F494455

General Info

Members Datasets Scaffolds Average Seq Length
1508 631 3016 322

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0197434|Ga0501042_0197434_276_1340
Length 354
Sequence MASSARGFALAPAARALISSTILSFPSFAANNMPSDATPRHTRLVILGSGPAGFSAAVYAARANLKPLLITGLEQGGQLMTTTDVDNWPADADGVQGPDLMARFQKHAERFETEVVFDHIQKVDLAASPKRLSGDNGEYTADAVIIATGASARYLGLPSEQAFMGKGVSACATCDGFFYKGQDVVVVGGGNTAVEEALYLSNIAKRVTVIHRRDKFRAEAILIDRLMAKTRDGGNISVVWDHVLDEVLGDATGVTGVRIKEKTTGATRDIPAHGVFIAIGHTPNTQVFEGQLDMANGYIQVRSGTQGNATATSVPGVFASGDVADHVYRQAVTSAGTGCMAALDAEAWLEEQVH

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
42 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
126 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
127 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
158 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
159 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
163 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
172 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
174 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
175 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
178 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
179 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
251 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
260 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
264 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
269 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
270 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
271 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
272 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
273 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
274 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
275 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
276 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
277 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
278 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
279 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
280 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
281 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
282 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
283 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
284 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
285 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
286 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
287 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
288 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
289 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
292 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
293 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
294 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
295 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
296 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
297 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
298 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
299 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
300 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
301 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
302 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
303 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
304 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
305 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
306 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
307 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
308 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
309 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
310 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
311 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
312 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
313 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
314 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
315 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
316 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
317 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
319 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
320 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
321 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
322 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
323 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
324 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
325 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
326 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
327 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
328 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
329 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
330 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
331 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
332 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
333 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
334 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
335 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
336 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
337 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
338 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
339 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
340 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
341 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
342 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
343 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
344 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
345 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
346 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
347 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
348 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
349 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
350 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
351 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
352 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
353 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
354 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
355 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
356 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
357 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
358 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
359 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
360 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
361 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
362 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
363 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
364 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
365 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
366 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
367 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
368 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
369 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
370 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
371 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
372 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
373 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
374 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
375 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
376 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
377 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
378 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
379 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
380 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
381 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
382 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
383 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
384 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
385 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
386 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
387 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
388 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
389 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
390 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
391 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
392 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
393 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
394 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
395 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
396 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
397 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
398 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
399 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
400 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
401 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
402 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
403 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
404 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
405 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
406 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
407 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
408 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
409 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
410 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
411 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
412 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
413 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
414 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
415 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
416 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
417 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
418 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
419 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
420 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
421 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
422 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
423 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
424 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
425 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
426 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
427 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
428 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
429 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
430 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
431 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
432 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
433 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
434 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
435 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
436 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
437 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
438 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
439 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
440 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
441 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
442 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
443 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
444 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
445 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
446 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
447 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
448 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
449 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
450 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
451 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
452 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
453 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
454 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
455 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
456 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
457 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
458 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
459 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
460 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
461 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
462 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
463 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
464 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
465 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
466 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
467 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
468 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
469 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
470 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
471 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
472 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
473 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
477 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
489 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
490 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
491 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
492 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
493 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
494 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
495 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
496 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
497 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
498 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
499 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
500 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
501 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
502 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
503 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
504 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
505 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
506 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
507 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
509 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
510 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
511 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
512 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
513 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
514 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
515 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
516 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
517 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
518 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
519 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
520 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
521 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
522 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
523 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
524 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
525 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
526 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
531 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
532 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
533 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
534 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
535 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
536 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
537 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
538 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
539 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
540 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
541 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
542 2519103095 Burkholderia sp. KJ006 Isolate Nodule
543 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
544 2547132512 Azospira oryzae 6a3 Isolate Unclassified
545 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
546 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
547 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
548 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
549 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
550 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
551 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
552 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
553 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
554 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
555 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
556 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
557 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
558 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
559 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
560 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
561 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
562 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
563 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
564 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
565 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
566 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
567 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
568 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
569 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
570 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
571 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
572 2818991436 Collimonas arenae 515 Isolate Unclassified
573 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
574 2818991450 Burkholderia sp. 604 Isolate Unclassified
575 2818991452 Burkholderia cepacia 561 Isolate Unclassified
576 2831864461 Roseateles noduli HZ7 Isolate Nodule
577 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
578 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
579 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
580 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
581 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
582 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
583 2855730933 Achromobacter sp. HZ28 Isolate Nodule
584 2855767633 Achromobacter sp. HZ34 Isolate Nodule
585 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
586 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
587 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
588 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
589 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
590 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
591 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
592 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
593 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
594 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
595 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
596 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
597 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
598 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
599 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
600 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
601 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
602 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
603 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
604 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
605 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
606 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
607 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
608 2928163908 Burkholderia sp. 567 Isolate Unclassified
609 2928170801 Burkholderia sp. 572 Isolate Unclassified
610 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
611 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
612 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
613 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
614 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
615 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
616 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
617 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
618 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
619 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
620 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
621 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
622 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
623 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
624 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
625 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
626 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
627 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
628 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
629 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
630 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
631 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.04
Metatranscriptomes 0.4
Isolates 6.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.72
Nodule 2.19
Rhizoplane 2.72
Rhizosphere 71.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0197434 3300049578 Bacteria 1451
2 JGI24740J21852_10000408 3300001979 Bacteria 18450
3 JGI24739J22299_10002612 3300001989 Bacteria 6938
4 JGI24739J22299_10022734 3300001989 Bacteria 2223
5 JGI24735J21928_10004224 3300002067 Bacteria 4846
6 JGI24735J21928_10043488 3300002067 Bacteria 1306
7 JGI24738J21930_10002746 3300002075 Bacteria 4528
8 JGI25155J39150_1000186 3300002704 Bacteria 26654
9 JGI25155J39150_1000416 3300002704 Bacteria 11587
10 JGI25156J39149_1000425 3300002705 Bacteria 26221
11 JGI25156J39149_1000808 3300002705 Bacteria 16016
12 JGI25156J39149_1001518 3300002705 Bacteria 9635
13 JGI25156J39149_1003490 3300002705 Bacteria 5129
14 JGI25162J39368_1000426 3300002737 Bacteria 34131
15 JGI25154J39366_1000496 3300002738 Bacteria 20193
16 JGI25154J39366_1000504 3300002738 Bacteria 19901
17 JGI25154J39366_1000704 3300002738 Bacteria 15273
18 JGI25154J39366_1000985 3300002738 Bacteria 11552
19 JGI25154J39366_1002170 3300002738 Bacteria 5478
20 JGI25158J39367_1000154 3300002739 Bacteria 16089
21 JGI25157J39369_1000021 3300002741 Bacteria 163907
22 JGI25157J39369_1000771 3300002741 Bacteria 16594
23 JGI25163J39215_1001943 3300002771 Bacteria 2600
24 JGI25150J39212_1007054 3300002774 Bacteria 2281
25 JGI25159J45721_1000806 3300002987 Bacteria 13665
26 JGI25151J46595_10003776 3300003187 Bacteria 8217
27 JGI25151J46595_10004054 3300003187 Bacteria 7856
28 JGI25151J46595_10018776 3300003187 Bacteria 2956
29 JGI25151J46595_10024627 3300003187 Bacteria 2460
30 JGI25165J46597_1000022 3300003214 Bacteria 357959
31 JGI25165J46597_1001231 3300003214 Bacteria 15212
32 rootH2_10004894 3300003320 Bacteria 17076
33 rootL2_10000757 3300003322 Bacteria 81071
34 rootL2_10000982 3300003322 Bacteria 15080
35 rootL2_10002392 3300003322 Bacteria 54339
36 rootL2_10008489 3300003322 Bacteria 50545
37 rootH1_10007359 3300003323 Bacteria 18468
38 JGI25160J50197_1000140 3300003354 Bacteria 65061
39 JGI25161J50226_1000062 3300003374 Bacteria 99783
40 JGI25161J50226_1004262 3300003374 Bacteria 3034
41 Ga0006554J51385_1029846 3300003567 Bacteria 1092
42 Ga0055538_1000002 3300003751 Bacteria 999437
43 Ga0055538_1000011 3300003751 Bacteria 357959
44 Ga0055539_1000002 3300003752 Bacteria 999437
45 Ga0055539_1000016 3300003752 Bacteria 358248
46 Ga0055539_1000129 3300003752 Bacteria 80419
47 Ga0055539_1001072 3300003752 Bacteria 5804
48 Ga0055533_1000004 3300003756 Bacteria 999437
49 Ga0055533_1000019 3300003756 Bacteria 357959
50 Ga0055533_1000033 3300003756 Bacteria 265716
51 Ga0055533_1000038 3300003756 Bacteria 251370
52 Ga0055533_1000040 3300003756 Bacteria 242927
53 Ga0055533_1000750 3300003756 Bacteria 10388
54 Ga0055532_1000001 3300003758 Bacteria 1119836
55 Ga0055532_1000016 3300003758 Bacteria 327509
56 Ga0055532_1003589 3300003758 Bacteria 2595
57 Ga0055525_1000002 3300003759 Bacteria 999437
58 Ga0055525_1000011 3300003759 Bacteria 503124
59 Ga0055525_1000046 3300003759 Bacteria 261587
60 Ga0055525_1000173 3300003759 Bacteria 81767
61 Ga0055525_1000182 3300003759 Bacteria 78412
62 Ga0055525_1000436 3300003759 Bacteria 24398
63 Ga0055525_1000804 3300003759 Bacteria 9793
64 Ga0055527_1000002 3300003760 Bacteria 830488
65 Ga0055535_1000001 3300003761 Bacteria 1119836
66 Ga0055535_1000908 3300003761 Bacteria 20052
67 Ga0055535_1002931 3300003761 Bacteria 5296
68 Ga0055535_1006273 3300003761 Bacteria 2439
69 Ga0055542_1000001 3300003762 Bacteria 1119836
70 Ga0055542_1001564 3300003762 Bacteria 10731
71 Ga0055529_1000001 3300003763 Bacteria 826680
72 Ga0055529_1000051 3300003763 Bacteria 205006
73 Ga0055529_1000218 3300003763 Bacteria 74813
74 Ga0055529_1001138 3300003763 Bacteria 11271
75 Ga0055526_1000358 3300003771 Bacteria 37034
76 Ga0055526_1000537 3300003771 Bacteria 30014
77 Ga0055526_1000716 3300003771 Bacteria 25160
78 Ga0055526_1001023 3300003771 Bacteria 20456
79 Ga0055526_1005468 3300003771 Bacteria 7294
80 Ga0055526_1009687 3300003771 Bacteria 4595
81 Ga0055526_1012007 3300003771 Bacteria 3829
82 Ga0055526_1023754 3300003771 Bacteria 2034
83 Ga0055526_1028162 3300003771 Bacteria 1708
84 Ga0055526_1028180 3300003771 Bacteria 1708
85 Ga0055526_1044351 3300003771 Bacteria 1074
86 Ga0055537_1000022 3300003773 Bacteria 114484
87 Ga0055537_1003965 3300003773 Bacteria 4383
88 Ga0055537_1004727 3300003773 Bacteria 3823
89 Ga0055537_1005357 3300003773 Bacteria 3454
90 Ga0055524_1000241 3300003775 Bacteria 57262
91 Ga0055524_1001254 3300003775 Bacteria 14894
92 Ga0055524_1001347 3300003775 Bacteria 14314
93 Ga0055524_1001821 3300003775 Bacteria 11688
94 Ga0055536_1000095 3300003781 Bacteria 76235
95 Ga0055534_1000468 3300003784 Bacteria 22901
96 Ga0055534_1000708 3300003784 Bacteria 16367
97 Ga0055534_1000987 3300003784 Bacteria 12550
98 Ga0055534_1005473 3300003784 Bacteria 3390
99 Ga0055534_1010175 3300003784 Bacteria 1990
100 Ga0055528_1000473 3300003790 Bacteria 32133
101 Ga0055528_1002794 3300003790 Bacteria 9145
102 Ga0055528_1034677 3300003790 Bacteria 1238
103 Ga0055530_10000057 3300003791 Bacteria 100782
104 Ga0055530_10004150 3300003791 Bacteria 7662
105 Ga0055530_10016028 3300003791 Bacteria 2414
106 Ga0055540_1000001 3300003792 Bacteria 466834
107 Ga0055540_1022195 3300003792 Bacteria 1629
108 Ga0055540_1033611 3300003792 Bacteria 1161
109 Ga0055531_10002737 3300003794 Bacteria 11585
110 Ga0055531_10018527 3300003794 Bacteria 2868
111 Ga0055541_1000002 3300003841 Bacteria 896405
112 Ga0055541_1000043 3300003841 Bacteria 161703
113 Ga0055541_1000084 3300003841 Bacteria 81767
114 Ga0055541_1005715 3300003841 Bacteria 2158
115 Ga0055543_1000121 3300004625 Bacteria 66082
116 Ga0055543_1001320 3300004625 Bacteria 10143
117 Ga0055543_1013115 3300004625 Bacteria 1647
118 Ga0065165_1000261 3300005262 Bacteria 90816
119 Ga0065165_1000613 3300005262 Bacteria 51836
120 Ga0065165_1000952 3300005262 Bacteria 36509
121 Ga0065715_10016327 3300005293 Bacteria 2048
122 Ga0065707_10107524 3300005295 Bacteria 2550
123 Ga0070658_10032140 3300005327 Bacteria 4220
124 Ga0070658_10158077 3300005327 Bacteria 1900
125 Ga0070676_10120384 3300005328 Bacteria 1647
126 Ga0070676_10173867 3300005328 Bacteria 1395
127 Ga0070683_100004795 3300005329 Bacteria 11192
128 Ga0070690_100065041 3300005330 Bacteria 2357
129 Ga0070670_100001406 3300005331 Bacteria 19333
130 Ga0070670_100003471 3300005331 Bacteria 13082
131 Ga0070670_100007979 3300005331 Bacteria 9003
132 Ga0070670_100033488 3300005331 Bacteria 4425
133 Ga0070670_100041376 3300005331 Bacteria 3961
134 Ga0070670_100074064 3300005331 Bacteria 2924
135 Ga0070670_100084291 3300005331 Bacteria 2730
136 Ga0070670_100137799 3300005331 Bacteria 2109
137 Ga0068869_100003074 3300005334 Bacteria 10156
138 Ga0068869_100283528 3300005334 Bacteria 1333
139 Ga0070666_10018750 3300005335 Bacteria 4455
140 Ga0070682_100009086 3300005337 Bacteria 5619
141 Ga0068868_100002961 3300005338 Bacteria 11792
142 Ga0068868_100044482 3300005338 Bacteria 3471
143 Ga0070660_100000008 3300005339 Bacteria 155650
144 Ga0070660_100003570 3300005339 Bacteria 10742
145 Ga0070660_100163250 3300005339 Bacteria 1796
146 Ga0070660_100178130 3300005339 Bacteria 1720
147 Ga0070660_100209466 3300005339 Bacteria 1582
148 Ga0070689_100061984 3300005340 Bacteria 2909
149 Ga0070687_100030926 3300005343 Bacteria 2621
150 Ga0070687_100058009 3300005343 Bacteria 2032
151 Ga0070661_100005081 3300005344 Bacteria 9075
152 Ga0070668_100004719 3300005347 Bacteria 10103
153 Ga0070668_100068825 3300005347 Bacteria 2752
154 Ga0070668_100187019 3300005347 Bacteria 1695
155 Ga0070669_100080910 3300005353 Bacteria 2419
156 Ga0070669_100237761 3300005353 Bacteria 1446
157 Ga0070675_100003790 3300005354 Bacteria 11481
158 Ga0070675_100005988 3300005354 Bacteria 9320
159 Ga0070675_100007331 3300005354 Bacteria 8512
160 Ga0070675_100009293 3300005354 Bacteria 7642
161 Ga0070675_100232539 3300005354 Bacteria 1608
162 Ga0070671_100035058 3300005355 Bacteria 4156
163 Ga0070671_100048181 3300005355 Bacteria 3543
164 Ga0070671_100053379 3300005355 Bacteria 3360
165 Ga0070674_100004270 3300005356 Bacteria 8131
166 Ga0070673_100002423 3300005364 Bacteria 11361
167 Ga0070673_100018209 3300005364 Bacteria 5014
168 Ga0070673_100031799 3300005364 Bacteria 3965
169 Ga0070673_100037071 3300005364 Bacteria 3712
170 Ga0070673_100047712 3300005364 Bacteria 3334
171 Ga0070673_100103268 3300005364 Bacteria 2351
172 Ga0070659_100000014 3300005366 Bacteria 178272
173 Ga0070659_100005143 3300005366 Bacteria 9380
174 Ga0070659_100148183 3300005366 Bacteria 1913
175 Ga0070659_100178134 3300005366 Bacteria 1744
176 Ga0070659_100275751 3300005366 Bacteria 1398
177 Ga0070667_100001679 3300005367 Bacteria 19790
178 Ga0070667_100009453 3300005367 Bacteria 8087
179 Ga0070714_100067168 3300005435 Bacteria 3091
180 Ga0070710_10295396 3300005437 Bacteria 1056
181 Ga0070701_10005536 3300005438 Bacteria 5225
182 Ga0070701_10227493 3300005438 Bacteria 1115
183 Ga0070705_100002406 3300005440 Bacteria 9418
184 Ga0070705_100044579 3300005440 Bacteria 2548
185 Ga0070700_100094244 3300005441 Bacteria 1960
186 Ga0070663_100000913 3300005455 Bacteria 16041
187 Ga0070663_100353011 3300005455 Bacteria 1191
188 Ga0070678_100001893 3300005456 Bacteria 11274
189 Ga0070662_100008260 3300005457 Bacteria 6779
190 Ga0070662_100023135 3300005457 Bacteria 4265
191 Ga0070662_100234096 3300005457 Bacteria 1470
192 Ga0070662_100318482 3300005457 Bacteria 1268
193 Ga0070681_10089614 3300005458 Bacteria 3027
194 Ga0070681_10096062 3300005458 Bacteria 2912
195 Ga0068867_100003769 3300005459 Bacteria 10673
196 Ga0068867_100019029 3300005459 Bacteria 4889
197 Ga0068867_100049361 3300005459 Bacteria 3098
198 Ga0068867_100104085 3300005459 Bacteria 2172
199 Ga0068867_100111074 3300005459 Bacteria 2106
200 Ga0070685_10260627 3300005466 Bacteria 1153
201 Ga0070706_100027330 3300005467 Bacteria 5251
202 Ga0070706_100040485 3300005467 Bacteria 4301
203 Ga0070706_100573970 3300005467 Bacteria 1049
204 Ga0070707_100171948 3300005468 Bacteria 2111
205 Ga0070698_100077238 3300005471 Bacteria 3330
206 Ga0070698_100194250 3300005471 Bacteria 1967
207 Ga0070698_100198110 3300005471 Bacteria 1944
208 Ga0070699_100051724 3300005518 Bacteria 3557
209 Ga0070699_100335711 3300005518 Bacteria 1360
210 Ga0070679_100082146 3300005530 Bacteria 3212
211 Ga0070684_100038866 3300005535 Bacteria 4091
212 Ga0070697_100137437 3300005536 Bacteria 2053
213 Ga0068853_100021304 3300005539 Bacteria 5403
214 Ga0068853_100138104 3300005539 Bacteria 2187
215 Ga0068853_100280460 3300005539 Bacteria 1536
216 Ga0070672_100000559 3300005543 Bacteria 21793
217 Ga0070672_100001075 3300005543 Bacteria 16635
218 Ga0070672_100020445 3300005543 Bacteria 4828
219 Ga0070672_100086563 3300005543 Bacteria 2520
220 Ga0070672_100160032 3300005543 Bacteria 1867
221 Ga0070672_100213340 3300005543 Bacteria 1617
222 Ga0070686_100081925 3300005544 Bacteria 2139
223 Ga0070686_100160244 3300005544 Bacteria 1584
224 Ga0070693_100155711 3300005547 Bacteria 1451
225 Ga0070665_100140620 3300005548 Bacteria 2417
226 Ga0070665_100457944 3300005548 Bacteria 1285
227 Ga0070704_100004786 3300005549 Bacteria 7838
228 Ga0068855_100000065 3300005563 Bacteria 129307
229 Ga0068855_100053523 3300005563 Bacteria 4748
230 Ga0068855_100071387 3300005563 Bacteria 4038
231 Ga0068855_100087568 3300005563 Bacteria 3599
232 Ga0068855_100141910 3300005563 Bacteria 2737
233 Ga0068855_100233970 3300005563 Bacteria 2055
234 Ga0070664_100018873 3300005564 Bacteria 5669
235 Ga0070664_100020897 3300005564 Bacteria 5394
236 Ga0070664_100104091 3300005564 Bacteria 2471
237 Ga0070664_100291396 3300005564 Bacteria 1474
238 Ga0070664_100551389 3300005564 Bacteria 1066
239 Ga0068857_100009558 3300005577 Bacteria 8421
240 Ga0068857_100080714 3300005577 Bacteria 2904
241 Ga0068857_100256505 3300005577 Bacteria 1604
242 Ga0068854_100014807 3300005578 Bacteria 5149
243 Ga0068854_100024410 3300005578 Bacteria 4139
244 Ga0068856_100051596 3300005614 Bacteria 4055
245 Ga0068856_100267979 3300005614 Bacteria 1724
246 Ga0070702_100118276 3300005615 Bacteria 1655
247 Ga0068852_100006246 3300005616 Bacteria 8595
248 Ga0068852_100008168 3300005616 Bacteria 7687
249 Ga0068852_100040750 3300005616 Bacteria 3921
250 Ga0068859_100000737 3300005617 Bacteria 32959
251 Ga0068859_100252302 3300005617 Bacteria 1855
252 Ga0068864_100000840 3300005618 Bacteria 25896
253 Ga0068864_100001287 3300005618 Bacteria 20878
254 Ga0068864_100013771 3300005618 Bacteria 6706
255 Ga0068864_100031709 3300005618 Bacteria 4486
256 Ga0068864_100036830 3300005618 Bacteria 4172
257 Ga0068861_100005132 3300005719 Bacteria 8829
258 Ga0068861_100011169 3300005719 Bacteria 6235
259 Ga0068851_10009611 3300005834 Bacteria 4503
260 Ga0068851_10143297 3300005834 Bacteria 1301
261 Ga0068870_10027159 3300005840 Bacteria 2861
262 Ga0068863_100005089 3300005841 Bacteria 12965
263 Ga0068863_100011648 3300005841 Bacteria 8507
264 Ga0068863_100205428 3300005841 Bacteria 1896
265 Ga0068863_100376592 3300005841 Bacteria 1386
266 Ga0068858_100125906 3300005842 Bacteria 2399
267 Ga0068860_100002072 3300005843 Bacteria 21139
268 Ga0068860_100078105 3300005843 Bacteria 3148
269 Ga0068862_100011170 3300005844 Bacteria 7418
270 Ga0068862_100019343 3300005844 Bacteria 5683
271 Ga0068862_100024514 3300005844 Bacteria 5062
272 Ga0068862_100047853 3300005844 Bacteria 3650
273 Ga0068862_100406526 3300005844 Bacteria 1275
274 Ga0075368_10007221 3300006042 Bacteria 3915
275 Ga0075363_100049286 3300006048 Bacteria 2242
276 Ga0075362_10021576 3300006177 Bacteria 2705
277 Ga0075367_10113805 3300006178 Bacteria 1663
278 Ga0075369_10004056 3300006186 Bacteria 5382
279 Ga0075366_10012319 3300006195 Bacteria 4848
280 Ga0075366_10012445 3300006195 Bacteria 4826
281 Ga0075366_10018887 3300006195 Bacteria 3984
282 Ga0075366_10052320 3300006195 Bacteria 2427
283 Ga0075366_10052525 3300006195 Bacteria 2421
284 Ga0097621_100044191 3300006237 Bacteria 3594
285 Ga0075370_10012972 3300006353 Bacteria 4419
286 Ga0075370_10061718 3300006353 Bacteria 2135
287 Ga0075370_10162176 3300006353 Bacteria 1312
288 Ga0068871_100010530 3300006358 Bacteria 6755
289 Ga0068871_100023680 3300006358 Bacteria 4753
290 Ga0068871_100229083 3300006358 Bacteria 1612
291 Ga0068871_100237988 3300006358 Bacteria 1582
292 Ga0075428_100034656 3300006844 Bacteria 5566
293 Ga0075430_100018777 3300006846 Bacteria 5883
294 Ga0075431_100032658 3300006847 Bacteria 5364
295 Ga0075431_100119141 3300006847 Bacteria 2724
296 Ga0075433_10197446 3300006852 Bacteria 1789
297 Ga0075434_100000211 3300006871 Bacteria 39638
298 Ga0075434_100013586 3300006871 Bacteria 7758
299 Ga0075434_100417867 3300006871 Bacteria 1362
300 Ga0075429_100000463 3300006880 Bacteria 30330
301 Ga0068865_100009315 3300006881 Bacteria 6083
302 Ga0075436_100000711 3300006914 Bacteria 22075
303 Ga0097620_100000737 3300006931 Bacteria 32959
304 Ga0097620_100252305 3300006931 Bacteria 1855
305 Ga0099824_1022389 3300006942 Bacteria 4177
306 Ga0079104_1000002 3300006946 Bacteria 514469
307 Ga0079104_1004866 3300006946 Bacteria 5565
308 Ga0099826_10000028 3300006948 Bacteria 129794
309 Ga0075435_100001401 3300007076 Bacteria 15529
310 Ga0075435_100013086 3300007076 Bacteria 6162
311 Ga0075435_100027772 3300007076 Bacteria 4431
312 Ga0075435_100056631 3300007076 Bacteria 3170
313 Ga0105251_10000602 3300009011 Bacteria 32992
314 Ga0105251_10041204 3300009011 Bacteria 2249
315 Ga0105244_10053504 3300009036 Bacteria 2051
316 Ga0105250_10002860 3300009092 Bacteria 8447
317 Ga0105250_10015617 3300009092 Bacteria 3108
318 Ga0105240_10000297 3300009093 Bacteria 96825
319 Ga0105240_10009100 3300009093 Bacteria 14099
320 Ga0105240_10034284 3300009093 Bacteria 6549
321 Ga0105240_10038292 3300009093 Bacteria 6151
322 Ga0105240_10110669 3300009093 Bacteria 3324
323 Ga0105240_10145471 3300009093 Bacteria 2829
324 Ga0105240_10329241 3300009093 Bacteria 1738
325 Ga0111539_10066234 3300009094 Bacteria 4266
326 Ga0114129_10054355 3300009147 Bacteria 5613
327 Ga0105243_10001651 3300009148 Bacteria 19332
328 Ga0105243_10107188 3300009148 Bacteria 2330
329 Ga0105241_10111771 3300009174 Bacteria 2188
330 Ga0105241_10140213 3300009174 Bacteria 1967
331 Ga0105242_10000485 3300009176 Bacteria 31627
332 Ga0105242_10149273 3300009176 Bacteria 2037
333 Ga0105242_10170498 3300009176 Bacteria 1912
334 Ga0105242_10363313 3300009176 Bacteria 1340
335 Ga0105248_10008373 3300009177 Bacteria 11356
336 Ga0105248_10063680 3300009177 Bacteria 4139
337 Ga0105237_10059880 3300009545 Bacteria 3809
338 Ga0105238_10008362 3300009551 Bacteria 10352
339 Ga0105238_10017542 3300009551 Bacteria 7279
340 Ga0105238_10018705 3300009551 Bacteria 7056
341 Ga0105238_10165226 3300009551 Bacteria 2189
342 Ga0105238_10288918 3300009551 Bacteria 1622
343 Ga0105238_10362725 3300009551 Bacteria 1438
344 Ga0105239_10005209 3300010375 Bacteria 15299
345 Ga0105239_10027775 3300010375 Bacteria 6227
346 Ga0105239_10197986 3300010375 Bacteria 2250
347 Ga0157317_1002422 3300012475 Bacteria 1101
348 Ga0157373_10085063 3300013100 Bacteria 2229
349 Ga0157370_10174745 3300013104 Bacteria 1996
350 Ga0157369_10000179 3300013105 Bacteria 89102
351 Ga0157369_10040041 3300013105 Bacteria 5118
352 Ga0157369_10213725 3300013105 Bacteria 2021
353 Ga0157374_10130246 3300013296 Bacteria 2434
354 Ga0157374_10145394 3300013296 Bacteria 2303
355 Ga0157374_10260712 3300013296 Bacteria 1707
356 Ga0157378_10032916 3300013297 Bacteria 4582
357 Ga0157378_10427012 3300013297 Bacteria 1311
358 Ga0163162_10068472 3300013306 Bacteria 3601
359 Ga0163162_10143959 3300013306 Bacteria 2498
360 Ga0163162_10201421 3300013306 Bacteria 2119
361 Ga0163162_10206877 3300013306 Bacteria 2092
362 Ga0157372_10105731 3300013307 Bacteria 3219
363 Ga0157372_10408573 3300013307 Bacteria 1582
364 Ga0157375_10027001 3300013308 Bacteria 5360
365 Ga0163163_10010908 3300014325 Bacteria 8207
366 Ga0163163_10016193 3300014325 Bacteria 6921
367 Ga0157380_10091235 3300014326 Bacteria 2515
368 Ga0182008_10000215 3300014497 Bacteria 45361
369 Ga0182008_10031438 3300014497 Bacteria 2673
370 Ga0157377_10244905 3300014745 Bacteria 1159
371 Ga0157379_10001176 3300014968 Bacteria 21315
372 Ga0157379_10052546 3300014968 Bacteria 3640
373 Ga0157379_10351075 3300014968 Bacteria 1350
374 Ga0157376_10008506 3300014969 Bacteria 7410
375 Ga0157376_10039234 3300014969 Bacteria 3861
376 Ga0182007_10001432 3300015262 Bacteria 12788
377 Ga0182007_10001777 3300015262 Bacteria 11266
378 Ga0182005_1000666 3300015265 Bacteria 16243
379 Ga0183361_10009 3300016635 Bacteria 205218
380 Ga0163161_10024951 3300017792 Bacteria 4226
381 Ga0163161_10097325 3300017792 Bacteria 2186
382 Ga0163161_10163705 3300017792 Bacteria 1697
383 Ga0163161_10230061 3300017792 Bacteria 1438
384 Ga0213872_10000003 3300021361 Bacteria 366948
385 Ga0213872_10000042 3300021361 Bacteria 118474
386 Ga0213872_10000197 3300021361 Bacteria 53584
387 Ga0213872_10000641 3300021361 Bacteria 26449
388 Ga0213872_10002773 3300021361 Bacteria 10030
389 Ga0213872_10024475 3300021361 Bacteria 2777
390 Ga0213872_10095944 3300021361 Bacteria 1324
391 Ga0209435_100090 3300025206 Bacteria 42168
392 Ga0209435_100200 3300025206 Bacteria 17454
393 Ga0209436_100005 3300025208 Bacteria 151087
394 Ga0209784_100002 3300025224 Bacteria 1753105
395 Ga0209784_100019 3300025224 Bacteria 453558
396 Ga0209566_100003 3300025225 Bacteria 1753105
397 Ga0209566_100017 3300025225 Bacteria 453558
398 Ga0209566_100601 3300025225 Bacteria 22542
399 Ga0209674_100004 3300025226 Bacteria 1753105
400 Ga0209674_100005 3300025226 Bacteria 1708125
401 Ga0209674_100031 3300025226 Bacteria 453558
402 Ga0209674_100064 3300025226 Bacteria 265769
403 Ga0209674_100066 3300025226 Bacteria 256739
404 Ga0209674_100110 3300025226 Bacteria 149245
405 Ga0209674_106234 3300025226 Bacteria 1654
406 Ga0209672_100001 3300025228 Bacteria 2828210
407 Ga0209672_100051 3300025228 Bacteria 234414
408 Ga0209147_100001 3300025229 Bacteria 2384371
409 Ga0209147_100023 3300025229 Bacteria 437803
410 Ga0209147_100120 3300025229 Bacteria 142306
411 Ga0209147_100365 3300025229 Bacteria 32099
412 Ga0209563_100005 3300025230 Bacteria 1774893
413 Ga0209563_100006 3300025230 Bacteria 1753105
414 Ga0209563_100035 3300025230 Bacteria 453558
415 Ga0209563_100107 3300025230 Bacteria 143807
416 Ga0209563_100126 3300025230 Bacteria 113122
417 Ga0207427_100197 3300025231 Bacteria 57629
418 Ga0207427_102210 3300025231 Bacteria 5509
419 Ga0207427_104178 3300025231 Bacteria 2563
420 Ga0209437_100038 3300025233 Bacteria 453558
421 Ga0209437_100080 3300025233 Bacteria 275402
422 Ga0209437_106554 3300025233 Bacteria 1934
423 Ga0209258_100001 3300025242 Bacteria 2384269
424 Ga0209258_100179 3300025242 Bacteria 137687
425 Ga0209258_100262 3300025242 Bacteria 90619
426 Ga0209258_100280 3300025242 Bacteria 85790
427 Ga0209258_100850 3300025242 Bacteria 16453
428 Ga0209258_102660 3300025242 Bacteria 4414
429 Ga0209646_1000060 3300025246 Bacteria 256386
430 Ga0209646_1000072 3300025246 Bacteria 224823
431 Ga0209646_1000294 3300025246 Bacteria 42168
432 Ga0209646_1000296 3300025246 Bacteria 41627
433 Ga0209026_1000049 3300025250 Bacteria 255273
434 Ga0209026_1000150 3300025250 Bacteria 111025
435 Ga0209026_1005310 3300025250 Bacteria 3500
436 Ga0209677_100003 3300025253 Bacteria 1753105
437 Ga0209677_100020 3300025253 Bacteria 453558
438 Ga0209677_100052 3300025253 Bacteria 167826
439 Ga0209677_100099 3300025253 Bacteria 92370
440 Ga0209677_100229 3300025253 Bacteria 39781
441 Ga0209677_101485 3300025253 Bacteria 10081
442 Ga0209148_1000003 3300025254 Bacteria 2384288
443 Ga0209148_1000027 3300025254 Bacteria 616374
444 Ga0209148_1018870 3300025254 Bacteria 1152
445 Ga0209759_1000033 3300025256 Bacteria 276117
446 Ga0209759_1000069 3300025256 Bacteria 182437
447 Ga0209759_1000116 3300025256 Bacteria 141810
448 Ga0209759_1000294 3300025256 Bacteria 69209
449 Ga0209759_1000516 3300025256 Bacteria 41847
450 Ga0209759_1000520 3300025256 Bacteria 41628
451 Ga0209759_1001511 3300025256 Bacteria 12818
452 Ga0209759_1007805 3300025256 Bacteria 3396
453 Ga0209759_1018384 3300025256 Bacteria 1689
454 Ga0209759_1022355 3300025256 Bacteria 1415
455 Ga0209233_1000016 3300025261 Bacteria 907830
456 Ga0209233_1000049 3300025261 Bacteria 453558
457 Ga0209565_1000015 3300025263 Bacteria 494091
458 Ga0209565_1001112 3300025263 Bacteria 13136
459 Ga0209565_1002528 3300025263 Bacteria 6505
460 Ga0209565_1010164 3300025263 Bacteria 2345
461 Ga0209455_1000001 3300025272 Bacteria 2384278
462 Ga0209455_1000044 3300025272 Bacteria 410787
463 Ga0209455_1000191 3300025272 Bacteria 90618
464 Ga0209455_1000203 3300025272 Bacteria 85784
465 Ga0209673_1000017 3300025273 Bacteria 492994
466 Ga0209673_1000070 3300025273 Bacteria 241592
467 Ga0209673_1004714 3300025273 Bacteria 7183
468 Ga0209673_1009022 3300025273 Bacteria 4374
469 Ga0209130_1000055 3300025284 Bacteria 211696
470 Ga0209130_1009756 3300025284 Bacteria 2705
471 Ga0209130_1030316 3300025284 Bacteria 1119
472 Ga0209675_1000012 3300025291 Bacteria 494061
473 Ga0209675_1000212 3300025291 Bacteria 61040
474 Ga0209675_1003345 3300025291 Bacteria 7690
475 Ga0209675_1006703 3300025291 Bacteria 4565
476 Ga0209675_1008288 3300025291 Bacteria 3842
477 Ga0209676_1000066 3300025292 Bacteria 317897
478 Ga0209025_1000384 3300025294 Bacteria 91722
479 Ga0209025_1001071 3300025294 Bacteria 39701
480 Ga0209025_1002826 3300025294 Bacteria 17463
481 Ga0209025_1004282 3300025294 Bacteria 12519
482 Ga0209025_1070686 3300025294 Bacteria 1241
483 Ga0209564_1000002 3300025295 Bacteria 1636803
484 Ga0209564_1000003 3300025295 Bacteria 1585848
485 Ga0209564_1000007 3300025295 Bacteria 1028582
486 Ga0209564_1000016 3300025295 Bacteria 613131
487 Ga0209564_1000107 3300025295 Bacteria 214040
488 Ga0209564_1000124 3300025295 Bacteria 202046
489 Ga0209564_1001211 3300025295 Bacteria 29397
490 Ga0209564_1001981 3300025295 Bacteria 17955
491 Ga0209564_1007499 3300025295 Bacteria 5625
492 Ga0209564_1011129 3300025295 Bacteria 4064
493 Ga0209564_1012325 3300025295 Bacteria 3739
494 Ga0209050_1000145 3300025298 Bacteria 168151
495 Ga0209050_1000304 3300025298 Bacteria 100918
496 Ga0209050_1001774 3300025298 Bacteria 21266
497 Ga0209256_1000007 3300025299 Bacteria 1136599
498 Ga0209256_1000076 3300025299 Bacteria 234735
499 Ga0209256_1000183 3300025299 Bacteria 122266
500 Ga0209256_1000482 3300025299 Bacteria 59266
501 Ga0209256_1000659 3300025299 Bacteria 46883
502 Ga0209256_1001268 3300025299 Bacteria 27564
503 Ga0209256_1004161 3300025299 Bacteria 9340
504 Ga0209256_1005488 3300025299 Bacteria 7271
505 Ga0207426_1000326 3300025302 Bacteria 91021
506 Ga0207426_1019591 3300025302 Bacteria 2362
507 Ga0209051_1000018 3300025303 Bacteria 527061
508 Ga0209051_1007055 3300025303 Bacteria 6215
509 Ga0209051_1010277 3300025303 Bacteria 4748
510 Ga0209051_1014646 3300025303 Bacteria 3647
511 Ga0209051_1020441 3300025303 Bacteria 2850
512 Ga0209257_1000084 3300025304 Bacteria 291502
513 Ga0209257_1000450 3300025304 Bacteria 77403
514 Ga0209257_1016886 3300025304 Bacteria 2916
515 Ga0207697_10007133 3300025315 Bacteria 5002
516 Ga0207656_10005509 3300025321 Bacteria 4479
517 Ga0207656_10068785 3300025321 Bacteria 1570
518 Ga0207696_1007745 3300025711 Bacteria 4172
519 Ga0207655_1011552 3300025728 Bacteria 5246
520 Ga0207655_1018621 3300025728 Bacteria 3671
521 Ga0207713_1000372 3300025735 Bacteria 48799
522 Ga0207682_10000340 3300025893 Bacteria 21300
523 Ga0207682_10003157 3300025893 Bacteria 7219
524 Ga0207642_10095627 3300025899 Bacteria 1479
525 Ga0207688_10014892 3300025901 Bacteria 4220
526 Ga0207680_10014240 3300025903 Bacteria 4109
527 Ga0207647_10001108 3300025904 Bacteria 20725
528 Ga0207647_10027614 3300025904 Bacteria 3698
529 Ga0207647_10056661 3300025904 Bacteria 2404
530 Ga0207699_10059428 3300025906 Bacteria 2291
531 Ga0207645_10010068 3300025907 Bacteria 6510
532 Ga0207643_10033124 3300025908 Bacteria 2891
533 Ga0207705_10016982 3300025909 Bacteria 5213
534 Ga0207684_10420729 3300025910 Bacteria 1148
535 Ga0207707_10018084 3300025912 Bacteria 6142
536 Ga0207707_10093997 3300025912 Bacteria 2619
537 Ga0207695_10000475 3300025913 Bacteria 86957
538 Ga0207695_10001437 3300025913 Bacteria 40017
539 Ga0207695_10020920 3300025913 Bacteria 7477
540 Ga0207695_10022917 3300025913 Bacteria 7073
541 Ga0207695_10040295 3300025913 Bacteria 5011
542 Ga0207695_10146794 3300025913 Bacteria 2302
543 Ga0207695_10424850 3300025913 Bacteria 1213
544 Ga0207671_10020117 3300025914 Bacteria 5089
545 Ga0207671_10049115 3300025914 Bacteria 3123
546 Ga0207662_10042078 3300025918 Bacteria 2692
547 Ga0207662_10210223 3300025918 Bacteria 1263
548 Ga0207657_10000018 3300025919 Bacteria 172140
549 Ga0207657_10003155 3300025919 Bacteria 17626
550 Ga0207657_10053105 3300025919 Bacteria 3513
551 Ga0207657_10099258 3300025919 Bacteria 2419
552 Ga0207657_10174529 3300025919 Bacteria 1740
553 Ga0207657_10209485 3300025919 Bacteria 1565
554 Ga0207649_10021775 3300025920 Bacteria 3697
555 Ga0207652_10240084 3300025921 Bacteria 1633
556 Ga0207646_10140214 3300025922 Bacteria 2177
557 Ga0207681_10007645 3300025923 Bacteria 6624
558 Ga0207681_10092494 3300025923 Bacteria 2162
559 Ga0207681_10115405 3300025923 Bacteria 1960
560 Ga0207681_10192057 3300025923 Bacteria 1563
561 Ga0207694_10009631 3300025924 Bacteria 7284
562 Ga0207694_10010860 3300025924 Bacteria 6875
563 Ga0207694_10136429 3300025924 Bacteria 1971
564 Ga0207694_10152233 3300025924 Bacteria 1864
565 Ga0207650_10001837 3300025925 Bacteria 14987
566 Ga0207650_10003488 3300025925 Bacteria 10806
567 Ga0207650_10003973 3300025925 Bacteria 10123
568 Ga0207650_10004126 3300025925 Bacteria 9924
569 Ga0207650_10014460 3300025925 Bacteria 5486
570 Ga0207650_10015106 3300025925 Bacteria 5372
571 Ga0207650_10112412 3300025925 Bacteria 2110
572 Ga0207650_10119376 3300025925 Bacteria 2051
573 Ga0207659_10001657 3300025926 Bacteria 13216
574 Ga0207659_10010218 3300025926 Bacteria 5887
575 Ga0207659_10030562 3300025926 Bacteria 3682
576 Ga0207659_10038636 3300025926 Bacteria 3322
577 Ga0207659_10251127 3300025926 Bacteria 1435
578 Ga0207664_10214521 3300025929 Bacteria 1667
579 Ga0207644_10247746 3300025931 Bacteria 1420
580 Ga0207644_10266804 3300025931 Bacteria 1370
581 Ga0207690_10000006 3300025932 Bacteria 433880
582 Ga0207690_10011102 3300025932 Bacteria 5373
583 Ga0207690_10204772 3300025932 Bacteria 1501
584 Ga0207706_10024839 3300025933 Bacteria 5371
585 Ga0207706_10035752 3300025933 Bacteria 4414
586 Ga0207706_10044198 3300025933 Bacteria 3949
587 Ga0207686_10009173 3300025934 Bacteria 5366
588 Ga0207686_10025673 3300025934 Bacteria 3431
589 Ga0207686_10030202 3300025934 Bacteria 3206
590 Ga0207686_10246653 3300025934 Bacteria 1302
591 Ga0207709_10000015 3300025935 Bacteria 493221
592 Ga0207709_10103816 3300025935 Bacteria 1885
593 Ga0207709_10140273 3300025935 Bacteria 1660
594 Ga0207669_10003780 3300025937 Bacteria 6581
595 Ga0207669_10031387 3300025937 Bacteria 2968
596 Ga0207669_10071799 3300025937 Bacteria 2177
597 Ga0207665_10058978 3300025939 Bacteria 2596
598 Ga0207691_10000511 3300025940 Bacteria 38559
599 Ga0207691_10000657 3300025940 Bacteria 34133
600 Ga0207691_10012670 3300025940 Bacteria 8076
601 Ga0207691_10122253 3300025940 Bacteria 2306
602 Ga0207691_10387578 3300025940 Bacteria 1192
603 Ga0207711_10066563 3300025941 Bacteria 3116
604 Ga0207711_10195075 3300025941 Bacteria 1847
605 Ga0207711_10269649 3300025941 Bacteria 1566
606 Ga0207711_10286956 3300025941 Bacteria 1516
607 Ga0207689_10005742 3300025942 Bacteria 11024
608 Ga0207689_10029190 3300025942 Bacteria 4609
609 Ga0207661_10011699 3300025944 Bacteria 6369
610 Ga0207661_10061378 3300025944 Bacteria 3037
611 Ga0207679_10008750 3300025945 Bacteria 6458
612 Ga0207679_10036127 3300025945 Bacteria 3502
613 Ga0207679_10168884 3300025945 Bacteria 1799
614 Ga0207667_10000025 3300025949 Bacteria 350159
615 Ga0207667_10061603 3300025949 Bacteria 3925
616 Ga0207667_10069899 3300025949 Bacteria 3655
617 Ga0207667_10078887 3300025949 Bacteria 3412
618 Ga0207667_10108582 3300025949 Bacteria 2862
619 Ga0207667_10178935 3300025949 Bacteria 2178
620 Ga0207667_10184930 3300025949 Bacteria 2139
621 Ga0207667_10205750 3300025949 Bacteria 2018
622 Ga0207667_10239869 3300025949 Bacteria 1855
623 Ga0207651_10019880 3300025960 Bacteria 4037
624 Ga0207651_10025944 3300025960 Bacteria 3651
625 Ga0207651_10053906 3300025960 Bacteria 2752
626 Ga0207651_10101946 3300025960 Bacteria 2132
627 Ga0207651_10147727 3300025960 Bacteria 1825
628 Ga0207651_10268137 3300025960 Bacteria 1405
629 Ga0207668_10010948 3300025972 Bacteria 5498
630 Ga0207668_10144250 3300025972 Bacteria 1835
631 Ga0207640_10079052 3300025981 Bacteria 2241
632 Ga0207658_10037156 3300025986 Bacteria 3496
633 Ga0207658_10166683 3300025986 Bacteria 1810
634 Ga0207677_10008977 3300026023 Bacteria 5607
635 Ga0207677_10021231 3300026023 Bacteria 3963
636 Ga0207677_10027378 3300026023 Bacteria 3589
637 Ga0207703_10039632 3300026035 Bacteria 3765
638 Ga0207703_10087754 3300026035 Bacteria 2609
639 Ga0207639_10333347 3300026041 Bacteria 1351
640 Ga0207639_10448162 3300026041 Bacteria 1171
641 Ga0207678_10001481 3300026067 Bacteria 21537
642 Ga0207678_10006930 3300026067 Bacteria 10059
643 Ga0207678_10146251 3300026067 Bacteria 2017
644 Ga0207678_10146390 3300026067 Bacteria 2016
645 Ga0207708_10021936 3300026075 Bacteria 4820
646 Ga0207708_10270499 3300026075 Bacteria 1374
647 Ga0207702_10001447 3300026078 Bacteria 23592
648 Ga0207702_10167492 3300026078 Bacteria 2011
649 Ga0207702_10189982 3300026078 Bacteria 1897
650 Ga0207641_10003449 3300026088 Bacteria 14004
651 Ga0207641_10008903 3300026088 Bacteria 8291
652 Ga0207648_10004759 3300026089 Bacteria 13865
653 Ga0207648_10009000 3300026089 Bacteria 9603
654 Ga0207648_10012937 3300026089 Bacteria 7793
655 Ga0207648_10027131 3300026089 Bacteria 5086
656 Ga0207648_10032660 3300026089 Bacteria 4593
657 Ga0207648_10066013 3300026089 Bacteria 3155
658 Ga0207648_10202806 3300026089 Bacteria 1759
659 Ga0207676_10004842 3300026095 Bacteria 9543
660 Ga0207676_10008136 3300026095 Bacteria 7455
661 Ga0207676_10016812 3300026095 Bacteria 5297
662 Ga0207676_10023784 3300026095 Bacteria 4526
663 Ga0207676_10101649 3300026095 Bacteria 2384
664 Ga0207676_10192068 3300026095 Bacteria 1797
665 Ga0207676_10235421 3300026095 Bacteria 1639
666 Ga0207674_10009285 3300026116 Bacteria 11268
667 Ga0207674_10014937 3300026116 Bacteria 8556
668 Ga0207674_10038859 3300026116 Bacteria 4937
669 Ga0207675_100003033 3300026118 Bacteria 16464
670 Ga0207675_100016941 3300026118 Bacteria 6810
671 Ga0207675_100024354 3300026118 Bacteria 5629
672 Ga0207675_100111015 3300026118 Bacteria 2587
673 Ga0207675_100212678 3300026118 Bacteria 1861
674 Ga0207683_10001153 3300026121 Bacteria 24057
675 Ga0207683_10004610 3300026121 Bacteria 11879
676 Ga0207683_10008024 3300026121 Bacteria 9029
677 Ga0207683_10026480 3300026121 Bacteria 5003
678 Ga0207698_10018026 3300026142 Bacteria 4802
679 Ga0209281_1000007 3300027111 Bacteria 938265
680 Ga0209281_1003905 3300027111 Bacteria 4663
681 Ga0209371_1000181 3300027312 Bacteria 93199
682 Ga0209371_1006167 3300027312 Bacteria 4525
683 Ga0209371_1014768 3300027312 Bacteria 2125
684 Ga0209969_1002277 3300027360 Bacteria 2647
685 Ga0209967_1002470 3300027364 Bacteria 2395
686 Ga0209996_1000164 3300027395 Bacteria 8493
687 Ga0210000_1003217 3300027462 Bacteria 2345
688 Ga0209995_1001528 3300027471 Bacteria 3579
689 Ga0209995_1003905 3300027471 Bacteria 2379
690 Ga0209968_1000368 3300027526 Bacteria 7397
691 Ga0209999_1011391 3300027543 Bacteria 1609
692 Ga0209282_1000051 3300027666 Bacteria 107809
693 Ga0209971_1002442 3300027682 Bacteria 4469
694 Ga0209971_1008899 3300027682 Bacteria 2382
695 Ga0209966_1000074 3300027695 Bacteria 43833
696 Ga0209998_10004405 3300027717 Bacteria 2993
697 Ga0209813_10018373 3300027866 Bacteria 1931
698 Ga0209974_10025808 3300027876 Bacteria 1945
699 Ga0268266_10076660 3300028379 Bacteria 2906
700 Ga0268265_10019427 3300028380 Bacteria 4723
701 Ga0268265_10028420 3300028380 Bacteria 4003
702 Ga0268265_10029869 3300028380 Bacteria 3920
703 Ga0268264_10001934 3300028381 Bacteria 18658
704 Ga0268264_10118668 3300028381 Bacteria 2328
705 Ga0268264_10251300 3300028381 Bacteria 1643
706 Ga0265336_10000123 3300028666 Bacteria 57956
707 Ga0307515_10000040 3300028794 Bacteria 322704
708 Ga0265338_10105861 3300028800 Bacteria 2279
709 Ga0265338_10315664 3300028800 Bacteria 1133
710 Ga0265324_10000361 3300029957 Bacteria 32911
711 Ga0268256_1000151 3300030500 Bacteria 93199
712 Ga0268256_1006158 3300030500 Bacteria 4519
713 Ga0268256_1014814 3300030500 Bacteria 2297
714 Ga0316180_1046710 3300030736 Bacteria 1760
715 Ga0265330_10000133 3300031235 Bacteria 59545
716 Ga0265332_10000001 3300031238 Bacteria 863783
717 Ga0265332_10000010 3300031238 Bacteria 289041
718 Ga0265332_10001971 3300031238 Bacteria 10804
719 Ga0265328_10016557 3300031239 Bacteria 2866
720 Ga0265329_10033973 3300031242 Bacteria 1648
721 Ga0265340_10002720 3300031247 Bacteria 10068
722 Ga0265331_10000996 3300031250 Bacteria 22244
723 Ga0265316_10008143 3300031344 Bacteria 9757
724 Ga0307513_10097991 3300031456 Bacteria 2965
725 Ga0307513_10298998 3300031456 Bacteria 1377
726 Ga0307509_10012999 3300031507 Bacteria 9886
727 Ga0307408_100000022 3300031548 Bacteria 310242
728 Ga0307408_100000439 3300031548 Bacteria 36782
729 Ga0307408_100001348 3300031548 Bacteria 18399
730 Ga0307408_100014832 3300031548 Bacteria 5182
731 Ga0307408_100031547 3300031548 Bacteria 3690
732 Ga0307408_100268935 3300031548 Bacteria 1414
733 Ga0307408_100372284 3300031548 Bacteria 1218
734 Ga0316575_10000023 3300031665 Bacteria 38722
735 Ga0316575_10000505 3300031665 Bacteria 11281
736 Ga0265314_10000013 3300031711 Bacteria 403405
737 Ga0265314_10001503 3300031711 Bacteria 25802
738 Ga0265342_10039179 3300031712 Bacteria 2881
739 Ga0316576_10053328 3300031727 Bacteria 2946
740 Ga0316578_10002083 3300031728 Bacteria 8564
741 Ga0307516_10162892 3300031730 Bacteria 1979
742 Ga0307405_10001449 3300031731 Bacteria 9994
743 Ga0307405_10011206 3300031731 Bacteria 4684
744 Ga0307405_10133923 3300031731 Bacteria 1717
745 Ga0307405_10161291 3300031731 Bacteria 1588
746 Ga0307405_10427599 3300031731 Bacteria 1044
747 Ga0316577_10149807 3300031733 Bacteria 1315
748 Ga0307413_10010124 3300031824 Bacteria 4553
749 Ga0307410_10003953 3300031852 Bacteria 7552
750 Ga0307410_10008212 3300031852 Bacteria 5776
751 Ga0307410_10014477 3300031852 Bacteria 4642
752 Ga0307406_10006988 3300031901 Bacteria 6250
753 Ga0307406_10010926 3300031901 Bacteria 5135
754 Ga0307406_10014813 3300031901 Bacteria 4494
755 Ga0307406_10047317 3300031901 Bacteria 2711
756 Ga0307406_10080300 3300031901 Bacteria 2165
757 Ga0307406_10146030 3300031901 Bacteria 1681
758 Ga0307407_10008265 3300031903 Bacteria 4767
759 Ga0307407_10011484 3300031903 Bacteria 4217
760 Ga0307407_10175615 3300031903 Bacteria 1415
761 Ga0307412_10000005 3300031911 Bacteria 526194
762 Ga0307412_10006540 3300031911 Bacteria 6596
763 Ga0307412_10013719 3300031911 Bacteria 4760
764 Ga0307412_10045390 3300031911 Bacteria 2872
765 Ga0307412_10096155 3300031911 Bacteria 2084
766 Ga0307409_100001860 3300031995 Bacteria 10740
767 Ga0307409_100006670 3300031995 Bacteria 6819
768 Ga0307409_100133032 3300031995 Bacteria 2129
769 Ga0307409_100158677 3300031995 Bacteria 1975
770 Ga0307409_100248226 3300031995 Bacteria 1625
771 Ga0307416_100001396 3300032002 Bacteria 13086
772 Ga0307416_100018054 3300032002 Bacteria 4957
773 Ga0307416_100122363 3300032002 Bacteria 2322
774 Ga0307416_100189464 3300032002 Bacteria 1938
775 Ga0307414_10007639 3300032004 Bacteria 6086
776 Ga0307414_10033326 3300032004 Bacteria 3404
777 Ga0307411_10015987 3300032005 Bacteria 4236
778 Ga0307411_10145577 3300032005 Bacteria 1753
779 Ga0307411_10415699 3300032005 Bacteria 1116
780 Ga0307415_100007017 3300032126 Bacteria 6126
781 Ga0307415_100031788 3300032126 Bacteria 3405
782 Ga0307510_10007396 3300033180 Bacteria 13098
783 Ga0373934_0021275 3300035086 Bacteria 2497
784 Ga0373952_0002596 3300035092 Bacteria 3255
785 Ga0373952_0005475 3300035092 Bacteria 2322
786 Ga0373939_0021383 3300035114 Bacteria 1770
787 Ga0373954_0000001 3300035118 Bacteria 158201
788 Ga0373956_0025311 3300035119 Bacteria 2564
789 Ga0373955_0110442 3300035172 Bacteria 1589
790 Ga0316574_0002756 3300035398 Bacteria 8916
791 Ga0316574_0037245 3300035398 Bacteria 2982
792 Ga0373924_0011995 3300035410 Bacteria 3229
793 Ga0373931_0010108 3300035691 Bacteria 4526
794 Ga0373931_0062980 3300035691 Bacteria 2003
795 Ga0373927_0040217 3300035695 Bacteria 3034
796 Ga0373927_0229112 3300035695 Bacteria 1221
797 Ga0373933_0009723 3300035724 Bacteria 5262
798 Ga0373933_0053917 3300035724 Bacteria 2408
799 Ga0373937_0002345 3300036401 Bacteria 15783
800 Ga0373937_0082773 3300036401 Bacteria 2969
801 Ga0373937_0157684 3300036401 Bacteria 2128
802 Ga0316582_0015925 3300036647 Bacteria 4312
803 Ga0316584_0015597 3300036712 Bacteria 5435
804 Ga0373925_0194648 3300037068 Bacteria 1610
805 Ga0373925_0226615 3300037068 Bacteria 1493
806 Ga0395899_0014587 3300037312 Bacteria 5998
807 Ga0395899_0027329 3300037312 Bacteria 4302
808 Ga0395899_0029304 3300037312 Bacteria 4140
809 Ga0395899_0078383 3300037312 Bacteria 2408
810 Ga0395899_0123930 3300037312 Bacteria 1849
811 Ga0395900_0000229 3300037418 Bacteria 88118
812 Ga0395900_0005063 3300037418 Bacteria 13830
813 Ga0395900_0005889 3300037418 Bacteria 12802
814 Ga0395900_0069915 3300037418 Bacteria 3609
815 Ga0395900_0076106 3300037418 Bacteria 3450
816 Ga0395900_0147005 3300037418 Bacteria 2409
817 Ga0395898_0055156 3300037466 Bacteria 3876
818 Ga0395898_0101462 3300037466 Bacteria 2763
819 Ga0395898_0103642 3300037466 Bacteria 2729
820 Ga0395898_0140493 3300037466 Bacteria 2312
821 Ga0395898_0244466 3300037466 Bacteria 1711
822 Ga0395898_0254175 3300037466 Bacteria 1676
823 Ga0395905_0000059 3300037471 Bacteria 198101
824 Ga0395905_0001515 3300037471 Bacteria 27796
825 Ga0395905_0002380 3300037471 Bacteria 20938
826 Ga0395905_0004975 3300037471 Bacteria 13689
827 Ga0395905_0026529 3300037471 Bacteria 5462
828 Ga0395905_0027140 3300037471 Bacteria 5400
829 Ga0395905_0045716 3300037471 Bacteria 4106
830 Ga0395905_0060945 3300037471 Bacteria 3528
831 Ga0316581_0000886 3300037588 Bacteria 6331
832 Ga0395901_0003564 3300038443 Bacteria 15698
833 Ga0395901_0013050 3300038443 Bacteria 8433
834 Ga0395901_0018224 3300038443 Bacteria 7168
835 Ga0395901_0042434 3300038443 Bacteria 4716
836 Ga0395901_0209008 3300038443 Bacteria 2043
837 Ga0436360_0690189 3300039438 Bacteria 2890
838 Ga0436361_0039956 3300039447 Bacteria 11953
839 Ga0436361_0577632 3300039447 Bacteria 2709
840 Ga0436361_0590531 3300039447 Bacteria 50583
841 Ga0436361_0616441 3300039447 Bacteria 29495
842 Ga0436361_0878220 3300039447 Bacteria 10265
843 Ga0436361_0926482 3300039447 Bacteria 8198
844 Ga0436361_1094903 3300039447 Bacteria 1252
845 Ga0436361_1150385 3300039447 Bacteria 105721
846 Ga0439436_0021132 3300041404 Bacteria 1936
847 Ga0451797_0462561 3300041453 Bacteria 1565
848 Ga0451807_0693819 3300041486 Bacteria 2357
849 Ga0451853_1690372 3300041512 Bacteria 2346
850 Ga0439443_005113 3300042003 Bacteria 1742
851 Ga0439462_0001510 3300042015 Bacteria 5204
852 Ga0450920_000782 3300042122 Bacteria 5132
853 Ga0450923_004002 3300042125 Bacteria 2280
854 Ga0450923_004577 3300042125 Bacteria 2176
855 Ga0450898_012896 3300042134 Bacteria 1387
856 Ga0439446_0059545 3300042156 Bacteria 1152
857 Ga0450908_000192 3300042184 Bacteria 12530
858 Ga0439434_0010251 3300042435 Bacteria 2762
859 Ga0439434_0059421 3300042435 Bacteria 1194
860 Ga0439435_0000279 3300042436 Bacteria 7539
861 Ga0439444_0003396 3300042437 Bacteria 2249
862 Ga0439459_0001318 3300042438 Bacteria 3618
863 Ga0439460_0020137 3300042461 Bacteria 1812
864 Ga0439460_0054942 3300042461 Bacteria 1202
865 Ga0450918_004421 3300042531 Bacteria 2559
866 Ga0451577_0000002 3300042876 Bacteria 1731375
867 Ga0451577_0000152 3300042876 Bacteria 153284
868 Ga0451577_0009047 3300042876 Bacteria 9614
869 Ga0451577_0018493 3300042876 Bacteria 6419
870 Ga0451577_0041881 3300042876 Bacteria 4109
871 Ga0451577_0076722 3300042876 Bacteria 2979
872 Ga0466969_0000147 3300044656 Bacteria 38236
873 Ga0466969_0003356 3300044656 Bacteria 8525
874 Ga0466969_0018747 3300044656 Bacteria 3602
875 Ga0466972_0000181 3300044658 Bacteria 48590
876 Ga0466972_0001865 3300044658 Bacteria 10332
877 Ga0466972_0068264 3300044658 Bacteria 1698
878 Ga0466972_0092114 3300044658 Bacteria 1437
879 Ga0466982_0053105 3300044672 Bacteria 2486
880 Ga0466982_0164584 3300044672 Bacteria 1350
881 Ga0453683_0000003 3300044673 Bacteria 942572
882 Ga0466965_0000486 3300044683 Bacteria 14114
883 Ga0466965_0072608 3300044683 Bacteria 1731
884 Ga0466965_0104281 3300044683 Bacteria 1452
885 Ga0466966_0007276 3300044684 Bacteria 7335
886 Ga0466966_0014215 3300044684 Bacteria 5271
887 Ga0466966_0037337 3300044684 Bacteria 3133
888 Ga0466961_0032784 3300044693 Bacteria 3337
889 Ga0466961_0044854 3300044693 Bacteria 2829
890 Ga0466961_0093369 3300044693 Bacteria 1898
891 Ga0466963_0021413 3300044694 Bacteria 4078
892 Ga0466964_0013417 3300044706 Bacteria 3109
893 Ga0453684_0000002 3300044712 Bacteria 1731375
894 Ga0453684_0000029 3300044712 Bacteria 757969
895 Ga0453684_0000122 3300044712 Bacteria 340529
896 Ga0466971_0002862 3300044719 Bacteria 7320
897 Ga0466968_0025979 3300044735 Bacteria 2401
898 Ga0466970_0015077 3300044765 Bacteria 3975
899 Ga0466970_0034730 3300044765 Bacteria 2670
900 Ga0466970_0046760 3300044765 Bacteria 2305
901 Ga0466970_0102714 3300044765 Bacteria 1557
902 Ga0466957_0014789 3300044842 Bacteria 4546
903 Ga0466957_0027037 3300044842 Bacteria 3407
904 Ga0466960_0012884 3300044901 Bacteria 3540
905 Ga0466959_0001734 3300045049 Bacteria 13556
906 Ga0466959_0006971 3300045049 Bacteria 7897
907 Ga0466959_0009426 3300045049 Bacteria 6944
908 Ga0466959_0013918 3300045049 Bacteria 5839
909 Ga0466959_0034741 3300045049 Bacteria 3729
910 Ga0466959_0131437 3300045049 Bacteria 1774
911 Ga0451576_0000004 3300045051 Bacteria 1312238
912 Ga0451576_0000937 3300045051 Bacteria 55001
913 Ga0451576_0001995 3300045051 Bacteria 32320
914 Ga0451576_0531785 3300045051 Bacteria 1235
915 Ga0466958_0018038 3300045836 Bacteria 4090
916 Ga0466958_0076484 3300045836 Bacteria 2054
917 Ga0466958_0138858 3300045836 Bacteria 1529
918 Ga0466967_0018215 3300045976 Bacteria 5604
919 Ga0495617_003418 3300046452 Bacteria 5981
920 Ga0495627_000005 3300046453 Bacteria 630805
921 Ga0495627_000008 3300046453 Bacteria 572150
922 Ga0495592_0035366 3300046454 Bacteria 3764
923 Ga0495603_0004454 3300046455 Bacteria 8355
924 Ga0495590_0000006 3300046457 Bacteria 372949
925 Ga0495591_009140 3300046458 Bacteria 3966
926 Ga0495629_0004774 3300046459 Bacteria 10161
927 Ga0495629_0008044 3300046459 Bacteria 7761
928 Ga0495629_0048051 3300046459 Bacteria 2992
929 Ga0495638_0000891 3300046460 Bacteria 30617
930 Ga0495638_0075921 3300046460 Bacteria 2048
931 Ga0495651_0118772 3300046462 Bacteria 1945
932 Ga0495651_0139087 3300046462 Bacteria 1763
933 Ga0495651_0146938 3300046462 Bacteria 1703
934 Ga0495653_0005110 3300046463 Bacteria 10650
935 Ga0495653_0048194 3300046463 Bacteria 3290
936 Ga0495653_0053553 3300046463 Bacteria 3086
937 Ga0495653_0093258 3300046463 Bacteria 2196
938 Ga0495653_0130559 3300046463 Bacteria 1779
939 Ga0495650_0000042 3300046471 Bacteria 357244
940 Ga0495650_0001355 3300046471 Bacteria 24323
941 Ga0495650_0001969 3300046471 Bacteria 18130
942 Ga0495650_0018615 3300046471 Bacteria 3445
943 Ga0495580_0001332 3300046472 Bacteria 21777
944 Ga0495580_0001735 3300046472 Bacteria 19158
945 Ga0495580_0002424 3300046472 Bacteria 16292
946 Ga0495580_0006696 3300046472 Bacteria 9354
947 Ga0495580_0009620 3300046472 Bacteria 7590
948 Ga0495580_0044936 3300046472 Bacteria 3139
949 Ga0495580_0092583 3300046472 Bacteria 2104
950 Ga0495580_0099819 3300046472 Bacteria 2019
951 Ga0495580_0130771 3300046472 Bacteria 1741
952 Ga0495582_0002157 3300046473 Bacteria 11010
953 Ga0495582_0039323 3300046473 Bacteria 2604
954 Ga0495582_0094002 3300046473 Bacteria 1673
955 Ga0495605_0004289 3300046474 Bacteria 8400
956 Ga0495605_0008150 3300046474 Bacteria 5924
957 Ga0495605_0013495 3300046474 Bacteria 4498
958 Ga0495605_0025104 3300046474 Bacteria 3107
959 Ga0495662_0021575 3300046476 Bacteria 3111
960 Ga0495664_0001925 3300046477 Bacteria 11055
961 Ga0495664_0002295 3300046477 Bacteria 10259
962 Ga0495664_0087473 3300046477 Bacteria 1872
963 Ga0495585_0009165 3300046492 Bacteria 5955
964 Ga0495594_0043606 3300046499 Bacteria 2459
965 Ga0495596_0001853 3300046500 Bacteria 11731
966 Ga0495596_0005945 3300046500 Bacteria 5693
967 Ga0495596_0031217 3300046500 Bacteria 2129
968 Ga0495596_0032079 3300046500 Bacteria 2096
969 Ga0495607_0004242 3300046501 Bacteria 10626
970 Ga0495607_0016789 3300046501 Bacteria 4719
971 Ga0495607_0048930 3300046501 Bacteria 2469
972 Ga0495583_0000046 3300046506 Bacteria 218059
973 Ga0495583_0000199 3300046506 Bacteria 100936
974 Ga0495583_0001566 3300046506 Bacteria 22601
975 Ga0495583_0007029 3300046506 Bacteria 7196
976 Ga0495583_0013937 3300046506 Bacteria 4456
977 Ga0495583_0030561 3300046506 Bacteria 2621
978 Ga0495606_0001300 3300046507 Bacteria 34419
979 Ga0495606_0013495 3300046507 Bacteria 6445
980 Ga0495606_0017051 3300046507 Bacteria 5508
981 Ga0495606_0023111 3300046507 Bacteria 4514
982 Ga0495606_0038631 3300046507 Bacteria 3227
983 Ga0495608_0004149 3300046511 Bacteria 10386
984 Ga0495608_0014134 3300046511 Bacteria 5538
985 Ga0495608_0018660 3300046511 Bacteria 4781
986 Ga0495608_0047765 3300046511 Bacteria 2845
987 Ga0495608_0146859 3300046511 Bacteria 1504
988 Ga0495610_0000965 3300046512 Bacteria 26628
989 Ga0495610_0015349 3300046512 Bacteria 4455
990 Ga0495610_0026492 3300046512 Bacteria 3094
991 Ga0495610_0076293 3300046512 Bacteria 1550
992 Ga0495616_0000277 3300046513 Bacteria 41639
993 Ga0495616_0000591 3300046513 Bacteria 27295
994 Ga0495616_0020712 3300046513 Bacteria 3572
995 Ga0495618_0009318 3300046514 Bacteria 5926
996 Ga0495618_0010152 3300046514 Bacteria 5695
997 Ga0495618_0030402 3300046514 Bacteria 3373
998 Ga0495628_0000146 3300046516 Bacteria 61136
999 Ga0495628_0003520 3300046516 Bacteria 14012
1000 Ga0495628_0007838 3300046516 Bacteria 9208
1001 Ga0495628_0020360 3300046516 Bacteria 5474
1002 Ga0495628_0167092 3300046516 Bacteria 1669
1003 Ga0495630_0035764 3300046517 Bacteria 3711
1004 Ga0495630_0117817 3300046517 Bacteria 2013
1005 Ga0495630_0135315 3300046517 Bacteria 1872
1006 Ga0495630_0191297 3300046517 Bacteria 1561
1007 Ga0495631_0020358 3300046518 Bacteria 3100
1008 Ga0495632_0026742 3300046519 Bacteria 3032
1009 Ga0495637_0000056 3300046520 Bacteria 98978
1010 Ga0495637_0014948 3300046520 Bacteria 3651
1011 Ga0495643_0000338 3300046522 Bacteria 63855
1012 Ga0495643_0003899 3300046522 Bacteria 10710
1013 Ga0495643_0046323 3300046522 Bacteria 2358
1014 Ga0495648_0000061 3300046524 Bacteria 151604
1015 Ga0495648_0006586 3300046524 Bacteria 9443
1016 Ga0495648_0033963 3300046524 Bacteria 3326
1017 Ga0495648_0034382 3300046524 Bacteria 3298
1018 Ga0495648_0043479 3300046524 Bacteria 2815
1019 Ga0495663_0005509 3300046525 Bacteria 3512
1020 Ga0495666_0001948 3300046526 Bacteria 10170
1021 Ga0495666_0002505 3300046526 Bacteria 9118
1022 Ga0495666_0004887 3300046526 Bacteria 6776
1023 Ga0495666_0009093 3300046526 Bacteria 4970
1024 Ga0495666_0019313 3300046526 Bacteria 3383
1025 Ga0495642_0038142 3300046528 Bacteria 1946
1026 Ga0495652_0003179 3300046529 Bacteria 16373
1027 Ga0495652_0005145 3300046529 Bacteria 12356
1028 Ga0495654_0000002 3300046530 Bacteria 1021205
1029 Ga0495665_0006633 3300046531 Bacteria 6246
1030 Ga0495665_0007109 3300046531 Bacteria 6039
1031 Ga0495665_0021549 3300046531 Bacteria 3462
1032 Ga0495665_0025980 3300046531 Bacteria 3144
1033 Ga0495665_0044296 3300046531 Bacteria 2364
1034 Ga0495665_0066826 3300046531 Bacteria 1896
1035 Ga0495665_0088612 3300046531 Bacteria 1626
1036 Ga0495640_0039067 3300046533 Bacteria 3333
1037 Ga0495640_0053364 3300046533 Bacteria 2771
1038 Ga0495586_0015604 3300046535 Bacteria 4041
1039 Ga0495586_0024691 3300046535 Bacteria 3214
1040 Ga0495586_0051886 3300046535 Bacteria 2220
1041 Ga0495587_0009070 3300046536 Bacteria 6384
1042 Ga0495587_0009851 3300046536 Bacteria 6102
1043 Ga0495609_0000068 3300046538 Bacteria 129809
1044 Ga0495609_0006564 3300046538 Bacteria 5925
1045 Ga0495609_0006753 3300046538 Bacteria 5813
1046 Ga0495609_0008300 3300046538 Bacteria 5092
1047 Ga0495609_0014009 3300046538 Bacteria 3776
1048 Ga0495597_0003195 3300046542 Bacteria 9766
1049 Ga0495597_0037407 3300046542 Bacteria 2179
1050 Ga0495597_0042258 3300046542 Bacteria 2033
1051 Ga0495645_0002615 3300046543 Bacteria 12247
1052 Ga0495645_0085294 3300046543 Bacteria 2261
1053 Ga0495622_0000103 3300046557 Bacteria 74095
1054 Ga0495622_0000302 3300046557 Bacteria 37049
1055 Ga0495622_0015026 3300046557 Bacteria 3598
1056 Ga0495633_0000098 3300046558 Bacteria 117269
1057 Ga0495633_0007613 3300046558 Bacteria 6201
1058 Ga0495668_0001564 3300046616 Bacteria 21690
1059 Ga0495668_0056124 3300046616 Bacteria 2174
1060 Ga0495668_0059443 3300046616 Bacteria 2109
1061 Ga0495634_0020033 3300046642 Bacteria 4746
1062 Ga0495634_0031484 3300046642 Bacteria 3653
1063 Ga0495634_0046473 3300046642 Bacteria 2929
1064 Ga0495611_0003553 3300046648 Bacteria 6851
1065 Ga0495625_0001274 3300046660 Bacteria 31651
1066 Ga0495625_0001560 3300046660 Bacteria 27286
1067 Ga0495625_0004014 3300046660 Bacteria 14079
1068 Ga0495625_0023355 3300046660 Bacteria 4724
1069 Ga0495625_0045383 3300046660 Bacteria 3177
1070 Ga0495635_0013156 3300046663 Bacteria 5792
1071 Ga0495635_0033384 3300046663 Bacteria 3570
1072 Ga0495661_0000214 3300046665 Bacteria 66777
1073 Ga0495661_0003694 3300046665 Bacteria 11243
1074 Ga0495661_0006774 3300046665 Bacteria 8033
1075 Ga0495661_0027992 3300046665 Bacteria 3614
1076 Ga0495661_0114645 3300046665 Bacteria 1497
1077 Ga0495588_0011122 3300046674 Bacteria 4213
1078 Ga0495657_0099532 3300046675 Bacteria 1854
1079 Ga0495657_0172549 3300046675 Bacteria 1331
1080 Ga0495599_0010704 3300046678 Bacteria 5617
1081 Ga0495599_0031631 3300046678 Bacteria 3321
1082 Ga0495599_0061717 3300046678 Bacteria 2341
1083 Ga0495599_0150574 3300046678 Bacteria 1441
1084 Ga0495623_0007478 3300046679 Bacteria 7092
1085 Ga0495623_0011348 3300046679 Bacteria 5765
1086 Ga0495623_0020400 3300046679 Bacteria 4283
1087 Ga0495623_0050894 3300046679 Bacteria 2622
1088 Ga0495623_0083931 3300046679 Bacteria 1966
1089 Ga0495646_0001277 3300046680 Bacteria 14817
1090 Ga0495646_0005738 3300046680 Bacteria 7865
1091 Ga0495646_0040548 3300046680 Bacteria 2866
1092 Ga0495646_0043769 3300046680 Bacteria 2739
1093 Ga0495646_0078754 3300046680 Bacteria 1925
1094 Ga0495669_0011616 3300046684 Bacteria 3742
1095 Ga0495669_0018504 3300046684 Bacteria 2995
1096 Ga0495613_0002040 3300046689 Bacteria 15344
1097 Ga0495613_0052155 3300046689 Bacteria 3013
1098 Ga0495613_0059926 3300046689 Bacteria 2788
1099 Ga0495624_0014397 3300046690 Bacteria 5367
1100 Ga0495624_0037912 3300046690 Bacteria 3099
1101 Ga0495624_0081590 3300046690 Bacteria 2002
1102 Ga0495624_0091403 3300046690 Bacteria 1877
1103 Ga0495670_0032851 3300046691 Bacteria 2581
1104 Ga0495671_0009461 3300046692 Bacteria 5442
1105 Ga0495671_0014203 3300046692 Bacteria 4292
1106 Ga0495649_0011940 3300046694 Bacteria 5076
1107 Ga0495589_0000084 3300046794 Bacteria 86500
1108 Ga0495589_0002030 3300046794 Bacteria 11459
1109 Ga0495589_0002384 3300046794 Bacteria 10559
1110 Ga0495600_0006104 3300046809 Bacteria 7299
1111 Ga0495600_0008025 3300046809 Bacteria 6471
1112 Ga0495600_0012775 3300046809 Bacteria 5260
1113 Ga0495600_0012928 3300046809 Bacteria 5231
1114 Ga0495660_0005264 3300046810 Bacteria 7757
1115 Ga0495660_0067480 3300046810 Bacteria 1905
1116 Ga0495660_0072803 3300046810 Bacteria 1819
1117 Ga0495581_0001458 3300047315 Bacteria 13153
1118 Ga0495581_0014511 3300047315 Bacteria 4569
1119 Ga0495581_0018211 3300047315 Bacteria 4079
1120 Ga0495581_0080012 3300047315 Bacteria 1891
1121 Ga0495604_0005561 3300047317 Bacteria 9991
1122 Ga0495604_0046411 3300047317 Bacteria 3386
1123 Ga0495604_0155460 3300047317 Bacteria 1620
1124 Ga0495636_0007671 3300047318 Bacteria 4243
1125 Ga0495636_0007946 3300047318 Bacteria 4177
1126 Ga0495636_0037307 3300047318 Bacteria 2007
1127 Ga0495636_0059039 3300047318 Bacteria 1618
1128 Ga0495674_0010002 3300047319 Bacteria 8987
1129 Ga0495674_0016573 3300047319 Bacteria 6875
1130 Ga0495674_0018299 3300047319 Bacteria 6524
1131 Ga0495674_0085689 3300047319 Bacteria 2698
1132 Ga0495674_0117115 3300047319 Bacteria 2254
1133 Ga0495672_0036633 3300047320 Bacteria 3010
1134 Ga0495672_0101083 3300047320 Bacteria 1563
1135 Ga0495676_0020148 3300047321 Bacteria 5861
1136 Ga0495676_0020359 3300047321 Bacteria 5821
1137 Ga0495676_0027276 3300047321 Bacteria 4899
1138 Ga0495676_0059585 3300047321 Bacteria 2997
1139 Ga0495680_0003442 3300047322 Bacteria 15610
1140 Ga0495680_0013228 3300047322 Bacteria 7209
1141 Ga0495680_0255151 3300047322 Bacteria 1242
1142 Ga0495683_0002960 3300047323 Bacteria 10033
1143 Ga0495683_0011838 3300047323 Bacteria 4586
1144 Ga0495683_0040443 3300047323 Bacteria 2355
1145 Ga0495687_000101 3300047443 Bacteria 129682
1146 Ga0495687_001048 3300047443 Bacteria 27433
1147 Ga0495687_001664 3300047443 Bacteria 19940
1148 Ga0495687_007657 3300047443 Bacteria 6317
1149 Ga0495687_043985 3300047443 Bacteria 1943
1150 Ga0495675_0010019 3300047444 Bacteria 5911
1151 Ga0495677_0000015 3300047445 Bacteria 129962
1152 Ga0495677_0095293 3300047445 Bacteria 1124
1153 Ga0495679_000050 3300047446 Bacteria 125325
1154 Ga0495679_008460 3300047446 Bacteria 4182
1155 Ga0495679_010252 3300047446 Bacteria 3689
1156 Ga0495673_0000028 3300047469 Bacteria 473418
1157 Ga0495673_0002276 3300047469 Bacteria 13763
1158 Ga0495673_0006233 3300047469 Bacteria 7054
1159 Ga0495673_0006821 3300047469 Bacteria 6664
1160 Ga0495681_0010670 3300047470 Bacteria 5544
1161 Ga0495681_0082456 3300047470 Bacteria 1433
1162 Ga0495684_0013586 3300047471 Bacteria 6269
1163 Ga0495684_0031309 3300047471 Bacteria 4084
1164 Ga0495684_0041628 3300047471 Bacteria 3521
1165 Ga0495593_0005298 3300047673 Bacteria 7619
1166 Ga0495593_0026344 3300047673 Bacteria 3211
1167 Ga0495593_0029599 3300047673 Bacteria 3001
1168 Ga0495593_0041678 3300047673 Bacteria 2467
1169 Ga0495593_0054424 3300047673 Bacteria 2109
1170 Ga0495602_0008243 3300048088 Bacteria 10882
1171 Ga0495602_0013381 3300048088 Bacteria 8388
1172 Ga0495602_0049125 3300048088 Bacteria 3782
1173 Ga0495602_0112887 3300048088 Bacteria 2204
1174 Ga0495614_0002084 3300048089 Bacteria 8824
1175 Ga0495614_0005686 3300048089 Bacteria 5622
1176 Ga0495626_0000554 3300048091 Bacteria 37066
1177 Ga0495626_0013103 3300048091 Bacteria 4318
1178 Ga0495626_0013780 3300048091 Bacteria 4193
1179 Ga0495626_0023087 3300048091 Bacteria 3067
1180 Ga0496101_0001774 3300048904 Bacteria 12961
1181 Ga0496101_0013735 3300048904 Bacteria 5431
1182 Ga0496101_0068731 3300048904 Bacteria 2591
1183 Ga0496102_0015155 3300048905 Bacteria 6712
1184 Ga0496102_0027585 3300048905 Bacteria 5070
1185 Ga0496102_0150426 3300048905 Bacteria 2187
1186 Ga0496103_0001531 3300048906 Bacteria 15434
1187 Ga0496103_0017920 3300048906 Bacteria 4243
1188 Ga0496103_0040340 3300048906 Bacteria 2868
1189 Ga0496103_0059130 3300048906 Bacteria 2381
1190 Ga0496103_0078080 3300048906 Bacteria 2079
1191 Ga0496104_0008340 3300048907 Bacteria 9205
1192 Ga0496104_0154488 3300048907 Bacteria 2202
1193 Ga0496105_0006468 3300048908 Bacteria 9006
1194 Ga0496105_0086963 3300048908 Bacteria 2583
1195 Ga0496106_0000060 3300048909 Bacteria 87287
1196 Ga0496106_0018163 3300048909 Bacteria 5202
1197 Ga0496108_0110982 3300048911 Bacteria 2345
1198 Ga0496108_0149414 3300048911 Bacteria 2016
1199 Ga0496109_0073754 3300048912 Bacteria 3136
1200 Ga0496109_0119688 3300048912 Bacteria 2452
1201 Ga0496109_0138323 3300048912 Bacteria 2277
1202 Ga0496110_0079512 3300048913 Bacteria 2919
1203 Ga0496110_0328850 3300048913 Bacteria 1392
1204 Ga0496110_0368185 3300048913 Bacteria 1309
1205 Ga0496111_0023507 3300048914 Bacteria 4328
1206 Ga0496111_0125635 3300048914 Bacteria 1896
1207 Ga0496111_0244666 3300048914 Bacteria 1332
1208 Ga0496112_0123209 3300048915 Bacteria 2563
1209 Ga0496112_0372368 3300048915 Bacteria 1370
1210 Ga0496113_0170575 3300048916 Bacteria 1723
1211 Ga0496113_0437237 3300048916 Bacteria 1051
1212 Ga0496114_0038689 3300048917 Bacteria 3947
1213 Ga0496115_0398832 3300048918 Bacteria 1116
1214 Ga0496116_0009120 3300048919 Bacteria 8503
1215 Ga0496116_0010428 3300048919 Bacteria 7785
1216 Ga0496116_0027827 3300048919 Bacteria 4107
1217 Ga0496116_0043395 3300048919 Bacteria 3064
1218 Ga0496117_0004030 3300048920 Bacteria 16547
1219 Ga0496117_0012277 3300048920 Bacteria 7572
1220 Ga0496117_0076429 3300048920 Bacteria 2220
1221 Ga0496117_0099534 3300048920 Bacteria 1844
1222 Ga0496117_0112716 3300048920 Bacteria 1690
1223 Ga0496118_0001261 3300048921 Bacteria 38807
1224 Ga0496118_0006078 3300048921 Bacteria 13436
1225 Ga0496118_0009303 3300048921 Bacteria 9959
1226 Ga0496118_0009322 3300048921 Bacteria 9946
1227 Ga0496118_0120350 3300048921 Bacteria 1713
1228 Ga0496121_0000102 3300048924 Bacteria 195341
1229 Ga0496121_0006822 3300048924 Bacteria 13980
1230 Ga0496121_0007246 3300048924 Bacteria 13425
1231 Ga0496121_0013190 3300048924 Bacteria 8907
1232 Ga0496121_0021224 3300048924 Bacteria 6374
1233 Ga0496121_0033960 3300048924 Bacteria 4602
1234 Ga0496121_0036277 3300048924 Bacteria 4396
1235 Ga0496122_0002281 3300048925 Bacteria 27761
1236 Ga0496123_0000197 3300048926 Bacteria 122784
1237 Ga0496123_0008020 3300048926 Bacteria 9782
1238 Ga0496124_0194365 3300048927 Bacteria 1549
1239 Ga0496124_0195598 3300048927 Bacteria 1543
1240 Ga0496125_0000983 3300048928 Bacteria 44536
1241 Ga0496125_0004366 3300048928 Bacteria 16383
1242 Ga0496126_0001236 3300048929 Bacteria 41467
1243 Ga0496126_0004718 3300048929 Bacteria 16087
1244 Ga0496126_0047016 3300048929 Bacteria 3953
1245 Ga0495678_000006 3300049459 Bacteria 463690
1246 Ga0495678_009322 3300049459 Bacteria 4866
1247 Ga0501315_013242 3300049531 Bacteria 1030
1248 Ga0501031_0000636 3300049568 Bacteria 20762
1249 Ga0501031_0013813 3300049568 Bacteria 5263
1250 Ga0501031_0038223 3300049568 Bacteria 3133
1251 Ga0501031_0085123 3300049568 Bacteria 2061
1252 Ga0501032_0000783 3300049569 Bacteria 25742
1253 Ga0501032_0007662 3300049569 Bacteria 7873
1254 Ga0501032_0009141 3300049569 Bacteria 7191
1255 Ga0501032_0134993 3300049569 Bacteria 1626
1256 Ga0501032_0141194 3300049569 Bacteria 1586
1257 Ga0501033_0001537 3300049570 Bacteria 20402
1258 Ga0501033_0013469 3300049570 Bacteria 6225
1259 Ga0501034_0000280 3300049571 Bacteria 91814
1260 Ga0501034_0010044 3300049571 Bacteria 9884
1261 Ga0501034_0025314 3300049571 Bacteria 6041
1262 Ga0501034_0185152 3300049571 Bacteria 2046
1263 Ga0501036_0001069 3300049572 Bacteria 20739
1264 Ga0501036_0022159 3300049572 Bacteria 5344
1265 Ga0501036_0024220 3300049572 Bacteria 5116
1266 Ga0501036_0107556 3300049572 Bacteria 2358
1267 Ga0501037_0000440 3300049573 Bacteria 34171
1268 Ga0501037_0015454 3300049573 Bacteria 5618
1269 Ga0501037_0039408 3300049573 Bacteria 3478
1270 Ga0501037_0072179 3300049573 Bacteria 2511
1271 Ga0501038_0000396 3300049574 Bacteria 37861
1272 Ga0501038_0002694 3300049574 Bacteria 16554
1273 Ga0501038_0023085 3300049574 Bacteria 5566
1274 Ga0501038_0107968 3300049574 Bacteria 2308
1275 Ga0501039_0000504 3300049575 Bacteria 28251
1276 Ga0501039_0002363 3300049575 Bacteria 14055
1277 Ga0501039_0012456 3300049575 Bacteria 6493
1278 Ga0501039_0019428 3300049575 Bacteria 5209
1279 Ga0501039_0043108 3300049575 Bacteria 3486
1280 Ga0501039_0256211 3300049575 Bacteria 1375
1281 Ga0501040_0000263 3300049576 Bacteria 30635
1282 Ga0501040_0007613 3300049576 Bacteria 7009
1283 Ga0501040_0203508 3300049576 Bacteria 1406
1284 Ga0501041_0000044 3300049577 Bacteria 43476
1285 Ga0501041_0117643 3300049577 Bacteria 1651
1286 Ga0501042_0000486 3300049578 Bacteria 20579
1287 Ga0501042_0002115 3300049578 Bacteria 12037
1288 Ga0501042_0018653 3300049578 Bacteria 4807
1289 Ga0501042_0258717 3300049578 Bacteria 1256
1290 Ga0501042_0303729 3300049578 Bacteria 1153
1291 Ga0501043_0006041 3300049579 Bacteria 9731
1292 Ga0501043_0019037 3300049579 Bacteria 5390
1293 Ga0501043_0092968 3300049579 Bacteria 2371
1294 Ga0501043_0243992 3300049579 Bacteria 1385
1295 Ga0501046_0000656 3300049580 Bacteria 33629
1296 Ga0501046_0005246 3300049580 Bacteria 11584
1297 Ga0501046_0005612 3300049580 Bacteria 11198
1298 Ga0501046_0044933 3300049580 Bacteria 3511
1299 Ga0501046_0046771 3300049580 Bacteria 3433
1300 Ga0501047_0005610 3300049581 Bacteria 11820
1301 Ga0501047_0006804 3300049581 Bacteria 10742
1302 Ga0501047_0037594 3300049581 Bacteria 4681
1303 Ga0501047_0211836 3300049581 Bacteria 1796
1304 Ga0501047_0233954 3300049581 Bacteria 1690
1305 Ga0501048_0001832 3300049582 Bacteria 16125
1306 Ga0501048_0042583 3300049582 Bacteria 3250
1307 Ga0501068_0000515 3300049584 Bacteria 19599
1308 Ga0501068_0001598 3300049584 Bacteria 12063
1309 Ga0501070_0001279 3300049586 Bacteria 22589
1310 Ga0501070_0006977 3300049586 Bacteria 9610
1311 Ga0501070_0084021 3300049586 Bacteria 2636
1312 Ga0501070_0117447 3300049586 Bacteria 2197
1313 Ga0501070_0120325 3300049586 Bacteria 2170
1314 Ga0501071_0001606 3300049587 Bacteria 13265
1315 Ga0501071_0059290 3300049587 Bacteria 2769
1316 Ga0501072_0004090 3300049588 Bacteria 11040
1317 Ga0501072_0016016 3300049588 Bacteria 5749
1318 Ga0501073_0000882 3300049589 Bacteria 21503
1319 Ga0501073_0053360 3300049589 Bacteria 2830
1320 Ga0501073_0119943 3300049589 Bacteria 1823
1321 Ga0501074_0000309 3300049590 Bacteria 28271
1322 Ga0501074_0000689 3300049590 Bacteria 21108
1323 Ga0501074_0001854 3300049590 Bacteria 14505
1324 Ga0501074_0148904 3300049590 Bacteria 1674
1325 Ga0501075_0000475 3300049591 Bacteria 23966
1326 Ga0501076_0000508 3300049592 Bacteria 24672
1327 Ga0501076_0127867 3300049592 Bacteria 2059
1328 Ga0501077_0001283 3300049593 Bacteria 15184
1329 Ga0501198_000102 3300049649 Bacteria 16377
1330 Ga0501222_000008 3300049662 Bacteria 120904
1331 Ga0501249_017453 3300049679 Bacteria 1547
1332 Ga0501079_0000184 3300049741 Bacteria 35607
1333 Ga0501079_0006365 3300049741 Bacteria 8864
1334 Ga0501080_0001544 3300049742 Bacteria 19454
1335 Ga0501080_0076598 3300049742 Bacteria 3110
1336 Ga0501080_0241807 3300049742 Bacteria 1647
1337 Ga0501081_0000384 3300049743 Bacteria 24346
1338 Ga0501081_0054526 3300049743 Bacteria 2762
1339 Ga0501266_001480 3300049763 Bacteria 2999
1340 Ga0501268_009940 3300049765 Bacteria 1471
1341 Ga0501269_000336 3300049766 Bacteria 12123
1342 Ga0501035_0000180 3300049822 Bacteria 77333
1343 Ga0501035_0000813 3300049822 Bacteria 33299
1344 Ga0501035_0018177 3300049822 Bacteria 6475
1345 Ga0501035_0019942 3300049822 Bacteria 6159
1346 Ga0501035_0103895 3300049822 Bacteria 2492
1347 Ga0501044_0000524 3300049823 Bacteria 46747
1348 Ga0501044_0033216 3300049823 Bacteria 5424
1349 Ga0501044_0054882 3300049823 Bacteria 4093
1350 Ga0501044_0099157 3300049823 Bacteria 2932
1351 Ga0501045_0000247 3300049824 Bacteria 31299
1352 Ga0501045_0000572 3300049824 Bacteria 23126
1353 Ga0501045_0011965 3300049824 Bacteria 6100
1354 Ga0501045_0031742 3300049824 Bacteria 3826
1355 nmdc:mga03683_19887_c1 3300050489 Bacteria 2569
1356 nmdc:mga03683_36081_c1 3300050489 Bacteria 2010
1357 nmdc:mga0k408_123335_c1 3300050493 Bacteria 1536
1358 nmdc:mga0k408_134_c1 3300050493 Bacteria 27880
1359 nmdc:mga0k408_16168_c1 3300050493 Bacteria 4137
1360 nmdc:mga0k408_16620_c1 3300050493 Bacteria 4086
1361 nmdc:mga0k408_173971_c1 3300050493 Bacteria 1284
1362 nmdc:mga0k408_2894_c1 3300050493 Bacteria 9099
1363 nmdc:mga0k408_40340_c1 3300050493 Bacteria 2686
1364 nmdc:mga0k408_41026_c1 3300050493 Bacteria 2664
1365 nmdc:mga0k408_48608_c1 3300050493 Bacteria 2454
1366 nmdc:mga0k408_6019_c1 3300050493 Bacteria 6472
1367 nmdc:mga0k408_64802_c1 3300050493 Bacteria 2126
1368 nmdc:mga0k408_9772_c1 3300050493 Bacteria 5178
1369 nmdc:mga07m45_11022_c1 3300050496 Bacteria 4739
1370 nmdc:mga07m45_17248_c1 3300050496 Bacteria 3875
1371 nmdc:mga07m45_178022_c1 3300050496 Bacteria 1237
1372 nmdc:mga07m45_3410_c1 3300050496 Bacteria 7662
1373 nmdc:mga07m45_7383_c1 3300050496 Bacteria 5614
1374 nmdc:mga09592_1507_c1 3300050508 Bacteria 18749
1375 nmdc:mga09592_23134_c1 3300050508 Bacteria 5130
1376 nmdc:mga0qj67_10463_c1 3300050509 Bacteria 6930
1377 nmdc:mga0qj67_42320_c1 3300050509 Bacteria 3586
1378 nmdc:mga06r32_21676_c1 3300050510 Bacteria 5933
1379 nmdc:mga0n895_13637_c1 3300050512 Bacteria 7345
1380 nmdc:mga0n895_612_c1 3300050512 Bacteria 24763
1381 nmdc:mga0rr50_1855_c1 3300050513 Bacteria 11716
1382 nmdc:mga0rr50_311602_c1 3300050513 Bacteria 1318
1383 nmdc:mga0rr50_454697_c1 3300050513 Bacteria 1086
1384 nmdc:mga08x19_115267_c1 3300050514 Bacteria 1796
1385 nmdc:mga08x19_1378_c1 3300050514 Bacteria 15037
1386 nmdc:mga0a205_106525_c1 3300050515 Bacteria 2701
1387 nmdc:mga0a205_132165_c1 3300050515 Bacteria 2396
1388 nmdc:mga0a205_77741_c1 3300050515 Bacteria 3206
1389 nmdc:mga0sz30_27896_c1 3300050516 Bacteria 2321
1390 nmdc:mga0sz30_28850_c1 3300050516 Bacteria 2285
1391 Ga0495601_0004489 3300053077 Bacteria 8065
1392 Ga0500594_0009231 3300053118 Bacteria 2267
1393 Ga0500618_000621 3300053125 Bacteria 21549
1394 Ga0500658_0004584 3300053134 Bacteria 5151
1395 Ga0500619_037639 3300053154 Bacteria 1512
1396 Ga0501084_0000800 3300054114 Bacteria 24076
1397 Ga0501084_0074382 3300054114 Bacteria 2845
1398 Ga0587070_017221 3300059491 Bacteria 1168
1399 Ga0587083_0033968 3300059505 Bacteria 1032
1400 Ga0587088_003967 3300059508 Bacteria 1839
1401 Ga0587111_0014305 3300060346 Bacteria 1433
1402 Ga0501082_0027573 3300060353 Bacteria 4889
1403 Ga0501082_0033601 3300060353 Bacteria 4425
1404 Ga0501082_0130558 3300060353 Bacteria 2180
1405 Ga0466962_0006893 3300061719 Bacteria 5447
1406 Ga0466962_0055701 3300061719 Bacteria 1889
1407 Ga0466962_0071259 3300061719 Bacteria 1660
1408 Ga0466962_0099246 3300061719 Bacteria 1398
1409 Ga0530510_0000383 3300061734 Bacteria 28772
1410 2509127558 2508501125 Bacteria 7208311
1411 2510250266 2510065045 Bacteria 7761063
1412 2511250623 2511231003 Bacteria 5606035
1413 2512347785 2512047030 Bacteria 9031815
1414 2513953255 2513237150 Bacteria 6553639
1415 2513960367 2513237151 Bacteria 6309801
1416 2514042216 2513237165 Bacteria 6771773
1417 2514053979 2513237166 Bacteria 10373764
1418 2515679175 2515154122 Bacteria 8609520
1419 2519458098 2519103095 Bacteria 6629912
1420 2527076927 2526164713 Bacteria 6780608
1421 2548847322 2547132512 Bacteria 3416496
1422 2550693906 2548876994 Bacteria 4904866
1423 2563059424 2562617112 Bacteria 10918404
1424 2585294386 2582581311 Bacteria 6763856
1425 2599739391 2599185239 Bacteria 8686614
1426 2599742664 2599185240 Bacteria 7968121
1427 2600204782 2599185355 Bacteria 7968906
1428 2644027623 2643221603 Bacteria 6147767
1429 2676741770 2675903129 Bacteria 7964495
1430 2713479636 2711768613 Bacteria 11048459
1431 2719639418 2718217991 Bacteria 7829542
1432 2738819826 2738541296 Bacteria 7285013
1433 2738832306 2738541298 Bacteria 7286732
1434 2738873833 2738541306 Bacteria 7284992
1435 2739185463 2738543002 Bacteria 7284546
1436 2739220431 2738543008 Bacteria 7282815
1437 2739612033 2739367655 Bacteria 4051151
1438 2746092020 2744054900 Bacteria 8399525
1439 2746099883 2744054901 Bacteria 8397047
1440 2753571306 2751185846 Bacteria 7242164
1441 2765568984 2765235838 Bacteria 5445269
1442 2792838654 2791355137 Bacteria 9654227
1443 2808984504 2808606386 Bacteria 4471946
1444 2809131231 2808606415 Bacteria 4576710
1445 2809150433 2808606419 Bacteria 4576925
1446 2817260253 2816332253 Bacteria 6764532
1447 2817277938 2816332256 Bacteria 6891714
1448 2817451108 2816332286 Bacteria 6853759
1449 2819545246 2818991436 Bacteria 5376622
1450 2819591158 2818991445 Bacteria 4955017
1451 2819622039 2818991450 Bacteria 6962147
1452 2819632776 2818991452 Bacteria 8442785
1453 2831870099 2831864461 Bacteria 6502356
1454 2839096132 2839094727 Bacteria 5534556
1455 2842330201 2842324504 Bacteria 9364110
1456 2842356756 2842348783 Bacteria 9002918
1457 2842457785 2842454564 Bacteria 8730687
1458 2842721485 2842718218 Bacteria 4560148
1459 2852621948 2852618963 Bacteria 4577824
1460 2855735821 2855730933 Bacteria 7047938
1461 2855772759 2855767633 Bacteria 7049357
1462 2857576489 2857576091 Bacteria 5465855
1463 2858691751 2858688981 Bacteria 8184122
1464 2863421790 2863421361 Bacteria 7300805
1465 2870072269 2870068957 Bacteria 8925310
1466 2881930140 2881927736 Bacteria 3993927
1467 2884812274 2884811622 Bacteria 5552861
1468 2884836881 2884836552 Bacteria 5219991
1469 2884853172 2884852848 Bacteria 5221161
1470 2885272175 2885270888 Bacteria 9831543
1471 2886849652 2886848708 Bacteria 5632523
1472 2894024230 2894023352 Bacteria 5167372
1473 2895516099 2895511927 Bacteria 6802080
1474 2896155710 2896154374 Bacteria 5221518
1475 2900635882 2900634093 Bacteria 10263517
1476 2902683185 2902682994 Bacteria 8951596
1477 2904484246 2904483920 Bacteria 7545285
1478 2904618162 2904615490 Bacteria 10047340
1479 2919530188 2919527303 Bacteria 7718827
1480 2921649876 2921643360 Bacteria 11448031
1481 2928109945 2928108538 Bacteria 7360024
1482 2928131032 2928130867 Bacteria 5467269
1483 2928136600 2928135762 Bacteria 7259641
1484 2928159633 2928157003 Bacteria 7522202
1485 2928164307 2928163908 Bacteria 7561269
1486 2928173110 2928170801 Bacteria 8785406
1487 2928509019 2928503688 Bacteria 7268108
1488 2945935813 2945934425 Bacteria 7444609
1489 2974322413 2974320154 Bacteria 4571377
1490 2981994073 2981990288 Bacteria 7590678
1491 2990710276 2990703756 Bacteria 7715990
1492 642422800 641736151 Bacteria 7477263
1493 642415505 641736154 Bacteria 7689995
1494 642592398 642555112 Bacteria 8676562
1495 642620598 642555113 Bacteria 8214658
1496 644747057 644736347 Bacteria 6476522
1497 8018848227 8018845410 Bacteria 8933938
1498 8020809291 8020807995 Bacteria 6801506
1499 8020944638 8020938398 Bacteria 7472757
1500 8020947380 8020945358 Bacteria 8467355
1501 8020959719 8020953355 Bacteria 7439080
1502 8021122667 8021120328 Bacteria 8782274
1503 8039099429 8039098773 Bacteria 6602928
1504 8040170555 8040167225 Bacteria 6542727
1505 8040175454 8040173305 Bacteria 6827067
1506 8055227234 8055225921 Bacteria 3341787
1507 8055266432 8055266321 Bacteria 7999742
1508 8055304951 8055301274 Bacteria 8587385
1509 Ga0501042_0197434
1510 JGI24740J21852_10000408
1511 JGI24739J22299_10002612
1512 JGI24739J22299_10022734
1513 JGI24735J21928_10004224
1514 JGI24735J21928_10043488
1515 JGI24738J21930_10002746
1516 JGI25155J39150_1000186
1517 JGI25155J39150_1000416
1518 JGI25156J39149_1000425
1519 JGI25156J39149_1000808
1520 JGI25156J39149_1001518
1521 JGI25156J39149_1003490
1522 JGI25162J39368_1000426
1523 JGI25154J39366_1000496
1524 JGI25154J39366_1000504
1525 JGI25154J39366_1000704
1526 JGI25154J39366_1000985
1527 JGI25154J39366_1002170
1528 JGI25158J39367_1000154
1529 JGI25157J39369_1000021
1530 JGI25157J39369_1000771
1531 JGI25163J39215_1001943
1532 JGI25150J39212_1007054
1533 JGI25159J45721_1000806
1534 JGI25151J46595_10003776
1535 JGI25151J46595_10004054
1536 JGI25151J46595_10018776
1537 JGI25151J46595_10024627
1538 JGI25165J46597_1000022
1539 JGI25165J46597_1001231
1540 rootH2_10004894
1541 rootL2_10000757
1542 rootL2_10000982
1543 rootL2_10002392
1544 rootL2_10008489
1545 rootH1_10007359
1546 JGI25160J50197_1000140
1547 JGI25161J50226_1000062
1548 JGI25161J50226_1004262
1549 Ga0006554J51385_1029846
1550 Ga0055538_1000002
1551 Ga0055538_1000011
1552 Ga0055539_1000002
1553 Ga0055539_1000016
1554 Ga0055539_1000129
1555 Ga0055539_1001072
1556 Ga0055533_1000004
1557 Ga0055533_1000019
1558 Ga0055533_1000033
1559 Ga0055533_1000038
1560 Ga0055533_1000040
1561 Ga0055533_1000750
1562 Ga0055532_1000001
1563 Ga0055532_1000016
1564 Ga0055532_1003589
1565 Ga0055525_1000002
1566 Ga0055525_1000011
1567 Ga0055525_1000046
1568 Ga0055525_1000173
1569 Ga0055525_1000182
1570 Ga0055525_1000436
1571 Ga0055525_1000804
1572 Ga0055527_1000002
1573 Ga0055535_1000001
1574 Ga0055535_1000908
1575 Ga0055535_1002931
1576 Ga0055535_1006273
1577 Ga0055542_1000001
1578 Ga0055542_1001564
1579 Ga0055529_1000001
1580 Ga0055529_1000051
1581 Ga0055529_1000218
1582 Ga0055529_1001138
1583 Ga0055526_1000358
1584 Ga0055526_1000537
1585 Ga0055526_1000716
1586 Ga0055526_1001023
1587 Ga0055526_1005468
1588 Ga0055526_1009687
1589 Ga0055526_1012007
1590 Ga0055526_1023754
1591 Ga0055526_1028162
1592 Ga0055526_1028180
1593 Ga0055526_1044351
1594 Ga0055537_1000022
1595 Ga0055537_1003965
1596 Ga0055537_1004727
1597 Ga0055537_1005357
1598 Ga0055524_1000241
1599 Ga0055524_1001254
1600 Ga0055524_1001347
1601 Ga0055524_1001821
1602 Ga0055536_1000095
1603 Ga0055534_1000468
1604 Ga0055534_1000708
1605 Ga0055534_1000987
1606 Ga0055534_1005473
1607 Ga0055534_1010175
1608 Ga0055528_1000473
1609 Ga0055528_1002794
1610 Ga0055528_1034677
1611 Ga0055530_10000057
1612 Ga0055530_10004150
1613 Ga0055530_10016028
1614 Ga0055540_1000001
1615 Ga0055540_1022195
1616 Ga0055540_1033611
1617 Ga0055531_10002737
1618 Ga0055531_10018527
1619 Ga0055541_1000002
1620 Ga0055541_1000043
1621 Ga0055541_1000084
1622 Ga0055541_1005715
1623 Ga0055543_1000121
1624 Ga0055543_1001320
1625 Ga0055543_1013115
1626 Ga0065165_1000261
1627 Ga0065165_1000613
1628 Ga0065165_1000952
1629 Ga0065715_10016327
1630 Ga0065707_10107524
1631 Ga0070658_10032140
1632 Ga0070658_10158077
1633 Ga0070676_10120384
1634 Ga0070676_10173867
1635 Ga0070683_100004795
1636 Ga0070690_100065041
1637 Ga0070670_100001406
1638 Ga0070670_100003471
1639 Ga0070670_100007979
1640 Ga0070670_100033488
1641 Ga0070670_100041376
1642 Ga0070670_100074064
1643 Ga0070670_100084291
1644 Ga0070670_100137799
1645 Ga0068869_100003074
1646 Ga0068869_100283528
1647 Ga0070666_10018750
1648 Ga0070682_100009086
1649 Ga0068868_100002961
1650 Ga0068868_100044482
1651 Ga0070660_100000008
1652 Ga0070660_100003570
1653 Ga0070660_100163250
1654 Ga0070660_100178130
1655 Ga0070660_100209466
1656 Ga0070689_100061984
1657 Ga0070687_100030926
1658 Ga0070687_100058009
1659 Ga0070661_100005081
1660 Ga0070668_100004719
1661 Ga0070668_100068825
1662 Ga0070668_100187019
1663 Ga0070669_100080910
1664 Ga0070669_100237761
1665 Ga0070675_100003790
1666 Ga0070675_100005988
1667 Ga0070675_100007331
1668 Ga0070675_100009293
1669 Ga0070675_100232539
1670 Ga0070671_100035058
1671 Ga0070671_100048181
1672 Ga0070671_100053379
1673 Ga0070674_100004270
1674 Ga0070673_100002423
1675 Ga0070673_100018209
1676 Ga0070673_100031799
1677 Ga0070673_100037071
1678 Ga0070673_100047712
1679 Ga0070673_100103268
1680 Ga0070659_100000014
1681 Ga0070659_100005143
1682 Ga0070659_100148183
1683 Ga0070659_100178134
1684 Ga0070659_100275751
1685 Ga0070667_100001679
1686 Ga0070667_100009453
1687 Ga0070714_100067168
1688 Ga0070710_10295396
1689 Ga0070701_10005536
1690 Ga0070701_10227493
1691 Ga0070705_100002406
1692 Ga0070705_100044579
1693 Ga0070700_100094244
1694 Ga0070663_100000913
1695 Ga0070663_100353011
1696 Ga0070678_100001893
1697 Ga0070662_100008260
1698 Ga0070662_100023135
1699 Ga0070662_100234096
1700 Ga0070662_100318482
1701 Ga0070681_10089614
1702 Ga0070681_10096062
1703 Ga0068867_100003769
1704 Ga0068867_100019029
1705 Ga0068867_100049361
1706 Ga0068867_100104085
1707 Ga0068867_100111074
1708 Ga0070685_10260627
1709 Ga0070706_100027330
1710 Ga0070706_100040485
1711 Ga0070706_100573970
1712 Ga0070707_100171948
1713 Ga0070698_100077238
1714 Ga0070698_100194250
1715 Ga0070698_100198110
1716 Ga0070699_100051724
1717 Ga0070699_100335711
1718 Ga0070679_100082146
1719 Ga0070684_100038866
1720 Ga0070697_100137437
1721 Ga0068853_100021304
1722 Ga0068853_100138104
1723 Ga0068853_100280460
1724 Ga0070672_100000559
1725 Ga0070672_100001075
1726 Ga0070672_100020445
1727 Ga0070672_100086563
1728 Ga0070672_100160032
1729 Ga0070672_100213340
1730 Ga0070686_100081925
1731 Ga0070686_100160244
1732 Ga0070693_100155711
1733 Ga0070665_100140620
1734 Ga0070665_100457944
1735 Ga0070704_100004786
1736 Ga0068855_100000065
1737 Ga0068855_100053523
1738 Ga0068855_100071387
1739 Ga0068855_100087568
1740 Ga0068855_100141910
1741 Ga0068855_100233970
1742 Ga0070664_100018873
1743 Ga0070664_100020897
1744 Ga0070664_100104091
1745 Ga0070664_100291396
1746 Ga0070664_100551389
1747 Ga0068857_100009558
1748 Ga0068857_100080714
1749 Ga0068857_100256505
1750 Ga0068854_100014807
1751 Ga0068854_100024410
1752 Ga0068856_100051596
1753 Ga0068856_100267979
1754 Ga0070702_100118276
1755 Ga0068852_100006246
1756 Ga0068852_100008168
1757 Ga0068852_100040750
1758 Ga0068859_100000737
1759 Ga0068859_100252302
1760 Ga0068864_100000840
1761 Ga0068864_100001287
1762 Ga0068864_100013771
1763 Ga0068864_100031709
1764 Ga0068864_100036830
1765 Ga0068861_100005132
1766 Ga0068861_100011169
1767 Ga0068851_10009611
1768 Ga0068851_10143297
1769 Ga0068870_10027159
1770 Ga0068863_100005089
1771 Ga0068863_100011648
1772 Ga0068863_100205428
1773 Ga0068863_100376592
1774 Ga0068858_100125906
1775 Ga0068860_100002072
1776 Ga0068860_100078105
1777 Ga0068862_100011170
1778 Ga0068862_100019343
1779 Ga0068862_100024514
1780 Ga0068862_100047853
1781 Ga0068862_100406526
1782 Ga0075368_10007221
1783 Ga0075363_100049286
1784 Ga0075362_10021576
1785 Ga0075367_10113805
1786 Ga0075369_10004056
1787 Ga0075366_10012319
1788 Ga0075366_10012445
1789 Ga0075366_10018887
1790 Ga0075366_10052320
1791 Ga0075366_10052525
1792 Ga0097621_100044191
1793 Ga0075370_10012972
1794 Ga0075370_10061718
1795 Ga0075370_10162176
1796 Ga0068871_100010530
1797 Ga0068871_100023680
1798 Ga0068871_100229083
1799 Ga0068871_100237988
1800 Ga0075428_100034656
1801 Ga0075430_100018777
1802 Ga0075431_100032658
1803 Ga0075431_100119141
1804 Ga0075433_10197446
1805 Ga0075434_100000211
1806 Ga0075434_100013586
1807 Ga0075434_100417867
1808 Ga0075429_100000463
1809 Ga0068865_100009315
1810 Ga0075436_100000711
1811 Ga0097620_100000737
1812 Ga0097620_100252305
1813 Ga0099824_1022389
1814 Ga0079104_1000002
1815 Ga0079104_1004866
1816 Ga0099826_10000028
1817 Ga0075435_100001401
1818 Ga0075435_100013086
1819 Ga0075435_100027772
1820 Ga0075435_100056631
1821 Ga0105251_10000602
1822 Ga0105251_10041204
1823 Ga0105244_10053504
1824 Ga0105250_10002860
1825 Ga0105250_10015617
1826 Ga0105240_10000297
1827 Ga0105240_10009100
1828 Ga0105240_10034284
1829 Ga0105240_10038292
1830 Ga0105240_10110669
1831 Ga0105240_10145471
1832 Ga0105240_10329241
1833 Ga0111539_10066234
1834 Ga0114129_10054355
1835 Ga0105243_10001651
1836 Ga0105243_10107188
1837 Ga0105241_10111771
1838 Ga0105241_10140213
1839 Ga0105242_10000485
1840 Ga0105242_10149273
1841 Ga0105242_10170498
1842 Ga0105242_10363313
1843 Ga0105248_10008373
1844 Ga0105248_10063680
1845 Ga0105237_10059880
1846 Ga0105238_10008362
1847 Ga0105238_10017542
1848 Ga0105238_10018705
1849 Ga0105238_10165226
1850 Ga0105238_10288918
1851 Ga0105238_10362725
1852 Ga0105239_10005209
1853 Ga0105239_10027775
1854 Ga0105239_10197986
1855 Ga0157317_1002422
1856 Ga0157373_10085063
1857 Ga0157370_10174745
1858 Ga0157369_10000179
1859 Ga0157369_10040041
1860 Ga0157369_10213725
1861 Ga0157374_10130246
1862 Ga0157374_10145394
1863 Ga0157374_10260712
1864 Ga0157378_10032916
1865 Ga0157378_10427012
1866 Ga0163162_10068472
1867 Ga0163162_10143959
1868 Ga0163162_10201421
1869 Ga0163162_10206877
1870 Ga0157372_10105731
1871 Ga0157372_10408573
1872 Ga0157375_10027001
1873 Ga0163163_10010908
1874 Ga0163163_10016193
1875 Ga0157380_10091235
1876 Ga0182008_10000215
1877 Ga0182008_10031438
1878 Ga0157377_10244905
1879 Ga0157379_10001176
1880 Ga0157379_10052546
1881 Ga0157379_10351075
1882 Ga0157376_10008506
1883 Ga0157376_10039234
1884 Ga0182007_10001432
1885 Ga0182007_10001777
1886 Ga0182005_1000666
1887 Ga0183361_10009
1888 Ga0163161_10024951
1889 Ga0163161_10097325
1890 Ga0163161_10163705
1891 Ga0163161_10230061
1892 Ga0213872_10000003
1893 Ga0213872_10000042
1894 Ga0213872_10000197
1895 Ga0213872_10000641
1896 Ga0213872_10002773
1897 Ga0213872_10024475
1898 Ga0213872_10095944
1899 Ga0209435_100090
1900 Ga0209435_100200
1901 Ga0209436_100005
1902 Ga0209784_100002
1903 Ga0209784_100019
1904 Ga0209566_100003
1905 Ga0209566_100017
1906 Ga0209566_100601
1907 Ga0209674_100004
1908 Ga0209674_100005
1909 Ga0209674_100031
1910 Ga0209674_100064
1911 Ga0209674_100066
1912 Ga0209674_100110
1913 Ga0209674_106234
1914 Ga0209672_100001
1915 Ga0209672_100051
1916 Ga0209147_100001
1917 Ga0209147_100023
1918 Ga0209147_100120
1919 Ga0209147_100365
1920 Ga0209563_100005
1921 Ga0209563_100006
1922 Ga0209563_100035
1923 Ga0209563_100107
1924 Ga0209563_100126
1925 Ga0207427_100197
1926 Ga0207427_102210
1927 Ga0207427_104178
1928 Ga0209437_100038
1929 Ga0209437_100080
1930 Ga0209437_106554
1931 Ga0209258_100001
1932 Ga0209258_100179
1933 Ga0209258_100262
1934 Ga0209258_100280
1935 Ga0209258_100850
1936 Ga0209258_102660
1937 Ga0209646_1000060
1938 Ga0209646_1000072
1939 Ga0209646_1000294
1940 Ga0209646_1000296
1941 Ga0209026_1000049
1942 Ga0209026_1000150
1943 Ga0209026_1005310
1944 Ga0209677_100003
1945 Ga0209677_100020
1946 Ga0209677_100052
1947 Ga0209677_100099
1948 Ga0209677_100229
1949 Ga0209677_101485
1950 Ga0209148_1000003
1951 Ga0209148_1000027
1952 Ga0209148_1018870
1953 Ga0209759_1000033
1954 Ga0209759_1000069
1955 Ga0209759_1000116
1956 Ga0209759_1000294
1957 Ga0209759_1000516
1958 Ga0209759_1000520
1959 Ga0209759_1001511
1960 Ga0209759_1007805
1961 Ga0209759_1018384
1962 Ga0209759_1022355
1963 Ga0209233_1000016
1964 Ga0209233_1000049
1965 Ga0209565_1000015
1966 Ga0209565_1001112
1967 Ga0209565_1002528
1968 Ga0209565_1010164
1969 Ga0209455_1000001
1970 Ga0209455_1000044
1971 Ga0209455_1000191
1972 Ga0209455_1000203
1973 Ga0209673_1000017
1974 Ga0209673_1000070
1975 Ga0209673_1004714
1976 Ga0209673_1009022
1977 Ga0209130_1000055
1978 Ga0209130_1009756
1979 Ga0209130_1030316
1980 Ga0209675_1000012
1981 Ga0209675_1000212
1982 Ga0209675_1003345
1983 Ga0209675_1006703
1984 Ga0209675_1008288
1985 Ga0209676_1000066
1986 Ga0209025_1000384
1987 Ga0209025_1001071
1988 Ga0209025_1002826
1989 Ga0209025_1004282
1990 Ga0209025_1070686
1991 Ga0209564_1000002
1992 Ga0209564_1000003
1993 Ga0209564_1000007
1994 Ga0209564_1000016
1995 Ga0209564_1000107
1996 Ga0209564_1000124
1997 Ga0209564_1001211
1998 Ga0209564_1001981
1999 Ga0209564_1007499
2000 Ga0209564_1011129
2001 Ga0209564_1012325
2002 Ga0209050_1000145
2003 Ga0209050_1000304
2004 Ga0209050_1001774
2005 Ga0209256_1000007
2006 Ga0209256_1000076
2007 Ga0209256_1000183
2008 Ga0209256_1000482
2009 Ga0209256_1000659
2010 Ga0209256_1001268
2011 Ga0209256_1004161
2012 Ga0209256_1005488
2013 Ga0207426_1000326
2014 Ga0207426_1019591
2015 Ga0209051_1000018
2016 Ga0209051_1007055
2017 Ga0209051_1010277
2018 Ga0209051_1014646
2019 Ga0209051_1020441
2020 Ga0209257_1000084
2021 Ga0209257_1000450
2022 Ga0209257_1016886
2023 Ga0207697_10007133
2024 Ga0207656_10005509
2025 Ga0207656_10068785
2026 Ga0207696_1007745
2027 Ga0207655_1011552
2028 Ga0207655_1018621
2029 Ga0207713_1000372
2030 Ga0207682_10000340
2031 Ga0207682_10003157
2032 Ga0207642_10095627
2033 Ga0207688_10014892
2034 Ga0207680_10014240
2035 Ga0207647_10001108
2036 Ga0207647_10027614
2037 Ga0207647_10056661
2038 Ga0207699_10059428
2039 Ga0207645_10010068
2040 Ga0207643_10033124
2041 Ga0207705_10016982
2042 Ga0207684_10420729
2043 Ga0207707_10018084
2044 Ga0207707_10093997
2045 Ga0207695_10000475
2046 Ga0207695_10001437
2047 Ga0207695_10020920
2048 Ga0207695_10022917
2049 Ga0207695_10040295
2050 Ga0207695_10146794
2051 Ga0207695_10424850
2052 Ga0207671_10020117
2053 Ga0207671_10049115
2054 Ga0207662_10042078
2055 Ga0207662_10210223
2056 Ga0207657_10000018
2057 Ga0207657_10003155
2058 Ga0207657_10053105
2059 Ga0207657_10099258
2060 Ga0207657_10174529
2061 Ga0207657_10209485
2062 Ga0207649_10021775
2063 Ga0207652_10240084
2064 Ga0207646_10140214
2065 Ga0207681_10007645
2066 Ga0207681_10092494
2067 Ga0207681_10115405
2068 Ga0207681_10192057
2069 Ga0207694_10009631
2070 Ga0207694_10010860
2071 Ga0207694_10136429
2072 Ga0207694_10152233
2073 Ga0207650_10001837
2074 Ga0207650_10003488
2075 Ga0207650_10003973
2076 Ga0207650_10004126
2077 Ga0207650_10014460
2078 Ga0207650_10015106
2079 Ga0207650_10112412
2080 Ga0207650_10119376
2081 Ga0207659_10001657
2082 Ga0207659_10010218
2083 Ga0207659_10030562
2084 Ga0207659_10038636
2085 Ga0207659_10251127
2086 Ga0207664_10214521
2087 Ga0207644_10247746
2088 Ga0207644_10266804
2089 Ga0207690_10000006
2090 Ga0207690_10011102
2091 Ga0207690_10204772
2092 Ga0207706_10024839
2093 Ga0207706_10035752
2094 Ga0207706_10044198
2095 Ga0207686_10009173
2096 Ga0207686_10025673
2097 Ga0207686_10030202
2098 Ga0207686_10246653
2099 Ga0207709_10000015
2100 Ga0207709_10103816
2101 Ga0207709_10140273
2102 Ga0207669_10003780
2103 Ga0207669_10031387
2104 Ga0207669_10071799
2105 Ga0207665_10058978
2106 Ga0207691_10000511
2107 Ga0207691_10000657
2108 Ga0207691_10012670
2109 Ga0207691_10122253
2110 Ga0207691_10387578
2111 Ga0207711_10066563
2112 Ga0207711_10195075
2113 Ga0207711_10269649
2114 Ga0207711_10286956
2115 Ga0207689_10005742
2116 Ga0207689_10029190
2117 Ga0207661_10011699
2118 Ga0207661_10061378
2119 Ga0207679_10008750
2120 Ga0207679_10036127
2121 Ga0207679_10168884
2122 Ga0207667_10000025
2123 Ga0207667_10061603
2124 Ga0207667_10069899
2125 Ga0207667_10078887
2126 Ga0207667_10108582
2127 Ga0207667_10178935
2128 Ga0207667_10184930
2129 Ga0207667_10205750
2130 Ga0207667_10239869
2131 Ga0207651_10019880
2132 Ga0207651_10025944
2133 Ga0207651_10053906
2134 Ga0207651_10101946
2135 Ga0207651_10147727
2136 Ga0207651_10268137
2137 Ga0207668_10010948
2138 Ga0207668_10144250
2139 Ga0207640_10079052
2140 Ga0207658_10037156
2141 Ga0207658_10166683
2142 Ga0207677_10008977
2143 Ga0207677_10021231
2144 Ga0207677_10027378
2145 Ga0207703_10039632
2146 Ga0207703_10087754
2147 Ga0207639_10333347
2148 Ga0207639_10448162
2149 Ga0207678_10001481
2150 Ga0207678_10006930
2151 Ga0207678_10146251
2152 Ga0207678_10146390
2153 Ga0207708_10021936
2154 Ga0207708_10270499
2155 Ga0207702_10001447
2156 Ga0207702_10167492
2157 Ga0207702_10189982
2158 Ga0207641_10003449
2159 Ga0207641_10008903
2160 Ga0207648_10004759
2161 Ga0207648_10009000
2162 Ga0207648_10012937
2163 Ga0207648_10027131
2164 Ga0207648_10032660
2165 Ga0207648_10066013
2166 Ga0207648_10202806
2167 Ga0207676_10004842
2168 Ga0207676_10008136
2169 Ga0207676_10016812
2170 Ga0207676_10023784
2171 Ga0207676_10101649
2172 Ga0207676_10192068
2173 Ga0207676_10235421
2174 Ga0207674_10009285
2175 Ga0207674_10014937
2176 Ga0207674_10038859
2177 Ga0207675_100003033
2178 Ga0207675_100016941
2179 Ga0207675_100024354
2180 Ga0207675_100111015
2181 Ga0207675_100212678
2182 Ga0207683_10001153
2183 Ga0207683_10004610
2184 Ga0207683_10008024
2185 Ga0207683_10026480
2186 Ga0207698_10018026
2187 Ga0209281_1000007
2188 Ga0209281_1003905
2189 Ga0209371_1000181
2190 Ga0209371_1006167
2191 Ga0209371_1014768
2192 Ga0209969_1002277
2193 Ga0209967_1002470
2194 Ga0209996_1000164
2195 Ga0210000_1003217
2196 Ga0209995_1001528
2197 Ga0209995_1003905
2198 Ga0209968_1000368
2199 Ga0209999_1011391
2200 Ga0209282_1000051
2201 Ga0209971_1002442
2202 Ga0209971_1008899
2203 Ga0209966_1000074
2204 Ga0209998_10004405
2205 Ga0209813_10018373
2206 Ga0209974_10025808
2207 Ga0268266_10076660
2208 Ga0268265_10019427
2209 Ga0268265_10028420
2210 Ga0268265_10029869
2211 Ga0268264_10001934
2212 Ga0268264_10118668
2213 Ga0268264_10251300
2214 Ga0265336_10000123
2215 Ga0307515_10000040
2216 Ga0265338_10105861
2217 Ga0265338_10315664
2218 Ga0265324_10000361
2219 Ga0268256_1000151
2220 Ga0268256_1006158
2221 Ga0268256_1014814
2222 Ga0316180_1046710
2223 Ga0265330_10000133
2224 Ga0265332_10000001
2225 Ga0265332_10000010
2226 Ga0265332_10001971
2227 Ga0265328_10016557
2228 Ga0265329_10033973
2229 Ga0265340_10002720
2230 Ga0265331_10000996
2231 Ga0265316_10008143
2232 Ga0307513_10097991
2233 Ga0307513_10298998
2234 Ga0307509_10012999
2235 Ga0307408_100000022
2236 Ga0307408_100000439
2237 Ga0307408_100001348
2238 Ga0307408_100014832
2239 Ga0307408_100031547
2240 Ga0307408_100268935
2241 Ga0307408_100372284
2242 Ga0316575_10000023
2243 Ga0316575_10000505
2244 Ga0265314_10000013
2245 Ga0265314_10001503
2246 Ga0265342_10039179
2247 Ga0316576_10053328
2248 Ga0316578_10002083
2249 Ga0307516_10162892
2250 Ga0307405_10001449
2251 Ga0307405_10011206
2252 Ga0307405_10133923
2253 Ga0307405_10161291
2254 Ga0307405_10427599
2255 Ga0316577_10149807
2256 Ga0307413_10010124
2257 Ga0307410_10003953
2258 Ga0307410_10008212
2259 Ga0307410_10014477
2260 Ga0307406_10006988
2261 Ga0307406_10010926
2262 Ga0307406_10014813
2263 Ga0307406_10047317
2264 Ga0307406_10080300
2265 Ga0307406_10146030
2266 Ga0307407_10008265
2267 Ga0307407_10011484
2268 Ga0307407_10175615
2269 Ga0307412_10000005
2270 Ga0307412_10006540
2271 Ga0307412_10013719
2272 Ga0307412_10045390
2273 Ga0307412_10096155
2274 Ga0307409_100001860
2275 Ga0307409_100006670
2276 Ga0307409_100133032
2277 Ga0307409_100158677
2278 Ga0307409_100248226
2279 Ga0307416_100001396
2280 Ga0307416_100018054
2281 Ga0307416_100122363
2282 Ga0307416_100189464
2283 Ga0307414_10007639
2284 Ga0307414_10033326
2285 Ga0307411_10015987
2286 Ga0307411_10145577
2287 Ga0307411_10415699
2288 Ga0307415_100007017
2289 Ga0307415_100031788
2290 Ga0307510_10007396
2291 Ga0373934_0021275
2292 Ga0373952_0002596
2293 Ga0373952_0005475
2294 Ga0373939_0021383
2295 Ga0373954_0000001
2296 Ga0373956_0025311
2297 Ga0373955_0110442
2298 Ga0316574_0002756
2299 Ga0316574_0037245
2300 Ga0373924_0011995
2301 Ga0373931_0010108
2302 Ga0373931_0062980
2303 Ga0373927_0040217
2304 Ga0373927_0229112
2305 Ga0373933_0009723
2306 Ga0373933_0053917
2307 Ga0373937_0002345
2308 Ga0373937_0082773
2309 Ga0373937_0157684
2310 Ga0316582_0015925
2311 Ga0316584_0015597
2312 Ga0373925_0194648
2313 Ga0373925_0226615
2314 Ga0395899_0014587
2315 Ga0395899_0027329
2316 Ga0395899_0029304
2317 Ga0395899_0078383
2318 Ga0395899_0123930
2319 Ga0395900_0000229
2320 Ga0395900_0005063
2321 Ga0395900_0005889
2322 Ga0395900_0069915
2323 Ga0395900_0076106
2324 Ga0395900_0147005
2325 Ga0395898_0055156
2326 Ga0395898_0101462
2327 Ga0395898_0103642
2328 Ga0395898_0140493
2329 Ga0395898_0244466
2330 Ga0395898_0254175
2331 Ga0395905_0000059
2332 Ga0395905_0001515
2333 Ga0395905_0002380
2334 Ga0395905_0004975
2335 Ga0395905_0026529
2336 Ga0395905_0027140
2337 Ga0395905_0045716
2338 Ga0395905_0060945
2339 Ga0316581_0000886
2340 Ga0395901_0003564
2341 Ga0395901_0013050
2342 Ga0395901_0018224
2343 Ga0395901_0042434
2344 Ga0395901_0209008
2345 Ga0436360_0690189
2346 Ga0436361_0039956
2347 Ga0436361_0577632
2348 Ga0436361_0590531
2349 Ga0436361_0616441
2350 Ga0436361_0878220
2351 Ga0436361_0926482
2352 Ga0436361_1094903
2353 Ga0436361_1150385
2354 Ga0439436_0021132
2355 Ga0451797_0462561
2356 Ga0451807_0693819
2357 Ga0451853_1690372
2358 Ga0439443_005113
2359 Ga0439462_0001510
2360 Ga0450920_000782
2361 Ga0450923_004002
2362 Ga0450923_004577
2363 Ga0450898_012896
2364 Ga0439446_0059545
2365 Ga0450908_000192
2366 Ga0439434_0010251
2367 Ga0439434_0059421
2368 Ga0439435_0000279
2369 Ga0439444_0003396
2370 Ga0439459_0001318
2371 Ga0439460_0020137
2372 Ga0439460_0054942
2373 Ga0450918_004421
2374 Ga0451577_0000002
2375 Ga0451577_0000152
2376 Ga0451577_0009047
2377 Ga0451577_0018493
2378 Ga0451577_0041881
2379 Ga0451577_0076722
2380 Ga0466969_0000147
2381 Ga0466969_0003356
2382 Ga0466969_0018747
2383 Ga0466972_0000181
2384 Ga0466972_0001865
2385 Ga0466972_0068264
2386 Ga0466972_0092114
2387 Ga0466982_0053105
2388 Ga0466982_0164584
2389 Ga0453683_0000003
2390 Ga0466965_0000486
2391 Ga0466965_0072608
2392 Ga0466965_0104281
2393 Ga0466966_0007276
2394 Ga0466966_0014215
2395 Ga0466966_0037337
2396 Ga0466961_0032784
2397 Ga0466961_0044854
2398 Ga0466961_0093369
2399 Ga0466963_0021413
2400 Ga0466964_0013417
2401 Ga0453684_0000002
2402 Ga0453684_0000029
2403 Ga0453684_0000122
2404 Ga0466971_0002862
2405 Ga0466968_0025979
2406 Ga0466970_0015077
2407 Ga0466970_0034730
2408 Ga0466970_0046760
2409 Ga0466970_0102714
2410 Ga0466957_0014789
2411 Ga0466957_0027037
2412 Ga0466960_0012884
2413 Ga0466959_0001734
2414 Ga0466959_0006971
2415 Ga0466959_0009426
2416 Ga0466959_0013918
2417 Ga0466959_0034741
2418 Ga0466959_0131437
2419 Ga0451576_0000004
2420 Ga0451576_0000937
2421 Ga0451576_0001995
2422 Ga0451576_0531785
2423 Ga0466958_0018038
2424 Ga0466958_0076484
2425 Ga0466958_0138858
2426 Ga0466967_0018215
2427 Ga0495617_003418
2428 Ga0495627_000005
2429 Ga0495627_000008
2430 Ga0495592_0035366
2431 Ga0495603_0004454
2432 Ga0495590_0000006
2433 Ga0495591_009140
2434 Ga0495629_0004774
2435 Ga0495629_0008044
2436 Ga0495629_0048051
2437 Ga0495638_0000891
2438 Ga0495638_0075921
2439 Ga0495651_0118772
2440 Ga0495651_0139087
2441 Ga0495651_0146938
2442 Ga0495653_0005110
2443 Ga0495653_0048194
2444 Ga0495653_0053553
2445 Ga0495653_0093258
2446 Ga0495653_0130559
2447 Ga0495650_0000042
2448 Ga0495650_0001355
2449 Ga0495650_0001969
2450 Ga0495650_0018615
2451 Ga0495580_0001332
2452 Ga0495580_0001735
2453 Ga0495580_0002424
2454 Ga0495580_0006696
2455 Ga0495580_0009620
2456 Ga0495580_0044936
2457 Ga0495580_0092583
2458 Ga0495580_0099819
2459 Ga0495580_0130771
2460 Ga0495582_0002157
2461 Ga0495582_0039323
2462 Ga0495582_0094002
2463 Ga0495605_0004289
2464 Ga0495605_0008150
2465 Ga0495605_0013495
2466 Ga0495605_0025104
2467 Ga0495662_0021575
2468 Ga0495664_0001925
2469 Ga0495664_0002295
2470 Ga0495664_0087473
2471 Ga0495585_0009165
2472 Ga0495594_0043606
2473 Ga0495596_0001853
2474 Ga0495596_0005945
2475 Ga0495596_0031217
2476 Ga0495596_0032079
2477 Ga0495607_0004242
2478 Ga0495607_0016789
2479 Ga0495607_0048930
2480 Ga0495583_0000046
2481 Ga0495583_0000199
2482 Ga0495583_0001566
2483 Ga0495583_0007029
2484 Ga0495583_0013937
2485 Ga0495583_0030561
2486 Ga0495606_0001300
2487 Ga0495606_0013495
2488 Ga0495606_0017051
2489 Ga0495606_0023111
2490 Ga0495606_0038631
2491 Ga0495608_0004149
2492 Ga0495608_0014134
2493 Ga0495608_0018660
2494 Ga0495608_0047765
2495 Ga0495608_0146859
2496 Ga0495610_0000965
2497 Ga0495610_0015349
2498 Ga0495610_0026492
2499 Ga0495610_0076293
2500 Ga0495616_0000277
2501 Ga0495616_0000591
2502 Ga0495616_0020712
2503 Ga0495618_0009318
2504 Ga0495618_0010152
2505 Ga0495618_0030402
2506 Ga0495628_0000146
2507 Ga0495628_0003520
2508 Ga0495628_0007838
2509 Ga0495628_0020360
2510 Ga0495628_0167092
2511 Ga0495630_0035764
2512 Ga0495630_0117817
2513 Ga0495630_0135315
2514 Ga0495630_0191297
2515 Ga0495631_0020358
2516 Ga0495632_0026742
2517 Ga0495637_0000056
2518 Ga0495637_0014948
2519 Ga0495643_0000338
2520 Ga0495643_0003899
2521 Ga0495643_0046323
2522 Ga0495648_0000061
2523 Ga0495648_0006586
2524 Ga0495648_0033963
2525 Ga0495648_0034382
2526 Ga0495648_0043479
2527 Ga0495663_0005509
2528 Ga0495666_0001948
2529 Ga0495666_0002505
2530 Ga0495666_0004887
2531 Ga0495666_0009093
2532 Ga0495666_0019313
2533 Ga0495642_0038142
2534 Ga0495652_0003179
2535 Ga0495652_0005145
2536 Ga0495654_0000002
2537 Ga0495665_0006633
2538 Ga0495665_0007109
2539 Ga0495665_0021549
2540 Ga0495665_0025980
2541 Ga0495665_0044296
2542 Ga0495665_0066826
2543 Ga0495665_0088612
2544 Ga0495640_0039067
2545 Ga0495640_0053364
2546 Ga0495586_0015604
2547 Ga0495586_0024691
2548 Ga0495586_0051886
2549 Ga0495587_0009070
2550 Ga0495587_0009851
2551 Ga0495609_0000068
2552 Ga0495609_0006564
2553 Ga0495609_0006753
2554 Ga0495609_0008300
2555 Ga0495609_0014009
2556 Ga0495597_0003195
2557 Ga0495597_0037407
2558 Ga0495597_0042258
2559 Ga0495645_0002615
2560 Ga0495645_0085294
2561 Ga0495622_0000103
2562 Ga0495622_0000302
2563 Ga0495622_0015026
2564 Ga0495633_0000098
2565 Ga0495633_0007613
2566 Ga0495668_0001564
2567 Ga0495668_0056124
2568 Ga0495668_0059443
2569 Ga0495634_0020033
2570 Ga0495634_0031484
2571 Ga0495634_0046473
2572 Ga0495611_0003553
2573 Ga0495625_0001274
2574 Ga0495625_0001560
2575 Ga0495625_0004014
2576 Ga0495625_0023355
2577 Ga0495625_0045383
2578 Ga0495635_0013156
2579 Ga0495635_0033384
2580 Ga0495661_0000214
2581 Ga0495661_0003694
2582 Ga0495661_0006774
2583 Ga0495661_0027992
2584 Ga0495661_0114645
2585 Ga0495588_0011122
2586 Ga0495657_0099532
2587 Ga0495657_0172549
2588 Ga0495599_0010704
2589 Ga0495599_0031631
2590 Ga0495599_0061717
2591 Ga0495599_0150574
2592 Ga0495623_0007478
2593 Ga0495623_0011348
2594 Ga0495623_0020400
2595 Ga0495623_0050894
2596 Ga0495623_0083931
2597 Ga0495646_0001277
2598 Ga0495646_0005738
2599 Ga0495646_0040548
2600 Ga0495646_0043769
2601 Ga0495646_0078754
2602 Ga0495669_0011616
2603 Ga0495669_0018504
2604 Ga0495613_0002040
2605 Ga0495613_0052155
2606 Ga0495613_0059926
2607 Ga0495624_0014397
2608 Ga0495624_0037912
2609 Ga0495624_0081590
2610 Ga0495624_0091403
2611 Ga0495670_0032851
2612 Ga0495671_0009461
2613 Ga0495671_0014203
2614 Ga0495649_0011940
2615 Ga0495589_0000084
2616 Ga0495589_0002030
2617 Ga0495589_0002384
2618 Ga0495600_0006104
2619 Ga0495600_0008025
2620 Ga0495600_0012775
2621 Ga0495600_0012928
2622 Ga0495660_0005264
2623 Ga0495660_0067480
2624 Ga0495660_0072803
2625 Ga0495581_0001458
2626 Ga0495581_0014511
2627 Ga0495581_0018211
2628 Ga0495581_0080012
2629 Ga0495604_0005561
2630 Ga0495604_0046411
2631 Ga0495604_0155460
2632 Ga0495636_0007671
2633 Ga0495636_0007946
2634 Ga0495636_0037307
2635 Ga0495636_0059039
2636 Ga0495674_0010002
2637 Ga0495674_0016573
2638 Ga0495674_0018299
2639 Ga0495674_0085689
2640 Ga0495674_0117115
2641 Ga0495672_0036633
2642 Ga0495672_0101083
2643 Ga0495676_0020148
2644 Ga0495676_0020359
2645 Ga0495676_0027276
2646 Ga0495676_0059585
2647 Ga0495680_0003442
2648 Ga0495680_0013228
2649 Ga0495680_0255151
2650 Ga0495683_0002960
2651 Ga0495683_0011838
2652 Ga0495683_0040443
2653 Ga0495687_000101
2654 Ga0495687_001048
2655 Ga0495687_001664
2656 Ga0495687_007657
2657 Ga0495687_043985
2658 Ga0495675_0010019
2659 Ga0495677_0000015
2660 Ga0495677_0095293
2661 Ga0495679_000050
2662 Ga0495679_008460
2663 Ga0495679_010252
2664 Ga0495673_0000028
2665 Ga0495673_0002276
2666 Ga0495673_0006233
2667 Ga0495673_0006821
2668 Ga0495681_0010670
2669 Ga0495681_0082456
2670 Ga0495684_0013586
2671 Ga0495684_0031309
2672 Ga0495684_0041628
2673 Ga0495593_0005298
2674 Ga0495593_0026344
2675 Ga0495593_0029599
2676 Ga0495593_0041678
2677 Ga0495593_0054424
2678 Ga0495602_0008243
2679 Ga0495602_0013381
2680 Ga0495602_0049125
2681 Ga0495602_0112887
2682 Ga0495614_0002084
2683 Ga0495614_0005686
2684 Ga0495626_0000554
2685 Ga0495626_0013103
2686 Ga0495626_0013780
2687 Ga0495626_0023087
2688 Ga0496101_0001774
2689 Ga0496101_0013735
2690 Ga0496101_0068731
2691 Ga0496102_0015155
2692 Ga0496102_0027585
2693 Ga0496102_0150426
2694 Ga0496103_0001531
2695 Ga0496103_0017920
2696 Ga0496103_0040340
2697 Ga0496103_0059130
2698 Ga0496103_0078080
2699 Ga0496104_0008340
2700 Ga0496104_0154488
2701 Ga0496105_0006468
2702 Ga0496105_0086963
2703 Ga0496106_0000060
2704 Ga0496106_0018163
2705 Ga0496108_0110982
2706 Ga0496108_0149414
2707 Ga0496109_0073754
2708 Ga0496109_0119688
2709 Ga0496109_0138323
2710 Ga0496110_0079512
2711 Ga0496110_0328850
2712 Ga0496110_0368185
2713 Ga0496111_0023507
2714 Ga0496111_0125635
2715 Ga0496111_0244666
2716 Ga0496112_0123209
2717 Ga0496112_0372368
2718 Ga0496113_0170575
2719 Ga0496113_0437237
2720 Ga0496114_0038689
2721 Ga0496115_0398832
2722 Ga0496116_0009120
2723 Ga0496116_0010428
2724 Ga0496116_0027827
2725 Ga0496116_0043395
2726 Ga0496117_0004030
2727 Ga0496117_0012277
2728 Ga0496117_0076429
2729 Ga0496117_0099534
2730 Ga0496117_0112716
2731 Ga0496118_0001261
2732 Ga0496118_0006078
2733 Ga0496118_0009303
2734 Ga0496118_0009322
2735 Ga0496118_0120350
2736 Ga0496121_0000102
2737 Ga0496121_0006822
2738 Ga0496121_0007246
2739 Ga0496121_0013190
2740 Ga0496121_0021224
2741 Ga0496121_0033960
2742 Ga0496121_0036277
2743 Ga0496122_0002281
2744 Ga0496123_0000197
2745 Ga0496123_0008020
2746 Ga0496124_0194365
2747 Ga0496124_0195598
2748 Ga0496125_0000983
2749 Ga0496125_0004366
2750 Ga0496126_0001236
2751 Ga0496126_0004718
2752 Ga0496126_0047016
2753 Ga0495678_000006
2754 Ga0495678_009322
2755 Ga0501315_013242
2756 Ga0501031_0000636
2757 Ga0501031_0013813
2758 Ga0501031_0038223
2759 Ga0501031_0085123
2760 Ga0501032_0000783
2761 Ga0501032_0007662
2762 Ga0501032_0009141
2763 Ga0501032_0134993
2764 Ga0501032_0141194
2765 Ga0501033_0001537
2766 Ga0501033_0013469
2767 Ga0501034_0000280
2768 Ga0501034_0010044
2769 Ga0501034_0025314
2770 Ga0501034_0185152
2771 Ga0501036_0001069
2772 Ga0501036_0022159
2773 Ga0501036_0024220
2774 Ga0501036_0107556
2775 Ga0501037_0000440
2776 Ga0501037_0015454
2777 Ga0501037_0039408
2778 Ga0501037_0072179
2779 Ga0501038_0000396
2780 Ga0501038_0002694
2781 Ga0501038_0023085
2782 Ga0501038_0107968
2783 Ga0501039_0000504
2784 Ga0501039_0002363
2785 Ga0501039_0012456
2786 Ga0501039_0019428
2787 Ga0501039_0043108
2788 Ga0501039_0256211
2789 Ga0501040_0000263
2790 Ga0501040_0007613
2791 Ga0501040_0203508
2792 Ga0501041_0000044
2793 Ga0501041_0117643
2794 Ga0501042_0000486
2795 Ga0501042_0002115
2796 Ga0501042_0018653
2797 Ga0501042_0258717
2798 Ga0501042_0303729
2799 Ga0501043_0006041
2800 Ga0501043_0019037
2801 Ga0501043_0092968
2802 Ga0501043_0243992
2803 Ga0501046_0000656
2804 Ga0501046_0005246
2805 Ga0501046_0005612
2806 Ga0501046_0044933
2807 Ga0501046_0046771
2808 Ga0501047_0005610
2809 Ga0501047_0006804
2810 Ga0501047_0037594
2811 Ga0501047_0211836
2812 Ga0501047_0233954
2813 Ga0501048_0001832
2814 Ga0501048_0042583
2815 Ga0501068_0000515
2816 Ga0501068_0001598
2817 Ga0501070_0001279
2818 Ga0501070_0006977
2819 Ga0501070_0084021
2820 Ga0501070_0117447
2821 Ga0501070_0120325
2822 Ga0501071_0001606
2823 Ga0501071_0059290
2824 Ga0501072_0004090
2825 Ga0501072_0016016
2826 Ga0501073_0000882
2827 Ga0501073_0053360
2828 Ga0501073_0119943
2829 Ga0501074_0000309
2830 Ga0501074_0000689
2831 Ga0501074_0001854
2832 Ga0501074_0148904
2833 Ga0501075_0000475
2834 Ga0501076_0000508
2835 Ga0501076_0127867
2836 Ga0501077_0001283
2837 Ga0501198_000102
2838 Ga0501222_000008
2839 Ga0501249_017453
2840 Ga0501079_0000184
2841 Ga0501079_0006365
2842 Ga0501080_0001544
2843 Ga0501080_0076598
2844 Ga0501080_0241807
2845 Ga0501081_0000384
2846 Ga0501081_0054526
2847 Ga0501266_001480
2848 Ga0501268_009940
2849 Ga0501269_000336
2850 Ga0501035_0000180
2851 Ga0501035_0000813
2852 Ga0501035_0018177
2853 Ga0501035_0019942
2854 Ga0501035_0103895
2855 Ga0501044_0000524
2856 Ga0501044_0033216
2857 Ga0501044_0054882
2858 Ga0501044_0099157
2859 Ga0501045_0000247
2860 Ga0501045_0000572
2861 Ga0501045_0011965
2862 Ga0501045_0031742
2863 nmdc:mga03683_19887_c1
2864 nmdc:mga03683_36081_c1
2865 nmdc:mga0k408_123335_c1
2866 nmdc:mga0k408_134_c1
2867 nmdc:mga0k408_16168_c1
2868 nmdc:mga0k408_16620_c1
2869 nmdc:mga0k408_173971_c1
2870 nmdc:mga0k408_2894_c1
2871 nmdc:mga0k408_40340_c1
2872 nmdc:mga0k408_41026_c1
2873 nmdc:mga0k408_48608_c1
2874 nmdc:mga0k408_6019_c1
2875 nmdc:mga0k408_64802_c1
2876 nmdc:mga0k408_9772_c1
2877 nmdc:mga07m45_11022_c1
2878 nmdc:mga07m45_17248_c1
2879 nmdc:mga07m45_178022_c1
2880 nmdc:mga07m45_3410_c1
2881 nmdc:mga07m45_7383_c1
2882 nmdc:mga09592_1507_c1
2883 nmdc:mga09592_23134_c1
2884 nmdc:mga0qj67_10463_c1
2885 nmdc:mga0qj67_42320_c1
2886 nmdc:mga06r32_21676_c1
2887 nmdc:mga0n895_13637_c1
2888 nmdc:mga0n895_612_c1
2889 nmdc:mga0rr50_1855_c1
2890 nmdc:mga0rr50_311602_c1
2891 nmdc:mga0rr50_454697_c1
2892 nmdc:mga08x19_115267_c1
2893 nmdc:mga08x19_1378_c1
2894 nmdc:mga0a205_106525_c1
2895 nmdc:mga0a205_132165_c1
2896 nmdc:mga0a205_77741_c1
2897 nmdc:mga0sz30_27896_c1
2898 nmdc:mga0sz30_28850_c1
2899 Ga0495601_0004489
2900 Ga0500594_0009231
2901 Ga0500618_000621
2902 Ga0500658_0004584
2903 Ga0500619_037639
2904 Ga0501084_0000800
2905 Ga0501084_0074382
2906 Ga0587070_017221
2907 Ga0587083_0033968
2908 Ga0587088_003967
2909 Ga0587111_0014305
2910 Ga0501082_0027573
2911 Ga0501082_0033601
2912 Ga0501082_0130558
2913 Ga0466962_0006893
2914 Ga0466962_0055701
2915 Ga0466962_0071259
2916 Ga0466962_0099246
2917 Ga0530510_0000383
2918 2509127558
2919 2510250266
2920 2511250623
2921 2512347785
2922 2513953255
2923 2513960367
2924 2514042216
2925 2514053979
2926 2515679175
2927 2519458098
2928 2527076927
2929 2548847322
2930 2550693906
2931 2563059424
2932 2585294386
2933 2599739391
2934 2599742664
2935 2600204782
2936 2644027623
2937 2676741770
2938 2713479636
2939 2719639418
2940 2738819826
2941 2738832306
2942 2738873833
2943 2739185463
2944 2739220431
2945 2739612033
2946 2746092020
2947 2746099883
2948 2753571306
2949 2765568984
2950 2792838654
2951 2808984504
2952 2809131231
2953 2809150433
2954 2817260253
2955 2817277938
2956 2817451108
2957 2819545246
2958 2819591158
2959 2819622039
2960 2819632776
2961 2831870099
2962 2839096132
2963 2842330201
2964 2842356756
2965 2842457785
2966 2842721485
2967 2852621948
2968 2855735821
2969 2855772759
2970 2857576489
2971 2858691751
2972 2863421790
2973 2870072269
2974 2881930140
2975 2884812274
2976 2884836881
2977 2884853172
2978 2885272175
2979 2886849652
2980 2894024230
2981 2895516099
2982 2896155710
2983 2900635882
2984 2902683185
2985 2904484246
2986 2904618162
2987 2919530188
2988 2921649876
2989 2928109945
2990 2928131032
2991 2928136600
2992 2928159633
2993 2928164307
2994 2928173110
2995 2928509019
2996 2945935813
2997 2974322413
2998 2981994073
2999 2990710276
3000 642422800
3001 642415505
3002 642592398
3003 642620598
3004 644747057
3005 8018848227
3006 8020809291
3007 8020944638
3008 8020947380
3009 8020959719
3010 8021122667
3011 8039099429
3012 8040170555
3013 8040175454
3014 8055227234
3015 8055266432
3016 8055304951

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

183

264

0.87

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

42

338

0.85

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

80

321

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u63-assembly1.cif.gz_A crystal structure of putative thioredoxin reductase from haemophilus influenzae 0.9823 5 317
1f6m-assembly1.cif.gz_A crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+ 0.9776 5 321
5vt3-assembly1.cif.gz_A high resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with nadp and fad 0.9766 7 318
5u63-assembly1.cif.gz_A crystal structure of putative thioredoxin reductase from haemophilus influenzae 0.9731 5 317
5vt3-assembly1.cif.gz_A high resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with nadp and fad 0.9704 7 318
ID Description Score Start End Superfamily
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.993 120 246 3.50.50.60
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9853 120 246 3.50.50.60
af_P0A9P4_2_316_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9812 5 316 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9695 120 246 3.50.50.60
af_P0A9P4_2_316_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9689 5 316 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6N6X486-F1-model_v4 deleted 0.9849 111 243
AF-A0A353D0T2-F1-model_v4 Thioredoxin-disulfide reductase 0.9792 4 116 GO:0016491
AF-A0A520GV49-F1-model_v4 Thioredoxin-disulfide reductase 0.9765 4 110 GO:0016491
AF-A0A7C5PUW0-F1-model_v4 Thioredoxin-disulfide reductase 0.9735 5 213 GO:0016668
AF-A0A6M1HRK1-F1-model_v4 deleted 0.9729 173 322

Map