F494455
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1508 | 631 | 3016 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300049578|Ga0501042_0197434|Ga0501042_0197434_276_1340 |
| Length | 354 |
| Sequence | MASSARGFALAPAARALISSTILSFPSFAANNMPSDATPRHTRLVILGSGPAGFSAAVYAARANLKPLLITGLEQGGQLMTTTDVDNWPADADGVQGPDLMARFQKHAERFETEVVFDHIQKVDLAASPKRLSGDNGEYTADAVIIATGASARYLGLPSEQAFMGKGVSACATCDGFFYKGQDVVVVGGGNTAVEEALYLSNIAKRVTVIHRRDKFRAEAILIDRLMAKTRDGGNISVVWDHVLDEVLGDATGVTGVRIKEKTTGATRDIPAHGVFIAIGHTPNTQVFEGQLDMANGYIQVRSGTQGNATATSVPGVFASGDVADHVYRQAVTSAGTGCMAALDAEAWLEEQVH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 22 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 126 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 127 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 154 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 162 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 251 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 260 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 270 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 273 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 274 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 275 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 277 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 278 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 279 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 280 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 281 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 282 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 283 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 284 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 285 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 286 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 287 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 288 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 289 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 290 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 292 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 293 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 294 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 295 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 296 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 297 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 298 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 299 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 300 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 301 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 302 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 303 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 304 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 305 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 306 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 307 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 308 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 309 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 310 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 311 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 312 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 313 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 314 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 315 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 316 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 317 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 319 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 320 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 321 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 322 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 323 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 324 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 325 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 326 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 327 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 329 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 330 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 331 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 332 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 333 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 334 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 335 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 336 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 337 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 338 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 339 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 340 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 341 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 342 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 343 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 344 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 345 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 346 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 347 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 348 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 349 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 350 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 351 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 352 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 353 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 354 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 355 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 356 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 357 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 358 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 359 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 360 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 361 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 362 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 363 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 451 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 452 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 453 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 454 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 455 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 456 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 457 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 458 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 459 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 460 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 461 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 462 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 463 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 464 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 465 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 466 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 467 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 468 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 469 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 470 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 471 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 472 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 498 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 499 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 500 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 504 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 505 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 506 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 510 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 511 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 512 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 515 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 516 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 520 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 522 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 523 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 524 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 525 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 532 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 533 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 534 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 535 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 536 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 537 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 538 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 539 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 540 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 541 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 542 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 543 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 544 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 545 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 546 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 547 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 548 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 549 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 550 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 551 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 552 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 553 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 554 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 555 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 556 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 557 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 558 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 559 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 560 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 561 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 562 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 563 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 564 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 565 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 566 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 567 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 568 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 569 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 570 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 571 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 572 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 573 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 574 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 575 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 576 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 577 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 578 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 579 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 580 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 581 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 582 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 583 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 584 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 585 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 586 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 587 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 588 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 589 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 590 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 591 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 592 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 593 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 594 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 595 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 596 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 597 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 598 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 599 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 600 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 601 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 602 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 603 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 604 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 605 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 606 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 607 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 608 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 609 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 610 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 611 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 612 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 613 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 614 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 615 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 616 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 617 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 618 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 619 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 620 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 621 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 622 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 623 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 624 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 625 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 626 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 627 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 628 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 629 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 630 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 631 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.04 |
| Metatranscriptomes | 0.4 |
| Isolates | 6.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.72 |
| Nodule | 2.19 |
| Rhizoplane | 2.72 |
| Rhizosphere | 71.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501042_0197434 | 3300049578 | Bacteria | 1451 |
| 2 | JGI24740J21852_10000408 | 3300001979 | Bacteria | 18450 |
| 3 | JGI24739J22299_10002612 | 3300001989 | Bacteria | 6938 |
| 4 | JGI24739J22299_10022734 | 3300001989 | Bacteria | 2223 |
| 5 | JGI24735J21928_10004224 | 3300002067 | Bacteria | 4846 |
| 6 | JGI24735J21928_10043488 | 3300002067 | Bacteria | 1306 |
| 7 | JGI24738J21930_10002746 | 3300002075 | Bacteria | 4528 |
| 8 | JGI25155J39150_1000186 | 3300002704 | Bacteria | 26654 |
| 9 | JGI25155J39150_1000416 | 3300002704 | Bacteria | 11587 |
| 10 | JGI25156J39149_1000425 | 3300002705 | Bacteria | 26221 |
| 11 | JGI25156J39149_1000808 | 3300002705 | Bacteria | 16016 |
| 12 | JGI25156J39149_1001518 | 3300002705 | Bacteria | 9635 |
| 13 | JGI25156J39149_1003490 | 3300002705 | Bacteria | 5129 |
| 14 | JGI25162J39368_1000426 | 3300002737 | Bacteria | 34131 |
| 15 | JGI25154J39366_1000496 | 3300002738 | Bacteria | 20193 |
| 16 | JGI25154J39366_1000504 | 3300002738 | Bacteria | 19901 |
| 17 | JGI25154J39366_1000704 | 3300002738 | Bacteria | 15273 |
| 18 | JGI25154J39366_1000985 | 3300002738 | Bacteria | 11552 |
| 19 | JGI25154J39366_1002170 | 3300002738 | Bacteria | 5478 |
| 20 | JGI25158J39367_1000154 | 3300002739 | Bacteria | 16089 |
| 21 | JGI25157J39369_1000021 | 3300002741 | Bacteria | 163907 |
| 22 | JGI25157J39369_1000771 | 3300002741 | Bacteria | 16594 |
| 23 | JGI25163J39215_1001943 | 3300002771 | Bacteria | 2600 |
| 24 | JGI25150J39212_1007054 | 3300002774 | Bacteria | 2281 |
| 25 | JGI25159J45721_1000806 | 3300002987 | Bacteria | 13665 |
| 26 | JGI25151J46595_10003776 | 3300003187 | Bacteria | 8217 |
| 27 | JGI25151J46595_10004054 | 3300003187 | Bacteria | 7856 |
| 28 | JGI25151J46595_10018776 | 3300003187 | Bacteria | 2956 |
| 29 | JGI25151J46595_10024627 | 3300003187 | Bacteria | 2460 |
| 30 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 31 | JGI25165J46597_1001231 | 3300003214 | Bacteria | 15212 |
| 32 | rootH2_10004894 | 3300003320 | Bacteria | 17076 |
| 33 | rootL2_10000757 | 3300003322 | Bacteria | 81071 |
| 34 | rootL2_10000982 | 3300003322 | Bacteria | 15080 |
| 35 | rootL2_10002392 | 3300003322 | Bacteria | 54339 |
| 36 | rootL2_10008489 | 3300003322 | Bacteria | 50545 |
| 37 | rootH1_10007359 | 3300003323 | Bacteria | 18468 |
| 38 | JGI25160J50197_1000140 | 3300003354 | Bacteria | 65061 |
| 39 | JGI25161J50226_1000062 | 3300003374 | Bacteria | 99783 |
| 40 | JGI25161J50226_1004262 | 3300003374 | Bacteria | 3034 |
| 41 | Ga0006554J51385_1029846 | 3300003567 | Bacteria | 1092 |
| 42 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 43 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 44 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 45 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 46 | Ga0055539_1000129 | 3300003752 | Bacteria | 80419 |
| 47 | Ga0055539_1001072 | 3300003752 | Bacteria | 5804 |
| 48 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 49 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 50 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 51 | Ga0055533_1000038 | 3300003756 | Bacteria | 251370 |
| 52 | Ga0055533_1000040 | 3300003756 | Bacteria | 242927 |
| 53 | Ga0055533_1000750 | 3300003756 | Bacteria | 10388 |
| 54 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 55 | Ga0055532_1000016 | 3300003758 | Bacteria | 327509 |
| 56 | Ga0055532_1003589 | 3300003758 | Bacteria | 2595 |
| 57 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 58 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 59 | Ga0055525_1000046 | 3300003759 | Bacteria | 261587 |
| 60 | Ga0055525_1000173 | 3300003759 | Bacteria | 81767 |
| 61 | Ga0055525_1000182 | 3300003759 | Bacteria | 78412 |
| 62 | Ga0055525_1000436 | 3300003759 | Bacteria | 24398 |
| 63 | Ga0055525_1000804 | 3300003759 | Bacteria | 9793 |
| 64 | Ga0055527_1000002 | 3300003760 | Bacteria | 830488 |
| 65 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 66 | Ga0055535_1000908 | 3300003761 | Bacteria | 20052 |
| 67 | Ga0055535_1002931 | 3300003761 | Bacteria | 5296 |
| 68 | Ga0055535_1006273 | 3300003761 | Bacteria | 2439 |
| 69 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 70 | Ga0055542_1001564 | 3300003762 | Bacteria | 10731 |
| 71 | Ga0055529_1000001 | 3300003763 | Bacteria | 826680 |
| 72 | Ga0055529_1000051 | 3300003763 | Bacteria | 205006 |
| 73 | Ga0055529_1000218 | 3300003763 | Bacteria | 74813 |
| 74 | Ga0055529_1001138 | 3300003763 | Bacteria | 11271 |
| 75 | Ga0055526_1000358 | 3300003771 | Bacteria | 37034 |
| 76 | Ga0055526_1000537 | 3300003771 | Bacteria | 30014 |
| 77 | Ga0055526_1000716 | 3300003771 | Bacteria | 25160 |
| 78 | Ga0055526_1001023 | 3300003771 | Bacteria | 20456 |
| 79 | Ga0055526_1005468 | 3300003771 | Bacteria | 7294 |
| 80 | Ga0055526_1009687 | 3300003771 | Bacteria | 4595 |
| 81 | Ga0055526_1012007 | 3300003771 | Bacteria | 3829 |
| 82 | Ga0055526_1023754 | 3300003771 | Bacteria | 2034 |
| 83 | Ga0055526_1028162 | 3300003771 | Bacteria | 1708 |
| 84 | Ga0055526_1028180 | 3300003771 | Bacteria | 1708 |
| 85 | Ga0055526_1044351 | 3300003771 | Bacteria | 1074 |
| 86 | Ga0055537_1000022 | 3300003773 | Bacteria | 114484 |
| 87 | Ga0055537_1003965 | 3300003773 | Bacteria | 4383 |
| 88 | Ga0055537_1004727 | 3300003773 | Bacteria | 3823 |
| 89 | Ga0055537_1005357 | 3300003773 | Bacteria | 3454 |
| 90 | Ga0055524_1000241 | 3300003775 | Bacteria | 57262 |
| 91 | Ga0055524_1001254 | 3300003775 | Bacteria | 14894 |
| 92 | Ga0055524_1001347 | 3300003775 | Bacteria | 14314 |
| 93 | Ga0055524_1001821 | 3300003775 | Bacteria | 11688 |
| 94 | Ga0055536_1000095 | 3300003781 | Bacteria | 76235 |
| 95 | Ga0055534_1000468 | 3300003784 | Bacteria | 22901 |
| 96 | Ga0055534_1000708 | 3300003784 | Bacteria | 16367 |
| 97 | Ga0055534_1000987 | 3300003784 | Bacteria | 12550 |
| 98 | Ga0055534_1005473 | 3300003784 | Bacteria | 3390 |
| 99 | Ga0055534_1010175 | 3300003784 | Bacteria | 1990 |
| 100 | Ga0055528_1000473 | 3300003790 | Bacteria | 32133 |
| 101 | Ga0055528_1002794 | 3300003790 | Bacteria | 9145 |
| 102 | Ga0055528_1034677 | 3300003790 | Bacteria | 1238 |
| 103 | Ga0055530_10000057 | 3300003791 | Bacteria | 100782 |
| 104 | Ga0055530_10004150 | 3300003791 | Bacteria | 7662 |
| 105 | Ga0055530_10016028 | 3300003791 | Bacteria | 2414 |
| 106 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 107 | Ga0055540_1022195 | 3300003792 | Bacteria | 1629 |
| 108 | Ga0055540_1033611 | 3300003792 | Bacteria | 1161 |
| 109 | Ga0055531_10002737 | 3300003794 | Bacteria | 11585 |
| 110 | Ga0055531_10018527 | 3300003794 | Bacteria | 2868 |
| 111 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 112 | Ga0055541_1000043 | 3300003841 | Bacteria | 161703 |
| 113 | Ga0055541_1000084 | 3300003841 | Bacteria | 81767 |
| 114 | Ga0055541_1005715 | 3300003841 | Bacteria | 2158 |
| 115 | Ga0055543_1000121 | 3300004625 | Bacteria | 66082 |
| 116 | Ga0055543_1001320 | 3300004625 | Bacteria | 10143 |
| 117 | Ga0055543_1013115 | 3300004625 | Bacteria | 1647 |
| 118 | Ga0065165_1000261 | 3300005262 | Bacteria | 90816 |
| 119 | Ga0065165_1000613 | 3300005262 | Bacteria | 51836 |
| 120 | Ga0065165_1000952 | 3300005262 | Bacteria | 36509 |
| 121 | Ga0065715_10016327 | 3300005293 | Bacteria | 2048 |
| 122 | Ga0065707_10107524 | 3300005295 | Bacteria | 2550 |
| 123 | Ga0070658_10032140 | 3300005327 | Bacteria | 4220 |
| 124 | Ga0070658_10158077 | 3300005327 | Bacteria | 1900 |
| 125 | Ga0070676_10120384 | 3300005328 | Bacteria | 1647 |
| 126 | Ga0070676_10173867 | 3300005328 | Bacteria | 1395 |
| 127 | Ga0070683_100004795 | 3300005329 | Bacteria | 11192 |
| 128 | Ga0070690_100065041 | 3300005330 | Bacteria | 2357 |
| 129 | Ga0070670_100001406 | 3300005331 | Bacteria | 19333 |
| 130 | Ga0070670_100003471 | 3300005331 | Bacteria | 13082 |
| 131 | Ga0070670_100007979 | 3300005331 | Bacteria | 9003 |
| 132 | Ga0070670_100033488 | 3300005331 | Bacteria | 4425 |
| 133 | Ga0070670_100041376 | 3300005331 | Bacteria | 3961 |
| 134 | Ga0070670_100074064 | 3300005331 | Bacteria | 2924 |
| 135 | Ga0070670_100084291 | 3300005331 | Bacteria | 2730 |
| 136 | Ga0070670_100137799 | 3300005331 | Bacteria | 2109 |
| 137 | Ga0068869_100003074 | 3300005334 | Bacteria | 10156 |
| 138 | Ga0068869_100283528 | 3300005334 | Bacteria | 1333 |
| 139 | Ga0070666_10018750 | 3300005335 | Bacteria | 4455 |
| 140 | Ga0070682_100009086 | 3300005337 | Bacteria | 5619 |
| 141 | Ga0068868_100002961 | 3300005338 | Bacteria | 11792 |
| 142 | Ga0068868_100044482 | 3300005338 | Bacteria | 3471 |
| 143 | Ga0070660_100000008 | 3300005339 | Bacteria | 155650 |
| 144 | Ga0070660_100003570 | 3300005339 | Bacteria | 10742 |
| 145 | Ga0070660_100163250 | 3300005339 | Bacteria | 1796 |
| 146 | Ga0070660_100178130 | 3300005339 | Bacteria | 1720 |
| 147 | Ga0070660_100209466 | 3300005339 | Bacteria | 1582 |
| 148 | Ga0070689_100061984 | 3300005340 | Bacteria | 2909 |
| 149 | Ga0070687_100030926 | 3300005343 | Bacteria | 2621 |
| 150 | Ga0070687_100058009 | 3300005343 | Bacteria | 2032 |
| 151 | Ga0070661_100005081 | 3300005344 | Bacteria | 9075 |
| 152 | Ga0070668_100004719 | 3300005347 | Bacteria | 10103 |
| 153 | Ga0070668_100068825 | 3300005347 | Bacteria | 2752 |
| 154 | Ga0070668_100187019 | 3300005347 | Bacteria | 1695 |
| 155 | Ga0070669_100080910 | 3300005353 | Bacteria | 2419 |
| 156 | Ga0070669_100237761 | 3300005353 | Bacteria | 1446 |
| 157 | Ga0070675_100003790 | 3300005354 | Bacteria | 11481 |
| 158 | Ga0070675_100005988 | 3300005354 | Bacteria | 9320 |
| 159 | Ga0070675_100007331 | 3300005354 | Bacteria | 8512 |
| 160 | Ga0070675_100009293 | 3300005354 | Bacteria | 7642 |
| 161 | Ga0070675_100232539 | 3300005354 | Bacteria | 1608 |
| 162 | Ga0070671_100035058 | 3300005355 | Bacteria | 4156 |
| 163 | Ga0070671_100048181 | 3300005355 | Bacteria | 3543 |
| 164 | Ga0070671_100053379 | 3300005355 | Bacteria | 3360 |
| 165 | Ga0070674_100004270 | 3300005356 | Bacteria | 8131 |
| 166 | Ga0070673_100002423 | 3300005364 | Bacteria | 11361 |
| 167 | Ga0070673_100018209 | 3300005364 | Bacteria | 5014 |
| 168 | Ga0070673_100031799 | 3300005364 | Bacteria | 3965 |
| 169 | Ga0070673_100037071 | 3300005364 | Bacteria | 3712 |
| 170 | Ga0070673_100047712 | 3300005364 | Bacteria | 3334 |
| 171 | Ga0070673_100103268 | 3300005364 | Bacteria | 2351 |
| 172 | Ga0070659_100000014 | 3300005366 | Bacteria | 178272 |
| 173 | Ga0070659_100005143 | 3300005366 | Bacteria | 9380 |
| 174 | Ga0070659_100148183 | 3300005366 | Bacteria | 1913 |
| 175 | Ga0070659_100178134 | 3300005366 | Bacteria | 1744 |
| 176 | Ga0070659_100275751 | 3300005366 | Bacteria | 1398 |
| 177 | Ga0070667_100001679 | 3300005367 | Bacteria | 19790 |
| 178 | Ga0070667_100009453 | 3300005367 | Bacteria | 8087 |
| 179 | Ga0070714_100067168 | 3300005435 | Bacteria | 3091 |
| 180 | Ga0070710_10295396 | 3300005437 | Bacteria | 1056 |
| 181 | Ga0070701_10005536 | 3300005438 | Bacteria | 5225 |
| 182 | Ga0070701_10227493 | 3300005438 | Bacteria | 1115 |
| 183 | Ga0070705_100002406 | 3300005440 | Bacteria | 9418 |
| 184 | Ga0070705_100044579 | 3300005440 | Bacteria | 2548 |
| 185 | Ga0070700_100094244 | 3300005441 | Bacteria | 1960 |
| 186 | Ga0070663_100000913 | 3300005455 | Bacteria | 16041 |
| 187 | Ga0070663_100353011 | 3300005455 | Bacteria | 1191 |
| 188 | Ga0070678_100001893 | 3300005456 | Bacteria | 11274 |
| 189 | Ga0070662_100008260 | 3300005457 | Bacteria | 6779 |
| 190 | Ga0070662_100023135 | 3300005457 | Bacteria | 4265 |
| 191 | Ga0070662_100234096 | 3300005457 | Bacteria | 1470 |
| 192 | Ga0070662_100318482 | 3300005457 | Bacteria | 1268 |
| 193 | Ga0070681_10089614 | 3300005458 | Bacteria | 3027 |
| 194 | Ga0070681_10096062 | 3300005458 | Bacteria | 2912 |
| 195 | Ga0068867_100003769 | 3300005459 | Bacteria | 10673 |
| 196 | Ga0068867_100019029 | 3300005459 | Bacteria | 4889 |
| 197 | Ga0068867_100049361 | 3300005459 | Bacteria | 3098 |
| 198 | Ga0068867_100104085 | 3300005459 | Bacteria | 2172 |
| 199 | Ga0068867_100111074 | 3300005459 | Bacteria | 2106 |
| 200 | Ga0070685_10260627 | 3300005466 | Bacteria | 1153 |
| 201 | Ga0070706_100027330 | 3300005467 | Bacteria | 5251 |
| 202 | Ga0070706_100040485 | 3300005467 | Bacteria | 4301 |
| 203 | Ga0070706_100573970 | 3300005467 | Bacteria | 1049 |
| 204 | Ga0070707_100171948 | 3300005468 | Bacteria | 2111 |
| 205 | Ga0070698_100077238 | 3300005471 | Bacteria | 3330 |
| 206 | Ga0070698_100194250 | 3300005471 | Bacteria | 1967 |
| 207 | Ga0070698_100198110 | 3300005471 | Bacteria | 1944 |
| 208 | Ga0070699_100051724 | 3300005518 | Bacteria | 3557 |
| 209 | Ga0070699_100335711 | 3300005518 | Bacteria | 1360 |
| 210 | Ga0070679_100082146 | 3300005530 | Bacteria | 3212 |
| 211 | Ga0070684_100038866 | 3300005535 | Bacteria | 4091 |
| 212 | Ga0070697_100137437 | 3300005536 | Bacteria | 2053 |
| 213 | Ga0068853_100021304 | 3300005539 | Bacteria | 5403 |
| 214 | Ga0068853_100138104 | 3300005539 | Bacteria | 2187 |
| 215 | Ga0068853_100280460 | 3300005539 | Bacteria | 1536 |
| 216 | Ga0070672_100000559 | 3300005543 | Bacteria | 21793 |
| 217 | Ga0070672_100001075 | 3300005543 | Bacteria | 16635 |
| 218 | Ga0070672_100020445 | 3300005543 | Bacteria | 4828 |
| 219 | Ga0070672_100086563 | 3300005543 | Bacteria | 2520 |
| 220 | Ga0070672_100160032 | 3300005543 | Bacteria | 1867 |
| 221 | Ga0070672_100213340 | 3300005543 | Bacteria | 1617 |
| 222 | Ga0070686_100081925 | 3300005544 | Bacteria | 2139 |
| 223 | Ga0070686_100160244 | 3300005544 | Bacteria | 1584 |
| 224 | Ga0070693_100155711 | 3300005547 | Bacteria | 1451 |
| 225 | Ga0070665_100140620 | 3300005548 | Bacteria | 2417 |
| 226 | Ga0070665_100457944 | 3300005548 | Bacteria | 1285 |
| 227 | Ga0070704_100004786 | 3300005549 | Bacteria | 7838 |
| 228 | Ga0068855_100000065 | 3300005563 | Bacteria | 129307 |
| 229 | Ga0068855_100053523 | 3300005563 | Bacteria | 4748 |
| 230 | Ga0068855_100071387 | 3300005563 | Bacteria | 4038 |
| 231 | Ga0068855_100087568 | 3300005563 | Bacteria | 3599 |
| 232 | Ga0068855_100141910 | 3300005563 | Bacteria | 2737 |
| 233 | Ga0068855_100233970 | 3300005563 | Bacteria | 2055 |
| 234 | Ga0070664_100018873 | 3300005564 | Bacteria | 5669 |
| 235 | Ga0070664_100020897 | 3300005564 | Bacteria | 5394 |
| 236 | Ga0070664_100104091 | 3300005564 | Bacteria | 2471 |
| 237 | Ga0070664_100291396 | 3300005564 | Bacteria | 1474 |
| 238 | Ga0070664_100551389 | 3300005564 | Bacteria | 1066 |
| 239 | Ga0068857_100009558 | 3300005577 | Bacteria | 8421 |
| 240 | Ga0068857_100080714 | 3300005577 | Bacteria | 2904 |
| 241 | Ga0068857_100256505 | 3300005577 | Bacteria | 1604 |
| 242 | Ga0068854_100014807 | 3300005578 | Bacteria | 5149 |
| 243 | Ga0068854_100024410 | 3300005578 | Bacteria | 4139 |
| 244 | Ga0068856_100051596 | 3300005614 | Bacteria | 4055 |
| 245 | Ga0068856_100267979 | 3300005614 | Bacteria | 1724 |
| 246 | Ga0070702_100118276 | 3300005615 | Bacteria | 1655 |
| 247 | Ga0068852_100006246 | 3300005616 | Bacteria | 8595 |
| 248 | Ga0068852_100008168 | 3300005616 | Bacteria | 7687 |
| 249 | Ga0068852_100040750 | 3300005616 | Bacteria | 3921 |
| 250 | Ga0068859_100000737 | 3300005617 | Bacteria | 32959 |
| 251 | Ga0068859_100252302 | 3300005617 | Bacteria | 1855 |
| 252 | Ga0068864_100000840 | 3300005618 | Bacteria | 25896 |
| 253 | Ga0068864_100001287 | 3300005618 | Bacteria | 20878 |
| 254 | Ga0068864_100013771 | 3300005618 | Bacteria | 6706 |
| 255 | Ga0068864_100031709 | 3300005618 | Bacteria | 4486 |
| 256 | Ga0068864_100036830 | 3300005618 | Bacteria | 4172 |
| 257 | Ga0068861_100005132 | 3300005719 | Bacteria | 8829 |
| 258 | Ga0068861_100011169 | 3300005719 | Bacteria | 6235 |
| 259 | Ga0068851_10009611 | 3300005834 | Bacteria | 4503 |
| 260 | Ga0068851_10143297 | 3300005834 | Bacteria | 1301 |
| 261 | Ga0068870_10027159 | 3300005840 | Bacteria | 2861 |
| 262 | Ga0068863_100005089 | 3300005841 | Bacteria | 12965 |
| 263 | Ga0068863_100011648 | 3300005841 | Bacteria | 8507 |
| 264 | Ga0068863_100205428 | 3300005841 | Bacteria | 1896 |
| 265 | Ga0068863_100376592 | 3300005841 | Bacteria | 1386 |
| 266 | Ga0068858_100125906 | 3300005842 | Bacteria | 2399 |
| 267 | Ga0068860_100002072 | 3300005843 | Bacteria | 21139 |
| 268 | Ga0068860_100078105 | 3300005843 | Bacteria | 3148 |
| 269 | Ga0068862_100011170 | 3300005844 | Bacteria | 7418 |
| 270 | Ga0068862_100019343 | 3300005844 | Bacteria | 5683 |
| 271 | Ga0068862_100024514 | 3300005844 | Bacteria | 5062 |
| 272 | Ga0068862_100047853 | 3300005844 | Bacteria | 3650 |
| 273 | Ga0068862_100406526 | 3300005844 | Bacteria | 1275 |
| 274 | Ga0075368_10007221 | 3300006042 | Bacteria | 3915 |
| 275 | Ga0075363_100049286 | 3300006048 | Bacteria | 2242 |
| 276 | Ga0075362_10021576 | 3300006177 | Bacteria | 2705 |
| 277 | Ga0075367_10113805 | 3300006178 | Bacteria | 1663 |
| 278 | Ga0075369_10004056 | 3300006186 | Bacteria | 5382 |
| 279 | Ga0075366_10012319 | 3300006195 | Bacteria | 4848 |
| 280 | Ga0075366_10012445 | 3300006195 | Bacteria | 4826 |
| 281 | Ga0075366_10018887 | 3300006195 | Bacteria | 3984 |
| 282 | Ga0075366_10052320 | 3300006195 | Bacteria | 2427 |
| 283 | Ga0075366_10052525 | 3300006195 | Bacteria | 2421 |
| 284 | Ga0097621_100044191 | 3300006237 | Bacteria | 3594 |
| 285 | Ga0075370_10012972 | 3300006353 | Bacteria | 4419 |
| 286 | Ga0075370_10061718 | 3300006353 | Bacteria | 2135 |
| 287 | Ga0075370_10162176 | 3300006353 | Bacteria | 1312 |
| 288 | Ga0068871_100010530 | 3300006358 | Bacteria | 6755 |
| 289 | Ga0068871_100023680 | 3300006358 | Bacteria | 4753 |
| 290 | Ga0068871_100229083 | 3300006358 | Bacteria | 1612 |
| 291 | Ga0068871_100237988 | 3300006358 | Bacteria | 1582 |
| 292 | Ga0075428_100034656 | 3300006844 | Bacteria | 5566 |
| 293 | Ga0075430_100018777 | 3300006846 | Bacteria | 5883 |
| 294 | Ga0075431_100032658 | 3300006847 | Bacteria | 5364 |
| 295 | Ga0075431_100119141 | 3300006847 | Bacteria | 2724 |
| 296 | Ga0075433_10197446 | 3300006852 | Bacteria | 1789 |
| 297 | Ga0075434_100000211 | 3300006871 | Bacteria | 39638 |
| 298 | Ga0075434_100013586 | 3300006871 | Bacteria | 7758 |
| 299 | Ga0075434_100417867 | 3300006871 | Bacteria | 1362 |
| 300 | Ga0075429_100000463 | 3300006880 | Bacteria | 30330 |
| 301 | Ga0068865_100009315 | 3300006881 | Bacteria | 6083 |
| 302 | Ga0075436_100000711 | 3300006914 | Bacteria | 22075 |
| 303 | Ga0097620_100000737 | 3300006931 | Bacteria | 32959 |
| 304 | Ga0097620_100252305 | 3300006931 | Bacteria | 1855 |
| 305 | Ga0099824_1022389 | 3300006942 | Bacteria | 4177 |
| 306 | Ga0079104_1000002 | 3300006946 | Bacteria | 514469 |
| 307 | Ga0079104_1004866 | 3300006946 | Bacteria | 5565 |
| 308 | Ga0099826_10000028 | 3300006948 | Bacteria | 129794 |
| 309 | Ga0075435_100001401 | 3300007076 | Bacteria | 15529 |
| 310 | Ga0075435_100013086 | 3300007076 | Bacteria | 6162 |
| 311 | Ga0075435_100027772 | 3300007076 | Bacteria | 4431 |
| 312 | Ga0075435_100056631 | 3300007076 | Bacteria | 3170 |
| 313 | Ga0105251_10000602 | 3300009011 | Bacteria | 32992 |
| 314 | Ga0105251_10041204 | 3300009011 | Bacteria | 2249 |
| 315 | Ga0105244_10053504 | 3300009036 | Bacteria | 2051 |
| 316 | Ga0105250_10002860 | 3300009092 | Bacteria | 8447 |
| 317 | Ga0105250_10015617 | 3300009092 | Bacteria | 3108 |
| 318 | Ga0105240_10000297 | 3300009093 | Bacteria | 96825 |
| 319 | Ga0105240_10009100 | 3300009093 | Bacteria | 14099 |
| 320 | Ga0105240_10034284 | 3300009093 | Bacteria | 6549 |
| 321 | Ga0105240_10038292 | 3300009093 | Bacteria | 6151 |
| 322 | Ga0105240_10110669 | 3300009093 | Bacteria | 3324 |
| 323 | Ga0105240_10145471 | 3300009093 | Bacteria | 2829 |
| 324 | Ga0105240_10329241 | 3300009093 | Bacteria | 1738 |
| 325 | Ga0111539_10066234 | 3300009094 | Bacteria | 4266 |
| 326 | Ga0114129_10054355 | 3300009147 | Bacteria | 5613 |
| 327 | Ga0105243_10001651 | 3300009148 | Bacteria | 19332 |
| 328 | Ga0105243_10107188 | 3300009148 | Bacteria | 2330 |
| 329 | Ga0105241_10111771 | 3300009174 | Bacteria | 2188 |
| 330 | Ga0105241_10140213 | 3300009174 | Bacteria | 1967 |
| 331 | Ga0105242_10000485 | 3300009176 | Bacteria | 31627 |
| 332 | Ga0105242_10149273 | 3300009176 | Bacteria | 2037 |
| 333 | Ga0105242_10170498 | 3300009176 | Bacteria | 1912 |
| 334 | Ga0105242_10363313 | 3300009176 | Bacteria | 1340 |
| 335 | Ga0105248_10008373 | 3300009177 | Bacteria | 11356 |
| 336 | Ga0105248_10063680 | 3300009177 | Bacteria | 4139 |
| 337 | Ga0105237_10059880 | 3300009545 | Bacteria | 3809 |
| 338 | Ga0105238_10008362 | 3300009551 | Bacteria | 10352 |
| 339 | Ga0105238_10017542 | 3300009551 | Bacteria | 7279 |
| 340 | Ga0105238_10018705 | 3300009551 | Bacteria | 7056 |
| 341 | Ga0105238_10165226 | 3300009551 | Bacteria | 2189 |
| 342 | Ga0105238_10288918 | 3300009551 | Bacteria | 1622 |
| 343 | Ga0105238_10362725 | 3300009551 | Bacteria | 1438 |
| 344 | Ga0105239_10005209 | 3300010375 | Bacteria | 15299 |
| 345 | Ga0105239_10027775 | 3300010375 | Bacteria | 6227 |
| 346 | Ga0105239_10197986 | 3300010375 | Bacteria | 2250 |
| 347 | Ga0157317_1002422 | 3300012475 | Bacteria | 1101 |
| 348 | Ga0157373_10085063 | 3300013100 | Bacteria | 2229 |
| 349 | Ga0157370_10174745 | 3300013104 | Bacteria | 1996 |
| 350 | Ga0157369_10000179 | 3300013105 | Bacteria | 89102 |
| 351 | Ga0157369_10040041 | 3300013105 | Bacteria | 5118 |
| 352 | Ga0157369_10213725 | 3300013105 | Bacteria | 2021 |
| 353 | Ga0157374_10130246 | 3300013296 | Bacteria | 2434 |
| 354 | Ga0157374_10145394 | 3300013296 | Bacteria | 2303 |
| 355 | Ga0157374_10260712 | 3300013296 | Bacteria | 1707 |
| 356 | Ga0157378_10032916 | 3300013297 | Bacteria | 4582 |
| 357 | Ga0157378_10427012 | 3300013297 | Bacteria | 1311 |
| 358 | Ga0163162_10068472 | 3300013306 | Bacteria | 3601 |
| 359 | Ga0163162_10143959 | 3300013306 | Bacteria | 2498 |
| 360 | Ga0163162_10201421 | 3300013306 | Bacteria | 2119 |
| 361 | Ga0163162_10206877 | 3300013306 | Bacteria | 2092 |
| 362 | Ga0157372_10105731 | 3300013307 | Bacteria | 3219 |
| 363 | Ga0157372_10408573 | 3300013307 | Bacteria | 1582 |
| 364 | Ga0157375_10027001 | 3300013308 | Bacteria | 5360 |
| 365 | Ga0163163_10010908 | 3300014325 | Bacteria | 8207 |
| 366 | Ga0163163_10016193 | 3300014325 | Bacteria | 6921 |
| 367 | Ga0157380_10091235 | 3300014326 | Bacteria | 2515 |
| 368 | Ga0182008_10000215 | 3300014497 | Bacteria | 45361 |
| 369 | Ga0182008_10031438 | 3300014497 | Bacteria | 2673 |
| 370 | Ga0157377_10244905 | 3300014745 | Bacteria | 1159 |
| 371 | Ga0157379_10001176 | 3300014968 | Bacteria | 21315 |
| 372 | Ga0157379_10052546 | 3300014968 | Bacteria | 3640 |
| 373 | Ga0157379_10351075 | 3300014968 | Bacteria | 1350 |
| 374 | Ga0157376_10008506 | 3300014969 | Bacteria | 7410 |
| 375 | Ga0157376_10039234 | 3300014969 | Bacteria | 3861 |
| 376 | Ga0182007_10001432 | 3300015262 | Bacteria | 12788 |
| 377 | Ga0182007_10001777 | 3300015262 | Bacteria | 11266 |
| 378 | Ga0182005_1000666 | 3300015265 | Bacteria | 16243 |
| 379 | Ga0183361_10009 | 3300016635 | Bacteria | 205218 |
| 380 | Ga0163161_10024951 | 3300017792 | Bacteria | 4226 |
| 381 | Ga0163161_10097325 | 3300017792 | Bacteria | 2186 |
| 382 | Ga0163161_10163705 | 3300017792 | Bacteria | 1697 |
| 383 | Ga0163161_10230061 | 3300017792 | Bacteria | 1438 |
| 384 | Ga0213872_10000003 | 3300021361 | Bacteria | 366948 |
| 385 | Ga0213872_10000042 | 3300021361 | Bacteria | 118474 |
| 386 | Ga0213872_10000197 | 3300021361 | Bacteria | 53584 |
| 387 | Ga0213872_10000641 | 3300021361 | Bacteria | 26449 |
| 388 | Ga0213872_10002773 | 3300021361 | Bacteria | 10030 |
| 389 | Ga0213872_10024475 | 3300021361 | Bacteria | 2777 |
| 390 | Ga0213872_10095944 | 3300021361 | Bacteria | 1324 |
| 391 | Ga0209435_100090 | 3300025206 | Bacteria | 42168 |
| 392 | Ga0209435_100200 | 3300025206 | Bacteria | 17454 |
| 393 | Ga0209436_100005 | 3300025208 | Bacteria | 151087 |
| 394 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 395 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 396 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 397 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 398 | Ga0209566_100601 | 3300025225 | Bacteria | 22542 |
| 399 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 400 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 401 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 402 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 403 | Ga0209674_100066 | 3300025226 | Bacteria | 256739 |
| 404 | Ga0209674_100110 | 3300025226 | Bacteria | 149245 |
| 405 | Ga0209674_106234 | 3300025226 | Bacteria | 1654 |
| 406 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 407 | Ga0209672_100051 | 3300025228 | Bacteria | 234414 |
| 408 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 409 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 410 | Ga0209147_100120 | 3300025229 | Bacteria | 142306 |
| 411 | Ga0209147_100365 | 3300025229 | Bacteria | 32099 |
| 412 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 413 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 414 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 415 | Ga0209563_100107 | 3300025230 | Bacteria | 143807 |
| 416 | Ga0209563_100126 | 3300025230 | Bacteria | 113122 |
| 417 | Ga0207427_100197 | 3300025231 | Bacteria | 57629 |
| 418 | Ga0207427_102210 | 3300025231 | Bacteria | 5509 |
| 419 | Ga0207427_104178 | 3300025231 | Bacteria | 2563 |
| 420 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 421 | Ga0209437_100080 | 3300025233 | Bacteria | 275402 |
| 422 | Ga0209437_106554 | 3300025233 | Bacteria | 1934 |
| 423 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 424 | Ga0209258_100179 | 3300025242 | Bacteria | 137687 |
| 425 | Ga0209258_100262 | 3300025242 | Bacteria | 90619 |
| 426 | Ga0209258_100280 | 3300025242 | Bacteria | 85790 |
| 427 | Ga0209258_100850 | 3300025242 | Bacteria | 16453 |
| 428 | Ga0209258_102660 | 3300025242 | Bacteria | 4414 |
| 429 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 430 | Ga0209646_1000072 | 3300025246 | Bacteria | 224823 |
| 431 | Ga0209646_1000294 | 3300025246 | Bacteria | 42168 |
| 432 | Ga0209646_1000296 | 3300025246 | Bacteria | 41627 |
| 433 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 434 | Ga0209026_1000150 | 3300025250 | Bacteria | 111025 |
| 435 | Ga0209026_1005310 | 3300025250 | Bacteria | 3500 |
| 436 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 437 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 438 | Ga0209677_100052 | 3300025253 | Bacteria | 167826 |
| 439 | Ga0209677_100099 | 3300025253 | Bacteria | 92370 |
| 440 | Ga0209677_100229 | 3300025253 | Bacteria | 39781 |
| 441 | Ga0209677_101485 | 3300025253 | Bacteria | 10081 |
| 442 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 443 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 444 | Ga0209148_1018870 | 3300025254 | Bacteria | 1152 |
| 445 | Ga0209759_1000033 | 3300025256 | Bacteria | 276117 |
| 446 | Ga0209759_1000069 | 3300025256 | Bacteria | 182437 |
| 447 | Ga0209759_1000116 | 3300025256 | Bacteria | 141810 |
| 448 | Ga0209759_1000294 | 3300025256 | Bacteria | 69209 |
| 449 | Ga0209759_1000516 | 3300025256 | Bacteria | 41847 |
| 450 | Ga0209759_1000520 | 3300025256 | Bacteria | 41628 |
| 451 | Ga0209759_1001511 | 3300025256 | Bacteria | 12818 |
| 452 | Ga0209759_1007805 | 3300025256 | Bacteria | 3396 |
| 453 | Ga0209759_1018384 | 3300025256 | Bacteria | 1689 |
| 454 | Ga0209759_1022355 | 3300025256 | Bacteria | 1415 |
| 455 | Ga0209233_1000016 | 3300025261 | Bacteria | 907830 |
| 456 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 457 | Ga0209565_1000015 | 3300025263 | Bacteria | 494091 |
| 458 | Ga0209565_1001112 | 3300025263 | Bacteria | 13136 |
| 459 | Ga0209565_1002528 | 3300025263 | Bacteria | 6505 |
| 460 | Ga0209565_1010164 | 3300025263 | Bacteria | 2345 |
| 461 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 462 | Ga0209455_1000044 | 3300025272 | Bacteria | 410787 |
| 463 | Ga0209455_1000191 | 3300025272 | Bacteria | 90618 |
| 464 | Ga0209455_1000203 | 3300025272 | Bacteria | 85784 |
| 465 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 466 | Ga0209673_1000070 | 3300025273 | Bacteria | 241592 |
| 467 | Ga0209673_1004714 | 3300025273 | Bacteria | 7183 |
| 468 | Ga0209673_1009022 | 3300025273 | Bacteria | 4374 |
| 469 | Ga0209130_1000055 | 3300025284 | Bacteria | 211696 |
| 470 | Ga0209130_1009756 | 3300025284 | Bacteria | 2705 |
| 471 | Ga0209130_1030316 | 3300025284 | Bacteria | 1119 |
| 472 | Ga0209675_1000012 | 3300025291 | Bacteria | 494061 |
| 473 | Ga0209675_1000212 | 3300025291 | Bacteria | 61040 |
| 474 | Ga0209675_1003345 | 3300025291 | Bacteria | 7690 |
| 475 | Ga0209675_1006703 | 3300025291 | Bacteria | 4565 |
| 476 | Ga0209675_1008288 | 3300025291 | Bacteria | 3842 |
| 477 | Ga0209676_1000066 | 3300025292 | Bacteria | 317897 |
| 478 | Ga0209025_1000384 | 3300025294 | Bacteria | 91722 |
| 479 | Ga0209025_1001071 | 3300025294 | Bacteria | 39701 |
| 480 | Ga0209025_1002826 | 3300025294 | Bacteria | 17463 |
| 481 | Ga0209025_1004282 | 3300025294 | Bacteria | 12519 |
| 482 | Ga0209025_1070686 | 3300025294 | Bacteria | 1241 |
| 483 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 484 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 485 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 486 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 487 | Ga0209564_1000107 | 3300025295 | Bacteria | 214040 |
| 488 | Ga0209564_1000124 | 3300025295 | Bacteria | 202046 |
| 489 | Ga0209564_1001211 | 3300025295 | Bacteria | 29397 |
| 490 | Ga0209564_1001981 | 3300025295 | Bacteria | 17955 |
| 491 | Ga0209564_1007499 | 3300025295 | Bacteria | 5625 |
| 492 | Ga0209564_1011129 | 3300025295 | Bacteria | 4064 |
| 493 | Ga0209564_1012325 | 3300025295 | Bacteria | 3739 |
| 494 | Ga0209050_1000145 | 3300025298 | Bacteria | 168151 |
| 495 | Ga0209050_1000304 | 3300025298 | Bacteria | 100918 |
| 496 | Ga0209050_1001774 | 3300025298 | Bacteria | 21266 |
| 497 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 498 | Ga0209256_1000076 | 3300025299 | Bacteria | 234735 |
| 499 | Ga0209256_1000183 | 3300025299 | Bacteria | 122266 |
| 500 | Ga0209256_1000482 | 3300025299 | Bacteria | 59266 |
| 501 | Ga0209256_1000659 | 3300025299 | Bacteria | 46883 |
| 502 | Ga0209256_1001268 | 3300025299 | Bacteria | 27564 |
| 503 | Ga0209256_1004161 | 3300025299 | Bacteria | 9340 |
| 504 | Ga0209256_1005488 | 3300025299 | Bacteria | 7271 |
| 505 | Ga0207426_1000326 | 3300025302 | Bacteria | 91021 |
| 506 | Ga0207426_1019591 | 3300025302 | Bacteria | 2362 |
| 507 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 508 | Ga0209051_1007055 | 3300025303 | Bacteria | 6215 |
| 509 | Ga0209051_1010277 | 3300025303 | Bacteria | 4748 |
| 510 | Ga0209051_1014646 | 3300025303 | Bacteria | 3647 |
| 511 | Ga0209051_1020441 | 3300025303 | Bacteria | 2850 |
| 512 | Ga0209257_1000084 | 3300025304 | Bacteria | 291502 |
| 513 | Ga0209257_1000450 | 3300025304 | Bacteria | 77403 |
| 514 | Ga0209257_1016886 | 3300025304 | Bacteria | 2916 |
| 515 | Ga0207697_10007133 | 3300025315 | Bacteria | 5002 |
| 516 | Ga0207656_10005509 | 3300025321 | Bacteria | 4479 |
| 517 | Ga0207656_10068785 | 3300025321 | Bacteria | 1570 |
| 518 | Ga0207696_1007745 | 3300025711 | Bacteria | 4172 |
| 519 | Ga0207655_1011552 | 3300025728 | Bacteria | 5246 |
| 520 | Ga0207655_1018621 | 3300025728 | Bacteria | 3671 |
| 521 | Ga0207713_1000372 | 3300025735 | Bacteria | 48799 |
| 522 | Ga0207682_10000340 | 3300025893 | Bacteria | 21300 |
| 523 | Ga0207682_10003157 | 3300025893 | Bacteria | 7219 |
| 524 | Ga0207642_10095627 | 3300025899 | Bacteria | 1479 |
| 525 | Ga0207688_10014892 | 3300025901 | Bacteria | 4220 |
| 526 | Ga0207680_10014240 | 3300025903 | Bacteria | 4109 |
| 527 | Ga0207647_10001108 | 3300025904 | Bacteria | 20725 |
| 528 | Ga0207647_10027614 | 3300025904 | Bacteria | 3698 |
| 529 | Ga0207647_10056661 | 3300025904 | Bacteria | 2404 |
| 530 | Ga0207699_10059428 | 3300025906 | Bacteria | 2291 |
| 531 | Ga0207645_10010068 | 3300025907 | Bacteria | 6510 |
| 532 | Ga0207643_10033124 | 3300025908 | Bacteria | 2891 |
| 533 | Ga0207705_10016982 | 3300025909 | Bacteria | 5213 |
| 534 | Ga0207684_10420729 | 3300025910 | Bacteria | 1148 |
| 535 | Ga0207707_10018084 | 3300025912 | Bacteria | 6142 |
| 536 | Ga0207707_10093997 | 3300025912 | Bacteria | 2619 |
| 537 | Ga0207695_10000475 | 3300025913 | Bacteria | 86957 |
| 538 | Ga0207695_10001437 | 3300025913 | Bacteria | 40017 |
| 539 | Ga0207695_10020920 | 3300025913 | Bacteria | 7477 |
| 540 | Ga0207695_10022917 | 3300025913 | Bacteria | 7073 |
| 541 | Ga0207695_10040295 | 3300025913 | Bacteria | 5011 |
| 542 | Ga0207695_10146794 | 3300025913 | Bacteria | 2302 |
| 543 | Ga0207695_10424850 | 3300025913 | Bacteria | 1213 |
| 544 | Ga0207671_10020117 | 3300025914 | Bacteria | 5089 |
| 545 | Ga0207671_10049115 | 3300025914 | Bacteria | 3123 |
| 546 | Ga0207662_10042078 | 3300025918 | Bacteria | 2692 |
| 547 | Ga0207662_10210223 | 3300025918 | Bacteria | 1263 |
| 548 | Ga0207657_10000018 | 3300025919 | Bacteria | 172140 |
| 549 | Ga0207657_10003155 | 3300025919 | Bacteria | 17626 |
| 550 | Ga0207657_10053105 | 3300025919 | Bacteria | 3513 |
| 551 | Ga0207657_10099258 | 3300025919 | Bacteria | 2419 |
| 552 | Ga0207657_10174529 | 3300025919 | Bacteria | 1740 |
| 553 | Ga0207657_10209485 | 3300025919 | Bacteria | 1565 |
| 554 | Ga0207649_10021775 | 3300025920 | Bacteria | 3697 |
| 555 | Ga0207652_10240084 | 3300025921 | Bacteria | 1633 |
| 556 | Ga0207646_10140214 | 3300025922 | Bacteria | 2177 |
| 557 | Ga0207681_10007645 | 3300025923 | Bacteria | 6624 |
| 558 | Ga0207681_10092494 | 3300025923 | Bacteria | 2162 |
| 559 | Ga0207681_10115405 | 3300025923 | Bacteria | 1960 |
| 560 | Ga0207681_10192057 | 3300025923 | Bacteria | 1563 |
| 561 | Ga0207694_10009631 | 3300025924 | Bacteria | 7284 |
| 562 | Ga0207694_10010860 | 3300025924 | Bacteria | 6875 |
| 563 | Ga0207694_10136429 | 3300025924 | Bacteria | 1971 |
| 564 | Ga0207694_10152233 | 3300025924 | Bacteria | 1864 |
| 565 | Ga0207650_10001837 | 3300025925 | Bacteria | 14987 |
| 566 | Ga0207650_10003488 | 3300025925 | Bacteria | 10806 |
| 567 | Ga0207650_10003973 | 3300025925 | Bacteria | 10123 |
| 568 | Ga0207650_10004126 | 3300025925 | Bacteria | 9924 |
| 569 | Ga0207650_10014460 | 3300025925 | Bacteria | 5486 |
| 570 | Ga0207650_10015106 | 3300025925 | Bacteria | 5372 |
| 571 | Ga0207650_10112412 | 3300025925 | Bacteria | 2110 |
| 572 | Ga0207650_10119376 | 3300025925 | Bacteria | 2051 |
| 573 | Ga0207659_10001657 | 3300025926 | Bacteria | 13216 |
| 574 | Ga0207659_10010218 | 3300025926 | Bacteria | 5887 |
| 575 | Ga0207659_10030562 | 3300025926 | Bacteria | 3682 |
| 576 | Ga0207659_10038636 | 3300025926 | Bacteria | 3322 |
| 577 | Ga0207659_10251127 | 3300025926 | Bacteria | 1435 |
| 578 | Ga0207664_10214521 | 3300025929 | Bacteria | 1667 |
| 579 | Ga0207644_10247746 | 3300025931 | Bacteria | 1420 |
| 580 | Ga0207644_10266804 | 3300025931 | Bacteria | 1370 |
| 581 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 582 | Ga0207690_10011102 | 3300025932 | Bacteria | 5373 |
| 583 | Ga0207690_10204772 | 3300025932 | Bacteria | 1501 |
| 584 | Ga0207706_10024839 | 3300025933 | Bacteria | 5371 |
| 585 | Ga0207706_10035752 | 3300025933 | Bacteria | 4414 |
| 586 | Ga0207706_10044198 | 3300025933 | Bacteria | 3949 |
| 587 | Ga0207686_10009173 | 3300025934 | Bacteria | 5366 |
| 588 | Ga0207686_10025673 | 3300025934 | Bacteria | 3431 |
| 589 | Ga0207686_10030202 | 3300025934 | Bacteria | 3206 |
| 590 | Ga0207686_10246653 | 3300025934 | Bacteria | 1302 |
| 591 | Ga0207709_10000015 | 3300025935 | Bacteria | 493221 |
| 592 | Ga0207709_10103816 | 3300025935 | Bacteria | 1885 |
| 593 | Ga0207709_10140273 | 3300025935 | Bacteria | 1660 |
| 594 | Ga0207669_10003780 | 3300025937 | Bacteria | 6581 |
| 595 | Ga0207669_10031387 | 3300025937 | Bacteria | 2968 |
| 596 | Ga0207669_10071799 | 3300025937 | Bacteria | 2177 |
| 597 | Ga0207665_10058978 | 3300025939 | Bacteria | 2596 |
| 598 | Ga0207691_10000511 | 3300025940 | Bacteria | 38559 |
| 599 | Ga0207691_10000657 | 3300025940 | Bacteria | 34133 |
| 600 | Ga0207691_10012670 | 3300025940 | Bacteria | 8076 |
| 601 | Ga0207691_10122253 | 3300025940 | Bacteria | 2306 |
| 602 | Ga0207691_10387578 | 3300025940 | Bacteria | 1192 |
| 603 | Ga0207711_10066563 | 3300025941 | Bacteria | 3116 |
| 604 | Ga0207711_10195075 | 3300025941 | Bacteria | 1847 |
| 605 | Ga0207711_10269649 | 3300025941 | Bacteria | 1566 |
| 606 | Ga0207711_10286956 | 3300025941 | Bacteria | 1516 |
| 607 | Ga0207689_10005742 | 3300025942 | Bacteria | 11024 |
| 608 | Ga0207689_10029190 | 3300025942 | Bacteria | 4609 |
| 609 | Ga0207661_10011699 | 3300025944 | Bacteria | 6369 |
| 610 | Ga0207661_10061378 | 3300025944 | Bacteria | 3037 |
| 611 | Ga0207679_10008750 | 3300025945 | Bacteria | 6458 |
| 612 | Ga0207679_10036127 | 3300025945 | Bacteria | 3502 |
| 613 | Ga0207679_10168884 | 3300025945 | Bacteria | 1799 |
| 614 | Ga0207667_10000025 | 3300025949 | Bacteria | 350159 |
| 615 | Ga0207667_10061603 | 3300025949 | Bacteria | 3925 |
| 616 | Ga0207667_10069899 | 3300025949 | Bacteria | 3655 |
| 617 | Ga0207667_10078887 | 3300025949 | Bacteria | 3412 |
| 618 | Ga0207667_10108582 | 3300025949 | Bacteria | 2862 |
| 619 | Ga0207667_10178935 | 3300025949 | Bacteria | 2178 |
| 620 | Ga0207667_10184930 | 3300025949 | Bacteria | 2139 |
| 621 | Ga0207667_10205750 | 3300025949 | Bacteria | 2018 |
| 622 | Ga0207667_10239869 | 3300025949 | Bacteria | 1855 |
| 623 | Ga0207651_10019880 | 3300025960 | Bacteria | 4037 |
| 624 | Ga0207651_10025944 | 3300025960 | Bacteria | 3651 |
| 625 | Ga0207651_10053906 | 3300025960 | Bacteria | 2752 |
| 626 | Ga0207651_10101946 | 3300025960 | Bacteria | 2132 |
| 627 | Ga0207651_10147727 | 3300025960 | Bacteria | 1825 |
| 628 | Ga0207651_10268137 | 3300025960 | Bacteria | 1405 |
| 629 | Ga0207668_10010948 | 3300025972 | Bacteria | 5498 |
| 630 | Ga0207668_10144250 | 3300025972 | Bacteria | 1835 |
| 631 | Ga0207640_10079052 | 3300025981 | Bacteria | 2241 |
| 632 | Ga0207658_10037156 | 3300025986 | Bacteria | 3496 |
| 633 | Ga0207658_10166683 | 3300025986 | Bacteria | 1810 |
| 634 | Ga0207677_10008977 | 3300026023 | Bacteria | 5607 |
| 635 | Ga0207677_10021231 | 3300026023 | Bacteria | 3963 |
| 636 | Ga0207677_10027378 | 3300026023 | Bacteria | 3589 |
| 637 | Ga0207703_10039632 | 3300026035 | Bacteria | 3765 |
| 638 | Ga0207703_10087754 | 3300026035 | Bacteria | 2609 |
| 639 | Ga0207639_10333347 | 3300026041 | Bacteria | 1351 |
| 640 | Ga0207639_10448162 | 3300026041 | Bacteria | 1171 |
| 641 | Ga0207678_10001481 | 3300026067 | Bacteria | 21537 |
| 642 | Ga0207678_10006930 | 3300026067 | Bacteria | 10059 |
| 643 | Ga0207678_10146251 | 3300026067 | Bacteria | 2017 |
| 644 | Ga0207678_10146390 | 3300026067 | Bacteria | 2016 |
| 645 | Ga0207708_10021936 | 3300026075 | Bacteria | 4820 |
| 646 | Ga0207708_10270499 | 3300026075 | Bacteria | 1374 |
| 647 | Ga0207702_10001447 | 3300026078 | Bacteria | 23592 |
| 648 | Ga0207702_10167492 | 3300026078 | Bacteria | 2011 |
| 649 | Ga0207702_10189982 | 3300026078 | Bacteria | 1897 |
| 650 | Ga0207641_10003449 | 3300026088 | Bacteria | 14004 |
| 651 | Ga0207641_10008903 | 3300026088 | Bacteria | 8291 |
| 652 | Ga0207648_10004759 | 3300026089 | Bacteria | 13865 |
| 653 | Ga0207648_10009000 | 3300026089 | Bacteria | 9603 |
| 654 | Ga0207648_10012937 | 3300026089 | Bacteria | 7793 |
| 655 | Ga0207648_10027131 | 3300026089 | Bacteria | 5086 |
| 656 | Ga0207648_10032660 | 3300026089 | Bacteria | 4593 |
| 657 | Ga0207648_10066013 | 3300026089 | Bacteria | 3155 |
| 658 | Ga0207648_10202806 | 3300026089 | Bacteria | 1759 |
| 659 | Ga0207676_10004842 | 3300026095 | Bacteria | 9543 |
| 660 | Ga0207676_10008136 | 3300026095 | Bacteria | 7455 |
| 661 | Ga0207676_10016812 | 3300026095 | Bacteria | 5297 |
| 662 | Ga0207676_10023784 | 3300026095 | Bacteria | 4526 |
| 663 | Ga0207676_10101649 | 3300026095 | Bacteria | 2384 |
| 664 | Ga0207676_10192068 | 3300026095 | Bacteria | 1797 |
| 665 | Ga0207676_10235421 | 3300026095 | Bacteria | 1639 |
| 666 | Ga0207674_10009285 | 3300026116 | Bacteria | 11268 |
| 667 | Ga0207674_10014937 | 3300026116 | Bacteria | 8556 |
| 668 | Ga0207674_10038859 | 3300026116 | Bacteria | 4937 |
| 669 | Ga0207675_100003033 | 3300026118 | Bacteria | 16464 |
| 670 | Ga0207675_100016941 | 3300026118 | Bacteria | 6810 |
| 671 | Ga0207675_100024354 | 3300026118 | Bacteria | 5629 |
| 672 | Ga0207675_100111015 | 3300026118 | Bacteria | 2587 |
| 673 | Ga0207675_100212678 | 3300026118 | Bacteria | 1861 |
| 674 | Ga0207683_10001153 | 3300026121 | Bacteria | 24057 |
| 675 | Ga0207683_10004610 | 3300026121 | Bacteria | 11879 |
| 676 | Ga0207683_10008024 | 3300026121 | Bacteria | 9029 |
| 677 | Ga0207683_10026480 | 3300026121 | Bacteria | 5003 |
| 678 | Ga0207698_10018026 | 3300026142 | Bacteria | 4802 |
| 679 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 680 | Ga0209281_1003905 | 3300027111 | Bacteria | 4663 |
| 681 | Ga0209371_1000181 | 3300027312 | Bacteria | 93199 |
| 682 | Ga0209371_1006167 | 3300027312 | Bacteria | 4525 |
| 683 | Ga0209371_1014768 | 3300027312 | Bacteria | 2125 |
| 684 | Ga0209969_1002277 | 3300027360 | Bacteria | 2647 |
| 685 | Ga0209967_1002470 | 3300027364 | Bacteria | 2395 |
| 686 | Ga0209996_1000164 | 3300027395 | Bacteria | 8493 |
| 687 | Ga0210000_1003217 | 3300027462 | Bacteria | 2345 |
| 688 | Ga0209995_1001528 | 3300027471 | Bacteria | 3579 |
| 689 | Ga0209995_1003905 | 3300027471 | Bacteria | 2379 |
| 690 | Ga0209968_1000368 | 3300027526 | Bacteria | 7397 |
| 691 | Ga0209999_1011391 | 3300027543 | Bacteria | 1609 |
| 692 | Ga0209282_1000051 | 3300027666 | Bacteria | 107809 |
| 693 | Ga0209971_1002442 | 3300027682 | Bacteria | 4469 |
| 694 | Ga0209971_1008899 | 3300027682 | Bacteria | 2382 |
| 695 | Ga0209966_1000074 | 3300027695 | Bacteria | 43833 |
| 696 | Ga0209998_10004405 | 3300027717 | Bacteria | 2993 |
| 697 | Ga0209813_10018373 | 3300027866 | Bacteria | 1931 |
| 698 | Ga0209974_10025808 | 3300027876 | Bacteria | 1945 |
| 699 | Ga0268266_10076660 | 3300028379 | Bacteria | 2906 |
| 700 | Ga0268265_10019427 | 3300028380 | Bacteria | 4723 |
| 701 | Ga0268265_10028420 | 3300028380 | Bacteria | 4003 |
| 702 | Ga0268265_10029869 | 3300028380 | Bacteria | 3920 |
| 703 | Ga0268264_10001934 | 3300028381 | Bacteria | 18658 |
| 704 | Ga0268264_10118668 | 3300028381 | Bacteria | 2328 |
| 705 | Ga0268264_10251300 | 3300028381 | Bacteria | 1643 |
| 706 | Ga0265336_10000123 | 3300028666 | Bacteria | 57956 |
| 707 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 708 | Ga0265338_10105861 | 3300028800 | Bacteria | 2279 |
| 709 | Ga0265338_10315664 | 3300028800 | Bacteria | 1133 |
| 710 | Ga0265324_10000361 | 3300029957 | Bacteria | 32911 |
| 711 | Ga0268256_1000151 | 3300030500 | Bacteria | 93199 |
| 712 | Ga0268256_1006158 | 3300030500 | Bacteria | 4519 |
| 713 | Ga0268256_1014814 | 3300030500 | Bacteria | 2297 |
| 714 | Ga0316180_1046710 | 3300030736 | Bacteria | 1760 |
| 715 | Ga0265330_10000133 | 3300031235 | Bacteria | 59545 |
| 716 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 717 | Ga0265332_10000010 | 3300031238 | Bacteria | 289041 |
| 718 | Ga0265332_10001971 | 3300031238 | Bacteria | 10804 |
| 719 | Ga0265328_10016557 | 3300031239 | Bacteria | 2866 |
| 720 | Ga0265329_10033973 | 3300031242 | Bacteria | 1648 |
| 721 | Ga0265340_10002720 | 3300031247 | Bacteria | 10068 |
| 722 | Ga0265331_10000996 | 3300031250 | Bacteria | 22244 |
| 723 | Ga0265316_10008143 | 3300031344 | Bacteria | 9757 |
| 724 | Ga0307513_10097991 | 3300031456 | Bacteria | 2965 |
| 725 | Ga0307513_10298998 | 3300031456 | Bacteria | 1377 |
| 726 | Ga0307509_10012999 | 3300031507 | Bacteria | 9886 |
| 727 | Ga0307408_100000022 | 3300031548 | Bacteria | 310242 |
| 728 | Ga0307408_100000439 | 3300031548 | Bacteria | 36782 |
| 729 | Ga0307408_100001348 | 3300031548 | Bacteria | 18399 |
| 730 | Ga0307408_100014832 | 3300031548 | Bacteria | 5182 |
| 731 | Ga0307408_100031547 | 3300031548 | Bacteria | 3690 |
| 732 | Ga0307408_100268935 | 3300031548 | Bacteria | 1414 |
| 733 | Ga0307408_100372284 | 3300031548 | Bacteria | 1218 |
| 734 | Ga0316575_10000023 | 3300031665 | Bacteria | 38722 |
| 735 | Ga0316575_10000505 | 3300031665 | Bacteria | 11281 |
| 736 | Ga0265314_10000013 | 3300031711 | Bacteria | 403405 |
| 737 | Ga0265314_10001503 | 3300031711 | Bacteria | 25802 |
| 738 | Ga0265342_10039179 | 3300031712 | Bacteria | 2881 |
| 739 | Ga0316576_10053328 | 3300031727 | Bacteria | 2946 |
| 740 | Ga0316578_10002083 | 3300031728 | Bacteria | 8564 |
| 741 | Ga0307516_10162892 | 3300031730 | Bacteria | 1979 |
| 742 | Ga0307405_10001449 | 3300031731 | Bacteria | 9994 |
| 743 | Ga0307405_10011206 | 3300031731 | Bacteria | 4684 |
| 744 | Ga0307405_10133923 | 3300031731 | Bacteria | 1717 |
| 745 | Ga0307405_10161291 | 3300031731 | Bacteria | 1588 |
| 746 | Ga0307405_10427599 | 3300031731 | Bacteria | 1044 |
| 747 | Ga0316577_10149807 | 3300031733 | Bacteria | 1315 |
| 748 | Ga0307413_10010124 | 3300031824 | Bacteria | 4553 |
| 749 | Ga0307410_10003953 | 3300031852 | Bacteria | 7552 |
| 750 | Ga0307410_10008212 | 3300031852 | Bacteria | 5776 |
| 751 | Ga0307410_10014477 | 3300031852 | Bacteria | 4642 |
| 752 | Ga0307406_10006988 | 3300031901 | Bacteria | 6250 |
| 753 | Ga0307406_10010926 | 3300031901 | Bacteria | 5135 |
| 754 | Ga0307406_10014813 | 3300031901 | Bacteria | 4494 |
| 755 | Ga0307406_10047317 | 3300031901 | Bacteria | 2711 |
| 756 | Ga0307406_10080300 | 3300031901 | Bacteria | 2165 |
| 757 | Ga0307406_10146030 | 3300031901 | Bacteria | 1681 |
| 758 | Ga0307407_10008265 | 3300031903 | Bacteria | 4767 |
| 759 | Ga0307407_10011484 | 3300031903 | Bacteria | 4217 |
| 760 | Ga0307407_10175615 | 3300031903 | Bacteria | 1415 |
| 761 | Ga0307412_10000005 | 3300031911 | Bacteria | 526194 |
| 762 | Ga0307412_10006540 | 3300031911 | Bacteria | 6596 |
| 763 | Ga0307412_10013719 | 3300031911 | Bacteria | 4760 |
| 764 | Ga0307412_10045390 | 3300031911 | Bacteria | 2872 |
| 765 | Ga0307412_10096155 | 3300031911 | Bacteria | 2084 |
| 766 | Ga0307409_100001860 | 3300031995 | Bacteria | 10740 |
| 767 | Ga0307409_100006670 | 3300031995 | Bacteria | 6819 |
| 768 | Ga0307409_100133032 | 3300031995 | Bacteria | 2129 |
| 769 | Ga0307409_100158677 | 3300031995 | Bacteria | 1975 |
| 770 | Ga0307409_100248226 | 3300031995 | Bacteria | 1625 |
| 771 | Ga0307416_100001396 | 3300032002 | Bacteria | 13086 |
| 772 | Ga0307416_100018054 | 3300032002 | Bacteria | 4957 |
| 773 | Ga0307416_100122363 | 3300032002 | Bacteria | 2322 |
| 774 | Ga0307416_100189464 | 3300032002 | Bacteria | 1938 |
| 775 | Ga0307414_10007639 | 3300032004 | Bacteria | 6086 |
| 776 | Ga0307414_10033326 | 3300032004 | Bacteria | 3404 |
| 777 | Ga0307411_10015987 | 3300032005 | Bacteria | 4236 |
| 778 | Ga0307411_10145577 | 3300032005 | Bacteria | 1753 |
| 779 | Ga0307411_10415699 | 3300032005 | Bacteria | 1116 |
| 780 | Ga0307415_100007017 | 3300032126 | Bacteria | 6126 |
| 781 | Ga0307415_100031788 | 3300032126 | Bacteria | 3405 |
| 782 | Ga0307510_10007396 | 3300033180 | Bacteria | 13098 |
| 783 | Ga0373934_0021275 | 3300035086 | Bacteria | 2497 |
| 784 | Ga0373952_0002596 | 3300035092 | Bacteria | 3255 |
| 785 | Ga0373952_0005475 | 3300035092 | Bacteria | 2322 |
| 786 | Ga0373939_0021383 | 3300035114 | Bacteria | 1770 |
| 787 | Ga0373954_0000001 | 3300035118 | Bacteria | 158201 |
| 788 | Ga0373956_0025311 | 3300035119 | Bacteria | 2564 |
| 789 | Ga0373955_0110442 | 3300035172 | Bacteria | 1589 |
| 790 | Ga0316574_0002756 | 3300035398 | Bacteria | 8916 |
| 791 | Ga0316574_0037245 | 3300035398 | Bacteria | 2982 |
| 792 | Ga0373924_0011995 | 3300035410 | Bacteria | 3229 |
| 793 | Ga0373931_0010108 | 3300035691 | Bacteria | 4526 |
| 794 | Ga0373931_0062980 | 3300035691 | Bacteria | 2003 |
| 795 | Ga0373927_0040217 | 3300035695 | Bacteria | 3034 |
| 796 | Ga0373927_0229112 | 3300035695 | Bacteria | 1221 |
| 797 | Ga0373933_0009723 | 3300035724 | Bacteria | 5262 |
| 798 | Ga0373933_0053917 | 3300035724 | Bacteria | 2408 |
| 799 | Ga0373937_0002345 | 3300036401 | Bacteria | 15783 |
| 800 | Ga0373937_0082773 | 3300036401 | Bacteria | 2969 |
| 801 | Ga0373937_0157684 | 3300036401 | Bacteria | 2128 |
| 802 | Ga0316582_0015925 | 3300036647 | Bacteria | 4312 |
| 803 | Ga0316584_0015597 | 3300036712 | Bacteria | 5435 |
| 804 | Ga0373925_0194648 | 3300037068 | Bacteria | 1610 |
| 805 | Ga0373925_0226615 | 3300037068 | Bacteria | 1493 |
| 806 | Ga0395899_0014587 | 3300037312 | Bacteria | 5998 |
| 807 | Ga0395899_0027329 | 3300037312 | Bacteria | 4302 |
| 808 | Ga0395899_0029304 | 3300037312 | Bacteria | 4140 |
| 809 | Ga0395899_0078383 | 3300037312 | Bacteria | 2408 |
| 810 | Ga0395899_0123930 | 3300037312 | Bacteria | 1849 |
| 811 | Ga0395900_0000229 | 3300037418 | Bacteria | 88118 |
| 812 | Ga0395900_0005063 | 3300037418 | Bacteria | 13830 |
| 813 | Ga0395900_0005889 | 3300037418 | Bacteria | 12802 |
| 814 | Ga0395900_0069915 | 3300037418 | Bacteria | 3609 |
| 815 | Ga0395900_0076106 | 3300037418 | Bacteria | 3450 |
| 816 | Ga0395900_0147005 | 3300037418 | Bacteria | 2409 |
| 817 | Ga0395898_0055156 | 3300037466 | Bacteria | 3876 |
| 818 | Ga0395898_0101462 | 3300037466 | Bacteria | 2763 |
| 819 | Ga0395898_0103642 | 3300037466 | Bacteria | 2729 |
| 820 | Ga0395898_0140493 | 3300037466 | Bacteria | 2312 |
| 821 | Ga0395898_0244466 | 3300037466 | Bacteria | 1711 |
| 822 | Ga0395898_0254175 | 3300037466 | Bacteria | 1676 |
| 823 | Ga0395905_0000059 | 3300037471 | Bacteria | 198101 |
| 824 | Ga0395905_0001515 | 3300037471 | Bacteria | 27796 |
| 825 | Ga0395905_0002380 | 3300037471 | Bacteria | 20938 |
| 826 | Ga0395905_0004975 | 3300037471 | Bacteria | 13689 |
| 827 | Ga0395905_0026529 | 3300037471 | Bacteria | 5462 |
| 828 | Ga0395905_0027140 | 3300037471 | Bacteria | 5400 |
| 829 | Ga0395905_0045716 | 3300037471 | Bacteria | 4106 |
| 830 | Ga0395905_0060945 | 3300037471 | Bacteria | 3528 |
| 831 | Ga0316581_0000886 | 3300037588 | Bacteria | 6331 |
| 832 | Ga0395901_0003564 | 3300038443 | Bacteria | 15698 |
| 833 | Ga0395901_0013050 | 3300038443 | Bacteria | 8433 |
| 834 | Ga0395901_0018224 | 3300038443 | Bacteria | 7168 |
| 835 | Ga0395901_0042434 | 3300038443 | Bacteria | 4716 |
| 836 | Ga0395901_0209008 | 3300038443 | Bacteria | 2043 |
| 837 | Ga0436360_0690189 | 3300039438 | Bacteria | 2890 |
| 838 | Ga0436361_0039956 | 3300039447 | Bacteria | 11953 |
| 839 | Ga0436361_0577632 | 3300039447 | Bacteria | 2709 |
| 840 | Ga0436361_0590531 | 3300039447 | Bacteria | 50583 |
| 841 | Ga0436361_0616441 | 3300039447 | Bacteria | 29495 |
| 842 | Ga0436361_0878220 | 3300039447 | Bacteria | 10265 |
| 843 | Ga0436361_0926482 | 3300039447 | Bacteria | 8198 |
| 844 | Ga0436361_1094903 | 3300039447 | Bacteria | 1252 |
| 845 | Ga0436361_1150385 | 3300039447 | Bacteria | 105721 |
| 846 | Ga0439436_0021132 | 3300041404 | Bacteria | 1936 |
| 847 | Ga0451797_0462561 | 3300041453 | Bacteria | 1565 |
| 848 | Ga0451807_0693819 | 3300041486 | Bacteria | 2357 |
| 849 | Ga0451853_1690372 | 3300041512 | Bacteria | 2346 |
| 850 | Ga0439443_005113 | 3300042003 | Bacteria | 1742 |
| 851 | Ga0439462_0001510 | 3300042015 | Bacteria | 5204 |
| 852 | Ga0450920_000782 | 3300042122 | Bacteria | 5132 |
| 853 | Ga0450923_004002 | 3300042125 | Bacteria | 2280 |
| 854 | Ga0450923_004577 | 3300042125 | Bacteria | 2176 |
| 855 | Ga0450898_012896 | 3300042134 | Bacteria | 1387 |
| 856 | Ga0439446_0059545 | 3300042156 | Bacteria | 1152 |
| 857 | Ga0450908_000192 | 3300042184 | Bacteria | 12530 |
| 858 | Ga0439434_0010251 | 3300042435 | Bacteria | 2762 |
| 859 | Ga0439434_0059421 | 3300042435 | Bacteria | 1194 |
| 860 | Ga0439435_0000279 | 3300042436 | Bacteria | 7539 |
| 861 | Ga0439444_0003396 | 3300042437 | Bacteria | 2249 |
| 862 | Ga0439459_0001318 | 3300042438 | Bacteria | 3618 |
| 863 | Ga0439460_0020137 | 3300042461 | Bacteria | 1812 |
| 864 | Ga0439460_0054942 | 3300042461 | Bacteria | 1202 |
| 865 | Ga0450918_004421 | 3300042531 | Bacteria | 2559 |
| 866 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 867 | Ga0451577_0000152 | 3300042876 | Bacteria | 153284 |
| 868 | Ga0451577_0009047 | 3300042876 | Bacteria | 9614 |
| 869 | Ga0451577_0018493 | 3300042876 | Bacteria | 6419 |
| 870 | Ga0451577_0041881 | 3300042876 | Bacteria | 4109 |
| 871 | Ga0451577_0076722 | 3300042876 | Bacteria | 2979 |
| 872 | Ga0466969_0000147 | 3300044656 | Bacteria | 38236 |
| 873 | Ga0466969_0003356 | 3300044656 | Bacteria | 8525 |
| 874 | Ga0466969_0018747 | 3300044656 | Bacteria | 3602 |
| 875 | Ga0466972_0000181 | 3300044658 | Bacteria | 48590 |
| 876 | Ga0466972_0001865 | 3300044658 | Bacteria | 10332 |
| 877 | Ga0466972_0068264 | 3300044658 | Bacteria | 1698 |
| 878 | Ga0466972_0092114 | 3300044658 | Bacteria | 1437 |
| 879 | Ga0466982_0053105 | 3300044672 | Bacteria | 2486 |
| 880 | Ga0466982_0164584 | 3300044672 | Bacteria | 1350 |
| 881 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 882 | Ga0466965_0000486 | 3300044683 | Bacteria | 14114 |
| 883 | Ga0466965_0072608 | 3300044683 | Bacteria | 1731 |
| 884 | Ga0466965_0104281 | 3300044683 | Bacteria | 1452 |
| 885 | Ga0466966_0007276 | 3300044684 | Bacteria | 7335 |
| 886 | Ga0466966_0014215 | 3300044684 | Bacteria | 5271 |
| 887 | Ga0466966_0037337 | 3300044684 | Bacteria | 3133 |
| 888 | Ga0466961_0032784 | 3300044693 | Bacteria | 3337 |
| 889 | Ga0466961_0044854 | 3300044693 | Bacteria | 2829 |
| 890 | Ga0466961_0093369 | 3300044693 | Bacteria | 1898 |
| 891 | Ga0466963_0021413 | 3300044694 | Bacteria | 4078 |
| 892 | Ga0466964_0013417 | 3300044706 | Bacteria | 3109 |
| 893 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 894 | Ga0453684_0000029 | 3300044712 | Bacteria | 757969 |
| 895 | Ga0453684_0000122 | 3300044712 | Bacteria | 340529 |
| 896 | Ga0466971_0002862 | 3300044719 | Bacteria | 7320 |
| 897 | Ga0466968_0025979 | 3300044735 | Bacteria | 2401 |
| 898 | Ga0466970_0015077 | 3300044765 | Bacteria | 3975 |
| 899 | Ga0466970_0034730 | 3300044765 | Bacteria | 2670 |
| 900 | Ga0466970_0046760 | 3300044765 | Bacteria | 2305 |
| 901 | Ga0466970_0102714 | 3300044765 | Bacteria | 1557 |
| 902 | Ga0466957_0014789 | 3300044842 | Bacteria | 4546 |
| 903 | Ga0466957_0027037 | 3300044842 | Bacteria | 3407 |
| 904 | Ga0466960_0012884 | 3300044901 | Bacteria | 3540 |
| 905 | Ga0466959_0001734 | 3300045049 | Bacteria | 13556 |
| 906 | Ga0466959_0006971 | 3300045049 | Bacteria | 7897 |
| 907 | Ga0466959_0009426 | 3300045049 | Bacteria | 6944 |
| 908 | Ga0466959_0013918 | 3300045049 | Bacteria | 5839 |
| 909 | Ga0466959_0034741 | 3300045049 | Bacteria | 3729 |
| 910 | Ga0466959_0131437 | 3300045049 | Bacteria | 1774 |
| 911 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 912 | Ga0451576_0000937 | 3300045051 | Bacteria | 55001 |
| 913 | Ga0451576_0001995 | 3300045051 | Bacteria | 32320 |
| 914 | Ga0451576_0531785 | 3300045051 | Bacteria | 1235 |
| 915 | Ga0466958_0018038 | 3300045836 | Bacteria | 4090 |
| 916 | Ga0466958_0076484 | 3300045836 | Bacteria | 2054 |
| 917 | Ga0466958_0138858 | 3300045836 | Bacteria | 1529 |
| 918 | Ga0466967_0018215 | 3300045976 | Bacteria | 5604 |
| 919 | Ga0495617_003418 | 3300046452 | Bacteria | 5981 |
| 920 | Ga0495627_000005 | 3300046453 | Bacteria | 630805 |
| 921 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 922 | Ga0495592_0035366 | 3300046454 | Bacteria | 3764 |
| 923 | Ga0495603_0004454 | 3300046455 | Bacteria | 8355 |
| 924 | Ga0495590_0000006 | 3300046457 | Bacteria | 372949 |
| 925 | Ga0495591_009140 | 3300046458 | Bacteria | 3966 |
| 926 | Ga0495629_0004774 | 3300046459 | Bacteria | 10161 |
| 927 | Ga0495629_0008044 | 3300046459 | Bacteria | 7761 |
| 928 | Ga0495629_0048051 | 3300046459 | Bacteria | 2992 |
| 929 | Ga0495638_0000891 | 3300046460 | Bacteria | 30617 |
| 930 | Ga0495638_0075921 | 3300046460 | Bacteria | 2048 |
| 931 | Ga0495651_0118772 | 3300046462 | Bacteria | 1945 |
| 932 | Ga0495651_0139087 | 3300046462 | Bacteria | 1763 |
| 933 | Ga0495651_0146938 | 3300046462 | Bacteria | 1703 |
| 934 | Ga0495653_0005110 | 3300046463 | Bacteria | 10650 |
| 935 | Ga0495653_0048194 | 3300046463 | Bacteria | 3290 |
| 936 | Ga0495653_0053553 | 3300046463 | Bacteria | 3086 |
| 937 | Ga0495653_0093258 | 3300046463 | Bacteria | 2196 |
| 938 | Ga0495653_0130559 | 3300046463 | Bacteria | 1779 |
| 939 | Ga0495650_0000042 | 3300046471 | Bacteria | 357244 |
| 940 | Ga0495650_0001355 | 3300046471 | Bacteria | 24323 |
| 941 | Ga0495650_0001969 | 3300046471 | Bacteria | 18130 |
| 942 | Ga0495650_0018615 | 3300046471 | Bacteria | 3445 |
| 943 | Ga0495580_0001332 | 3300046472 | Bacteria | 21777 |
| 944 | Ga0495580_0001735 | 3300046472 | Bacteria | 19158 |
| 945 | Ga0495580_0002424 | 3300046472 | Bacteria | 16292 |
| 946 | Ga0495580_0006696 | 3300046472 | Bacteria | 9354 |
| 947 | Ga0495580_0009620 | 3300046472 | Bacteria | 7590 |
| 948 | Ga0495580_0044936 | 3300046472 | Bacteria | 3139 |
| 949 | Ga0495580_0092583 | 3300046472 | Bacteria | 2104 |
| 950 | Ga0495580_0099819 | 3300046472 | Bacteria | 2019 |
| 951 | Ga0495580_0130771 | 3300046472 | Bacteria | 1741 |
| 952 | Ga0495582_0002157 | 3300046473 | Bacteria | 11010 |
| 953 | Ga0495582_0039323 | 3300046473 | Bacteria | 2604 |
| 954 | Ga0495582_0094002 | 3300046473 | Bacteria | 1673 |
| 955 | Ga0495605_0004289 | 3300046474 | Bacteria | 8400 |
| 956 | Ga0495605_0008150 | 3300046474 | Bacteria | 5924 |
| 957 | Ga0495605_0013495 | 3300046474 | Bacteria | 4498 |
| 958 | Ga0495605_0025104 | 3300046474 | Bacteria | 3107 |
| 959 | Ga0495662_0021575 | 3300046476 | Bacteria | 3111 |
| 960 | Ga0495664_0001925 | 3300046477 | Bacteria | 11055 |
| 961 | Ga0495664_0002295 | 3300046477 | Bacteria | 10259 |
| 962 | Ga0495664_0087473 | 3300046477 | Bacteria | 1872 |
| 963 | Ga0495585_0009165 | 3300046492 | Bacteria | 5955 |
| 964 | Ga0495594_0043606 | 3300046499 | Bacteria | 2459 |
| 965 | Ga0495596_0001853 | 3300046500 | Bacteria | 11731 |
| 966 | Ga0495596_0005945 | 3300046500 | Bacteria | 5693 |
| 967 | Ga0495596_0031217 | 3300046500 | Bacteria | 2129 |
| 968 | Ga0495596_0032079 | 3300046500 | Bacteria | 2096 |
| 969 | Ga0495607_0004242 | 3300046501 | Bacteria | 10626 |
| 970 | Ga0495607_0016789 | 3300046501 | Bacteria | 4719 |
| 971 | Ga0495607_0048930 | 3300046501 | Bacteria | 2469 |
| 972 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 973 | Ga0495583_0000199 | 3300046506 | Bacteria | 100936 |
| 974 | Ga0495583_0001566 | 3300046506 | Bacteria | 22601 |
| 975 | Ga0495583_0007029 | 3300046506 | Bacteria | 7196 |
| 976 | Ga0495583_0013937 | 3300046506 | Bacteria | 4456 |
| 977 | Ga0495583_0030561 | 3300046506 | Bacteria | 2621 |
| 978 | Ga0495606_0001300 | 3300046507 | Bacteria | 34419 |
| 979 | Ga0495606_0013495 | 3300046507 | Bacteria | 6445 |
| 980 | Ga0495606_0017051 | 3300046507 | Bacteria | 5508 |
| 981 | Ga0495606_0023111 | 3300046507 | Bacteria | 4514 |
| 982 | Ga0495606_0038631 | 3300046507 | Bacteria | 3227 |
| 983 | Ga0495608_0004149 | 3300046511 | Bacteria | 10386 |
| 984 | Ga0495608_0014134 | 3300046511 | Bacteria | 5538 |
| 985 | Ga0495608_0018660 | 3300046511 | Bacteria | 4781 |
| 986 | Ga0495608_0047765 | 3300046511 | Bacteria | 2845 |
| 987 | Ga0495608_0146859 | 3300046511 | Bacteria | 1504 |
| 988 | Ga0495610_0000965 | 3300046512 | Bacteria | 26628 |
| 989 | Ga0495610_0015349 | 3300046512 | Bacteria | 4455 |
| 990 | Ga0495610_0026492 | 3300046512 | Bacteria | 3094 |
| 991 | Ga0495610_0076293 | 3300046512 | Bacteria | 1550 |
| 992 | Ga0495616_0000277 | 3300046513 | Bacteria | 41639 |
| 993 | Ga0495616_0000591 | 3300046513 | Bacteria | 27295 |
| 994 | Ga0495616_0020712 | 3300046513 | Bacteria | 3572 |
| 995 | Ga0495618_0009318 | 3300046514 | Bacteria | 5926 |
| 996 | Ga0495618_0010152 | 3300046514 | Bacteria | 5695 |
| 997 | Ga0495618_0030402 | 3300046514 | Bacteria | 3373 |
| 998 | Ga0495628_0000146 | 3300046516 | Bacteria | 61136 |
| 999 | Ga0495628_0003520 | 3300046516 | Bacteria | 14012 |
| 1000 | Ga0495628_0007838 | 3300046516 | Bacteria | 9208 |
| 1001 | Ga0495628_0020360 | 3300046516 | Bacteria | 5474 |
| 1002 | Ga0495628_0167092 | 3300046516 | Bacteria | 1669 |
| 1003 | Ga0495630_0035764 | 3300046517 | Bacteria | 3711 |
| 1004 | Ga0495630_0117817 | 3300046517 | Bacteria | 2013 |
| 1005 | Ga0495630_0135315 | 3300046517 | Bacteria | 1872 |
| 1006 | Ga0495630_0191297 | 3300046517 | Bacteria | 1561 |
| 1007 | Ga0495631_0020358 | 3300046518 | Bacteria | 3100 |
| 1008 | Ga0495632_0026742 | 3300046519 | Bacteria | 3032 |
| 1009 | Ga0495637_0000056 | 3300046520 | Bacteria | 98978 |
| 1010 | Ga0495637_0014948 | 3300046520 | Bacteria | 3651 |
| 1011 | Ga0495643_0000338 | 3300046522 | Bacteria | 63855 |
| 1012 | Ga0495643_0003899 | 3300046522 | Bacteria | 10710 |
| 1013 | Ga0495643_0046323 | 3300046522 | Bacteria | 2358 |
| 1014 | Ga0495648_0000061 | 3300046524 | Bacteria | 151604 |
| 1015 | Ga0495648_0006586 | 3300046524 | Bacteria | 9443 |
| 1016 | Ga0495648_0033963 | 3300046524 | Bacteria | 3326 |
| 1017 | Ga0495648_0034382 | 3300046524 | Bacteria | 3298 |
| 1018 | Ga0495648_0043479 | 3300046524 | Bacteria | 2815 |
| 1019 | Ga0495663_0005509 | 3300046525 | Bacteria | 3512 |
| 1020 | Ga0495666_0001948 | 3300046526 | Bacteria | 10170 |
| 1021 | Ga0495666_0002505 | 3300046526 | Bacteria | 9118 |
| 1022 | Ga0495666_0004887 | 3300046526 | Bacteria | 6776 |
| 1023 | Ga0495666_0009093 | 3300046526 | Bacteria | 4970 |
| 1024 | Ga0495666_0019313 | 3300046526 | Bacteria | 3383 |
| 1025 | Ga0495642_0038142 | 3300046528 | Bacteria | 1946 |
| 1026 | Ga0495652_0003179 | 3300046529 | Bacteria | 16373 |
| 1027 | Ga0495652_0005145 | 3300046529 | Bacteria | 12356 |
| 1028 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 1029 | Ga0495665_0006633 | 3300046531 | Bacteria | 6246 |
| 1030 | Ga0495665_0007109 | 3300046531 | Bacteria | 6039 |
| 1031 | Ga0495665_0021549 | 3300046531 | Bacteria | 3462 |
| 1032 | Ga0495665_0025980 | 3300046531 | Bacteria | 3144 |
| 1033 | Ga0495665_0044296 | 3300046531 | Bacteria | 2364 |
| 1034 | Ga0495665_0066826 | 3300046531 | Bacteria | 1896 |
| 1035 | Ga0495665_0088612 | 3300046531 | Bacteria | 1626 |
| 1036 | Ga0495640_0039067 | 3300046533 | Bacteria | 3333 |
| 1037 | Ga0495640_0053364 | 3300046533 | Bacteria | 2771 |
| 1038 | Ga0495586_0015604 | 3300046535 | Bacteria | 4041 |
| 1039 | Ga0495586_0024691 | 3300046535 | Bacteria | 3214 |
| 1040 | Ga0495586_0051886 | 3300046535 | Bacteria | 2220 |
| 1041 | Ga0495587_0009070 | 3300046536 | Bacteria | 6384 |
| 1042 | Ga0495587_0009851 | 3300046536 | Bacteria | 6102 |
| 1043 | Ga0495609_0000068 | 3300046538 | Bacteria | 129809 |
| 1044 | Ga0495609_0006564 | 3300046538 | Bacteria | 5925 |
| 1045 | Ga0495609_0006753 | 3300046538 | Bacteria | 5813 |
| 1046 | Ga0495609_0008300 | 3300046538 | Bacteria | 5092 |
| 1047 | Ga0495609_0014009 | 3300046538 | Bacteria | 3776 |
| 1048 | Ga0495597_0003195 | 3300046542 | Bacteria | 9766 |
| 1049 | Ga0495597_0037407 | 3300046542 | Bacteria | 2179 |
| 1050 | Ga0495597_0042258 | 3300046542 | Bacteria | 2033 |
| 1051 | Ga0495645_0002615 | 3300046543 | Bacteria | 12247 |
| 1052 | Ga0495645_0085294 | 3300046543 | Bacteria | 2261 |
| 1053 | Ga0495622_0000103 | 3300046557 | Bacteria | 74095 |
| 1054 | Ga0495622_0000302 | 3300046557 | Bacteria | 37049 |
| 1055 | Ga0495622_0015026 | 3300046557 | Bacteria | 3598 |
| 1056 | Ga0495633_0000098 | 3300046558 | Bacteria | 117269 |
| 1057 | Ga0495633_0007613 | 3300046558 | Bacteria | 6201 |
| 1058 | Ga0495668_0001564 | 3300046616 | Bacteria | 21690 |
| 1059 | Ga0495668_0056124 | 3300046616 | Bacteria | 2174 |
| 1060 | Ga0495668_0059443 | 3300046616 | Bacteria | 2109 |
| 1061 | Ga0495634_0020033 | 3300046642 | Bacteria | 4746 |
| 1062 | Ga0495634_0031484 | 3300046642 | Bacteria | 3653 |
| 1063 | Ga0495634_0046473 | 3300046642 | Bacteria | 2929 |
| 1064 | Ga0495611_0003553 | 3300046648 | Bacteria | 6851 |
| 1065 | Ga0495625_0001274 | 3300046660 | Bacteria | 31651 |
| 1066 | Ga0495625_0001560 | 3300046660 | Bacteria | 27286 |
| 1067 | Ga0495625_0004014 | 3300046660 | Bacteria | 14079 |
| 1068 | Ga0495625_0023355 | 3300046660 | Bacteria | 4724 |
| 1069 | Ga0495625_0045383 | 3300046660 | Bacteria | 3177 |
| 1070 | Ga0495635_0013156 | 3300046663 | Bacteria | 5792 |
| 1071 | Ga0495635_0033384 | 3300046663 | Bacteria | 3570 |
| 1072 | Ga0495661_0000214 | 3300046665 | Bacteria | 66777 |
| 1073 | Ga0495661_0003694 | 3300046665 | Bacteria | 11243 |
| 1074 | Ga0495661_0006774 | 3300046665 | Bacteria | 8033 |
| 1075 | Ga0495661_0027992 | 3300046665 | Bacteria | 3614 |
| 1076 | Ga0495661_0114645 | 3300046665 | Bacteria | 1497 |
| 1077 | Ga0495588_0011122 | 3300046674 | Bacteria | 4213 |
| 1078 | Ga0495657_0099532 | 3300046675 | Bacteria | 1854 |
| 1079 | Ga0495657_0172549 | 3300046675 | Bacteria | 1331 |
| 1080 | Ga0495599_0010704 | 3300046678 | Bacteria | 5617 |
| 1081 | Ga0495599_0031631 | 3300046678 | Bacteria | 3321 |
| 1082 | Ga0495599_0061717 | 3300046678 | Bacteria | 2341 |
| 1083 | Ga0495599_0150574 | 3300046678 | Bacteria | 1441 |
| 1084 | Ga0495623_0007478 | 3300046679 | Bacteria | 7092 |
| 1085 | Ga0495623_0011348 | 3300046679 | Bacteria | 5765 |
| 1086 | Ga0495623_0020400 | 3300046679 | Bacteria | 4283 |
| 1087 | Ga0495623_0050894 | 3300046679 | Bacteria | 2622 |
| 1088 | Ga0495623_0083931 | 3300046679 | Bacteria | 1966 |
| 1089 | Ga0495646_0001277 | 3300046680 | Bacteria | 14817 |
| 1090 | Ga0495646_0005738 | 3300046680 | Bacteria | 7865 |
| 1091 | Ga0495646_0040548 | 3300046680 | Bacteria | 2866 |
| 1092 | Ga0495646_0043769 | 3300046680 | Bacteria | 2739 |
| 1093 | Ga0495646_0078754 | 3300046680 | Bacteria | 1925 |
| 1094 | Ga0495669_0011616 | 3300046684 | Bacteria | 3742 |
| 1095 | Ga0495669_0018504 | 3300046684 | Bacteria | 2995 |
| 1096 | Ga0495613_0002040 | 3300046689 | Bacteria | 15344 |
| 1097 | Ga0495613_0052155 | 3300046689 | Bacteria | 3013 |
| 1098 | Ga0495613_0059926 | 3300046689 | Bacteria | 2788 |
| 1099 | Ga0495624_0014397 | 3300046690 | Bacteria | 5367 |
| 1100 | Ga0495624_0037912 | 3300046690 | Bacteria | 3099 |
| 1101 | Ga0495624_0081590 | 3300046690 | Bacteria | 2002 |
| 1102 | Ga0495624_0091403 | 3300046690 | Bacteria | 1877 |
| 1103 | Ga0495670_0032851 | 3300046691 | Bacteria | 2581 |
| 1104 | Ga0495671_0009461 | 3300046692 | Bacteria | 5442 |
| 1105 | Ga0495671_0014203 | 3300046692 | Bacteria | 4292 |
| 1106 | Ga0495649_0011940 | 3300046694 | Bacteria | 5076 |
| 1107 | Ga0495589_0000084 | 3300046794 | Bacteria | 86500 |
| 1108 | Ga0495589_0002030 | 3300046794 | Bacteria | 11459 |
| 1109 | Ga0495589_0002384 | 3300046794 | Bacteria | 10559 |
| 1110 | Ga0495600_0006104 | 3300046809 | Bacteria | 7299 |
| 1111 | Ga0495600_0008025 | 3300046809 | Bacteria | 6471 |
| 1112 | Ga0495600_0012775 | 3300046809 | Bacteria | 5260 |
| 1113 | Ga0495600_0012928 | 3300046809 | Bacteria | 5231 |
| 1114 | Ga0495660_0005264 | 3300046810 | Bacteria | 7757 |
| 1115 | Ga0495660_0067480 | 3300046810 | Bacteria | 1905 |
| 1116 | Ga0495660_0072803 | 3300046810 | Bacteria | 1819 |
| 1117 | Ga0495581_0001458 | 3300047315 | Bacteria | 13153 |
| 1118 | Ga0495581_0014511 | 3300047315 | Bacteria | 4569 |
| 1119 | Ga0495581_0018211 | 3300047315 | Bacteria | 4079 |
| 1120 | Ga0495581_0080012 | 3300047315 | Bacteria | 1891 |
| 1121 | Ga0495604_0005561 | 3300047317 | Bacteria | 9991 |
| 1122 | Ga0495604_0046411 | 3300047317 | Bacteria | 3386 |
| 1123 | Ga0495604_0155460 | 3300047317 | Bacteria | 1620 |
| 1124 | Ga0495636_0007671 | 3300047318 | Bacteria | 4243 |
| 1125 | Ga0495636_0007946 | 3300047318 | Bacteria | 4177 |
| 1126 | Ga0495636_0037307 | 3300047318 | Bacteria | 2007 |
| 1127 | Ga0495636_0059039 | 3300047318 | Bacteria | 1618 |
| 1128 | Ga0495674_0010002 | 3300047319 | Bacteria | 8987 |
| 1129 | Ga0495674_0016573 | 3300047319 | Bacteria | 6875 |
| 1130 | Ga0495674_0018299 | 3300047319 | Bacteria | 6524 |
| 1131 | Ga0495674_0085689 | 3300047319 | Bacteria | 2698 |
| 1132 | Ga0495674_0117115 | 3300047319 | Bacteria | 2254 |
| 1133 | Ga0495672_0036633 | 3300047320 | Bacteria | 3010 |
| 1134 | Ga0495672_0101083 | 3300047320 | Bacteria | 1563 |
| 1135 | Ga0495676_0020148 | 3300047321 | Bacteria | 5861 |
| 1136 | Ga0495676_0020359 | 3300047321 | Bacteria | 5821 |
| 1137 | Ga0495676_0027276 | 3300047321 | Bacteria | 4899 |
| 1138 | Ga0495676_0059585 | 3300047321 | Bacteria | 2997 |
| 1139 | Ga0495680_0003442 | 3300047322 | Bacteria | 15610 |
| 1140 | Ga0495680_0013228 | 3300047322 | Bacteria | 7209 |
| 1141 | Ga0495680_0255151 | 3300047322 | Bacteria | 1242 |
| 1142 | Ga0495683_0002960 | 3300047323 | Bacteria | 10033 |
| 1143 | Ga0495683_0011838 | 3300047323 | Bacteria | 4586 |
| 1144 | Ga0495683_0040443 | 3300047323 | Bacteria | 2355 |
| 1145 | Ga0495687_000101 | 3300047443 | Bacteria | 129682 |
| 1146 | Ga0495687_001048 | 3300047443 | Bacteria | 27433 |
| 1147 | Ga0495687_001664 | 3300047443 | Bacteria | 19940 |
| 1148 | Ga0495687_007657 | 3300047443 | Bacteria | 6317 |
| 1149 | Ga0495687_043985 | 3300047443 | Bacteria | 1943 |
| 1150 | Ga0495675_0010019 | 3300047444 | Bacteria | 5911 |
| 1151 | Ga0495677_0000015 | 3300047445 | Bacteria | 129962 |
| 1152 | Ga0495677_0095293 | 3300047445 | Bacteria | 1124 |
| 1153 | Ga0495679_000050 | 3300047446 | Bacteria | 125325 |
| 1154 | Ga0495679_008460 | 3300047446 | Bacteria | 4182 |
| 1155 | Ga0495679_010252 | 3300047446 | Bacteria | 3689 |
| 1156 | Ga0495673_0000028 | 3300047469 | Bacteria | 473418 |
| 1157 | Ga0495673_0002276 | 3300047469 | Bacteria | 13763 |
| 1158 | Ga0495673_0006233 | 3300047469 | Bacteria | 7054 |
| 1159 | Ga0495673_0006821 | 3300047469 | Bacteria | 6664 |
| 1160 | Ga0495681_0010670 | 3300047470 | Bacteria | 5544 |
| 1161 | Ga0495681_0082456 | 3300047470 | Bacteria | 1433 |
| 1162 | Ga0495684_0013586 | 3300047471 | Bacteria | 6269 |
| 1163 | Ga0495684_0031309 | 3300047471 | Bacteria | 4084 |
| 1164 | Ga0495684_0041628 | 3300047471 | Bacteria | 3521 |
| 1165 | Ga0495593_0005298 | 3300047673 | Bacteria | 7619 |
| 1166 | Ga0495593_0026344 | 3300047673 | Bacteria | 3211 |
| 1167 | Ga0495593_0029599 | 3300047673 | Bacteria | 3001 |
| 1168 | Ga0495593_0041678 | 3300047673 | Bacteria | 2467 |
| 1169 | Ga0495593_0054424 | 3300047673 | Bacteria | 2109 |
| 1170 | Ga0495602_0008243 | 3300048088 | Bacteria | 10882 |
| 1171 | Ga0495602_0013381 | 3300048088 | Bacteria | 8388 |
| 1172 | Ga0495602_0049125 | 3300048088 | Bacteria | 3782 |
| 1173 | Ga0495602_0112887 | 3300048088 | Bacteria | 2204 |
| 1174 | Ga0495614_0002084 | 3300048089 | Bacteria | 8824 |
| 1175 | Ga0495614_0005686 | 3300048089 | Bacteria | 5622 |
| 1176 | Ga0495626_0000554 | 3300048091 | Bacteria | 37066 |
| 1177 | Ga0495626_0013103 | 3300048091 | Bacteria | 4318 |
| 1178 | Ga0495626_0013780 | 3300048091 | Bacteria | 4193 |
| 1179 | Ga0495626_0023087 | 3300048091 | Bacteria | 3067 |
| 1180 | Ga0496101_0001774 | 3300048904 | Bacteria | 12961 |
| 1181 | Ga0496101_0013735 | 3300048904 | Bacteria | 5431 |
| 1182 | Ga0496101_0068731 | 3300048904 | Bacteria | 2591 |
| 1183 | Ga0496102_0015155 | 3300048905 | Bacteria | 6712 |
| 1184 | Ga0496102_0027585 | 3300048905 | Bacteria | 5070 |
| 1185 | Ga0496102_0150426 | 3300048905 | Bacteria | 2187 |
| 1186 | Ga0496103_0001531 | 3300048906 | Bacteria | 15434 |
| 1187 | Ga0496103_0017920 | 3300048906 | Bacteria | 4243 |
| 1188 | Ga0496103_0040340 | 3300048906 | Bacteria | 2868 |
| 1189 | Ga0496103_0059130 | 3300048906 | Bacteria | 2381 |
| 1190 | Ga0496103_0078080 | 3300048906 | Bacteria | 2079 |
| 1191 | Ga0496104_0008340 | 3300048907 | Bacteria | 9205 |
| 1192 | Ga0496104_0154488 | 3300048907 | Bacteria | 2202 |
| 1193 | Ga0496105_0006468 | 3300048908 | Bacteria | 9006 |
| 1194 | Ga0496105_0086963 | 3300048908 | Bacteria | 2583 |
| 1195 | Ga0496106_0000060 | 3300048909 | Bacteria | 87287 |
| 1196 | Ga0496106_0018163 | 3300048909 | Bacteria | 5202 |
| 1197 | Ga0496108_0110982 | 3300048911 | Bacteria | 2345 |
| 1198 | Ga0496108_0149414 | 3300048911 | Bacteria | 2016 |
| 1199 | Ga0496109_0073754 | 3300048912 | Bacteria | 3136 |
| 1200 | Ga0496109_0119688 | 3300048912 | Bacteria | 2452 |
| 1201 | Ga0496109_0138323 | 3300048912 | Bacteria | 2277 |
| 1202 | Ga0496110_0079512 | 3300048913 | Bacteria | 2919 |
| 1203 | Ga0496110_0328850 | 3300048913 | Bacteria | 1392 |
| 1204 | Ga0496110_0368185 | 3300048913 | Bacteria | 1309 |
| 1205 | Ga0496111_0023507 | 3300048914 | Bacteria | 4328 |
| 1206 | Ga0496111_0125635 | 3300048914 | Bacteria | 1896 |
| 1207 | Ga0496111_0244666 | 3300048914 | Bacteria | 1332 |
| 1208 | Ga0496112_0123209 | 3300048915 | Bacteria | 2563 |
| 1209 | Ga0496112_0372368 | 3300048915 | Bacteria | 1370 |
| 1210 | Ga0496113_0170575 | 3300048916 | Bacteria | 1723 |
| 1211 | Ga0496113_0437237 | 3300048916 | Bacteria | 1051 |
| 1212 | Ga0496114_0038689 | 3300048917 | Bacteria | 3947 |
| 1213 | Ga0496115_0398832 | 3300048918 | Bacteria | 1116 |
| 1214 | Ga0496116_0009120 | 3300048919 | Bacteria | 8503 |
| 1215 | Ga0496116_0010428 | 3300048919 | Bacteria | 7785 |
| 1216 | Ga0496116_0027827 | 3300048919 | Bacteria | 4107 |
| 1217 | Ga0496116_0043395 | 3300048919 | Bacteria | 3064 |
| 1218 | Ga0496117_0004030 | 3300048920 | Bacteria | 16547 |
| 1219 | Ga0496117_0012277 | 3300048920 | Bacteria | 7572 |
| 1220 | Ga0496117_0076429 | 3300048920 | Bacteria | 2220 |
| 1221 | Ga0496117_0099534 | 3300048920 | Bacteria | 1844 |
| 1222 | Ga0496117_0112716 | 3300048920 | Bacteria | 1690 |
| 1223 | Ga0496118_0001261 | 3300048921 | Bacteria | 38807 |
| 1224 | Ga0496118_0006078 | 3300048921 | Bacteria | 13436 |
| 1225 | Ga0496118_0009303 | 3300048921 | Bacteria | 9959 |
| 1226 | Ga0496118_0009322 | 3300048921 | Bacteria | 9946 |
| 1227 | Ga0496118_0120350 | 3300048921 | Bacteria | 1713 |
| 1228 | Ga0496121_0000102 | 3300048924 | Bacteria | 195341 |
| 1229 | Ga0496121_0006822 | 3300048924 | Bacteria | 13980 |
| 1230 | Ga0496121_0007246 | 3300048924 | Bacteria | 13425 |
| 1231 | Ga0496121_0013190 | 3300048924 | Bacteria | 8907 |
| 1232 | Ga0496121_0021224 | 3300048924 | Bacteria | 6374 |
| 1233 | Ga0496121_0033960 | 3300048924 | Bacteria | 4602 |
| 1234 | Ga0496121_0036277 | 3300048924 | Bacteria | 4396 |
| 1235 | Ga0496122_0002281 | 3300048925 | Bacteria | 27761 |
| 1236 | Ga0496123_0000197 | 3300048926 | Bacteria | 122784 |
| 1237 | Ga0496123_0008020 | 3300048926 | Bacteria | 9782 |
| 1238 | Ga0496124_0194365 | 3300048927 | Bacteria | 1549 |
| 1239 | Ga0496124_0195598 | 3300048927 | Bacteria | 1543 |
| 1240 | Ga0496125_0000983 | 3300048928 | Bacteria | 44536 |
| 1241 | Ga0496125_0004366 | 3300048928 | Bacteria | 16383 |
| 1242 | Ga0496126_0001236 | 3300048929 | Bacteria | 41467 |
| 1243 | Ga0496126_0004718 | 3300048929 | Bacteria | 16087 |
| 1244 | Ga0496126_0047016 | 3300048929 | Bacteria | 3953 |
| 1245 | Ga0495678_000006 | 3300049459 | Bacteria | 463690 |
| 1246 | Ga0495678_009322 | 3300049459 | Bacteria | 4866 |
| 1247 | Ga0501315_013242 | 3300049531 | Bacteria | 1030 |
| 1248 | Ga0501031_0000636 | 3300049568 | Bacteria | 20762 |
| 1249 | Ga0501031_0013813 | 3300049568 | Bacteria | 5263 |
| 1250 | Ga0501031_0038223 | 3300049568 | Bacteria | 3133 |
| 1251 | Ga0501031_0085123 | 3300049568 | Bacteria | 2061 |
| 1252 | Ga0501032_0000783 | 3300049569 | Bacteria | 25742 |
| 1253 | Ga0501032_0007662 | 3300049569 | Bacteria | 7873 |
| 1254 | Ga0501032_0009141 | 3300049569 | Bacteria | 7191 |
| 1255 | Ga0501032_0134993 | 3300049569 | Bacteria | 1626 |
| 1256 | Ga0501032_0141194 | 3300049569 | Bacteria | 1586 |
| 1257 | Ga0501033_0001537 | 3300049570 | Bacteria | 20402 |
| 1258 | Ga0501033_0013469 | 3300049570 | Bacteria | 6225 |
| 1259 | Ga0501034_0000280 | 3300049571 | Bacteria | 91814 |
| 1260 | Ga0501034_0010044 | 3300049571 | Bacteria | 9884 |
| 1261 | Ga0501034_0025314 | 3300049571 | Bacteria | 6041 |
| 1262 | Ga0501034_0185152 | 3300049571 | Bacteria | 2046 |
| 1263 | Ga0501036_0001069 | 3300049572 | Bacteria | 20739 |
| 1264 | Ga0501036_0022159 | 3300049572 | Bacteria | 5344 |
| 1265 | Ga0501036_0024220 | 3300049572 | Bacteria | 5116 |
| 1266 | Ga0501036_0107556 | 3300049572 | Bacteria | 2358 |
| 1267 | Ga0501037_0000440 | 3300049573 | Bacteria | 34171 |
| 1268 | Ga0501037_0015454 | 3300049573 | Bacteria | 5618 |
| 1269 | Ga0501037_0039408 | 3300049573 | Bacteria | 3478 |
| 1270 | Ga0501037_0072179 | 3300049573 | Bacteria | 2511 |
| 1271 | Ga0501038_0000396 | 3300049574 | Bacteria | 37861 |
| 1272 | Ga0501038_0002694 | 3300049574 | Bacteria | 16554 |
| 1273 | Ga0501038_0023085 | 3300049574 | Bacteria | 5566 |
| 1274 | Ga0501038_0107968 | 3300049574 | Bacteria | 2308 |
| 1275 | Ga0501039_0000504 | 3300049575 | Bacteria | 28251 |
| 1276 | Ga0501039_0002363 | 3300049575 | Bacteria | 14055 |
| 1277 | Ga0501039_0012456 | 3300049575 | Bacteria | 6493 |
| 1278 | Ga0501039_0019428 | 3300049575 | Bacteria | 5209 |
| 1279 | Ga0501039_0043108 | 3300049575 | Bacteria | 3486 |
| 1280 | Ga0501039_0256211 | 3300049575 | Bacteria | 1375 |
| 1281 | Ga0501040_0000263 | 3300049576 | Bacteria | 30635 |
| 1282 | Ga0501040_0007613 | 3300049576 | Bacteria | 7009 |
| 1283 | Ga0501040_0203508 | 3300049576 | Bacteria | 1406 |
| 1284 | Ga0501041_0000044 | 3300049577 | Bacteria | 43476 |
| 1285 | Ga0501041_0117643 | 3300049577 | Bacteria | 1651 |
| 1286 | Ga0501042_0000486 | 3300049578 | Bacteria | 20579 |
| 1287 | Ga0501042_0002115 | 3300049578 | Bacteria | 12037 |
| 1288 | Ga0501042_0018653 | 3300049578 | Bacteria | 4807 |
| 1289 | Ga0501042_0258717 | 3300049578 | Bacteria | 1256 |
| 1290 | Ga0501042_0303729 | 3300049578 | Bacteria | 1153 |
| 1291 | Ga0501043_0006041 | 3300049579 | Bacteria | 9731 |
| 1292 | Ga0501043_0019037 | 3300049579 | Bacteria | 5390 |
| 1293 | Ga0501043_0092968 | 3300049579 | Bacteria | 2371 |
| 1294 | Ga0501043_0243992 | 3300049579 | Bacteria | 1385 |
| 1295 | Ga0501046_0000656 | 3300049580 | Bacteria | 33629 |
| 1296 | Ga0501046_0005246 | 3300049580 | Bacteria | 11584 |
| 1297 | Ga0501046_0005612 | 3300049580 | Bacteria | 11198 |
| 1298 | Ga0501046_0044933 | 3300049580 | Bacteria | 3511 |
| 1299 | Ga0501046_0046771 | 3300049580 | Bacteria | 3433 |
| 1300 | Ga0501047_0005610 | 3300049581 | Bacteria | 11820 |
| 1301 | Ga0501047_0006804 | 3300049581 | Bacteria | 10742 |
| 1302 | Ga0501047_0037594 | 3300049581 | Bacteria | 4681 |
| 1303 | Ga0501047_0211836 | 3300049581 | Bacteria | 1796 |
| 1304 | Ga0501047_0233954 | 3300049581 | Bacteria | 1690 |
| 1305 | Ga0501048_0001832 | 3300049582 | Bacteria | 16125 |
| 1306 | Ga0501048_0042583 | 3300049582 | Bacteria | 3250 |
| 1307 | Ga0501068_0000515 | 3300049584 | Bacteria | 19599 |
| 1308 | Ga0501068_0001598 | 3300049584 | Bacteria | 12063 |
| 1309 | Ga0501070_0001279 | 3300049586 | Bacteria | 22589 |
| 1310 | Ga0501070_0006977 | 3300049586 | Bacteria | 9610 |
| 1311 | Ga0501070_0084021 | 3300049586 | Bacteria | 2636 |
| 1312 | Ga0501070_0117447 | 3300049586 | Bacteria | 2197 |
| 1313 | Ga0501070_0120325 | 3300049586 | Bacteria | 2170 |
| 1314 | Ga0501071_0001606 | 3300049587 | Bacteria | 13265 |
| 1315 | Ga0501071_0059290 | 3300049587 | Bacteria | 2769 |
| 1316 | Ga0501072_0004090 | 3300049588 | Bacteria | 11040 |
| 1317 | Ga0501072_0016016 | 3300049588 | Bacteria | 5749 |
| 1318 | Ga0501073_0000882 | 3300049589 | Bacteria | 21503 |
| 1319 | Ga0501073_0053360 | 3300049589 | Bacteria | 2830 |
| 1320 | Ga0501073_0119943 | 3300049589 | Bacteria | 1823 |
| 1321 | Ga0501074_0000309 | 3300049590 | Bacteria | 28271 |
| 1322 | Ga0501074_0000689 | 3300049590 | Bacteria | 21108 |
| 1323 | Ga0501074_0001854 | 3300049590 | Bacteria | 14505 |
| 1324 | Ga0501074_0148904 | 3300049590 | Bacteria | 1674 |
| 1325 | Ga0501075_0000475 | 3300049591 | Bacteria | 23966 |
| 1326 | Ga0501076_0000508 | 3300049592 | Bacteria | 24672 |
| 1327 | Ga0501076_0127867 | 3300049592 | Bacteria | 2059 |
| 1328 | Ga0501077_0001283 | 3300049593 | Bacteria | 15184 |
| 1329 | Ga0501198_000102 | 3300049649 | Bacteria | 16377 |
| 1330 | Ga0501222_000008 | 3300049662 | Bacteria | 120904 |
| 1331 | Ga0501249_017453 | 3300049679 | Bacteria | 1547 |
| 1332 | Ga0501079_0000184 | 3300049741 | Bacteria | 35607 |
| 1333 | Ga0501079_0006365 | 3300049741 | Bacteria | 8864 |
| 1334 | Ga0501080_0001544 | 3300049742 | Bacteria | 19454 |
| 1335 | Ga0501080_0076598 | 3300049742 | Bacteria | 3110 |
| 1336 | Ga0501080_0241807 | 3300049742 | Bacteria | 1647 |
| 1337 | Ga0501081_0000384 | 3300049743 | Bacteria | 24346 |
| 1338 | Ga0501081_0054526 | 3300049743 | Bacteria | 2762 |
| 1339 | Ga0501266_001480 | 3300049763 | Bacteria | 2999 |
| 1340 | Ga0501268_009940 | 3300049765 | Bacteria | 1471 |
| 1341 | Ga0501269_000336 | 3300049766 | Bacteria | 12123 |
| 1342 | Ga0501035_0000180 | 3300049822 | Bacteria | 77333 |
| 1343 | Ga0501035_0000813 | 3300049822 | Bacteria | 33299 |
| 1344 | Ga0501035_0018177 | 3300049822 | Bacteria | 6475 |
| 1345 | Ga0501035_0019942 | 3300049822 | Bacteria | 6159 |
| 1346 | Ga0501035_0103895 | 3300049822 | Bacteria | 2492 |
| 1347 | Ga0501044_0000524 | 3300049823 | Bacteria | 46747 |
| 1348 | Ga0501044_0033216 | 3300049823 | Bacteria | 5424 |
| 1349 | Ga0501044_0054882 | 3300049823 | Bacteria | 4093 |
| 1350 | Ga0501044_0099157 | 3300049823 | Bacteria | 2932 |
| 1351 | Ga0501045_0000247 | 3300049824 | Bacteria | 31299 |
| 1352 | Ga0501045_0000572 | 3300049824 | Bacteria | 23126 |
| 1353 | Ga0501045_0011965 | 3300049824 | Bacteria | 6100 |
| 1354 | Ga0501045_0031742 | 3300049824 | Bacteria | 3826 |
| 1355 | nmdc:mga03683_19887_c1 | 3300050489 | Bacteria | 2569 |
| 1356 | nmdc:mga03683_36081_c1 | 3300050489 | Bacteria | 2010 |
| 1357 | nmdc:mga0k408_123335_c1 | 3300050493 | Bacteria | 1536 |
| 1358 | nmdc:mga0k408_134_c1 | 3300050493 | Bacteria | 27880 |
| 1359 | nmdc:mga0k408_16168_c1 | 3300050493 | Bacteria | 4137 |
| 1360 | nmdc:mga0k408_16620_c1 | 3300050493 | Bacteria | 4086 |
| 1361 | nmdc:mga0k408_173971_c1 | 3300050493 | Bacteria | 1284 |
| 1362 | nmdc:mga0k408_2894_c1 | 3300050493 | Bacteria | 9099 |
| 1363 | nmdc:mga0k408_40340_c1 | 3300050493 | Bacteria | 2686 |
| 1364 | nmdc:mga0k408_41026_c1 | 3300050493 | Bacteria | 2664 |
| 1365 | nmdc:mga0k408_48608_c1 | 3300050493 | Bacteria | 2454 |
| 1366 | nmdc:mga0k408_6019_c1 | 3300050493 | Bacteria | 6472 |
| 1367 | nmdc:mga0k408_64802_c1 | 3300050493 | Bacteria | 2126 |
| 1368 | nmdc:mga0k408_9772_c1 | 3300050493 | Bacteria | 5178 |
| 1369 | nmdc:mga07m45_11022_c1 | 3300050496 | Bacteria | 4739 |
| 1370 | nmdc:mga07m45_17248_c1 | 3300050496 | Bacteria | 3875 |
| 1371 | nmdc:mga07m45_178022_c1 | 3300050496 | Bacteria | 1237 |
| 1372 | nmdc:mga07m45_3410_c1 | 3300050496 | Bacteria | 7662 |
| 1373 | nmdc:mga07m45_7383_c1 | 3300050496 | Bacteria | 5614 |
| 1374 | nmdc:mga09592_1507_c1 | 3300050508 | Bacteria | 18749 |
| 1375 | nmdc:mga09592_23134_c1 | 3300050508 | Bacteria | 5130 |
| 1376 | nmdc:mga0qj67_10463_c1 | 3300050509 | Bacteria | 6930 |
| 1377 | nmdc:mga0qj67_42320_c1 | 3300050509 | Bacteria | 3586 |
| 1378 | nmdc:mga06r32_21676_c1 | 3300050510 | Bacteria | 5933 |
| 1379 | nmdc:mga0n895_13637_c1 | 3300050512 | Bacteria | 7345 |
| 1380 | nmdc:mga0n895_612_c1 | 3300050512 | Bacteria | 24763 |
| 1381 | nmdc:mga0rr50_1855_c1 | 3300050513 | Bacteria | 11716 |
| 1382 | nmdc:mga0rr50_311602_c1 | 3300050513 | Bacteria | 1318 |
| 1383 | nmdc:mga0rr50_454697_c1 | 3300050513 | Bacteria | 1086 |
| 1384 | nmdc:mga08x19_115267_c1 | 3300050514 | Bacteria | 1796 |
| 1385 | nmdc:mga08x19_1378_c1 | 3300050514 | Bacteria | 15037 |
| 1386 | nmdc:mga0a205_106525_c1 | 3300050515 | Bacteria | 2701 |
| 1387 | nmdc:mga0a205_132165_c1 | 3300050515 | Bacteria | 2396 |
| 1388 | nmdc:mga0a205_77741_c1 | 3300050515 | Bacteria | 3206 |
| 1389 | nmdc:mga0sz30_27896_c1 | 3300050516 | Bacteria | 2321 |
| 1390 | nmdc:mga0sz30_28850_c1 | 3300050516 | Bacteria | 2285 |
| 1391 | Ga0495601_0004489 | 3300053077 | Bacteria | 8065 |
| 1392 | Ga0500594_0009231 | 3300053118 | Bacteria | 2267 |
| 1393 | Ga0500618_000621 | 3300053125 | Bacteria | 21549 |
| 1394 | Ga0500658_0004584 | 3300053134 | Bacteria | 5151 |
| 1395 | Ga0500619_037639 | 3300053154 | Bacteria | 1512 |
| 1396 | Ga0501084_0000800 | 3300054114 | Bacteria | 24076 |
| 1397 | Ga0501084_0074382 | 3300054114 | Bacteria | 2845 |
| 1398 | Ga0587070_017221 | 3300059491 | Bacteria | 1168 |
| 1399 | Ga0587083_0033968 | 3300059505 | Bacteria | 1032 |
| 1400 | Ga0587088_003967 | 3300059508 | Bacteria | 1839 |
| 1401 | Ga0587111_0014305 | 3300060346 | Bacteria | 1433 |
| 1402 | Ga0501082_0027573 | 3300060353 | Bacteria | 4889 |
| 1403 | Ga0501082_0033601 | 3300060353 | Bacteria | 4425 |
| 1404 | Ga0501082_0130558 | 3300060353 | Bacteria | 2180 |
| 1405 | Ga0466962_0006893 | 3300061719 | Bacteria | 5447 |
| 1406 | Ga0466962_0055701 | 3300061719 | Bacteria | 1889 |
| 1407 | Ga0466962_0071259 | 3300061719 | Bacteria | 1660 |
| 1408 | Ga0466962_0099246 | 3300061719 | Bacteria | 1398 |
| 1409 | Ga0530510_0000383 | 3300061734 | Bacteria | 28772 |
| 1410 | 2509127558 | 2508501125 | Bacteria | 7208311 |
| 1411 | 2510250266 | 2510065045 | Bacteria | 7761063 |
| 1412 | 2511250623 | 2511231003 | Bacteria | 5606035 |
| 1413 | 2512347785 | 2512047030 | Bacteria | 9031815 |
| 1414 | 2513953255 | 2513237150 | Bacteria | 6553639 |
| 1415 | 2513960367 | 2513237151 | Bacteria | 6309801 |
| 1416 | 2514042216 | 2513237165 | Bacteria | 6771773 |
| 1417 | 2514053979 | 2513237166 | Bacteria | 10373764 |
| 1418 | 2515679175 | 2515154122 | Bacteria | 8609520 |
| 1419 | 2519458098 | 2519103095 | Bacteria | 6629912 |
| 1420 | 2527076927 | 2526164713 | Bacteria | 6780608 |
| 1421 | 2548847322 | 2547132512 | Bacteria | 3416496 |
| 1422 | 2550693906 | 2548876994 | Bacteria | 4904866 |
| 1423 | 2563059424 | 2562617112 | Bacteria | 10918404 |
| 1424 | 2585294386 | 2582581311 | Bacteria | 6763856 |
| 1425 | 2599739391 | 2599185239 | Bacteria | 8686614 |
| 1426 | 2599742664 | 2599185240 | Bacteria | 7968121 |
| 1427 | 2600204782 | 2599185355 | Bacteria | 7968906 |
| 1428 | 2644027623 | 2643221603 | Bacteria | 6147767 |
| 1429 | 2676741770 | 2675903129 | Bacteria | 7964495 |
| 1430 | 2713479636 | 2711768613 | Bacteria | 11048459 |
| 1431 | 2719639418 | 2718217991 | Bacteria | 7829542 |
| 1432 | 2738819826 | 2738541296 | Bacteria | 7285013 |
| 1433 | 2738832306 | 2738541298 | Bacteria | 7286732 |
| 1434 | 2738873833 | 2738541306 | Bacteria | 7284992 |
| 1435 | 2739185463 | 2738543002 | Bacteria | 7284546 |
| 1436 | 2739220431 | 2738543008 | Bacteria | 7282815 |
| 1437 | 2739612033 | 2739367655 | Bacteria | 4051151 |
| 1438 | 2746092020 | 2744054900 | Bacteria | 8399525 |
| 1439 | 2746099883 | 2744054901 | Bacteria | 8397047 |
| 1440 | 2753571306 | 2751185846 | Bacteria | 7242164 |
| 1441 | 2765568984 | 2765235838 | Bacteria | 5445269 |
| 1442 | 2792838654 | 2791355137 | Bacteria | 9654227 |
| 1443 | 2808984504 | 2808606386 | Bacteria | 4471946 |
| 1444 | 2809131231 | 2808606415 | Bacteria | 4576710 |
| 1445 | 2809150433 | 2808606419 | Bacteria | 4576925 |
| 1446 | 2817260253 | 2816332253 | Bacteria | 6764532 |
| 1447 | 2817277938 | 2816332256 | Bacteria | 6891714 |
| 1448 | 2817451108 | 2816332286 | Bacteria | 6853759 |
| 1449 | 2819545246 | 2818991436 | Bacteria | 5376622 |
| 1450 | 2819591158 | 2818991445 | Bacteria | 4955017 |
| 1451 | 2819622039 | 2818991450 | Bacteria | 6962147 |
| 1452 | 2819632776 | 2818991452 | Bacteria | 8442785 |
| 1453 | 2831870099 | 2831864461 | Bacteria | 6502356 |
| 1454 | 2839096132 | 2839094727 | Bacteria | 5534556 |
| 1455 | 2842330201 | 2842324504 | Bacteria | 9364110 |
| 1456 | 2842356756 | 2842348783 | Bacteria | 9002918 |
| 1457 | 2842457785 | 2842454564 | Bacteria | 8730687 |
| 1458 | 2842721485 | 2842718218 | Bacteria | 4560148 |
| 1459 | 2852621948 | 2852618963 | Bacteria | 4577824 |
| 1460 | 2855735821 | 2855730933 | Bacteria | 7047938 |
| 1461 | 2855772759 | 2855767633 | Bacteria | 7049357 |
| 1462 | 2857576489 | 2857576091 | Bacteria | 5465855 |
| 1463 | 2858691751 | 2858688981 | Bacteria | 8184122 |
| 1464 | 2863421790 | 2863421361 | Bacteria | 7300805 |
| 1465 | 2870072269 | 2870068957 | Bacteria | 8925310 |
| 1466 | 2881930140 | 2881927736 | Bacteria | 3993927 |
| 1467 | 2884812274 | 2884811622 | Bacteria | 5552861 |
| 1468 | 2884836881 | 2884836552 | Bacteria | 5219991 |
| 1469 | 2884853172 | 2884852848 | Bacteria | 5221161 |
| 1470 | 2885272175 | 2885270888 | Bacteria | 9831543 |
| 1471 | 2886849652 | 2886848708 | Bacteria | 5632523 |
| 1472 | 2894024230 | 2894023352 | Bacteria | 5167372 |
| 1473 | 2895516099 | 2895511927 | Bacteria | 6802080 |
| 1474 | 2896155710 | 2896154374 | Bacteria | 5221518 |
| 1475 | 2900635882 | 2900634093 | Bacteria | 10263517 |
| 1476 | 2902683185 | 2902682994 | Bacteria | 8951596 |
| 1477 | 2904484246 | 2904483920 | Bacteria | 7545285 |
| 1478 | 2904618162 | 2904615490 | Bacteria | 10047340 |
| 1479 | 2919530188 | 2919527303 | Bacteria | 7718827 |
| 1480 | 2921649876 | 2921643360 | Bacteria | 11448031 |
| 1481 | 2928109945 | 2928108538 | Bacteria | 7360024 |
| 1482 | 2928131032 | 2928130867 | Bacteria | 5467269 |
| 1483 | 2928136600 | 2928135762 | Bacteria | 7259641 |
| 1484 | 2928159633 | 2928157003 | Bacteria | 7522202 |
| 1485 | 2928164307 | 2928163908 | Bacteria | 7561269 |
| 1486 | 2928173110 | 2928170801 | Bacteria | 8785406 |
| 1487 | 2928509019 | 2928503688 | Bacteria | 7268108 |
| 1488 | 2945935813 | 2945934425 | Bacteria | 7444609 |
| 1489 | 2974322413 | 2974320154 | Bacteria | 4571377 |
| 1490 | 2981994073 | 2981990288 | Bacteria | 7590678 |
| 1491 | 2990710276 | 2990703756 | Bacteria | 7715990 |
| 1492 | 642422800 | 641736151 | Bacteria | 7477263 |
| 1493 | 642415505 | 641736154 | Bacteria | 7689995 |
| 1494 | 642592398 | 642555112 | Bacteria | 8676562 |
| 1495 | 642620598 | 642555113 | Bacteria | 8214658 |
| 1496 | 644747057 | 644736347 | Bacteria | 6476522 |
| 1497 | 8018848227 | 8018845410 | Bacteria | 8933938 |
| 1498 | 8020809291 | 8020807995 | Bacteria | 6801506 |
| 1499 | 8020944638 | 8020938398 | Bacteria | 7472757 |
| 1500 | 8020947380 | 8020945358 | Bacteria | 8467355 |
| 1501 | 8020959719 | 8020953355 | Bacteria | 7439080 |
| 1502 | 8021122667 | 8021120328 | Bacteria | 8782274 |
| 1503 | 8039099429 | 8039098773 | Bacteria | 6602928 |
| 1504 | 8040170555 | 8040167225 | Bacteria | 6542727 |
| 1505 | 8040175454 | 8040173305 | Bacteria | 6827067 |
| 1506 | 8055227234 | 8055225921 | Bacteria | 3341787 |
| 1507 | 8055266432 | 8055266321 | Bacteria | 7999742 |
| 1508 | 8055304951 | 8055301274 | Bacteria | 8587385 |
| 1509 | Ga0501042_0197434 | |||
| 1510 | JGI24740J21852_10000408 | |||
| 1511 | JGI24739J22299_10002612 | |||
| 1512 | JGI24739J22299_10022734 | |||
| 1513 | JGI24735J21928_10004224 | |||
| 1514 | JGI24735J21928_10043488 | |||
| 1515 | JGI24738J21930_10002746 | |||
| 1516 | JGI25155J39150_1000186 | |||
| 1517 | JGI25155J39150_1000416 | |||
| 1518 | JGI25156J39149_1000425 | |||
| 1519 | JGI25156J39149_1000808 | |||
| 1520 | JGI25156J39149_1001518 | |||
| 1521 | JGI25156J39149_1003490 | |||
| 1522 | JGI25162J39368_1000426 | |||
| 1523 | JGI25154J39366_1000496 | |||
| 1524 | JGI25154J39366_1000504 | |||
| 1525 | JGI25154J39366_1000704 | |||
| 1526 | JGI25154J39366_1000985 | |||
| 1527 | JGI25154J39366_1002170 | |||
| 1528 | JGI25158J39367_1000154 | |||
| 1529 | JGI25157J39369_1000021 | |||
| 1530 | JGI25157J39369_1000771 | |||
| 1531 | JGI25163J39215_1001943 | |||
| 1532 | JGI25150J39212_1007054 | |||
| 1533 | JGI25159J45721_1000806 | |||
| 1534 | JGI25151J46595_10003776 | |||
| 1535 | JGI25151J46595_10004054 | |||
| 1536 | JGI25151J46595_10018776 | |||
| 1537 | JGI25151J46595_10024627 | |||
| 1538 | JGI25165J46597_1000022 | |||
| 1539 | JGI25165J46597_1001231 | |||
| 1540 | rootH2_10004894 | |||
| 1541 | rootL2_10000757 | |||
| 1542 | rootL2_10000982 | |||
| 1543 | rootL2_10002392 | |||
| 1544 | rootL2_10008489 | |||
| 1545 | rootH1_10007359 | |||
| 1546 | JGI25160J50197_1000140 | |||
| 1547 | JGI25161J50226_1000062 | |||
| 1548 | JGI25161J50226_1004262 | |||
| 1549 | Ga0006554J51385_1029846 | |||
| 1550 | Ga0055538_1000002 | |||
| 1551 | Ga0055538_1000011 | |||
| 1552 | Ga0055539_1000002 | |||
| 1553 | Ga0055539_1000016 | |||
| 1554 | Ga0055539_1000129 | |||
| 1555 | Ga0055539_1001072 | |||
| 1556 | Ga0055533_1000004 | |||
| 1557 | Ga0055533_1000019 | |||
| 1558 | Ga0055533_1000033 | |||
| 1559 | Ga0055533_1000038 | |||
| 1560 | Ga0055533_1000040 | |||
| 1561 | Ga0055533_1000750 | |||
| 1562 | Ga0055532_1000001 | |||
| 1563 | Ga0055532_1000016 | |||
| 1564 | Ga0055532_1003589 | |||
| 1565 | Ga0055525_1000002 | |||
| 1566 | Ga0055525_1000011 | |||
| 1567 | Ga0055525_1000046 | |||
| 1568 | Ga0055525_1000173 | |||
| 1569 | Ga0055525_1000182 | |||
| 1570 | Ga0055525_1000436 | |||
| 1571 | Ga0055525_1000804 | |||
| 1572 | Ga0055527_1000002 | |||
| 1573 | Ga0055535_1000001 | |||
| 1574 | Ga0055535_1000908 | |||
| 1575 | Ga0055535_1002931 | |||
| 1576 | Ga0055535_1006273 | |||
| 1577 | Ga0055542_1000001 | |||
| 1578 | Ga0055542_1001564 | |||
| 1579 | Ga0055529_1000001 | |||
| 1580 | Ga0055529_1000051 | |||
| 1581 | Ga0055529_1000218 | |||
| 1582 | Ga0055529_1001138 | |||
| 1583 | Ga0055526_1000358 | |||
| 1584 | Ga0055526_1000537 | |||
| 1585 | Ga0055526_1000716 | |||
| 1586 | Ga0055526_1001023 | |||
| 1587 | Ga0055526_1005468 | |||
| 1588 | Ga0055526_1009687 | |||
| 1589 | Ga0055526_1012007 | |||
| 1590 | Ga0055526_1023754 | |||
| 1591 | Ga0055526_1028162 | |||
| 1592 | Ga0055526_1028180 | |||
| 1593 | Ga0055526_1044351 | |||
| 1594 | Ga0055537_1000022 | |||
| 1595 | Ga0055537_1003965 | |||
| 1596 | Ga0055537_1004727 | |||
| 1597 | Ga0055537_1005357 | |||
| 1598 | Ga0055524_1000241 | |||
| 1599 | Ga0055524_1001254 | |||
| 1600 | Ga0055524_1001347 | |||
| 1601 | Ga0055524_1001821 | |||
| 1602 | Ga0055536_1000095 | |||
| 1603 | Ga0055534_1000468 | |||
| 1604 | Ga0055534_1000708 | |||
| 1605 | Ga0055534_1000987 | |||
| 1606 | Ga0055534_1005473 | |||
| 1607 | Ga0055534_1010175 | |||
| 1608 | Ga0055528_1000473 | |||
| 1609 | Ga0055528_1002794 | |||
| 1610 | Ga0055528_1034677 | |||
| 1611 | Ga0055530_10000057 | |||
| 1612 | Ga0055530_10004150 | |||
| 1613 | Ga0055530_10016028 | |||
| 1614 | Ga0055540_1000001 | |||
| 1615 | Ga0055540_1022195 | |||
| 1616 | Ga0055540_1033611 | |||
| 1617 | Ga0055531_10002737 | |||
| 1618 | Ga0055531_10018527 | |||
| 1619 | Ga0055541_1000002 | |||
| 1620 | Ga0055541_1000043 | |||
| 1621 | Ga0055541_1000084 | |||
| 1622 | Ga0055541_1005715 | |||
| 1623 | Ga0055543_1000121 | |||
| 1624 | Ga0055543_1001320 | |||
| 1625 | Ga0055543_1013115 | |||
| 1626 | Ga0065165_1000261 | |||
| 1627 | Ga0065165_1000613 | |||
| 1628 | Ga0065165_1000952 | |||
| 1629 | Ga0065715_10016327 | |||
| 1630 | Ga0065707_10107524 | |||
| 1631 | Ga0070658_10032140 | |||
| 1632 | Ga0070658_10158077 | |||
| 1633 | Ga0070676_10120384 | |||
| 1634 | Ga0070676_10173867 | |||
| 1635 | Ga0070683_100004795 | |||
| 1636 | Ga0070690_100065041 | |||
| 1637 | Ga0070670_100001406 | |||
| 1638 | Ga0070670_100003471 | |||
| 1639 | Ga0070670_100007979 | |||
| 1640 | Ga0070670_100033488 | |||
| 1641 | Ga0070670_100041376 | |||
| 1642 | Ga0070670_100074064 | |||
| 1643 | Ga0070670_100084291 | |||
| 1644 | Ga0070670_100137799 | |||
| 1645 | Ga0068869_100003074 | |||
| 1646 | Ga0068869_100283528 | |||
| 1647 | Ga0070666_10018750 | |||
| 1648 | Ga0070682_100009086 | |||
| 1649 | Ga0068868_100002961 | |||
| 1650 | Ga0068868_100044482 | |||
| 1651 | Ga0070660_100000008 | |||
| 1652 | Ga0070660_100003570 | |||
| 1653 | Ga0070660_100163250 | |||
| 1654 | Ga0070660_100178130 | |||
| 1655 | Ga0070660_100209466 | |||
| 1656 | Ga0070689_100061984 | |||
| 1657 | Ga0070687_100030926 | |||
| 1658 | Ga0070687_100058009 | |||
| 1659 | Ga0070661_100005081 | |||
| 1660 | Ga0070668_100004719 | |||
| 1661 | Ga0070668_100068825 | |||
| 1662 | Ga0070668_100187019 | |||
| 1663 | Ga0070669_100080910 | |||
| 1664 | Ga0070669_100237761 | |||
| 1665 | Ga0070675_100003790 | |||
| 1666 | Ga0070675_100005988 | |||
| 1667 | Ga0070675_100007331 | |||
| 1668 | Ga0070675_100009293 | |||
| 1669 | Ga0070675_100232539 | |||
| 1670 | Ga0070671_100035058 | |||
| 1671 | Ga0070671_100048181 | |||
| 1672 | Ga0070671_100053379 | |||
| 1673 | Ga0070674_100004270 | |||
| 1674 | Ga0070673_100002423 | |||
| 1675 | Ga0070673_100018209 | |||
| 1676 | Ga0070673_100031799 | |||
| 1677 | Ga0070673_100037071 | |||
| 1678 | Ga0070673_100047712 | |||
| 1679 | Ga0070673_100103268 | |||
| 1680 | Ga0070659_100000014 | |||
| 1681 | Ga0070659_100005143 | |||
| 1682 | Ga0070659_100148183 | |||
| 1683 | Ga0070659_100178134 | |||
| 1684 | Ga0070659_100275751 | |||
| 1685 | Ga0070667_100001679 | |||
| 1686 | Ga0070667_100009453 | |||
| 1687 | Ga0070714_100067168 | |||
| 1688 | Ga0070710_10295396 | |||
| 1689 | Ga0070701_10005536 | |||
| 1690 | Ga0070701_10227493 | |||
| 1691 | Ga0070705_100002406 | |||
| 1692 | Ga0070705_100044579 | |||
| 1693 | Ga0070700_100094244 | |||
| 1694 | Ga0070663_100000913 | |||
| 1695 | Ga0070663_100353011 | |||
| 1696 | Ga0070678_100001893 | |||
| 1697 | Ga0070662_100008260 | |||
| 1698 | Ga0070662_100023135 | |||
| 1699 | Ga0070662_100234096 | |||
| 1700 | Ga0070662_100318482 | |||
| 1701 | Ga0070681_10089614 | |||
| 1702 | Ga0070681_10096062 | |||
| 1703 | Ga0068867_100003769 | |||
| 1704 | Ga0068867_100019029 | |||
| 1705 | Ga0068867_100049361 | |||
| 1706 | Ga0068867_100104085 | |||
| 1707 | Ga0068867_100111074 | |||
| 1708 | Ga0070685_10260627 | |||
| 1709 | Ga0070706_100027330 | |||
| 1710 | Ga0070706_100040485 | |||
| 1711 | Ga0070706_100573970 | |||
| 1712 | Ga0070707_100171948 | |||
| 1713 | Ga0070698_100077238 | |||
| 1714 | Ga0070698_100194250 | |||
| 1715 | Ga0070698_100198110 | |||
| 1716 | Ga0070699_100051724 | |||
| 1717 | Ga0070699_100335711 | |||
| 1718 | Ga0070679_100082146 | |||
| 1719 | Ga0070684_100038866 | |||
| 1720 | Ga0070697_100137437 | |||
| 1721 | Ga0068853_100021304 | |||
| 1722 | Ga0068853_100138104 | |||
| 1723 | Ga0068853_100280460 | |||
| 1724 | Ga0070672_100000559 | |||
| 1725 | Ga0070672_100001075 | |||
| 1726 | Ga0070672_100020445 | |||
| 1727 | Ga0070672_100086563 | |||
| 1728 | Ga0070672_100160032 | |||
| 1729 | Ga0070672_100213340 | |||
| 1730 | Ga0070686_100081925 | |||
| 1731 | Ga0070686_100160244 | |||
| 1732 | Ga0070693_100155711 | |||
| 1733 | Ga0070665_100140620 | |||
| 1734 | Ga0070665_100457944 | |||
| 1735 | Ga0070704_100004786 | |||
| 1736 | Ga0068855_100000065 | |||
| 1737 | Ga0068855_100053523 | |||
| 1738 | Ga0068855_100071387 | |||
| 1739 | Ga0068855_100087568 | |||
| 1740 | Ga0068855_100141910 | |||
| 1741 | Ga0068855_100233970 | |||
| 1742 | Ga0070664_100018873 | |||
| 1743 | Ga0070664_100020897 | |||
| 1744 | Ga0070664_100104091 | |||
| 1745 | Ga0070664_100291396 | |||
| 1746 | Ga0070664_100551389 | |||
| 1747 | Ga0068857_100009558 | |||
| 1748 | Ga0068857_100080714 | |||
| 1749 | Ga0068857_100256505 | |||
| 1750 | Ga0068854_100014807 | |||
| 1751 | Ga0068854_100024410 | |||
| 1752 | Ga0068856_100051596 | |||
| 1753 | Ga0068856_100267979 | |||
| 1754 | Ga0070702_100118276 | |||
| 1755 | Ga0068852_100006246 | |||
| 1756 | Ga0068852_100008168 | |||
| 1757 | Ga0068852_100040750 | |||
| 1758 | Ga0068859_100000737 | |||
| 1759 | Ga0068859_100252302 | |||
| 1760 | Ga0068864_100000840 | |||
| 1761 | Ga0068864_100001287 | |||
| 1762 | Ga0068864_100013771 | |||
| 1763 | Ga0068864_100031709 | |||
| 1764 | Ga0068864_100036830 | |||
| 1765 | Ga0068861_100005132 | |||
| 1766 | Ga0068861_100011169 | |||
| 1767 | Ga0068851_10009611 | |||
| 1768 | Ga0068851_10143297 | |||
| 1769 | Ga0068870_10027159 | |||
| 1770 | Ga0068863_100005089 | |||
| 1771 | Ga0068863_100011648 | |||
| 1772 | Ga0068863_100205428 | |||
| 1773 | Ga0068863_100376592 | |||
| 1774 | Ga0068858_100125906 | |||
| 1775 | Ga0068860_100002072 | |||
| 1776 | Ga0068860_100078105 | |||
| 1777 | Ga0068862_100011170 | |||
| 1778 | Ga0068862_100019343 | |||
| 1779 | Ga0068862_100024514 | |||
| 1780 | Ga0068862_100047853 | |||
| 1781 | Ga0068862_100406526 | |||
| 1782 | Ga0075368_10007221 | |||
| 1783 | Ga0075363_100049286 | |||
| 1784 | Ga0075362_10021576 | |||
| 1785 | Ga0075367_10113805 | |||
| 1786 | Ga0075369_10004056 | |||
| 1787 | Ga0075366_10012319 | |||
| 1788 | Ga0075366_10012445 | |||
| 1789 | Ga0075366_10018887 | |||
| 1790 | Ga0075366_10052320 | |||
| 1791 | Ga0075366_10052525 | |||
| 1792 | Ga0097621_100044191 | |||
| 1793 | Ga0075370_10012972 | |||
| 1794 | Ga0075370_10061718 | |||
| 1795 | Ga0075370_10162176 | |||
| 1796 | Ga0068871_100010530 | |||
| 1797 | Ga0068871_100023680 | |||
| 1798 | Ga0068871_100229083 | |||
| 1799 | Ga0068871_100237988 | |||
| 1800 | Ga0075428_100034656 | |||
| 1801 | Ga0075430_100018777 | |||
| 1802 | Ga0075431_100032658 | |||
| 1803 | Ga0075431_100119141 | |||
| 1804 | Ga0075433_10197446 | |||
| 1805 | Ga0075434_100000211 | |||
| 1806 | Ga0075434_100013586 | |||
| 1807 | Ga0075434_100417867 | |||
| 1808 | Ga0075429_100000463 | |||
| 1809 | Ga0068865_100009315 | |||
| 1810 | Ga0075436_100000711 | |||
| 1811 | Ga0097620_100000737 | |||
| 1812 | Ga0097620_100252305 | |||
| 1813 | Ga0099824_1022389 | |||
| 1814 | Ga0079104_1000002 | |||
| 1815 | Ga0079104_1004866 | |||
| 1816 | Ga0099826_10000028 | |||
| 1817 | Ga0075435_100001401 | |||
| 1818 | Ga0075435_100013086 | |||
| 1819 | Ga0075435_100027772 | |||
| 1820 | Ga0075435_100056631 | |||
| 1821 | Ga0105251_10000602 | |||
| 1822 | Ga0105251_10041204 | |||
| 1823 | Ga0105244_10053504 | |||
| 1824 | Ga0105250_10002860 | |||
| 1825 | Ga0105250_10015617 | |||
| 1826 | Ga0105240_10000297 | |||
| 1827 | Ga0105240_10009100 | |||
| 1828 | Ga0105240_10034284 | |||
| 1829 | Ga0105240_10038292 | |||
| 1830 | Ga0105240_10110669 | |||
| 1831 | Ga0105240_10145471 | |||
| 1832 | Ga0105240_10329241 | |||
| 1833 | Ga0111539_10066234 | |||
| 1834 | Ga0114129_10054355 | |||
| 1835 | Ga0105243_10001651 | |||
| 1836 | Ga0105243_10107188 | |||
| 1837 | Ga0105241_10111771 | |||
| 1838 | Ga0105241_10140213 | |||
| 1839 | Ga0105242_10000485 | |||
| 1840 | Ga0105242_10149273 | |||
| 1841 | Ga0105242_10170498 | |||
| 1842 | Ga0105242_10363313 | |||
| 1843 | Ga0105248_10008373 | |||
| 1844 | Ga0105248_10063680 | |||
| 1845 | Ga0105237_10059880 | |||
| 1846 | Ga0105238_10008362 | |||
| 1847 | Ga0105238_10017542 | |||
| 1848 | Ga0105238_10018705 | |||
| 1849 | Ga0105238_10165226 | |||
| 1850 | Ga0105238_10288918 | |||
| 1851 | Ga0105238_10362725 | |||
| 1852 | Ga0105239_10005209 | |||
| 1853 | Ga0105239_10027775 | |||
| 1854 | Ga0105239_10197986 | |||
| 1855 | Ga0157317_1002422 | |||
| 1856 | Ga0157373_10085063 | |||
| 1857 | Ga0157370_10174745 | |||
| 1858 | Ga0157369_10000179 | |||
| 1859 | Ga0157369_10040041 | |||
| 1860 | Ga0157369_10213725 | |||
| 1861 | Ga0157374_10130246 | |||
| 1862 | Ga0157374_10145394 | |||
| 1863 | Ga0157374_10260712 | |||
| 1864 | Ga0157378_10032916 | |||
| 1865 | Ga0157378_10427012 | |||
| 1866 | Ga0163162_10068472 | |||
| 1867 | Ga0163162_10143959 | |||
| 1868 | Ga0163162_10201421 | |||
| 1869 | Ga0163162_10206877 | |||
| 1870 | Ga0157372_10105731 | |||
| 1871 | Ga0157372_10408573 | |||
| 1872 | Ga0157375_10027001 | |||
| 1873 | Ga0163163_10010908 | |||
| 1874 | Ga0163163_10016193 | |||
| 1875 | Ga0157380_10091235 | |||
| 1876 | Ga0182008_10000215 | |||
| 1877 | Ga0182008_10031438 | |||
| 1878 | Ga0157377_10244905 | |||
| 1879 | Ga0157379_10001176 | |||
| 1880 | Ga0157379_10052546 | |||
| 1881 | Ga0157379_10351075 | |||
| 1882 | Ga0157376_10008506 | |||
| 1883 | Ga0157376_10039234 | |||
| 1884 | Ga0182007_10001432 | |||
| 1885 | Ga0182007_10001777 | |||
| 1886 | Ga0182005_1000666 | |||
| 1887 | Ga0183361_10009 | |||
| 1888 | Ga0163161_10024951 | |||
| 1889 | Ga0163161_10097325 | |||
| 1890 | Ga0163161_10163705 | |||
| 1891 | Ga0163161_10230061 | |||
| 1892 | Ga0213872_10000003 | |||
| 1893 | Ga0213872_10000042 | |||
| 1894 | Ga0213872_10000197 | |||
| 1895 | Ga0213872_10000641 | |||
| 1896 | Ga0213872_10002773 | |||
| 1897 | Ga0213872_10024475 | |||
| 1898 | Ga0213872_10095944 | |||
| 1899 | Ga0209435_100090 | |||
| 1900 | Ga0209435_100200 | |||
| 1901 | Ga0209436_100005 | |||
| 1902 | Ga0209784_100002 | |||
| 1903 | Ga0209784_100019 | |||
| 1904 | Ga0209566_100003 | |||
| 1905 | Ga0209566_100017 | |||
| 1906 | Ga0209566_100601 | |||
| 1907 | Ga0209674_100004 | |||
| 1908 | Ga0209674_100005 | |||
| 1909 | Ga0209674_100031 | |||
| 1910 | Ga0209674_100064 | |||
| 1911 | Ga0209674_100066 | |||
| 1912 | Ga0209674_100110 | |||
| 1913 | Ga0209674_106234 | |||
| 1914 | Ga0209672_100001 | |||
| 1915 | Ga0209672_100051 | |||
| 1916 | Ga0209147_100001 | |||
| 1917 | Ga0209147_100023 | |||
| 1918 | Ga0209147_100120 | |||
| 1919 | Ga0209147_100365 | |||
| 1920 | Ga0209563_100005 | |||
| 1921 | Ga0209563_100006 | |||
| 1922 | Ga0209563_100035 | |||
| 1923 | Ga0209563_100107 | |||
| 1924 | Ga0209563_100126 | |||
| 1925 | Ga0207427_100197 | |||
| 1926 | Ga0207427_102210 | |||
| 1927 | Ga0207427_104178 | |||
| 1928 | Ga0209437_100038 | |||
| 1929 | Ga0209437_100080 | |||
| 1930 | Ga0209437_106554 | |||
| 1931 | Ga0209258_100001 | |||
| 1932 | Ga0209258_100179 | |||
| 1933 | Ga0209258_100262 | |||
| 1934 | Ga0209258_100280 | |||
| 1935 | Ga0209258_100850 | |||
| 1936 | Ga0209258_102660 | |||
| 1937 | Ga0209646_1000060 | |||
| 1938 | Ga0209646_1000072 | |||
| 1939 | Ga0209646_1000294 | |||
| 1940 | Ga0209646_1000296 | |||
| 1941 | Ga0209026_1000049 | |||
| 1942 | Ga0209026_1000150 | |||
| 1943 | Ga0209026_1005310 | |||
| 1944 | Ga0209677_100003 | |||
| 1945 | Ga0209677_100020 | |||
| 1946 | Ga0209677_100052 | |||
| 1947 | Ga0209677_100099 | |||
| 1948 | Ga0209677_100229 | |||
| 1949 | Ga0209677_101485 | |||
| 1950 | Ga0209148_1000003 | |||
| 1951 | Ga0209148_1000027 | |||
| 1952 | Ga0209148_1018870 | |||
| 1953 | Ga0209759_1000033 | |||
| 1954 | Ga0209759_1000069 | |||
| 1955 | Ga0209759_1000116 | |||
| 1956 | Ga0209759_1000294 | |||
| 1957 | Ga0209759_1000516 | |||
| 1958 | Ga0209759_1000520 | |||
| 1959 | Ga0209759_1001511 | |||
| 1960 | Ga0209759_1007805 | |||
| 1961 | Ga0209759_1018384 | |||
| 1962 | Ga0209759_1022355 | |||
| 1963 | Ga0209233_1000016 | |||
| 1964 | Ga0209233_1000049 | |||
| 1965 | Ga0209565_1000015 | |||
| 1966 | Ga0209565_1001112 | |||
| 1967 | Ga0209565_1002528 | |||
| 1968 | Ga0209565_1010164 | |||
| 1969 | Ga0209455_1000001 | |||
| 1970 | Ga0209455_1000044 | |||
| 1971 | Ga0209455_1000191 | |||
| 1972 | Ga0209455_1000203 | |||
| 1973 | Ga0209673_1000017 | |||
| 1974 | Ga0209673_1000070 | |||
| 1975 | Ga0209673_1004714 | |||
| 1976 | Ga0209673_1009022 | |||
| 1977 | Ga0209130_1000055 | |||
| 1978 | Ga0209130_1009756 | |||
| 1979 | Ga0209130_1030316 | |||
| 1980 | Ga0209675_1000012 | |||
| 1981 | Ga0209675_1000212 | |||
| 1982 | Ga0209675_1003345 | |||
| 1983 | Ga0209675_1006703 | |||
| 1984 | Ga0209675_1008288 | |||
| 1985 | Ga0209676_1000066 | |||
| 1986 | Ga0209025_1000384 | |||
| 1987 | Ga0209025_1001071 | |||
| 1988 | Ga0209025_1002826 | |||
| 1989 | Ga0209025_1004282 | |||
| 1990 | Ga0209025_1070686 | |||
| 1991 | Ga0209564_1000002 | |||
| 1992 | Ga0209564_1000003 | |||
| 1993 | Ga0209564_1000007 | |||
| 1994 | Ga0209564_1000016 | |||
| 1995 | Ga0209564_1000107 | |||
| 1996 | Ga0209564_1000124 | |||
| 1997 | Ga0209564_1001211 | |||
| 1998 | Ga0209564_1001981 | |||
| 1999 | Ga0209564_1007499 | |||
| 2000 | Ga0209564_1011129 | |||
| 2001 | Ga0209564_1012325 | |||
| 2002 | Ga0209050_1000145 | |||
| 2003 | Ga0209050_1000304 | |||
| 2004 | Ga0209050_1001774 | |||
| 2005 | Ga0209256_1000007 | |||
| 2006 | Ga0209256_1000076 | |||
| 2007 | Ga0209256_1000183 | |||
| 2008 | Ga0209256_1000482 | |||
| 2009 | Ga0209256_1000659 | |||
| 2010 | Ga0209256_1001268 | |||
| 2011 | Ga0209256_1004161 | |||
| 2012 | Ga0209256_1005488 | |||
| 2013 | Ga0207426_1000326 | |||
| 2014 | Ga0207426_1019591 | |||
| 2015 | Ga0209051_1000018 | |||
| 2016 | Ga0209051_1007055 | |||
| 2017 | Ga0209051_1010277 | |||
| 2018 | Ga0209051_1014646 | |||
| 2019 | Ga0209051_1020441 | |||
| 2020 | Ga0209257_1000084 | |||
| 2021 | Ga0209257_1000450 | |||
| 2022 | Ga0209257_1016886 | |||
| 2023 | Ga0207697_10007133 | |||
| 2024 | Ga0207656_10005509 | |||
| 2025 | Ga0207656_10068785 | |||
| 2026 | Ga0207696_1007745 | |||
| 2027 | Ga0207655_1011552 | |||
| 2028 | Ga0207655_1018621 | |||
| 2029 | Ga0207713_1000372 | |||
| 2030 | Ga0207682_10000340 | |||
| 2031 | Ga0207682_10003157 | |||
| 2032 | Ga0207642_10095627 | |||
| 2033 | Ga0207688_10014892 | |||
| 2034 | Ga0207680_10014240 | |||
| 2035 | Ga0207647_10001108 | |||
| 2036 | Ga0207647_10027614 | |||
| 2037 | Ga0207647_10056661 | |||
| 2038 | Ga0207699_10059428 | |||
| 2039 | Ga0207645_10010068 | |||
| 2040 | Ga0207643_10033124 | |||
| 2041 | Ga0207705_10016982 | |||
| 2042 | Ga0207684_10420729 | |||
| 2043 | Ga0207707_10018084 | |||
| 2044 | Ga0207707_10093997 | |||
| 2045 | Ga0207695_10000475 | |||
| 2046 | Ga0207695_10001437 | |||
| 2047 | Ga0207695_10020920 | |||
| 2048 | Ga0207695_10022917 | |||
| 2049 | Ga0207695_10040295 | |||
| 2050 | Ga0207695_10146794 | |||
| 2051 | Ga0207695_10424850 | |||
| 2052 | Ga0207671_10020117 | |||
| 2053 | Ga0207671_10049115 | |||
| 2054 | Ga0207662_10042078 | |||
| 2055 | Ga0207662_10210223 | |||
| 2056 | Ga0207657_10000018 | |||
| 2057 | Ga0207657_10003155 | |||
| 2058 | Ga0207657_10053105 | |||
| 2059 | Ga0207657_10099258 | |||
| 2060 | Ga0207657_10174529 | |||
| 2061 | Ga0207657_10209485 | |||
| 2062 | Ga0207649_10021775 | |||
| 2063 | Ga0207652_10240084 | |||
| 2064 | Ga0207646_10140214 | |||
| 2065 | Ga0207681_10007645 | |||
| 2066 | Ga0207681_10092494 | |||
| 2067 | Ga0207681_10115405 | |||
| 2068 | Ga0207681_10192057 | |||
| 2069 | Ga0207694_10009631 | |||
| 2070 | Ga0207694_10010860 | |||
| 2071 | Ga0207694_10136429 | |||
| 2072 | Ga0207694_10152233 | |||
| 2073 | Ga0207650_10001837 | |||
| 2074 | Ga0207650_10003488 | |||
| 2075 | Ga0207650_10003973 | |||
| 2076 | Ga0207650_10004126 | |||
| 2077 | Ga0207650_10014460 | |||
| 2078 | Ga0207650_10015106 | |||
| 2079 | Ga0207650_10112412 | |||
| 2080 | Ga0207650_10119376 | |||
| 2081 | Ga0207659_10001657 | |||
| 2082 | Ga0207659_10010218 | |||
| 2083 | Ga0207659_10030562 | |||
| 2084 | Ga0207659_10038636 | |||
| 2085 | Ga0207659_10251127 | |||
| 2086 | Ga0207664_10214521 | |||
| 2087 | Ga0207644_10247746 | |||
| 2088 | Ga0207644_10266804 | |||
| 2089 | Ga0207690_10000006 | |||
| 2090 | Ga0207690_10011102 | |||
| 2091 | Ga0207690_10204772 | |||
| 2092 | Ga0207706_10024839 | |||
| 2093 | Ga0207706_10035752 | |||
| 2094 | Ga0207706_10044198 | |||
| 2095 | Ga0207686_10009173 | |||
| 2096 | Ga0207686_10025673 | |||
| 2097 | Ga0207686_10030202 | |||
| 2098 | Ga0207686_10246653 | |||
| 2099 | Ga0207709_10000015 | |||
| 2100 | Ga0207709_10103816 | |||
| 2101 | Ga0207709_10140273 | |||
| 2102 | Ga0207669_10003780 | |||
| 2103 | Ga0207669_10031387 | |||
| 2104 | Ga0207669_10071799 | |||
| 2105 | Ga0207665_10058978 | |||
| 2106 | Ga0207691_10000511 | |||
| 2107 | Ga0207691_10000657 | |||
| 2108 | Ga0207691_10012670 | |||
| 2109 | Ga0207691_10122253 | |||
| 2110 | Ga0207691_10387578 | |||
| 2111 | Ga0207711_10066563 | |||
| 2112 | Ga0207711_10195075 | |||
| 2113 | Ga0207711_10269649 | |||
| 2114 | Ga0207711_10286956 | |||
| 2115 | Ga0207689_10005742 | |||
| 2116 | Ga0207689_10029190 | |||
| 2117 | Ga0207661_10011699 | |||
| 2118 | Ga0207661_10061378 | |||
| 2119 | Ga0207679_10008750 | |||
| 2120 | Ga0207679_10036127 | |||
| 2121 | Ga0207679_10168884 | |||
| 2122 | Ga0207667_10000025 | |||
| 2123 | Ga0207667_10061603 | |||
| 2124 | Ga0207667_10069899 | |||
| 2125 | Ga0207667_10078887 | |||
| 2126 | Ga0207667_10108582 | |||
| 2127 | Ga0207667_10178935 | |||
| 2128 | Ga0207667_10184930 | |||
| 2129 | Ga0207667_10205750 | |||
| 2130 | Ga0207667_10239869 | |||
| 2131 | Ga0207651_10019880 | |||
| 2132 | Ga0207651_10025944 | |||
| 2133 | Ga0207651_10053906 | |||
| 2134 | Ga0207651_10101946 | |||
| 2135 | Ga0207651_10147727 | |||
| 2136 | Ga0207651_10268137 | |||
| 2137 | Ga0207668_10010948 | |||
| 2138 | Ga0207668_10144250 | |||
| 2139 | Ga0207640_10079052 | |||
| 2140 | Ga0207658_10037156 | |||
| 2141 | Ga0207658_10166683 | |||
| 2142 | Ga0207677_10008977 | |||
| 2143 | Ga0207677_10021231 | |||
| 2144 | Ga0207677_10027378 | |||
| 2145 | Ga0207703_10039632 | |||
| 2146 | Ga0207703_10087754 | |||
| 2147 | Ga0207639_10333347 | |||
| 2148 | Ga0207639_10448162 | |||
| 2149 | Ga0207678_10001481 | |||
| 2150 | Ga0207678_10006930 | |||
| 2151 | Ga0207678_10146251 | |||
| 2152 | Ga0207678_10146390 | |||
| 2153 | Ga0207708_10021936 | |||
| 2154 | Ga0207708_10270499 | |||
| 2155 | Ga0207702_10001447 | |||
| 2156 | Ga0207702_10167492 | |||
| 2157 | Ga0207702_10189982 | |||
| 2158 | Ga0207641_10003449 | |||
| 2159 | Ga0207641_10008903 | |||
| 2160 | Ga0207648_10004759 | |||
| 2161 | Ga0207648_10009000 | |||
| 2162 | Ga0207648_10012937 | |||
| 2163 | Ga0207648_10027131 | |||
| 2164 | Ga0207648_10032660 | |||
| 2165 | Ga0207648_10066013 | |||
| 2166 | Ga0207648_10202806 | |||
| 2167 | Ga0207676_10004842 | |||
| 2168 | Ga0207676_10008136 | |||
| 2169 | Ga0207676_10016812 | |||
| 2170 | Ga0207676_10023784 | |||
| 2171 | Ga0207676_10101649 | |||
| 2172 | Ga0207676_10192068 | |||
| 2173 | Ga0207676_10235421 | |||
| 2174 | Ga0207674_10009285 | |||
| 2175 | Ga0207674_10014937 | |||
| 2176 | Ga0207674_10038859 | |||
| 2177 | Ga0207675_100003033 | |||
| 2178 | Ga0207675_100016941 | |||
| 2179 | Ga0207675_100024354 | |||
| 2180 | Ga0207675_100111015 | |||
| 2181 | Ga0207675_100212678 | |||
| 2182 | Ga0207683_10001153 | |||
| 2183 | Ga0207683_10004610 | |||
| 2184 | Ga0207683_10008024 | |||
| 2185 | Ga0207683_10026480 | |||
| 2186 | Ga0207698_10018026 | |||
| 2187 | Ga0209281_1000007 | |||
| 2188 | Ga0209281_1003905 | |||
| 2189 | Ga0209371_1000181 | |||
| 2190 | Ga0209371_1006167 | |||
| 2191 | Ga0209371_1014768 | |||
| 2192 | Ga0209969_1002277 | |||
| 2193 | Ga0209967_1002470 | |||
| 2194 | Ga0209996_1000164 | |||
| 2195 | Ga0210000_1003217 | |||
| 2196 | Ga0209995_1001528 | |||
| 2197 | Ga0209995_1003905 | |||
| 2198 | Ga0209968_1000368 | |||
| 2199 | Ga0209999_1011391 | |||
| 2200 | Ga0209282_1000051 | |||
| 2201 | Ga0209971_1002442 | |||
| 2202 | Ga0209971_1008899 | |||
| 2203 | Ga0209966_1000074 | |||
| 2204 | Ga0209998_10004405 | |||
| 2205 | Ga0209813_10018373 | |||
| 2206 | Ga0209974_10025808 | |||
| 2207 | Ga0268266_10076660 | |||
| 2208 | Ga0268265_10019427 | |||
| 2209 | Ga0268265_10028420 | |||
| 2210 | Ga0268265_10029869 | |||
| 2211 | Ga0268264_10001934 | |||
| 2212 | Ga0268264_10118668 | |||
| 2213 | Ga0268264_10251300 | |||
| 2214 | Ga0265336_10000123 | |||
| 2215 | Ga0307515_10000040 | |||
| 2216 | Ga0265338_10105861 | |||
| 2217 | Ga0265338_10315664 | |||
| 2218 | Ga0265324_10000361 | |||
| 2219 | Ga0268256_1000151 | |||
| 2220 | Ga0268256_1006158 | |||
| 2221 | Ga0268256_1014814 | |||
| 2222 | Ga0316180_1046710 | |||
| 2223 | Ga0265330_10000133 | |||
| 2224 | Ga0265332_10000001 | |||
| 2225 | Ga0265332_10000010 | |||
| 2226 | Ga0265332_10001971 | |||
| 2227 | Ga0265328_10016557 | |||
| 2228 | Ga0265329_10033973 | |||
| 2229 | Ga0265340_10002720 | |||
| 2230 | Ga0265331_10000996 | |||
| 2231 | Ga0265316_10008143 | |||
| 2232 | Ga0307513_10097991 | |||
| 2233 | Ga0307513_10298998 | |||
| 2234 | Ga0307509_10012999 | |||
| 2235 | Ga0307408_100000022 | |||
| 2236 | Ga0307408_100000439 | |||
| 2237 | Ga0307408_100001348 | |||
| 2238 | Ga0307408_100014832 | |||
| 2239 | Ga0307408_100031547 | |||
| 2240 | Ga0307408_100268935 | |||
| 2241 | Ga0307408_100372284 | |||
| 2242 | Ga0316575_10000023 | |||
| 2243 | Ga0316575_10000505 | |||
| 2244 | Ga0265314_10000013 | |||
| 2245 | Ga0265314_10001503 | |||
| 2246 | Ga0265342_10039179 | |||
| 2247 | Ga0316576_10053328 | |||
| 2248 | Ga0316578_10002083 | |||
| 2249 | Ga0307516_10162892 | |||
| 2250 | Ga0307405_10001449 | |||
| 2251 | Ga0307405_10011206 | |||
| 2252 | Ga0307405_10133923 | |||
| 2253 | Ga0307405_10161291 | |||
| 2254 | Ga0307405_10427599 | |||
| 2255 | Ga0316577_10149807 | |||
| 2256 | Ga0307413_10010124 | |||
| 2257 | Ga0307410_10003953 | |||
| 2258 | Ga0307410_10008212 | |||
| 2259 | Ga0307410_10014477 | |||
| 2260 | Ga0307406_10006988 | |||
| 2261 | Ga0307406_10010926 | |||
| 2262 | Ga0307406_10014813 | |||
| 2263 | Ga0307406_10047317 | |||
| 2264 | Ga0307406_10080300 | |||
| 2265 | Ga0307406_10146030 | |||
| 2266 | Ga0307407_10008265 | |||
| 2267 | Ga0307407_10011484 | |||
| 2268 | Ga0307407_10175615 | |||
| 2269 | Ga0307412_10000005 | |||
| 2270 | Ga0307412_10006540 | |||
| 2271 | Ga0307412_10013719 | |||
| 2272 | Ga0307412_10045390 | |||
| 2273 | Ga0307412_10096155 | |||
| 2274 | Ga0307409_100001860 | |||
| 2275 | Ga0307409_100006670 | |||
| 2276 | Ga0307409_100133032 | |||
| 2277 | Ga0307409_100158677 | |||
| 2278 | Ga0307409_100248226 | |||
| 2279 | Ga0307416_100001396 | |||
| 2280 | Ga0307416_100018054 | |||
| 2281 | Ga0307416_100122363 | |||
| 2282 | Ga0307416_100189464 | |||
| 2283 | Ga0307414_10007639 | |||
| 2284 | Ga0307414_10033326 | |||
| 2285 | Ga0307411_10015987 | |||
| 2286 | Ga0307411_10145577 | |||
| 2287 | Ga0307411_10415699 | |||
| 2288 | Ga0307415_100007017 | |||
| 2289 | Ga0307415_100031788 | |||
| 2290 | Ga0307510_10007396 | |||
| 2291 | Ga0373934_0021275 | |||
| 2292 | Ga0373952_0002596 | |||
| 2293 | Ga0373952_0005475 | |||
| 2294 | Ga0373939_0021383 | |||
| 2295 | Ga0373954_0000001 | |||
| 2296 | Ga0373956_0025311 | |||
| 2297 | Ga0373955_0110442 | |||
| 2298 | Ga0316574_0002756 | |||
| 2299 | Ga0316574_0037245 | |||
| 2300 | Ga0373924_0011995 | |||
| 2301 | Ga0373931_0010108 | |||
| 2302 | Ga0373931_0062980 | |||
| 2303 | Ga0373927_0040217 | |||
| 2304 | Ga0373927_0229112 | |||
| 2305 | Ga0373933_0009723 | |||
| 2306 | Ga0373933_0053917 | |||
| 2307 | Ga0373937_0002345 | |||
| 2308 | Ga0373937_0082773 | |||
| 2309 | Ga0373937_0157684 | |||
| 2310 | Ga0316582_0015925 | |||
| 2311 | Ga0316584_0015597 | |||
| 2312 | Ga0373925_0194648 | |||
| 2313 | Ga0373925_0226615 | |||
| 2314 | Ga0395899_0014587 | |||
| 2315 | Ga0395899_0027329 | |||
| 2316 | Ga0395899_0029304 | |||
| 2317 | Ga0395899_0078383 | |||
| 2318 | Ga0395899_0123930 | |||
| 2319 | Ga0395900_0000229 | |||
| 2320 | Ga0395900_0005063 | |||
| 2321 | Ga0395900_0005889 | |||
| 2322 | Ga0395900_0069915 | |||
| 2323 | Ga0395900_0076106 | |||
| 2324 | Ga0395900_0147005 | |||
| 2325 | Ga0395898_0055156 | |||
| 2326 | Ga0395898_0101462 | |||
| 2327 | Ga0395898_0103642 | |||
| 2328 | Ga0395898_0140493 | |||
| 2329 | Ga0395898_0244466 | |||
| 2330 | Ga0395898_0254175 | |||
| 2331 | Ga0395905_0000059 | |||
| 2332 | Ga0395905_0001515 | |||
| 2333 | Ga0395905_0002380 | |||
| 2334 | Ga0395905_0004975 | |||
| 2335 | Ga0395905_0026529 | |||
| 2336 | Ga0395905_0027140 | |||
| 2337 | Ga0395905_0045716 | |||
| 2338 | Ga0395905_0060945 | |||
| 2339 | Ga0316581_0000886 | |||
| 2340 | Ga0395901_0003564 | |||
| 2341 | Ga0395901_0013050 | |||
| 2342 | Ga0395901_0018224 | |||
| 2343 | Ga0395901_0042434 | |||
| 2344 | Ga0395901_0209008 | |||
| 2345 | Ga0436360_0690189 | |||
| 2346 | Ga0436361_0039956 | |||
| 2347 | Ga0436361_0577632 | |||
| 2348 | Ga0436361_0590531 | |||
| 2349 | Ga0436361_0616441 | |||
| 2350 | Ga0436361_0878220 | |||
| 2351 | Ga0436361_0926482 | |||
| 2352 | Ga0436361_1094903 | |||
| 2353 | Ga0436361_1150385 | |||
| 2354 | Ga0439436_0021132 | |||
| 2355 | Ga0451797_0462561 | |||
| 2356 | Ga0451807_0693819 | |||
| 2357 | Ga0451853_1690372 | |||
| 2358 | Ga0439443_005113 | |||
| 2359 | Ga0439462_0001510 | |||
| 2360 | Ga0450920_000782 | |||
| 2361 | Ga0450923_004002 | |||
| 2362 | Ga0450923_004577 | |||
| 2363 | Ga0450898_012896 | |||
| 2364 | Ga0439446_0059545 | |||
| 2365 | Ga0450908_000192 | |||
| 2366 | Ga0439434_0010251 | |||
| 2367 | Ga0439434_0059421 | |||
| 2368 | Ga0439435_0000279 | |||
| 2369 | Ga0439444_0003396 | |||
| 2370 | Ga0439459_0001318 | |||
| 2371 | Ga0439460_0020137 | |||
| 2372 | Ga0439460_0054942 | |||
| 2373 | Ga0450918_004421 | |||
| 2374 | Ga0451577_0000002 | |||
| 2375 | Ga0451577_0000152 | |||
| 2376 | Ga0451577_0009047 | |||
| 2377 | Ga0451577_0018493 | |||
| 2378 | Ga0451577_0041881 | |||
| 2379 | Ga0451577_0076722 | |||
| 2380 | Ga0466969_0000147 | |||
| 2381 | Ga0466969_0003356 | |||
| 2382 | Ga0466969_0018747 | |||
| 2383 | Ga0466972_0000181 | |||
| 2384 | Ga0466972_0001865 | |||
| 2385 | Ga0466972_0068264 | |||
| 2386 | Ga0466972_0092114 | |||
| 2387 | Ga0466982_0053105 | |||
| 2388 | Ga0466982_0164584 | |||
| 2389 | Ga0453683_0000003 | |||
| 2390 | Ga0466965_0000486 | |||
| 2391 | Ga0466965_0072608 | |||
| 2392 | Ga0466965_0104281 | |||
| 2393 | Ga0466966_0007276 | |||
| 2394 | Ga0466966_0014215 | |||
| 2395 | Ga0466966_0037337 | |||
| 2396 | Ga0466961_0032784 | |||
| 2397 | Ga0466961_0044854 | |||
| 2398 | Ga0466961_0093369 | |||
| 2399 | Ga0466963_0021413 | |||
| 2400 | Ga0466964_0013417 | |||
| 2401 | Ga0453684_0000002 | |||
| 2402 | Ga0453684_0000029 | |||
| 2403 | Ga0453684_0000122 | |||
| 2404 | Ga0466971_0002862 | |||
| 2405 | Ga0466968_0025979 | |||
| 2406 | Ga0466970_0015077 | |||
| 2407 | Ga0466970_0034730 | |||
| 2408 | Ga0466970_0046760 | |||
| 2409 | Ga0466970_0102714 | |||
| 2410 | Ga0466957_0014789 | |||
| 2411 | Ga0466957_0027037 | |||
| 2412 | Ga0466960_0012884 | |||
| 2413 | Ga0466959_0001734 | |||
| 2414 | Ga0466959_0006971 | |||
| 2415 | Ga0466959_0009426 | |||
| 2416 | Ga0466959_0013918 | |||
| 2417 | Ga0466959_0034741 | |||
| 2418 | Ga0466959_0131437 | |||
| 2419 | Ga0451576_0000004 | |||
| 2420 | Ga0451576_0000937 | |||
| 2421 | Ga0451576_0001995 | |||
| 2422 | Ga0451576_0531785 | |||
| 2423 | Ga0466958_0018038 | |||
| 2424 | Ga0466958_0076484 | |||
| 2425 | Ga0466958_0138858 | |||
| 2426 | Ga0466967_0018215 | |||
| 2427 | Ga0495617_003418 | |||
| 2428 | Ga0495627_000005 | |||
| 2429 | Ga0495627_000008 | |||
| 2430 | Ga0495592_0035366 | |||
| 2431 | Ga0495603_0004454 | |||
| 2432 | Ga0495590_0000006 | |||
| 2433 | Ga0495591_009140 | |||
| 2434 | Ga0495629_0004774 | |||
| 2435 | Ga0495629_0008044 | |||
| 2436 | Ga0495629_0048051 | |||
| 2437 | Ga0495638_0000891 | |||
| 2438 | Ga0495638_0075921 | |||
| 2439 | Ga0495651_0118772 | |||
| 2440 | Ga0495651_0139087 | |||
| 2441 | Ga0495651_0146938 | |||
| 2442 | Ga0495653_0005110 | |||
| 2443 | Ga0495653_0048194 | |||
| 2444 | Ga0495653_0053553 | |||
| 2445 | Ga0495653_0093258 | |||
| 2446 | Ga0495653_0130559 | |||
| 2447 | Ga0495650_0000042 | |||
| 2448 | Ga0495650_0001355 | |||
| 2449 | Ga0495650_0001969 | |||
| 2450 | Ga0495650_0018615 | |||
| 2451 | Ga0495580_0001332 | |||
| 2452 | Ga0495580_0001735 | |||
| 2453 | Ga0495580_0002424 | |||
| 2454 | Ga0495580_0006696 | |||
| 2455 | Ga0495580_0009620 | |||
| 2456 | Ga0495580_0044936 | |||
| 2457 | Ga0495580_0092583 | |||
| 2458 | Ga0495580_0099819 | |||
| 2459 | Ga0495580_0130771 | |||
| 2460 | Ga0495582_0002157 | |||
| 2461 | Ga0495582_0039323 | |||
| 2462 | Ga0495582_0094002 | |||
| 2463 | Ga0495605_0004289 | |||
| 2464 | Ga0495605_0008150 | |||
| 2465 | Ga0495605_0013495 | |||
| 2466 | Ga0495605_0025104 | |||
| 2467 | Ga0495662_0021575 | |||
| 2468 | Ga0495664_0001925 | |||
| 2469 | Ga0495664_0002295 | |||
| 2470 | Ga0495664_0087473 | |||
| 2471 | Ga0495585_0009165 | |||
| 2472 | Ga0495594_0043606 | |||
| 2473 | Ga0495596_0001853 | |||
| 2474 | Ga0495596_0005945 | |||
| 2475 | Ga0495596_0031217 | |||
| 2476 | Ga0495596_0032079 | |||
| 2477 | Ga0495607_0004242 | |||
| 2478 | Ga0495607_0016789 | |||
| 2479 | Ga0495607_0048930 | |||
| 2480 | Ga0495583_0000046 | |||
| 2481 | Ga0495583_0000199 | |||
| 2482 | Ga0495583_0001566 | |||
| 2483 | Ga0495583_0007029 | |||
| 2484 | Ga0495583_0013937 | |||
| 2485 | Ga0495583_0030561 | |||
| 2486 | Ga0495606_0001300 | |||
| 2487 | Ga0495606_0013495 | |||
| 2488 | Ga0495606_0017051 | |||
| 2489 | Ga0495606_0023111 | |||
| 2490 | Ga0495606_0038631 | |||
| 2491 | Ga0495608_0004149 | |||
| 2492 | Ga0495608_0014134 | |||
| 2493 | Ga0495608_0018660 | |||
| 2494 | Ga0495608_0047765 | |||
| 2495 | Ga0495608_0146859 | |||
| 2496 | Ga0495610_0000965 | |||
| 2497 | Ga0495610_0015349 | |||
| 2498 | Ga0495610_0026492 | |||
| 2499 | Ga0495610_0076293 | |||
| 2500 | Ga0495616_0000277 | |||
| 2501 | Ga0495616_0000591 | |||
| 2502 | Ga0495616_0020712 | |||
| 2503 | Ga0495618_0009318 | |||
| 2504 | Ga0495618_0010152 | |||
| 2505 | Ga0495618_0030402 | |||
| 2506 | Ga0495628_0000146 | |||
| 2507 | Ga0495628_0003520 | |||
| 2508 | Ga0495628_0007838 | |||
| 2509 | Ga0495628_0020360 | |||
| 2510 | Ga0495628_0167092 | |||
| 2511 | Ga0495630_0035764 | |||
| 2512 | Ga0495630_0117817 | |||
| 2513 | Ga0495630_0135315 | |||
| 2514 | Ga0495630_0191297 | |||
| 2515 | Ga0495631_0020358 | |||
| 2516 | Ga0495632_0026742 | |||
| 2517 | Ga0495637_0000056 | |||
| 2518 | Ga0495637_0014948 | |||
| 2519 | Ga0495643_0000338 | |||
| 2520 | Ga0495643_0003899 | |||
| 2521 | Ga0495643_0046323 | |||
| 2522 | Ga0495648_0000061 | |||
| 2523 | Ga0495648_0006586 | |||
| 2524 | Ga0495648_0033963 | |||
| 2525 | Ga0495648_0034382 | |||
| 2526 | Ga0495648_0043479 | |||
| 2527 | Ga0495663_0005509 | |||
| 2528 | Ga0495666_0001948 | |||
| 2529 | Ga0495666_0002505 | |||
| 2530 | Ga0495666_0004887 | |||
| 2531 | Ga0495666_0009093 | |||
| 2532 | Ga0495666_0019313 | |||
| 2533 | Ga0495642_0038142 | |||
| 2534 | Ga0495652_0003179 | |||
| 2535 | Ga0495652_0005145 | |||
| 2536 | Ga0495654_0000002 | |||
| 2537 | Ga0495665_0006633 | |||
| 2538 | Ga0495665_0007109 | |||
| 2539 | Ga0495665_0021549 | |||
| 2540 | Ga0495665_0025980 | |||
| 2541 | Ga0495665_0044296 | |||
| 2542 | Ga0495665_0066826 | |||
| 2543 | Ga0495665_0088612 | |||
| 2544 | Ga0495640_0039067 | |||
| 2545 | Ga0495640_0053364 | |||
| 2546 | Ga0495586_0015604 | |||
| 2547 | Ga0495586_0024691 | |||
| 2548 | Ga0495586_0051886 | |||
| 2549 | Ga0495587_0009070 | |||
| 2550 | Ga0495587_0009851 | |||
| 2551 | Ga0495609_0000068 | |||
| 2552 | Ga0495609_0006564 | |||
| 2553 | Ga0495609_0006753 | |||
| 2554 | Ga0495609_0008300 | |||
| 2555 | Ga0495609_0014009 | |||
| 2556 | Ga0495597_0003195 | |||
| 2557 | Ga0495597_0037407 | |||
| 2558 | Ga0495597_0042258 | |||
| 2559 | Ga0495645_0002615 | |||
| 2560 | Ga0495645_0085294 | |||
| 2561 | Ga0495622_0000103 | |||
| 2562 | Ga0495622_0000302 | |||
| 2563 | Ga0495622_0015026 | |||
| 2564 | Ga0495633_0000098 | |||
| 2565 | Ga0495633_0007613 | |||
| 2566 | Ga0495668_0001564 | |||
| 2567 | Ga0495668_0056124 | |||
| 2568 | Ga0495668_0059443 | |||
| 2569 | Ga0495634_0020033 | |||
| 2570 | Ga0495634_0031484 | |||
| 2571 | Ga0495634_0046473 | |||
| 2572 | Ga0495611_0003553 | |||
| 2573 | Ga0495625_0001274 | |||
| 2574 | Ga0495625_0001560 | |||
| 2575 | Ga0495625_0004014 | |||
| 2576 | Ga0495625_0023355 | |||
| 2577 | Ga0495625_0045383 | |||
| 2578 | Ga0495635_0013156 | |||
| 2579 | Ga0495635_0033384 | |||
| 2580 | Ga0495661_0000214 | |||
| 2581 | Ga0495661_0003694 | |||
| 2582 | Ga0495661_0006774 | |||
| 2583 | Ga0495661_0027992 | |||
| 2584 | Ga0495661_0114645 | |||
| 2585 | Ga0495588_0011122 | |||
| 2586 | Ga0495657_0099532 | |||
| 2587 | Ga0495657_0172549 | |||
| 2588 | Ga0495599_0010704 | |||
| 2589 | Ga0495599_0031631 | |||
| 2590 | Ga0495599_0061717 | |||
| 2591 | Ga0495599_0150574 | |||
| 2592 | Ga0495623_0007478 | |||
| 2593 | Ga0495623_0011348 | |||
| 2594 | Ga0495623_0020400 | |||
| 2595 | Ga0495623_0050894 | |||
| 2596 | Ga0495623_0083931 | |||
| 2597 | Ga0495646_0001277 | |||
| 2598 | Ga0495646_0005738 | |||
| 2599 | Ga0495646_0040548 | |||
| 2600 | Ga0495646_0043769 | |||
| 2601 | Ga0495646_0078754 | |||
| 2602 | Ga0495669_0011616 | |||
| 2603 | Ga0495669_0018504 | |||
| 2604 | Ga0495613_0002040 | |||
| 2605 | Ga0495613_0052155 | |||
| 2606 | Ga0495613_0059926 | |||
| 2607 | Ga0495624_0014397 | |||
| 2608 | Ga0495624_0037912 | |||
| 2609 | Ga0495624_0081590 | |||
| 2610 | Ga0495624_0091403 | |||
| 2611 | Ga0495670_0032851 | |||
| 2612 | Ga0495671_0009461 | |||
| 2613 | Ga0495671_0014203 | |||
| 2614 | Ga0495649_0011940 | |||
| 2615 | Ga0495589_0000084 | |||
| 2616 | Ga0495589_0002030 | |||
| 2617 | Ga0495589_0002384 | |||
| 2618 | Ga0495600_0006104 | |||
| 2619 | Ga0495600_0008025 | |||
| 2620 | Ga0495600_0012775 | |||
| 2621 | Ga0495600_0012928 | |||
| 2622 | Ga0495660_0005264 | |||
| 2623 | Ga0495660_0067480 | |||
| 2624 | Ga0495660_0072803 | |||
| 2625 | Ga0495581_0001458 | |||
| 2626 | Ga0495581_0014511 | |||
| 2627 | Ga0495581_0018211 | |||
| 2628 | Ga0495581_0080012 | |||
| 2629 | Ga0495604_0005561 | |||
| 2630 | Ga0495604_0046411 | |||
| 2631 | Ga0495604_0155460 | |||
| 2632 | Ga0495636_0007671 | |||
| 2633 | Ga0495636_0007946 | |||
| 2634 | Ga0495636_0037307 | |||
| 2635 | Ga0495636_0059039 | |||
| 2636 | Ga0495674_0010002 | |||
| 2637 | Ga0495674_0016573 | |||
| 2638 | Ga0495674_0018299 | |||
| 2639 | Ga0495674_0085689 | |||
| 2640 | Ga0495674_0117115 | |||
| 2641 | Ga0495672_0036633 | |||
| 2642 | Ga0495672_0101083 | |||
| 2643 | Ga0495676_0020148 | |||
| 2644 | Ga0495676_0020359 | |||
| 2645 | Ga0495676_0027276 | |||
| 2646 | Ga0495676_0059585 | |||
| 2647 | Ga0495680_0003442 | |||
| 2648 | Ga0495680_0013228 | |||
| 2649 | Ga0495680_0255151 | |||
| 2650 | Ga0495683_0002960 | |||
| 2651 | Ga0495683_0011838 | |||
| 2652 | Ga0495683_0040443 | |||
| 2653 | Ga0495687_000101 | |||
| 2654 | Ga0495687_001048 | |||
| 2655 | Ga0495687_001664 | |||
| 2656 | Ga0495687_007657 | |||
| 2657 | Ga0495687_043985 | |||
| 2658 | Ga0495675_0010019 | |||
| 2659 | Ga0495677_0000015 | |||
| 2660 | Ga0495677_0095293 | |||
| 2661 | Ga0495679_000050 | |||
| 2662 | Ga0495679_008460 | |||
| 2663 | Ga0495679_010252 | |||
| 2664 | Ga0495673_0000028 | |||
| 2665 | Ga0495673_0002276 | |||
| 2666 | Ga0495673_0006233 | |||
| 2667 | Ga0495673_0006821 | |||
| 2668 | Ga0495681_0010670 | |||
| 2669 | Ga0495681_0082456 | |||
| 2670 | Ga0495684_0013586 | |||
| 2671 | Ga0495684_0031309 | |||
| 2672 | Ga0495684_0041628 | |||
| 2673 | Ga0495593_0005298 | |||
| 2674 | Ga0495593_0026344 | |||
| 2675 | Ga0495593_0029599 | |||
| 2676 | Ga0495593_0041678 | |||
| 2677 | Ga0495593_0054424 | |||
| 2678 | Ga0495602_0008243 | |||
| 2679 | Ga0495602_0013381 | |||
| 2680 | Ga0495602_0049125 | |||
| 2681 | Ga0495602_0112887 | |||
| 2682 | Ga0495614_0002084 | |||
| 2683 | Ga0495614_0005686 | |||
| 2684 | Ga0495626_0000554 | |||
| 2685 | Ga0495626_0013103 | |||
| 2686 | Ga0495626_0013780 | |||
| 2687 | Ga0495626_0023087 | |||
| 2688 | Ga0496101_0001774 | |||
| 2689 | Ga0496101_0013735 | |||
| 2690 | Ga0496101_0068731 | |||
| 2691 | Ga0496102_0015155 | |||
| 2692 | Ga0496102_0027585 | |||
| 2693 | Ga0496102_0150426 | |||
| 2694 | Ga0496103_0001531 | |||
| 2695 | Ga0496103_0017920 | |||
| 2696 | Ga0496103_0040340 | |||
| 2697 | Ga0496103_0059130 | |||
| 2698 | Ga0496103_0078080 | |||
| 2699 | Ga0496104_0008340 | |||
| 2700 | Ga0496104_0154488 | |||
| 2701 | Ga0496105_0006468 | |||
| 2702 | Ga0496105_0086963 | |||
| 2703 | Ga0496106_0000060 | |||
| 2704 | Ga0496106_0018163 | |||
| 2705 | Ga0496108_0110982 | |||
| 2706 | Ga0496108_0149414 | |||
| 2707 | Ga0496109_0073754 | |||
| 2708 | Ga0496109_0119688 | |||
| 2709 | Ga0496109_0138323 | |||
| 2710 | Ga0496110_0079512 | |||
| 2711 | Ga0496110_0328850 | |||
| 2712 | Ga0496110_0368185 | |||
| 2713 | Ga0496111_0023507 | |||
| 2714 | Ga0496111_0125635 | |||
| 2715 | Ga0496111_0244666 | |||
| 2716 | Ga0496112_0123209 | |||
| 2717 | Ga0496112_0372368 | |||
| 2718 | Ga0496113_0170575 | |||
| 2719 | Ga0496113_0437237 | |||
| 2720 | Ga0496114_0038689 | |||
| 2721 | Ga0496115_0398832 | |||
| 2722 | Ga0496116_0009120 | |||
| 2723 | Ga0496116_0010428 | |||
| 2724 | Ga0496116_0027827 | |||
| 2725 | Ga0496116_0043395 | |||
| 2726 | Ga0496117_0004030 | |||
| 2727 | Ga0496117_0012277 | |||
| 2728 | Ga0496117_0076429 | |||
| 2729 | Ga0496117_0099534 | |||
| 2730 | Ga0496117_0112716 | |||
| 2731 | Ga0496118_0001261 | |||
| 2732 | Ga0496118_0006078 | |||
| 2733 | Ga0496118_0009303 | |||
| 2734 | Ga0496118_0009322 | |||
| 2735 | Ga0496118_0120350 | |||
| 2736 | Ga0496121_0000102 | |||
| 2737 | Ga0496121_0006822 | |||
| 2738 | Ga0496121_0007246 | |||
| 2739 | Ga0496121_0013190 | |||
| 2740 | Ga0496121_0021224 | |||
| 2741 | Ga0496121_0033960 | |||
| 2742 | Ga0496121_0036277 | |||
| 2743 | Ga0496122_0002281 | |||
| 2744 | Ga0496123_0000197 | |||
| 2745 | Ga0496123_0008020 | |||
| 2746 | Ga0496124_0194365 | |||
| 2747 | Ga0496124_0195598 | |||
| 2748 | Ga0496125_0000983 | |||
| 2749 | Ga0496125_0004366 | |||
| 2750 | Ga0496126_0001236 | |||
| 2751 | Ga0496126_0004718 | |||
| 2752 | Ga0496126_0047016 | |||
| 2753 | Ga0495678_000006 | |||
| 2754 | Ga0495678_009322 | |||
| 2755 | Ga0501315_013242 | |||
| 2756 | Ga0501031_0000636 | |||
| 2757 | Ga0501031_0013813 | |||
| 2758 | Ga0501031_0038223 | |||
| 2759 | Ga0501031_0085123 | |||
| 2760 | Ga0501032_0000783 | |||
| 2761 | Ga0501032_0007662 | |||
| 2762 | Ga0501032_0009141 | |||
| 2763 | Ga0501032_0134993 | |||
| 2764 | Ga0501032_0141194 | |||
| 2765 | Ga0501033_0001537 | |||
| 2766 | Ga0501033_0013469 | |||
| 2767 | Ga0501034_0000280 | |||
| 2768 | Ga0501034_0010044 | |||
| 2769 | Ga0501034_0025314 | |||
| 2770 | Ga0501034_0185152 | |||
| 2771 | Ga0501036_0001069 | |||
| 2772 | Ga0501036_0022159 | |||
| 2773 | Ga0501036_0024220 | |||
| 2774 | Ga0501036_0107556 | |||
| 2775 | Ga0501037_0000440 | |||
| 2776 | Ga0501037_0015454 | |||
| 2777 | Ga0501037_0039408 | |||
| 2778 | Ga0501037_0072179 | |||
| 2779 | Ga0501038_0000396 | |||
| 2780 | Ga0501038_0002694 | |||
| 2781 | Ga0501038_0023085 | |||
| 2782 | Ga0501038_0107968 | |||
| 2783 | Ga0501039_0000504 | |||
| 2784 | Ga0501039_0002363 | |||
| 2785 | Ga0501039_0012456 | |||
| 2786 | Ga0501039_0019428 | |||
| 2787 | Ga0501039_0043108 | |||
| 2788 | Ga0501039_0256211 | |||
| 2789 | Ga0501040_0000263 | |||
| 2790 | Ga0501040_0007613 | |||
| 2791 | Ga0501040_0203508 | |||
| 2792 | Ga0501041_0000044 | |||
| 2793 | Ga0501041_0117643 | |||
| 2794 | Ga0501042_0000486 | |||
| 2795 | Ga0501042_0002115 | |||
| 2796 | Ga0501042_0018653 | |||
| 2797 | Ga0501042_0258717 | |||
| 2798 | Ga0501042_0303729 | |||
| 2799 | Ga0501043_0006041 | |||
| 2800 | Ga0501043_0019037 | |||
| 2801 | Ga0501043_0092968 | |||
| 2802 | Ga0501043_0243992 | |||
| 2803 | Ga0501046_0000656 | |||
| 2804 | Ga0501046_0005246 | |||
| 2805 | Ga0501046_0005612 | |||
| 2806 | Ga0501046_0044933 | |||
| 2807 | Ga0501046_0046771 | |||
| 2808 | Ga0501047_0005610 | |||
| 2809 | Ga0501047_0006804 | |||
| 2810 | Ga0501047_0037594 | |||
| 2811 | Ga0501047_0211836 | |||
| 2812 | Ga0501047_0233954 | |||
| 2813 | Ga0501048_0001832 | |||
| 2814 | Ga0501048_0042583 | |||
| 2815 | Ga0501068_0000515 | |||
| 2816 | Ga0501068_0001598 | |||
| 2817 | Ga0501070_0001279 | |||
| 2818 | Ga0501070_0006977 | |||
| 2819 | Ga0501070_0084021 | |||
| 2820 | Ga0501070_0117447 | |||
| 2821 | Ga0501070_0120325 | |||
| 2822 | Ga0501071_0001606 | |||
| 2823 | Ga0501071_0059290 | |||
| 2824 | Ga0501072_0004090 | |||
| 2825 | Ga0501072_0016016 | |||
| 2826 | Ga0501073_0000882 | |||
| 2827 | Ga0501073_0053360 | |||
| 2828 | Ga0501073_0119943 | |||
| 2829 | Ga0501074_0000309 | |||
| 2830 | Ga0501074_0000689 | |||
| 2831 | Ga0501074_0001854 | |||
| 2832 | Ga0501074_0148904 | |||
| 2833 | Ga0501075_0000475 | |||
| 2834 | Ga0501076_0000508 | |||
| 2835 | Ga0501076_0127867 | |||
| 2836 | Ga0501077_0001283 | |||
| 2837 | Ga0501198_000102 | |||
| 2838 | Ga0501222_000008 | |||
| 2839 | Ga0501249_017453 | |||
| 2840 | Ga0501079_0000184 | |||
| 2841 | Ga0501079_0006365 | |||
| 2842 | Ga0501080_0001544 | |||
| 2843 | Ga0501080_0076598 | |||
| 2844 | Ga0501080_0241807 | |||
| 2845 | Ga0501081_0000384 | |||
| 2846 | Ga0501081_0054526 | |||
| 2847 | Ga0501266_001480 | |||
| 2848 | Ga0501268_009940 | |||
| 2849 | Ga0501269_000336 | |||
| 2850 | Ga0501035_0000180 | |||
| 2851 | Ga0501035_0000813 | |||
| 2852 | Ga0501035_0018177 | |||
| 2853 | Ga0501035_0019942 | |||
| 2854 | Ga0501035_0103895 | |||
| 2855 | Ga0501044_0000524 | |||
| 2856 | Ga0501044_0033216 | |||
| 2857 | Ga0501044_0054882 | |||
| 2858 | Ga0501044_0099157 | |||
| 2859 | Ga0501045_0000247 | |||
| 2860 | Ga0501045_0000572 | |||
| 2861 | Ga0501045_0011965 | |||
| 2862 | Ga0501045_0031742 | |||
| 2863 | nmdc:mga03683_19887_c1 | |||
| 2864 | nmdc:mga03683_36081_c1 | |||
| 2865 | nmdc:mga0k408_123335_c1 | |||
| 2866 | nmdc:mga0k408_134_c1 | |||
| 2867 | nmdc:mga0k408_16168_c1 | |||
| 2868 | nmdc:mga0k408_16620_c1 | |||
| 2869 | nmdc:mga0k408_173971_c1 | |||
| 2870 | nmdc:mga0k408_2894_c1 | |||
| 2871 | nmdc:mga0k408_40340_c1 | |||
| 2872 | nmdc:mga0k408_41026_c1 | |||
| 2873 | nmdc:mga0k408_48608_c1 | |||
| 2874 | nmdc:mga0k408_6019_c1 | |||
| 2875 | nmdc:mga0k408_64802_c1 | |||
| 2876 | nmdc:mga0k408_9772_c1 | |||
| 2877 | nmdc:mga07m45_11022_c1 | |||
| 2878 | nmdc:mga07m45_17248_c1 | |||
| 2879 | nmdc:mga07m45_178022_c1 | |||
| 2880 | nmdc:mga07m45_3410_c1 | |||
| 2881 | nmdc:mga07m45_7383_c1 | |||
| 2882 | nmdc:mga09592_1507_c1 | |||
| 2883 | nmdc:mga09592_23134_c1 | |||
| 2884 | nmdc:mga0qj67_10463_c1 | |||
| 2885 | nmdc:mga0qj67_42320_c1 | |||
| 2886 | nmdc:mga06r32_21676_c1 | |||
| 2887 | nmdc:mga0n895_13637_c1 | |||
| 2888 | nmdc:mga0n895_612_c1 | |||
| 2889 | nmdc:mga0rr50_1855_c1 | |||
| 2890 | nmdc:mga0rr50_311602_c1 | |||
| 2891 | nmdc:mga0rr50_454697_c1 | |||
| 2892 | nmdc:mga08x19_115267_c1 | |||
| 2893 | nmdc:mga08x19_1378_c1 | |||
| 2894 | nmdc:mga0a205_106525_c1 | |||
| 2895 | nmdc:mga0a205_132165_c1 | |||
| 2896 | nmdc:mga0a205_77741_c1 | |||
| 2897 | nmdc:mga0sz30_27896_c1 | |||
| 2898 | nmdc:mga0sz30_28850_c1 | |||
| 2899 | Ga0495601_0004489 | |||
| 2900 | Ga0500594_0009231 | |||
| 2901 | Ga0500618_000621 | |||
| 2902 | Ga0500658_0004584 | |||
| 2903 | Ga0500619_037639 | |||
| 2904 | Ga0501084_0000800 | |||
| 2905 | Ga0501084_0074382 | |||
| 2906 | Ga0587070_017221 | |||
| 2907 | Ga0587083_0033968 | |||
| 2908 | Ga0587088_003967 | |||
| 2909 | Ga0587111_0014305 | |||
| 2910 | Ga0501082_0027573 | |||
| 2911 | Ga0501082_0033601 | |||
| 2912 | Ga0501082_0130558 | |||
| 2913 | Ga0466962_0006893 | |||
| 2914 | Ga0466962_0055701 | |||
| 2915 | Ga0466962_0071259 | |||
| 2916 | Ga0466962_0099246 | |||
| 2917 | Ga0530510_0000383 | |||
| 2918 | 2509127558 | |||
| 2919 | 2510250266 | |||
| 2920 | 2511250623 | |||
| 2921 | 2512347785 | |||
| 2922 | 2513953255 | |||
| 2923 | 2513960367 | |||
| 2924 | 2514042216 | |||
| 2925 | 2514053979 | |||
| 2926 | 2515679175 | |||
| 2927 | 2519458098 | |||
| 2928 | 2527076927 | |||
| 2929 | 2548847322 | |||
| 2930 | 2550693906 | |||
| 2931 | 2563059424 | |||
| 2932 | 2585294386 | |||
| 2933 | 2599739391 | |||
| 2934 | 2599742664 | |||
| 2935 | 2600204782 | |||
| 2936 | 2644027623 | |||
| 2937 | 2676741770 | |||
| 2938 | 2713479636 | |||
| 2939 | 2719639418 | |||
| 2940 | 2738819826 | |||
| 2941 | 2738832306 | |||
| 2942 | 2738873833 | |||
| 2943 | 2739185463 | |||
| 2944 | 2739220431 | |||
| 2945 | 2739612033 | |||
| 2946 | 2746092020 | |||
| 2947 | 2746099883 | |||
| 2948 | 2753571306 | |||
| 2949 | 2765568984 | |||
| 2950 | 2792838654 | |||
| 2951 | 2808984504 | |||
| 2952 | 2809131231 | |||
| 2953 | 2809150433 | |||
| 2954 | 2817260253 | |||
| 2955 | 2817277938 | |||
| 2956 | 2817451108 | |||
| 2957 | 2819545246 | |||
| 2958 | 2819591158 | |||
| 2959 | 2819622039 | |||
| 2960 | 2819632776 | |||
| 2961 | 2831870099 | |||
| 2962 | 2839096132 | |||
| 2963 | 2842330201 | |||
| 2964 | 2842356756 | |||
| 2965 | 2842457785 | |||
| 2966 | 2842721485 | |||
| 2967 | 2852621948 | |||
| 2968 | 2855735821 | |||
| 2969 | 2855772759 | |||
| 2970 | 2857576489 | |||
| 2971 | 2858691751 | |||
| 2972 | 2863421790 | |||
| 2973 | 2870072269 | |||
| 2974 | 2881930140 | |||
| 2975 | 2884812274 | |||
| 2976 | 2884836881 | |||
| 2977 | 2884853172 | |||
| 2978 | 2885272175 | |||
| 2979 | 2886849652 | |||
| 2980 | 2894024230 | |||
| 2981 | 2895516099 | |||
| 2982 | 2896155710 | |||
| 2983 | 2900635882 | |||
| 2984 | 2902683185 | |||
| 2985 | 2904484246 | |||
| 2986 | 2904618162 | |||
| 2987 | 2919530188 | |||
| 2988 | 2921649876 | |||
| 2989 | 2928109945 | |||
| 2990 | 2928131032 | |||
| 2991 | 2928136600 | |||
| 2992 | 2928159633 | |||
| 2993 | 2928164307 | |||
| 2994 | 2928173110 | |||
| 2995 | 2928509019 | |||
| 2996 | 2945935813 | |||
| 2997 | 2974322413 | |||
| 2998 | 2981994073 | |||
| 2999 | 2990710276 | |||
| 3000 | 642422800 | |||
| 3001 | 642415505 | |||
| 3002 | 642592398 | |||
| 3003 | 642620598 | |||
| 3004 | 644747057 | |||
| 3005 | 8018848227 | |||
| 3006 | 8020809291 | |||
| 3007 | 8020944638 | |||
| 3008 | 8020947380 | |||
| 3009 | 8020959719 | |||
| 3010 | 8021122667 | |||
| 3011 | 8039099429 | |||
| 3012 | 8040170555 | |||
| 3013 | 8040175454 | |||
| 3014 | 8055227234 | |||
| 3015 | 8055266432 | |||
| 3016 | 8055304951 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5u63-assembly1.cif.gz_A | crystal structure of putative thioredoxin reductase from haemophilus influenzae | 0.9823 | 5 | 317 |
| 1f6m-assembly1.cif.gz_A | crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+ | 0.9776 | 5 | 321 |
| 5vt3-assembly1.cif.gz_A | high resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with nadp and fad | 0.9766 | 7 | 318 |
| 5u63-assembly1.cif.gz_A | crystal structure of putative thioredoxin reductase from haemophilus influenzae | 0.9731 | 5 | 317 |
| 5vt3-assembly1.cif.gz_A | high resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with nadp and fad | 0.9704 | 7 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5u63A02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.993 | 120 | 246 | 3.50.50.60 |
| 5u63A02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9853 | 120 | 246 | 3.50.50.60 |
| af_P0A9P4_2_316_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9812 | 5 | 316 | 3.50.50.60 |
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9695 | 120 | 246 | 3.50.50.60 |
| af_P0A9P4_2_316_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9689 | 5 | 316 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6X486-F1-model_v4 | deleted | 0.9849 | 111 | 243 |
|
| AF-A0A353D0T2-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9792 | 4 | 116 |
GO:0016491
|
| AF-A0A520GV49-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9765 | 4 | 110 |
GO:0016491
|
| AF-A0A7C5PUW0-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9735 | 5 | 213 |
GO:0016668
|
| AF-A0A6M1HRK1-F1-model_v4 | deleted | 0.9729 | 173 | 322 |
|