100407722
1614 Ga0070667_100712302
1615 Ga0070703_10043743
1616 Ga0070703_10055704
1617 Ga0070703_10061922
1618 Ga0070709_10009910
1619 Ga0070709_10274103
1620 Ga0070709_10378568
1621 Ga0070714_100058375
1622 Ga0070714_100257428
1623 Ga0070713_100114080
1624 Ga0070713_100197773
1625 Ga0070713_100222856
1626 Ga0070713_100224955
1627 Ga0070713_100351136
1628 Ga0070713_100558597
1629 Ga0070710_10003930
1630 Ga0070710_10044950
1631 Ga0070710_10130912
1632 Ga0070711_100022847
1633 Ga0070711_100084682
1634 Ga0070711_100085919
1635 Ga0070711_100397929
1636 Ga0070705_100001378
1637 Ga0070705_100010637
1638 Ga0070705_100016819
1639 Ga0070705_100065129
1640 Ga0070705_100065685
1641 Ga0070705_100111033
1642 Ga0070705_100124781
1643 Ga0070705_100147131
1644 Ga0070700_100000457
1645 Ga0070700_100051555
1646 Ga0070700_100061077
1647 Ga0070700_100315083
1648 Ga0070700_100339503
1649 Ga0070700_100485839
1650 Ga0070694_100001824
1651 Ga0070694_100022369
1652 Ga0070694_100078589
1653 Ga0070694_100082460
1654 Ga0070694_100460556
1655 Ga0070694_100472064
1656 Ga0070708_100003247
1657 Ga0070708_100003792
1658 Ga0070708_100011346
1659 Ga0070708_100018954
1660 Ga0070708_100032371
1661 Ga0070708_100037361
1662 Ga0070708_100048798
1663 Ga0070708_100066557
1664 Ga0070708_100079649
1665 Ga0070708_100089268
1666 Ga0070708_100148809
1667 Ga0070708_100151811
1668 Ga0070708_100435779
1669 Ga0070708_100587542
1670 Ga0070663_100000167
1671 Ga0070678_100080846
1672 Ga0070678_100423761
1673 Ga0070662_100001464
1674 Ga0070662_100017049
1675 Ga0070662_100197858
1676 Ga0070662_100428938
1677 Ga0070662_100446237
1678 Ga0070681_10000852
1679 Ga0070681_10000898
1680 Ga0070681_10017554
1681 Ga0070681_10051632
1682 Ga0070681_10131120
1683 Ga0070681_10165696
1684 Ga0070681_10171698
1685 Ga0068867_100000347
1686 Ga0068867_100000382
1687 Ga0068867_100002024
1688 Ga0068867_100003059
1689 Ga0068867_100007232
1690 Ga0068867_100113394
1691 Ga0068867_100138568
1692 Ga0070685_10174139
1693 Ga0070706_100001137
1694 Ga0070706_100027332
1695 Ga0070706_100084951
1696 Ga0070706_100106706
1697 Ga0070706_100202883
1698 Ga0070706_100267098
1699 Ga0070706_100279348
1700 Ga0070706_100287849
1701 Ga0070706_100325790
1702 Ga0070707_100011824
1703 Ga0070707_100065984
1704 Ga0070707_100138676
1705 Ga0070707_100259735
1706 Ga0070707_100364113
1707 Ga0070707_100541240
1708 Ga0070698_100000110
1709 Ga0070698_100019877
1710 Ga0070698_100027252
1711 Ga0070698_100034483
1712 Ga0070698_100078815
1713 Ga0070698_100160715
1714 Ga0070698_100264545
1715 Ga0070698_100312851
1716 Ga0070698_100387468
1717 Ga0070699_100005810
1718 Ga0070699_100008560
1719 Ga0070699_100020042
1720 Ga0070699_100027987
1721 Ga0070699_100032281
1722 Ga0070699_100063068
1723 Ga0070699_100063336
1724 Ga0070699_100066277
1725 Ga0070699_100067475
1726 Ga0070699_100096606
1727 Ga0070699_100190308
1728 Ga0070699_100211156
1729 Ga0070699_100611799
1730 Ga0070679_100002929
1731 Ga0070679_100025321
1732 Ga0070679_100054381
1733 Ga0070679_100209658
1734 Ga0070679_100373855
1735 Ga0070684_100004515
1736 Ga0070684_100013751
1737 Ga0070684_100161967
1738 Ga0070684_100195039
1739 Ga0070684_100330729
1740 Ga0070697_100003309
1741 Ga0070697_100004392
1742 Ga0070697_100012817
1743 Ga0070697_100018719
1744 Ga0070697_100040479
1745 Ga0070697_100066526
1746 Ga0070697_100099968
1747 Ga0070697_100414712
1748 Ga0070697_100501839
1749 Ga0068853_100035390
1750 Ga0068853_100043288
1751 Ga0068853_100139823
1752 Ga0068853_100159097
1753 Ga0070672_100001028
1754 Ga0070672_100003113
1755 Ga0070672_100007023
1756 Ga0070672_100062063
1757 Ga0070672_100072867
1758 Ga0070672_100194672
1759 Ga0070686_100000394
1760 Ga0070686_100073790
1761 Ga0070686_100464332
1762 Ga0070695_100000724
1763 Ga0070695_100009703
1764 Ga0070695_100021490
1765 Ga0070695_100045572
1766 Ga0070695_100076356
1767 Ga0070695_100082344
1768 Ga0070695_100119075
1769 Ga0070695_100164901
1770 Ga0070696_100002440
1771 Ga0070696_100024923
1772 Ga0070696_100059206
1773 Ga0070696_100085964
1774 Ga0070696_100112452
1775 Ga0070696_100272708
1776 Ga0070696_100299714
1777 Ga0070696_100305090
1778 Ga0070696_100366072
1779 Ga0070693_100000530
1780 Ga0070693_100028206
1781 Ga0070665_100053465
1782 Ga0070665_100289904
1783 Ga0070665_100537584
1784 Ga0070704_100030815
1785 Ga0070704_100044729
1786 Ga0070704_100046332
1787 Ga0070704_100053519
1788 Ga0070704_100312001
1789 Ga0068855_100000221
1790 Ga0068855_100000319
1791 Ga0068855_100001074
1792 Ga0068855_100030553
1793 Ga0070664_100028129
1794 Ga0070664_100107053
1795 Ga0070664_100169494
1796 Ga0070664_100265485
1797 Ga0070664_100310117
1798 Ga0068857_100003125
1799 Ga0068857_100011491
1800 Ga0068857_100039971
1801 Ga0068857_100209496
1802 Ga0068857_100665956
1803 Ga0068854_100002450
1804 Ga0068854_100017860
1805 Ga0068854_100027688
1806 Ga0068854_100029699
1807 Ga0068856_100000395
1808 Ga0068856_100000702
1809 Ga0068856_100006539
1810 Ga0068856_100071442
1811 Ga0068856_100110613
1812 Ga0068856_100172230
1813 Ga0070702_100005045
1814 Ga0070702_100074608
1815 Ga0070702_100083189
1816 Ga0070702_100351757
1817 Ga0070702_100426519
1818 Ga0068852_100013672
1819 Ga0068852_100057047
1820 Ga0068852_100363435
1821 Ga0068859_100005562
1822 Ga0068859_100052175
1823 Ga0068859_100315399
1824 Ga0068859_100368890
1825 Ga0068859_100524675
1826 Ga0068864_100009783
1827 Ga0068864_100019686
1828 Ga0068864_100088825
1829 Ga0068864_100536979
1830 Ga0068866_10047771
1831 Ga0068866_10115925
1832 Ga0068861_100000215
1833 Ga0068861_100020438
1834 Ga0068861_100065067
1835 Ga0068861_100114297
1836 Ga0068861_100127163
1837 Ga0068861_100197654
1838 Ga0068861_100414240
1839 Ga0068870_10005277
1840 Ga0068870_10075049
1841 Ga0068870_10307629
1842 Ga0068863_100011479
1843 Ga0068863_100620379
1844 Ga0068858_100012272
1845 Ga0068858_100014856
1846 Ga0068858_100062959
1847 Ga0068860_100005361
1848 Ga0068860_100006217
1849 Ga0068860_100172082
1850 Ga0068860_100364306
1851 Ga0068860_100385768
1852 Ga0068860_100411011
1853 Ga0068860_100446116
1854 Ga0068860_100468211
1855 Ga0068860_100624064
1856 Ga0068862_100000487
1857 Ga0068862_100004802
1858 Ga0068862_100005359
1859 Ga0068862_100007938
1860 Ga0068862_100008356
1861 Ga0068862_100482258
1862 Ga0081455_10009207
1863 Ga0081455_10012540
1864 Ga0081538_10002955
1865 Ga0081540_1009165
1866 Ga0081540_1022020
1867 Ga0081539_10000005
1868 Ga0081539_10010818
1869 Ga0070717_10030630
1870 Ga0070717_10031603
1871 Ga0070717_10076240
1872 Ga0070717_10081475
1873 Ga0070717_10259026
1874 Ga0070717_10445543
1875 Ga0075365_10059939
1876 Ga0075365_10209186
1877 Ga0075364_10141433
1878 Ga0070715_10033522
1879 Ga0070715_10199334
1880 Ga0070716_100011844
1881 Ga0070716_100013575
1882 Ga0070716_100066523
1883 Ga0070712_100002462
1884 Ga0070712_100074986
1885 Ga0070712_100198168
1886 Ga0070712_100202754
1887 Ga0075362_10032693
1888 Ga0075367_10038686
1889 Ga0075366_10020461
1890 Ga0097621_100000655
1891 Ga0097621_100000712
1892 Ga0097621_100001381
1893 Ga0097621_100009385
1894 Ga0097621_100075788
1895 Ga0097621_100109456
1896 Ga0075370_10018571
1897 Ga0068871_100000128
1898 Ga0068871_100004305
1899 Ga0068871_100006933
1900 Ga0068871_100009068
1901 Ga0068871_100034070
1902 Ga0068871_100202301
1903 Ga0075428_100000470
1904 Ga0075428_100001407
1905 Ga0075428_100004438
1906 Ga0075428_100035695
1907 Ga0075428_100044380
1908 Ga0075428_100091286
1909 Ga0075428_100093715
1910 Ga0075428_100190009
1911 Ga0075428_100315065
1912 Ga0075430_100000104
1913 Ga0075430_100002874
1914 Ga0075430_100027546
1915 Ga0075430_100028790
1916 Ga0075430_100094421
1917 Ga0075430_100217736
1918 Ga0075430_100330233
1919 Ga0075430_100483120
1920 Ga0075431_100001472
1921 Ga0075431_100002983
1922 Ga0075431_100012897
1923 Ga0075431_100021273
1924 Ga0075431_100032096
1925 Ga0075431_100040701
1926 Ga0075431_100053715
1927 Ga0075431_100058876
1928 Ga0075431_100066441
1929 Ga0075431_100068550
1930 Ga0075431_100076627
1931 Ga0075431_100080694
1932 Ga0075431_100151068
1933 Ga0075431_100186840
1934 Ga0075431_100324220
1935 Ga0075431_100328467
1936 Ga0075431_100410262
1937 Ga0075431_100482244
1938 Ga0075433_10001635
1939 Ga0075433_10011551
1940 Ga0075433_10022370
1941 Ga0075433_10041400
1942 Ga0075433_10050516
1943 Ga0075433_10056028
1944 Ga0075433_10125059
1945 Ga0075433_10334463
1946 Ga0075433_10362395
1947 Ga0075433_10483842
1948 Ga0075434_100000469
1949 Ga0075434_100015709
1950 Ga0075434_100022371
1951 Ga0075434_100035465
1952 Ga0075434_100049436
1953 Ga0075434_100068018
1954 Ga0075434_100069888
1955 Ga0075434_100071588
1956 Ga0075434_100192190
1957 Ga0075434_100378399
1958 Ga0075434_100389325
1959 Ga0075434_100416613
1960 Ga0075434_100666726
1961 Ga0075429_100001259
1962 Ga0075429_100013498
1963 Ga0075429_100020898
1964 Ga0075429_100027791
1965 Ga0075429_100033913
1966 Ga0075429_100138986
1967 Ga0075429_100174171
1968 Ga0075429_100220591
1969 Ga0075429_100370296
1970 Ga0075429_100485962
1971 Ga0075429_100491243
1972 Ga0068865_100004568
1973 Ga0068865_100084502
1974 Ga0068865_100222464
1975 Ga0075436_100004214
1976 Ga0075436_100010262
1977 Ga0075436_100010910
1978 Ga0075436_100013523
1979 Ga0075436_100031727
1980 Ga0075436_100124658
1981 Ga0075436_100138472
1982 Ga0097620_100005562
1983 Ga0097620_100052175
1984 Ga0097620_100315384
1985 Ga0097620_100368908
1986 Ga0097620_100524687
1987 Ga0075435_100009432
1988 Ga0075435_100016130
1989 Ga0075435_100016853
1990 Ga0075435_100083146
1991 Ga0075435_100137537
1992 Ga0075435_100167259
1993 Ga0075435_100424984
1994 Ga0075435_100523447
1995 Ga0075435_100630789
1996 Ga0099794_10000310
1997 Ga0099794_10013939
1998 Ga0105240_10003938
1999 Ga0105240_10004517
2000 Ga0105240_10019165
2001 Ga0105240_10168563
2002 Ga0105240_10334195
2003 Ga0111539_10000033
2004 Ga0111539_10004735
2005 Ga0111539_10006679
2006 Ga0111539_10006843
2007 Ga0111539_10032915
2008 Ga0111539_10070895
2009 Ga0111539_10077464
2010 Ga0105245_10000523
2011 Ga0105245_10072099
2012 Ga0105245_10516721
2013 Ga0105245_10565861
2014 Ga0105245_10626589
2015 Ga0114129_10000042
2016 Ga0114129_10006838
2017 Ga0114129_10015964
2018 Ga0114129_10024796
2019 Ga0114129_10042802
2020 Ga0114129_10043209
2021 Ga0114129_10065592
2022 Ga0114129_10073438
2023 Ga0114129_10076908
2024 Ga0114129_10118118
2025 Ga0114129_10166304
2026 Ga0114129_10183534
2027 Ga0114129_10188671
2028 Ga0114129_10205366
2029 Ga0114129_10318525
2030 Ga0114129_10586621
2031 Ga0114129_10713969
2032 Ga0114129_11091238
2033 Ga0114129_11193471
2034 Ga0105243_10014982
2035 Ga0105243_10057957
2036 Ga0105243_10067344
2037 Ga0105243_10273085
2038 Ga0105243_10515795
2039 Ga0105241_10001179
2040 Ga0105241_10045989
2041 Ga0105241_10120680
2042 Ga0105242_10004792
2043 Ga0105242_10013473
2044 Ga0105242_10056164
2045 Ga0105242_10284374
2046 Ga0105242_10452761
2047 Ga0105248_10021019
2048 Ga0105248_10121987
2049 Ga0105248_10624575
2050 Ga0105238_10003209
2051 Ga0105238_10285683
2052 Ga0105238_10553300
2053 Ga0105249_10052101
2054 Ga0105249_10059101
2055 Ga0105249_10082803
2056 Ga0105249_10122364
2057 Ga0105249_10349543
2058 Ga0099796_10037372
2059 Ga0099796_10134529
2060 Ga0105239_10051935
2061 Ga0105239_10109037
2062 Ga0105239_10177529
2063 Ga0105239_10183842
2064 Ga0105239_10213971
2065 Ga0105239_10240618
2066 Ga0105246_10017101
2067 Ga0105246_10176928
2068 Ga0157373_10004022
2069 Ga0157373_10253554
2070 Ga0157371_10083170
2071 Ga0157370_10201223
2072 Ga0157369_10000253
2073 Ga0157369_10135847
2074 Ga0157369_10428501
2075 Ga0157374_10000185
2076 Ga0157374_10000555
2077 Ga0157374_10083217
2078 Ga0157378_10000245
2079 Ga0157378_10000256
2080 Ga0157378_10013281
2081 Ga0157378_10341480
2082 Ga0157378_10565132
2083 Ga0163162_10042496
2084 Ga0163162_10274934
2085 Ga0163162_10991681
2086 Ga0157372_10000310
2087 Ga0157372_10000704
2088 Ga0157372_10006181
2089 Ga0157372_10444242
2090 Ga0157375_10060541
2091 Ga0157375_10103512
2092 Ga0157375_10103719
2093 Ga0157375_10103752
2094 Ga0157375_10233222
2095 Ga0157375_10404091
2096 Ga0157375_10432545
2097 Ga0157375_10747566
2098 Ga0163163_10000629
2099 Ga0163163_10010981
2100 Ga0163163_10013691
2101 Ga0163163_10648426
2102 Ga0157380_10000622
2103 Ga0157380_10018733
2104 Ga0157380_10128589
2105 Ga0182008_10063456
2106 Ga0157377_10204822
2107 Ga0157379_10466371
2108 Ga0157376_10061590
2109 Ga0157376_10112309
2110 Ga0157376_10185298
2111 Ga0163161_10013549
2112 Ga0163161_10019586
2113 Ga0213872_10191890
2114 Ga0213874_10054643
2115 Ga0213875_10000031
2116 Ga0213875_10011074
2117 Ga0213875_10031100
2118 Ga0213871_10003108
2119 Ga0213871_10010785
2120 Ga0207425_1001394
2121 Ga0209129_1000038
2122 Ga0209673_1006212
2123 Ga0209564_1000162
2124 Ga0209758_1000152
2125 Ga0209758_1000268
2126 Ga0209050_1000634
2127 Ga0209051_1018684
2128 Ga0207653_10044668
2129 Ga0207682_10001827
2130 Ga0207682_10002442
2131 Ga0207682_10006763
2132 Ga0207692_10033945
2133 Ga0207692_10068775
2134 Ga0207642_10090708
2135 Ga0207642_10263416
2136 Ga0207680_10091210
2137 Ga0207680_10253565
2138 Ga0207685_10083535
2139 Ga0207685_10132727
2140 Ga0207699_10068254
2141 Ga0207699_10097440
2142 Ga0207699_10188398
2143 Ga0207699_10254006
2144 Ga0207645_10003940
2145 Ga0207645_10007209
2146 Ga0207645_10047526
2147 Ga0207645_10048214
2148 Ga0207645_10085051
2149 Ga0207645_10086119
2150 Ga0207645_10143787
2151 Ga0207643_10007922
2152 Ga0207643_10021697
2153 Ga0207643_10042997
2154 Ga0207643_10047414
2155 Ga0207684_10004374
2156 Ga0207684_10018218
2157 Ga0207684_10041285
2158 Ga0207684_10050770
2159 Ga0207684_10127314
2160 Ga0207684_10141148
2161 Ga0207684_10292087
2162 Ga0207684_10391272
2163 Ga0207684_10616467
2164 Ga0207654_10023921
2165 Ga0207654_10453108
2166 Ga0207707_10000116
2167 Ga0207707_10002125
2168 Ga0207707_10009719
2169 Ga0207707_10151516
2170 Ga0207707_10389240
2171 Ga0207707_10425421
2172 Ga0207695_10013936
2173 Ga0207695_10064783
2174 Ga0207695_10213574
2175 Ga0207695_10355295
2176 Ga0207693_10001378
2177 Ga0207693_10003875
2178 Ga0207693_10009321
2179 Ga0207693_10081766
2180 Ga0207693_10421476
2181 Ga0207663_10032599
2182 Ga0207663_10064800
2183 Ga0207663_10391143
2184 Ga0207663_10433675
2185 Ga0207663_10441364
2186 Ga0207660_10002889
2187 Ga0207660_10003241
2188 Ga0207660_10027825
2189 Ga0207660_10065156
2190 Ga0207660_10075335
2191 Ga0207660_10090695
2192 Ga0207660_10107783
2193 Ga0207660_10154842
2194 Ga0207662_10021154
2195 Ga0207662_10036540
2196 Ga0207662_10050184
2197 Ga0207662_10187918
2198 Ga0207657_10002084
2199 Ga0207649_10001837
2200 Ga0207652_10003098
2201 Ga0207652_10003188
2202 Ga0207646_10005516
2203 Ga0207646_10006384
2204 Ga0207646_10019430
2205 Ga0207646_10073368
2206 Ga0207646_10083553
2207 Ga0207646_10087386
2208 Ga0207646_10112231
2209 Ga0207646_10303599
2210 Ga0207646_10366230
2211 Ga0207681_10005697
2212 Ga0207681_10006234
2213 Ga0207681_10040017
2214 Ga0207681_10046721
2215 Ga0207681_10071471
2216 Ga0207681_10076841
2217 Ga0207694_10000808
2218 Ga0207650_10000551
2219 Ga0207650_10168712
2220 Ga0207650_10208399
2221 Ga0207659_10001103
2222 Ga0207659_10021669
2223 Ga0207659_10040215
2224 Ga0207659_10138628
2225 Ga0207659_10154218
2226 Ga0207687_10034986
2227 Ga0207687_10163810
2228 Ga0207687_10173737
2229 Ga0207687_10456197
2230 Ga0207700_10106401
2231 Ga0207700_10197787
2232 Ga0207700_10298235
2233 Ga0207700_10348275
2234 Ga0207700_10369071
2235 Ga0207664_10010521
2236 Ga0207664_10314345
2237 Ga0207664_10338440
2238 Ga0207664_10447763
2239 Ga0207644_10052722
2240 Ga0207690_10063370
2241 Ga0207690_10303445
2242 Ga0207706_10005422
2243 Ga0207706_10020088
2244 Ga0207706_10088092
2245 Ga0207706_10481303
2246 Ga0207686_10046404
2247 Ga0207686_10137838
2248 Ga0207709_10002771
2249 Ga0207670_10060075
2250 Ga0207670_10100406
2251 Ga0207670_10176697
2252 Ga0207670_10496473
2253 Ga0207669_10011554
2254 Ga0207669_10140907
2255 Ga0207669_10198706
2256 Ga0207704_10011150
2257 Ga0207704_10015163
2258 Ga0207704_10068996
2259 Ga0207704_10102662
2260 Ga0207665_10022420
2261 Ga0207665_10025098
2262 Ga0207665_10033065
2263 Ga0207691_10000654
2264 Ga0207691_10004065
2265 Ga0207691_10010593
2266 Ga0207691_10011146
2267 Ga0207691_10015804
2268 Ga0207691_10031435
2269 Ga0207691_10094413
2270 Ga0207691_10157805
2271 Ga0207711_10063130
2272 Ga0207711_10131113
2273 Ga0207711_10174551
2274 Ga0207711_10202260
2275 Ga0207711_10297236
2276 Ga0207689_10000058
2277 Ga0207689_10002032
2278 Ga0207689_10012451
2279 Ga0207689_10116569
2280 Ga0207661_10018061
2281 Ga0207661_10046145
2282 Ga0207661_10329958
2283 Ga0207661_10437998
2284 Ga0207679_10002446
2285 Ga0207679_10214720
2286 Ga0207679_10265414
2287 Ga0207679_10445513
2288 Ga0207667_10000302
2289 Ga0207667_10000342
2290 Ga0207667_10007687
2291 Ga0207667_10077943
2292 Ga0207667_10878921
2293 Ga0207651_10002536
2294 Ga0207651_10026438
2295 Ga0207651_10216807
2296 Ga0207651_10453664
2297 Ga0207712_10030656
2298 Ga0207712_10067792
2299 Ga0207712_10096187
2300 Ga0207712_10178009
2301 Ga0207668_10006404
2302 Ga0207668_10076748
2303 Ga0207668_10121854
2304 Ga0207640_10009617
2305 Ga0207640_10037075
2306 Ga0207640_10083073
2307 Ga0207640_10224167
2308 Ga0207658_10006276
2309 Ga0207677_10045251
2310 Ga0207677_10047631
2311 Ga0207677_10178073
2312 Ga0207703_10009410
2313 Ga0207703_10065489
2314 Ga0207703_10112267
2315 Ga0207639_10013319
2316 Ga0207639_10104608
2317 Ga0207678_10000501
2318 Ga0207708_10030161
2319 Ga0207708_10035592
2320 Ga0207708_10075312
2321 Ga0207708_10090592
2322 Ga0207708_10094789
2323 Ga0207708_10124614
2324 Ga0207708_10204446
2325 Ga0207708_10341087
2326 Ga0207708_10401329
2327 Ga0207702_10001675
2328 Ga0207702_10007641
2329 Ga0207702_10219058
2330 Ga0207702_10507216
2331 Ga0207641_10011020
2332 Ga0207641_10016259
2333 Ga0207641_10317891
2334 Ga0207641_10333839
2335 Ga0207641_10555287
2336 Ga0207648_10000911
2337 Ga0207648_10002647
2338 Ga0207648_10005445
2339 Ga0207648_10006801
2340 Ga0207648_10017555
2341 Ga0207648_10062711
2342 Ga0207648_10171772
2343 Ga0207648_10274668
2344 Ga0207648_10399345
2345 Ga0207648_10479842
2346 Ga0207648_10698200
2347 Ga0207676_10006658
2348 Ga0207676_10240206
2349 Ga0207674_10002881
2350 Ga0207674_10036930
2351 Ga0207674_10042118
2352 Ga0207674_10622043
2353 Ga0207675_100003808
2354 Ga0207675_100015304
2355 Ga0207675_100023622
2356 Ga0207675_100027113
2357 Ga0207675_100039299
2358 Ga0207675_100061603
2359 Ga0207675_100101064
2360 Ga0207675_100419755
2361 Ga0207683_10074474
2362 Ga0207683_10106798
2363 Ga0207683_10209681
2364 Ga0207683_10362433
2365 Ga0207698_10007876
2366 Ga0207698_10286670
2367 Ga0207698_10316826
2368 Ga0209969_1004713
2369 Ga0210000_1001017
2370 Ga0210000_1006743
2371 Ga0209982_1012689
2372 Ga0209588_1003957
2373 Ga0209588_1034994
2374 Ga0209974_10011645
2375 Ga0207428_10000001
2376 Ga0207428_10000214
2377 Ga0207428_10000794
2378 Ga0207428_10030615
2379 Ga0207428_10394614
2380 Ga0268266_10006285
2381 Ga0268266_10088977
2382 Ga0268265_10000291
2383 Ga0268265_10011760
2384 Ga0268265_10026086
2385 Ga0268265_10037529
2386 Ga0268265_10079564
2387 Ga0268265_10092699
2388 Ga0268265_10710430
2389 Ga0268264_10010180
2390 Ga0268264_10011418
2391 Ga0268264_10102819
2392 Ga0268264_10283031
2393 Ga0268264_10283953
2394 Ga0268264_10340659
2395 Ga0268264_10378744
2396 Ga0265323_10030400
2397 Ga0265336_10005326
2398 Ga0307515_10000567
2399 Ga0307515_10001764
2400 Ga0307515_10017612
2401 Ga0307515_10154994
2402 Ga0265338_10116832
2403 Ga0265338_10179064
2404 Ga0265338_10272559
2405 Ga0307511_10110826
2406 Ga0307512_10056794
2407 Ga0307512_10152899
2408 Ga0307512_10180443
2409 Ga0265330_10034444
2410 Ga0265320_10006970
2411 Ga0265339_10001307
2412 Ga0265331_10061874
2413 Ga0307513_10019225
2414 Ga0307513_10023508
2415 Ga0307513_10025089
2416 Ga0307513_10028304
2417 Ga0307513_10029096
2418 Ga0307513_10060082
2419 Ga0307513_10141846
2420 Ga0307513_10148595
2421 Ga0307513_10286647
2422 Ga0307509_10018664
2423 Ga0307408_100056367
2424 Ga0307408_100321120
2425 Ga0307408_100469400
2426 Ga0307408_100580272
2427 Ga0307508_10000133
2428 Ga0307514_10038864
2429 Ga0265314_10019470
2430 Ga0265342_10007004
2431 Ga0307516_10000747
2432 Ga0307516_10002063
2433 Ga0307405_10233057
2434 Ga0307413_10011267
2435 Ga0307518_10215546
2436 Ga0307410_10002475
2437 Ga0307406_10056580
2438 Ga0307407_10319380
2439 Ga0307412_10021440
2440 Ga0307409_100020905
2441 Ga0307409_100042172
2442 Ga0307409_100647996
2443 Ga0307416_100042240
2444 Ga0307416_100125061
2445 Ga0307416_100150289
2446 Ga0307416_100157725
2447 Ga0307416_100359489
2448 Ga0307416_100382521
2449 Ga0307416_100390082
2450 Ga0307411_10005848
2451 Ga0307411_10046909
2452 Ga0307411_10061891
2453 Ga0307411_10136279
2454 Ga0307411_10360116
2455 Ga0307507_10034086
2456 Ga0307510_10010883
2457 Ga0373930_0042092
2458 Ga0373948_0002801
2459 Ga0373940_0009756
2460 Ga0373940_0052833
2461 Ga0373952_0028271
2462 Ga0373939_0060273
2463 Ga0373953_0004130
2464 Ga0373953_0008528
2465 Ga0373953_0018486
2466 Ga0373953_0092861
2467 Ga0373954_0000006
2468 Ga0373954_0013401
2469 Ga0373954_0063985
2470 Ga0373954_0253192
2471 Ga0373956_0022127
2472 Ga0373957_0007206
2473 Ga0373957_0026624
2474 Ga0373955_0022552
2475 Ga0373955_0032155
2476 Ga0373942_0037600
2477 Ga0373961_0010428
2478 Ga0373924_0016868
2479 Ga0373924_0040131
2480 Ga0373924_0051486
2481 Ga0373924_0105168
2482 Ga0373931_0008116
2483 Ga0373931_0152358
2484 Ga0373931_0230415
2485 Ga0373927_0054967
2486 Ga0373927_0094975
2487 Ga0373933_0002554
2488 Ga0373933_0006374
2489 Ga0373933_0088149
2490 Ga0373937_0000595
2491 Ga0373937_0004857
2492 Ga0373937_0014930
2493 Ga0373937_0019178
2494 Ga0373937_0064219
2495 Ga0373937_0093528
2496 Ga0373937_0099029
2497 Ga0373937_0222136
2498 Ga0373937_0304898
2499 Ga0373937_0612699
2500 Ga0373937_0713218
2501 Ga0373925_0033853
2502 Ga0373925_0036520
2503 Ga0373925_0128455
2504 Ga0373925_0187086
2505 Ga0373925_0224930
2506 Ga0373925_0278656
2507 Ga0373925_0328246
2508 Ga0395899_0009901
2509 Ga0395900_0007096
2510 Ga0395900_0008202
2511 Ga0395900_0061683
2512 Ga0395900_0110984
2513 Ga0395898_0009370
2514 Ga0395898_0124971
2515 Ga0395905_0031024
2516 Ga0395905_0439309
2517 Ga0436364_0143816
2518 Ga0436364_0257301
2519 Ga0436364_0793438
2520 Ga0436364_0818873
2521 Ga0436364_1066269
2522 Ga0436364_1318842
2523 Ga0395901_0004642
2524 Ga0395901_0012050
2525 Ga0395901_0013096
2526 Ga0395901_0068491
2527 Ga0436365_0177547
2528 Ga0436365_0425373
2529 Ga0436365_0681786
2530 Ga0436365_0868950
2531 Ga0436360_0061449
2532 Ga0436360_0486209
2533 Ga0436360_0793917
2534 Ga0436360_1074955
2535 Ga0436360_1280092
2536 Ga0436360_1290437
2537 Ga0436361_1006987
2538 Ga0436363_0911403
2539 Ga0436363_1073413
2540 Ga0436362_0481759
2541 Ga0436362_1028638
2542 Ga0451793_1545139
2543 Ga0451802_1112197
2544 Ga0451807_0499581
2545 Ga0451807_1253711
2546 Ga0451849_0276976
2547 Ga0451851_0523242
2548 Ga0439431_0016250
2549 Ga0439441_006088
2550 Ga0439441_016519
2551 Ga0439448_0001756
2552 Ga0439448_0011271
2553 Ga0439450_009064
2554 Ga0439455_0013004
2555 Ga0450889_001382
2556 Ga0439458_0009129
2557 Ga0439459_0000152
2558 Ga0439464_0004171
2559 Ga0439460_0001159
2560 Ga0439460_0088558
2561 Ga0451577_0029889
2562 Ga0451577_0041449
2563 Ga0451577_0088469
2564 Ga0466969_0009411
2565 Ga0453683_0004609
2566 Ga0453683_0098926
2567 Ga0453684_0010525
2568 Ga0453684_0115564
2569 Ga0453684_0312292
2570 Ga0453684_0583733
2571 Ga0466959_0014401
2572 Ga0451576_0003738
2573 Ga0451576_0012679
2574 Ga0451576_0095383
2575 Ga0451576_0231551
2576 Ga0451576_0245856
2577 Ga0451576_0298432
2578 Ga0451576_0378546
2579 Ga0451576_0414902
2580 Ga0466958_0088800
2581 Ga0466958_0091092
2582 Ga0466967_0213926
2583 Ga0466967_0413470
2584 Ga0495592_0000160
2585 Ga0495592_0000928
2586 Ga0495603_0132468
2587 Ga0495590_0111461
2588 Ga0495629_0401303
2589 Ga0495638_0001008
2590 Ga0495638_0043046
2591 Ga0495638_0103625
2592 Ga0495651_0079219
2593 Ga0495651_0109338
2594 Ga0495653_0316980
2595 Ga0495580_0037801
2596 Ga0495580_0077357
2597 Ga0495580_0104380
2598 Ga0495582_0015221
2599 Ga0495582_0055355
2600 Ga0495582_0147220
2601 Ga0495662_0009907
2602 Ga0495608_0001288
2603 Ga0495608_0015622
2604 Ga0495610_0055629
2605 Ga0495620_0070385
2606 Ga0495620_0090246
2607 Ga0495628_0001997
2608 Ga0495628_0049177
2609 Ga0495628_0179249
2610 Ga0495630_0001497
2611 Ga0495630_0010529
2612 Ga0495630_0077680
2613 Ga0495630_0157346
2614 Ga0495630_0315901
2615 Ga0495632_0024686
2616 Ga0495632_0054487
2617 Ga0495632_0141651
2618 Ga0495666_0001472
2619 Ga0495666_0020433
2620 Ga0495642_0116589
2621 Ga0495652_0050184
2622 Ga0495640_0000622
2623 Ga0495640_0041479
2624 Ga0495640_0086660
2625 Ga0495586_0001804
2626 Ga0495586_0011239
2627 Ga0495586_0011452
2628 Ga0495586_0022520
2629 Ga0495586_0173157
2630 Ga0495587_0016321
2631 Ga0495587_0055134
2632 Ga0495645_0056608
2633 Ga0495667_0004436
2634 Ga0495667_0008992
2635 Ga0495667_0036472
2636 Ga0495634_0004756
2637 Ga0495634_0048623
2638 Ga0495634_0075662
2639 Ga0495625_0000452
2640 Ga0495625_0005241
2641 Ga0495625_0034663
2642 Ga0495635_0018825
2643 Ga0495635_0128061
2644 Ga0495659_0007967
2645 Ga0495659_0011969
2646 Ga0495599_0007711
2647 Ga0495599_0031262
2648 Ga0495599_0079319
2649 Ga0495599_0094923
2650 Ga0495647_0026811
2651 Ga0495658_0043624
2652 Ga0495658_0083815
2653 Ga0495669_0022956
2654 Ga0495669_0038652
2655 Ga0495669_0128026
2656 Ga0495613_0016058
2657 Ga0495624_0032623
2658 Ga0495600_0008015
2659 Ga0495604_0001281
2660 Ga0495636_0020840
2661 Ga0495674_0007664
2662 Ga0495674_0077092
2663 Ga0495674_0080808
2664 Ga0495674_0118630
2665 Ga0495680_0000665
2666 Ga0495680_0093768
2667 Ga0495675_0016482
2668 Ga0495675_0146396
2669 Ga0495684_0322337
2670 Ga0495593_0210636
2671 Ga0495602_0003699
2672 Ga0495602_0083243
2673 Ga0495614_0092830
2674 Ga0496100_0207965
2675 Ga0496102_0009055
2676 Ga0496102_0018920
2677 Ga0496102_0047527
2678 Ga0496102_0317890
2679 Ga0496104_0041740
2680 Ga0496104_0289822
2681 Ga0496106_0083474
2682 Ga0496106_0162961
2683 Ga0496106_0365983
2684 Ga0496107_0090270
2685 Ga0496109_0546403
2686 Ga0496112_0003733
2687 Ga0496112_0140233
2688 Ga0496112_0181338
2689 Ga0496112_0513735
2690 Ga0496112_0873636
2691 Ga0496118_0037802
2692 Ga0496119_0014528
2693 Ga0496121_0092816
2694 Ga0496126_0001339
2695 Ga0501031_0001671
2696 Ga0501031_0006567
2697 Ga0501031_0067526
2698 Ga0501032_0012640
2699 Ga0501032_0199448
2700 Ga0501032_0331132
2701 Ga0501033_0028548
2702 Ga0501033_0049310
2703 Ga0501033_0059948
2704 Ga0501033_0076679
2705 Ga0501033_0102784
2706 Ga0501036_0010791
2707 Ga0501036_0111897
2708 Ga0501036_0181883
2709 Ga0501036_0211748
2710 Ga0501037_0123723
2711 Ga0501037_0224693
2712 Ga0501038_0006982
2713 Ga0501038_0008494
2714 Ga0501038_0071944
2715 Ga0501038_0112166
2716 Ga0501038_0146862
2717 Ga0501038_0235050
2718 Ga0501039_0003897
2719 Ga0501039_0008458
2720 Ga0501039_0015965
2721 Ga0501039_0305649
2722 Ga0501039_0458236
2723 Ga0501040_0003299
2724 Ga0501040_0004167
2725 Ga0501040_0005119
2726 Ga0501040_0054080
2727 Ga0501040_0060566
2728 Ga0501040_0061276
2729 Ga0501040_0075062
2730 Ga0501040_0161860
2731 Ga0501040_0169605
2732 Ga0501040_0213272
2733 Ga0501040_0216139
2734 Ga0501040_0362779
2735 Ga0501041_0003324
2736 Ga0501041_0008148
2737 Ga0501041_0036481
2738 Ga0501041_0044144
2739 Ga0501041_0152210
2740 Ga0501041_0200804
2741 Ga0501041_0234544
2742 Ga0501041_0289759
2743 Ga0501042_0002578
2744 Ga0501042_0038435
2745 Ga0501042_0048793
2746 Ga0501042_0063642
2747 Ga0501042_0106511
2748 Ga0501042_0120172
2749 Ga0501043_0033960
2750 Ga0501043_0105080
2751 Ga0501043_0107629
2752 Ga0501043_0481151
2753 Ga0501046_0001962
2754 Ga0501046_0004982
2755 Ga0501046_0006823
2756 Ga0501046_0030364
2757 Ga0501046_0095204
2758 Ga0501047_0035034
2759 Ga0501048_0010923
2760 Ga0501048_0011694
2761 Ga0501048_0075735
2762 Ga0501048_0144139
2763 Ga0501048_0151340
2764 Ga0501048_0198638
2765 Ga0501048_0304650
2766 Ga0501068_0003456
2767 Ga0501068_0080825
2768 Ga0501070_0237117
2769 Ga0501070_0295479
2770 Ga0501071_0000244
2771 Ga0501071_0057203
2772 Ga0501071_0077946
2773 Ga0501072_0002603
2774 Ga0501072_0010608
2775 Ga0501072_0043509
2776 Ga0501072_0095782
2777 Ga0501072_0134650
2778 Ga0501072_0139603
2779 Ga0501072_0147679
2780 Ga0501072_0256715
2781 Ga0501072_0441104
2782 Ga0501073_0176181
2783 Ga0501074_0007388
2784 Ga0501074_0011907
2785 Ga0501074_0094026
2786 Ga0501074_0105750
2787 Ga0501074_0160007
2788 Ga0501075_0002670
2789 Ga0501075_0004621
2790 Ga0501075_0014543
2791 Ga0501075_0017637
2792 Ga0501075_0018540
2793 Ga0501075_0023006
2794 Ga0501075_0053090
2795 Ga0501075_0061150
2796 Ga0501075_0073459
2797 Ga0501075_0092811
2798 Ga0501075_0100270
2799 Ga0501075_0110137
2800 Ga0501075_0135693
2801 Ga0501075_0281805
2802 Ga0501076_0000941
2803 Ga0501076_0001068
2804 Ga0501076_0008483
2805 Ga0501076_0023984
2806 Ga0501076_0032035
2807 Ga0501076_0035412
2808 Ga0501076_0062674
2809 Ga0501076_0123523
2810 Ga0501076_0191079
2811 Ga0501076_0397988
2812 Ga0501077_0001148
2813 Ga0501077_0001199
2814 Ga0501077_0006228
2815 Ga0501077_0007712
2816 Ga0501077_0023151
2817 Ga0501077_0024656
2818 Ga0501077_0027849
2819 Ga0501077_0143405
2820 Ga0501077_0219633
2821 Ga0501079_0000911
2822 Ga0501079_0007952
2823 Ga0501079_0015315
2824 Ga0501079_0031397
2825 Ga0501079_0098538
2826 Ga0501079_0165532
2827 Ga0501079_0170630
2828 Ga0501079_0197258
2829 Ga0501079_0349818
2830 Ga0501079_0493282
2831 Ga0501080_0003304
2832 Ga0501080_0047991
2833 Ga0501080_0057118
2834 Ga0501080_0123805
2835 Ga0501080_0153994
2836 Ga0501080_0208191
2837 Ga0501080_0234960
2838 Ga0501080_0545622
2839 Ga0501080_0587237
2840 Ga0501081_0001515
2841 Ga0501081_0002460
2842 Ga0501081_0002931
2843 Ga0501081_0005008
2844 Ga0501081_0009379
2845 Ga0501081_0013240
2846 Ga0501081_0026018
2847 Ga0501081_0038170
2848 Ga0501081_0060570
2849 Ga0501081_0078747
2850 Ga0501081_0129766
2851 Ga0501081_0154530
2852 Ga0501081_0269858
2853 Ga0501081_0456872
2854 Ga0501083_0023161
2855 Ga0501083_0071249
2856 Ga0501035_0018384
2857 Ga0501035_0067862
2858 Ga0501035_0159062
2859 Ga0501035_0165729
2860 Ga0501044_0007157
2861 Ga0501044_0118648
2862 Ga0501045_0001177
2863 Ga0501045_0003250
2864 Ga0501045_0041224
2865 Ga0501045_0078303
2866 Ga0501045_0078916
2867 Ga0501045_0082145
2868 Ga0501045_0120718
2869 Ga0501045_0123408
2870 nmdc:mga03683_1672_c1
2871 nmdc:mga03683_58571_c1
2872 nmdc:mga0yw44_25904_c1
2873 nmdc:mga0k408_91632_c1
2874 nmdc:mga06z11_171635_c1
2875 nmdc:mga07m45_21154_c1
2876 nmdc:mga05p37_12411_c1
2877 nmdc:mga05p37_14151_c1
2878 nmdc:mga05p37_15548_c1
2879 nmdc:mga05p37_175126_c1
2880 nmdc:mga05p37_241719_c1
2881 nmdc:mga05p37_353904_c1
2882 nmdc:mga05p37_374430_c1
2883 nmdc:mga05p37_38570_c1
2884 nmdc:mga05p37_50332_c1
2885 nmdc:mga05p37_53612_c1
2886 nmdc:mga05p37_62345_c1
2887 nmdc:mga05p37_627_c1
2888 nmdc:mga05p37_66785_c1
2889 nmdc:mga05p37_75279_c1
2890 nmdc:mga05p37_94602_c1
2891 nmdc:mga05p37_99443_c1
2892 nmdc:mga09592_11897_c1
2893 nmdc:mga09592_134798_c1
2894 nmdc:mga09592_176518_c1
2895 nmdc:mga09592_184865_c1
2896 nmdc:mga09592_20769_c1
2897 nmdc:mga09592_279637_c1
2898 nmdc:mga09592_407385_c1
2899 nmdc:mga09592_408506_c1
2900 nmdc:mga09592_50607_c1
2901 nmdc:mga09592_618701_c1
2902 nmdc:mga09592_65955_c1
2903 nmdc:mga0qj67_112928_c1
2904 nmdc:mga0qj67_11455_c1
2905 nmdc:mga0qj67_19615_c1
2906 nmdc:mga0qj67_379815_c1
2907 nmdc:mga0qj67_51140_c1
2908 nmdc:mga0qj67_60678_c1
2909 nmdc:mga0qj67_737_c1
2910 nmdc:mga0qj67_771_c1
2911 nmdc:mga0qj67_87339_c1
2912 nmdc:mga06r32_1149_c1
2913 nmdc:mga06r32_132780_c1
2914 nmdc:mga06r32_13803_c1
2915 nmdc:mga06r32_211578_c1
2916 nmdc:mga06r32_212603_c1
2917 nmdc:mga06r32_235728_c1
2918 nmdc:mga06r32_2878_c1
2919 nmdc:mga06r32_379548_c1
2920 nmdc:mga06r32_44035_c1
2921 nmdc:mga06r32_76406_c1
2922 nmdc:mga06r32_78818_c1
2923 nmdc:mga08y16_19421_c1
2924 nmdc:mga08y16_1_c1
2925 nmdc:mga08y16_2040_c1
2926 nmdc:mga08y16_20667_c1
2927 nmdc:mga08y16_338265_c1
2928 nmdc:mga08y16_38688_c1
2929 nmdc:mga08y16_499791_c1
2930 nmdc:mga08y16_57849_c2
2931 nmdc:mga08y16_74958_c1
2932 nmdc:mga0n895_14201_c1
2933 nmdc:mga0n895_144738_c1
2934 nmdc:mga0n895_14800_c1
2935 nmdc:mga0n895_160454_c1
2936 nmdc:mga0n895_18707_c1
2937 nmdc:mga0n895_191716_c1
2938 nmdc:mga0n895_20812_c1
2939 nmdc:mga0n895_28969_c1
2940 nmdc:mga0n895_429560_c1
2941 nmdc:mga0n895_46394_c1
2942 nmdc:mga0n895_58009_c1
2943 nmdc:mga0n895_59351_c1
2944 nmdc:mga0n895_647719_c1
2945 nmdc:mga0n895_81789_c1
2946 nmdc:mga0n895_9124_c1
2947 nmdc:mga0rr50_106603_c1
2948 nmdc:mga0rr50_146101_c1
2949 nmdc:mga0rr50_149029_c1
2950 nmdc:mga0rr50_164753_c1
2951 nmdc:mga0rr50_167347_c1
2952 nmdc:mga0rr50_220573_c1
2953 nmdc:mga0rr50_36415_c1
2954 nmdc:mga08x19_127633_c1
2955 nmdc:mga08x19_1493_c1
2956 nmdc:mga08x19_181647_c1
2957 nmdc:mga08x19_349013_c1
2958 nmdc:mga08x19_34912_c1
2959 nmdc:mga08x19_39695_c1
2960 nmdc:mga0a205_12082_c1
2961 nmdc:mga0a205_123200_c1
2962 nmdc:mga0a205_21728_c1
2963 nmdc:mga0a205_246361_c1
2964 nmdc:mga0a205_333772_c1
2965 nmdc:mga0a205_349618_c1
2966 nmdc:mga0a205_452501_c1
2967 nmdc:mga0a205_46959_c1
2968 nmdc:mga0a205_50570_c1
2969 nmdc:mga0a205_525647_c1
2970 nmdc:mga0a205_5345_c1
2971 nmdc:mga0a205_616575_c1
2972 nmdc:mga0a205_897_c1
2973 nmdc:mga0a205_95351_c1
2974 nmdc:mga0sz30_16033_c1
2975 Ga0495601_0036178
2976 Ga0495601_0051457
2977 Ga0495612_0002393
2978 Ga0495619_0039627
2979 Ga0495619_0144377
2980 Ga0495619_0219744
2981 Ga0500578_0000028
2982 Ga0500644_0006411
2983 Ga0500644_0076356
2984 Ga0500641_0014986
2985 Ga0500650_0135466
2986 Ga0500658_0006100
2987 Ga0500559_0000864
2988 Ga0500568_0035313
2989 Ga0500604_0010329
2990 Ga0500619_020654
2991 Ga0500620_092511
2992 Ga0500622_0017751
2993 Ga0501084_0000224
2994 Ga0501084_0001053
2995 Ga0501084_0051966
2996 Ga0501084_0056339
2997 Ga0501084_0082746
2998 Ga0501084_0098446
2999 Ga0501084_0142189
3000 Ga0501084_0178502
3001 Ga0501084_0313761
3002 Ga0501082_0000354
3003 Ga0501082_0002209
3004 Ga0501082_0003064
3005 Ga0501082_0028497
3006 Ga0501082_0033174
3007 Ga0501082_0066666
3008 Ga0501082_0076523
3009 Ga0501082_0129443
3010 Ga0501082_0195142
3011 Ga0530510_0000710
3012 Ga0530510_0002646
3013 Ga0530510_0005735
3014 Ga0530510_0048449
3015 Ga0530510_0203698
3016 2587728612
3017 2587732428
3018 2587757769
3019 2588291972
3020 2643971378
3021 2644140913
3022 2644276705

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

49

288

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9823 4 255
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9799 4 257
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9648 4 257
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9597 4 255
2ze3-assembly1.cif.gz_A-2 crystal structure of dfa0005 complexed with alpha-ketoglutarate: a novel member of the icl/pepm superfamily from alkali-tolerant deinococcus ficus 0.9116 1 256
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9818 4 226 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9481 4 226 3.20.20.60
af_Q8GYI4_58_362_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9204 1 247 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9198 1 226 3.20.20.60
af_P9WLN9_1_257_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9167 8 247 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2V6PFR3-F1-model_v4 2-methylisocitrate lyase 0.9958 20 175 GO:0016829
AF-A0A7V8BJQ6-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9957 76 257 GO:0016829
AF-A0A536SY66-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.995 4 257 GO:0016829
AF-A0A524Q9N9-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9947 4 188 GO:0016829
AF-A0A7Y5GCF5-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.992 4 257 GO:0016829

Map