F494436
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1505 | 562 | 1425 | 480 |
Family's Representative Sequence
| Representative Sequence | 3300047446|Ga0495679_000022|Ga0495679_000022_40218_41624 |
| Length | 456 |
| Sequence | MRIGGEKITHTEIIEVFNPYTRELVGTVPKATVDDVRHAFEYAHAYRARLTRYERAQILRRAADIVRERTAEIADLITAESGLCKKDSLYEAGRVSDVLVFGANEALKDDGQVFSCDLTPHGKQRRVYTQREPLLGVICAITPFNHPMNQVAHKIVPSIATNNRIVVKPSEKVPLSTCLLADILYSAGLPPQLLQVVTGDPKDIADELITNRHVDLITFTGGVAIGKYIANKMGYRRAVLELGGNDPIIVMEDADLDEASTLAVSGSYKNSGQRCTAIKRMLVHEAVADRFVELLVEKTRAIRYGDPADPATDMGTVIDEDAAKFFEAQVNDAVSRGAKLLVGNVRRGALYSPTVVDRVTPDMPLVRYETFGPVIRISNSTDYGLSSSVCTNRLDYITRFIAELEVGSVNVREVPGYRLELTPFGGIKDSGLGYKEGVQEAIKSFTNVKTYSLPWQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 5 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 6 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 7 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 8 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 9 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 10 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 11 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 12 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 13 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 14 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 15 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 16 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 17 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 18 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 19 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 20 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 21 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 22 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 23 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 24 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 25 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 26 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 27 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 28 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 29 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 30 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 31 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 32 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 33 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 34 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 35 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 36 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 37 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 38 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 39 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 40 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 41 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 42 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 43 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 44 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 45 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 46 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 47 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 48 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 49 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 50 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 51 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 52 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 53 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 54 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 55 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 56 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 57 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 58 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 59 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 60 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 61 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 62 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 63 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 64 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 65 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 66 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 67 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 68 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 69 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 70 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 71 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 72 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 73 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 74 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 75 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 76 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 77 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 78 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 79 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 83 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 89 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 91 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 92 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 94 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 95 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 97 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 98 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 99 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 100 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 101 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 102 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 103 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 104 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 108 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 111 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 114 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 116 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 127 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 143 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 144 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 145 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 146 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 149 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 150 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 153 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 157 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 158 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 160 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 161 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 162 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 164 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 165 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 166 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 167 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 168 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 169 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 170 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 171 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 172 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 173 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 174 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 175 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 177 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 178 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 179 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 180 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 181 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 182 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 184 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 185 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 186 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 187 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 188 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 189 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 190 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 191 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 193 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 194 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 195 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 196 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 207 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 209 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 221 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 225 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 226 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 227 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 229 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 230 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 240 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 241 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 242 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 245 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 246 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 248 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 250 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 252 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 255 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 258 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 322 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 333 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 337 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 338 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 339 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 340 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 341 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 342 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 343 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 344 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 345 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 346 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 347 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 348 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 349 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 350 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 351 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 352 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 353 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 354 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 355 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 356 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 357 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 358 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 359 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 360 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 361 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 362 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 363 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 364 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 365 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 366 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 367 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 368 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 369 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 370 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 371 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 372 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 373 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 374 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 375 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 376 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 377 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 378 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 379 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 380 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 381 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 382 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 383 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 384 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 385 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 386 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 387 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 388 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 389 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 390 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 391 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 392 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 393 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 394 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 395 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 461 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 462 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 463 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 464 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 465 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 466 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 467 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 468 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 469 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 470 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 471 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 472 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 473 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 474 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 475 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 476 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 477 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 478 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 479 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 480 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 481 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 482 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 512 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 513 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 514 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 515 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 516 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 525 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 526 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 527 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 528 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 529 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 530 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 531 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 532 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 533 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 534 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 535 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 536 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 537 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 538 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 539 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 540 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 541 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 542 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 543 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 544 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 545 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 546 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 547 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 548 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 549 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 551 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 552 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 554 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 555 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 556 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 557 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 558 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 559 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 560 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 561 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 562 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.68 |
| Metatranscriptomes | 0 |
| Isolates | 5.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.76 |
| Nodule | 0.93 |
| Rhizoplane | 3.85 |
| Rhizosphere | 77.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013044 | 3300001979 | Bacteria | 3116 |
| 2 | JGI24739J22299_10002041 | 3300001989 | Bacteria | 7737 |
| 3 | JGI24739J22299_10005780 | 3300001989 | Bacteria | 4687 |
| 4 | JGI24739J22299_10008446 | 3300001989 | Bacteria | 3846 |
| 5 | JGI24743J22301_10005128 | 3300001991 | Bacteria | 2173 |
| 6 | JGI24742J22300_10004324 | 3300002244 | Bacteria | 2321 |
| 7 | JGI25155J39150_1000121 | 3300002704 | Bacteria | 38491 |
| 8 | JGI25156J39149_1000100 | 3300002705 | Bacteria | 63565 |
| 9 | JGI25156J39149_1001101 | 3300002705 | Bacteria | 12310 |
| 10 | JGI25162J39368_1000040 | 3300002737 | Bacteria | 175938 |
| 11 | JGI25154J39366_1000121 | 3300002738 | Bacteria | 62887 |
| 12 | JGI25157J39369_1000130 | 3300002741 | Bacteria | 63360 |
| 13 | JGI25152J39213_1000666 | 3300002773 | Bacteria | 17941 |
| 14 | JGI25150J39212_1004092 | 3300002774 | Bacteria | 3295 |
| 15 | JGI25159J45721_1000190 | 3300002987 | Bacteria | 28606 |
| 16 | JGI25159J45721_1002388 | 3300002987 | Bacteria | 7155 |
| 17 | JGI25159J45721_1002971 | 3300002987 | Bacteria | 6163 |
| 18 | JGI25151J46595_10001588 | 3300003187 | Bacteria | 15088 |
| 19 | JGI25151J46595_10003002 | 3300003187 | Bacteria | 9597 |
| 20 | JGI25151J46595_10003463 | 3300003187 | Bacteria | 8708 |
| 21 | JGI25151J46595_10009359 | 3300003187 | Bacteria | 4645 |
| 22 | JGI25151J46595_10021104 | 3300003187 | Bacteria | 2732 |
| 23 | JGI25165J46597_1000051 | 3300003214 | Bacteria | 241012 |
| 24 | JGI25153J46596_10000066 | 3300003215 | Bacteria | 123268 |
| 25 | JGI25153J46596_10000914 | 3300003215 | Bacteria | 17941 |
| 26 | rootH1_10006056 | 3300003323 | Bacteria | 45984 |
| 27 | JGI25160J50197_1000031 | 3300003354 | Bacteria | 175708 |
| 28 | JGI25160J50197_1000345 | 3300003354 | Bacteria | 30950 |
| 29 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 30 | Ga0055538_1000025 | 3300003751 | Bacteria | 241012 |
| 31 | Ga0055539_1000032 | 3300003752 | Bacteria | 241012 |
| 32 | Ga0055533_1000042 | 3300003756 | Bacteria | 241012 |
| 33 | Ga0055532_1003245 | 3300003758 | Bacteria | 2885 |
| 34 | Ga0055525_1000050 | 3300003759 | Bacteria | 241012 |
| 35 | Ga0055535_1001815 | 3300003761 | Bacteria | 9255 |
| 36 | Ga0055542_1001741 | 3300003762 | Bacteria | 9255 |
| 37 | Ga0055529_1000475 | 3300003763 | Bacteria | 38260 |
| 38 | Ga0055526_1006082 | 3300003771 | Bacteria | 6668 |
| 39 | Ga0055526_1006763 | 3300003771 | Bacteria | 6131 |
| 40 | Ga0055537_1000183 | 3300003773 | Bacteria | 46516 |
| 41 | Ga0055537_1000254 | 3300003773 | Bacteria | 38945 |
| 42 | Ga0055537_1000640 | 3300003773 | Bacteria | 18595 |
| 43 | Ga0055537_1003881 | 3300003773 | Bacteria | 4451 |
| 44 | Ga0055524_1000101 | 3300003775 | Bacteria | 106527 |
| 45 | Ga0055536_1000680 | 3300003781 | Bacteria | 22876 |
| 46 | Ga0055536_1003212 | 3300003781 | Bacteria | 8860 |
| 47 | Ga0055534_1000579 | 3300003784 | Bacteria | 19225 |
| 48 | Ga0055534_1001577 | 3300003784 | Bacteria | 8856 |
| 49 | Ga0055528_1001018 | 3300003790 | Bacteria | 18595 |
| 50 | Ga0055530_10001334 | 3300003791 | Bacteria | 18475 |
| 51 | Ga0055540_1000099 | 3300003792 | Bacteria | 96187 |
| 52 | Ga0055540_1001144 | 3300003792 | Bacteria | 16551 |
| 53 | Ga0055540_1001339 | 3300003792 | Bacteria | 14844 |
| 54 | Ga0055531_10002500 | 3300003794 | Bacteria | 12247 |
| 55 | Ga0055531_10016598 | 3300003794 | Bacteria | 3166 |
| 56 | Ga0055541_1000023 | 3300003841 | Bacteria | 241012 |
| 57 | Ga0058692_1002848 | 3300003856 | Bacteria | 5655 |
| 58 | Ga0055543_1001205 | 3300004625 | Bacteria | 10864 |
| 59 | Ga0065165_1000075 | 3300005262 | Bacteria | 164281 |
| 60 | Ga0065165_1002503 | 3300005262 | Bacteria | 15365 |
| 61 | Ga0065165_1020613 | 3300005262 | Bacteria | 2315 |
| 62 | Ga0065714_10094400 | 3300005288 | Bacteria | 1817 |
| 63 | Ga0065712_10076177 | 3300005290 | Bacteria | 3715 |
| 64 | Ga0065715_10023900 | 3300005293 | Bacteria | 1651 |
| 65 | Ga0065707_10086095 | 3300005295 | Bacteria | 5670 |
| 66 | Ga0070658_10005585 | 3300005327 | Bacteria | 10200 |
| 67 | Ga0070658_10175530 | 3300005327 | Bacteria | 1802 |
| 68 | Ga0070676_10000148 | 3300005328 | Bacteria | 27670 |
| 69 | Ga0070676_10000358 | 3300005328 | Bacteria | 20978 |
| 70 | Ga0070676_10023184 | 3300005328 | Bacteria | 3487 |
| 71 | Ga0070676_10043269 | 3300005328 | Bacteria | 2617 |
| 72 | Ga0070683_100008040 | 3300005329 | Bacteria | 8955 |
| 73 | Ga0070683_100017202 | 3300005329 | Bacteria | 6386 |
| 74 | Ga0070683_100058972 | 3300005329 | Bacteria | 3566 |
| 75 | Ga0070683_100059613 | 3300005329 | Bacteria | 3546 |
| 76 | Ga0070690_100022632 | 3300005330 | Bacteria | 3846 |
| 77 | Ga0070690_100087458 | 3300005330 | Bacteria | 2047 |
| 78 | Ga0070670_100001361 | 3300005331 | Bacteria | 19584 |
| 79 | Ga0070670_100005248 | 3300005331 | Bacteria | 10910 |
| 80 | Ga0070670_100024381 | 3300005331 | Bacteria | 5202 |
| 81 | Ga0070670_100029684 | 3300005331 | Bacteria | 4708 |
| 82 | Ga0070670_100033630 | 3300005331 | Bacteria | 4416 |
| 83 | Ga0070670_100053796 | 3300005331 | Bacteria | 3456 |
| 84 | Ga0070670_100059058 | 3300005331 | Bacteria | 3292 |
| 85 | Ga0070670_100059254 | 3300005331 | Bacteria | 3286 |
| 86 | Ga0070670_100166491 | 3300005331 | Bacteria | 1911 |
| 87 | Ga0070677_10000799 | 3300005333 | Bacteria | 10454 |
| 88 | Ga0070677_10023498 | 3300005333 | Bacteria | 2283 |
| 89 | Ga0068869_100001654 | 3300005334 | Bacteria | 13305 |
| 90 | Ga0068869_100016511 | 3300005334 | Bacteria | 4978 |
| 91 | Ga0068869_100032567 | 3300005334 | Bacteria | 3674 |
| 92 | Ga0068869_100066870 | 3300005334 | Bacteria | 2650 |
| 93 | Ga0068869_100069803 | 3300005334 | Bacteria | 2599 |
| 94 | Ga0068869_100152623 | 3300005334 | Bacteria | 1792 |
| 95 | Ga0070666_10002683 | 3300005335 | Bacteria | 10735 |
| 96 | Ga0070666_10004155 | 3300005335 | Bacteria | 8787 |
| 97 | Ga0070666_10059851 | 3300005335 | Bacteria | 2577 |
| 98 | Ga0070680_100003143 | 3300005336 | Bacteria | 12265 |
| 99 | Ga0068868_100001446 | 3300005338 | Bacteria | 16366 |
| 100 | Ga0068868_100001448 | 3300005338 | Bacteria | 16365 |
| 101 | Ga0068868_100025255 | 3300005338 | Bacteria | 4516 |
| 102 | Ga0068868_100026903 | 3300005338 | Bacteria | 4385 |
| 103 | Ga0068868_100027849 | 3300005338 | Bacteria | 4313 |
| 104 | Ga0068868_100112372 | 3300005338 | Bacteria | 2214 |
| 105 | Ga0068868_100120218 | 3300005338 | Bacteria | 2142 |
| 106 | Ga0068868_100135695 | 3300005338 | Bacteria | 2017 |
| 107 | Ga0070660_100000040 | 3300005339 | Bacteria | 75773 |
| 108 | Ga0070660_100007070 | 3300005339 | Bacteria | 7798 |
| 109 | Ga0070660_100098154 | 3300005339 | Bacteria | 2318 |
| 110 | Ga0070689_100005644 | 3300005340 | Bacteria | 8571 |
| 111 | Ga0070691_10028046 | 3300005341 | Bacteria | 2629 |
| 112 | Ga0070687_100000725 | 3300005343 | Bacteria | 10957 |
| 113 | Ga0070661_100001117 | 3300005344 | Bacteria | 18832 |
| 114 | Ga0070661_100013669 | 3300005344 | Bacteria | 5701 |
| 115 | Ga0070661_100014791 | 3300005344 | Bacteria | 5502 |
| 116 | Ga0070661_100032460 | 3300005344 | Bacteria | 3780 |
| 117 | Ga0070692_10003099 | 3300005345 | Bacteria | 6654 |
| 118 | Ga0070692_10006942 | 3300005345 | Bacteria | 4954 |
| 119 | Ga0070692_10018619 | 3300005345 | Bacteria | 3343 |
| 120 | Ga0070692_10023354 | 3300005345 | Bacteria | 3029 |
| 121 | Ga0070668_100001120 | 3300005347 | Bacteria | 18884 |
| 122 | Ga0070668_100001207 | 3300005347 | Bacteria | 18349 |
| 123 | Ga0070668_100002539 | 3300005347 | Bacteria | 13436 |
| 124 | Ga0070668_100008228 | 3300005347 | Bacteria | 7744 |
| 125 | Ga0070668_100015868 | 3300005347 | Bacteria | 5635 |
| 126 | Ga0070668_100017358 | 3300005347 | Bacteria | 5391 |
| 127 | Ga0070668_100036158 | 3300005347 | Bacteria | 3769 |
| 128 | Ga0070669_100015487 | 3300005353 | Bacteria | 5434 |
| 129 | Ga0070669_100085187 | 3300005353 | Bacteria | 2360 |
| 130 | Ga0070675_100000127 | 3300005354 | Bacteria | 45462 |
| 131 | Ga0070675_100006009 | 3300005354 | Bacteria | 9302 |
| 132 | Ga0070675_100017061 | 3300005354 | Bacteria | 5771 |
| 133 | Ga0070675_100019717 | 3300005354 | Bacteria | 5377 |
| 134 | Ga0070675_100020291 | 3300005354 | Bacteria | 5303 |
| 135 | Ga0070675_100022840 | 3300005354 | Bacteria | 4998 |
| 136 | Ga0070675_100061149 | 3300005354 | Bacteria | 3110 |
| 137 | Ga0070675_100177231 | 3300005354 | Bacteria | 1841 |
| 138 | Ga0070671_100000385 | 3300005355 | Bacteria | 30358 |
| 139 | Ga0070671_100001859 | 3300005355 | Bacteria | 16109 |
| 140 | Ga0070671_100005362 | 3300005355 | Bacteria | 10225 |
| 141 | Ga0070671_100023725 | 3300005355 | Bacteria | 5021 |
| 142 | Ga0070671_100031223 | 3300005355 | Bacteria | 4399 |
| 143 | Ga0070671_100033607 | 3300005355 | Bacteria | 4244 |
| 144 | Ga0070671_100034527 | 3300005355 | Bacteria | 4186 |
| 145 | Ga0070671_100037375 | 3300005355 | Bacteria | 4026 |
| 146 | Ga0070671_100038568 | 3300005355 | Bacteria | 3965 |
| 147 | Ga0070671_100171910 | 3300005355 | Bacteria | 1833 |
| 148 | Ga0070674_100000120 | 3300005356 | Bacteria | 35826 |
| 149 | Ga0070674_100040651 | 3300005356 | Bacteria | 3147 |
| 150 | Ga0070674_100098106 | 3300005356 | Bacteria | 2129 |
| 151 | Ga0070673_100000465 | 3300005364 | Bacteria | 21543 |
| 152 | Ga0070673_100022841 | 3300005364 | Bacteria | 4561 |
| 153 | Ga0070673_100023139 | 3300005364 | Bacteria | 4536 |
| 154 | Ga0070673_100031470 | 3300005364 | Bacteria | 3981 |
| 155 | Ga0070673_100046988 | 3300005364 | Bacteria | 3356 |
| 156 | Ga0070673_100049389 | 3300005364 | Bacteria | 3285 |
| 157 | Ga0070673_100057489 | 3300005364 | Bacteria | 3073 |
| 158 | Ga0070673_100162192 | 3300005364 | Bacteria | 1902 |
| 159 | Ga0070688_100007940 | 3300005365 | Bacteria | 5739 |
| 160 | Ga0070688_100012229 | 3300005365 | Bacteria | 4804 |
| 161 | Ga0070659_100000335 | 3300005366 | Bacteria | 36311 |
| 162 | Ga0070659_100003843 | 3300005366 | Bacteria | 10708 |
| 163 | Ga0070659_100033464 | 3300005366 | Bacteria | 3992 |
| 164 | Ga0070659_100047925 | 3300005366 | Bacteria | 3354 |
| 165 | Ga0070659_100069679 | 3300005366 | Bacteria | 2792 |
| 166 | Ga0070659_100126174 | 3300005366 | Bacteria | 2076 |
| 167 | Ga0070667_100001635 | 3300005367 | Bacteria | 20037 |
| 168 | Ga0070667_100002817 | 3300005367 | Bacteria | 15004 |
| 169 | Ga0070667_100010671 | 3300005367 | Bacteria | 7589 |
| 170 | Ga0070667_100019721 | 3300005367 | Bacteria | 5594 |
| 171 | Ga0070667_100027031 | 3300005367 | Bacteria | 4773 |
| 172 | Ga0070709_10020613 | 3300005434 | Bacteria | 3827 |
| 173 | Ga0070714_100001578 | 3300005435 | Bacteria | 16557 |
| 174 | Ga0070714_100021635 | 3300005435 | Bacteria | 5263 |
| 175 | Ga0070714_100028074 | 3300005435 | Bacteria | 4665 |
| 176 | Ga0070714_100080266 | 3300005435 | Bacteria | 2839 |
| 177 | Ga0070713_100000030 | 3300005436 | Bacteria | 88948 |
| 178 | Ga0070713_100007351 | 3300005436 | Bacteria | 7722 |
| 179 | Ga0070713_100020020 | 3300005436 | Bacteria | 5122 |
| 180 | Ga0070713_100023150 | 3300005436 | Bacteria | 4814 |
| 181 | Ga0070710_10004978 | 3300005437 | Bacteria | 6290 |
| 182 | Ga0070701_10017146 | 3300005438 | Bacteria | 3381 |
| 183 | Ga0070701_10083976 | 3300005438 | Bacteria | 1731 |
| 184 | Ga0070711_100019510 | 3300005439 | Bacteria | 4350 |
| 185 | Ga0070711_100086840 | 3300005439 | Bacteria | 2244 |
| 186 | Ga0070705_100053755 | 3300005440 | Bacteria | 2359 |
| 187 | Ga0070705_100054282 | 3300005440 | Bacteria | 2350 |
| 188 | Ga0070700_100002594 | 3300005441 | Bacteria | 9240 |
| 189 | Ga0070694_100006213 | 3300005444 | Bacteria | 7251 |
| 190 | Ga0070694_100018184 | 3300005444 | Bacteria | 4458 |
| 191 | Ga0070708_100000315 | 3300005445 | Bacteria | 36417 |
| 192 | Ga0070708_100133133 | 3300005445 | Bacteria | 2302 |
| 193 | Ga0070663_100000273 | 3300005455 | Bacteria | 26046 |
| 194 | Ga0070663_100005582 | 3300005455 | Bacteria | 7488 |
| 195 | Ga0070663_100022567 | 3300005455 | Bacteria | 4209 |
| 196 | Ga0070663_100026453 | 3300005455 | Bacteria | 3931 |
| 197 | Ga0070663_100096148 | 3300005455 | Bacteria | 2203 |
| 198 | Ga0070678_100000532 | 3300005456 | Bacteria | 18540 |
| 199 | Ga0070678_100027467 | 3300005456 | Bacteria | 3864 |
| 200 | Ga0070678_100032420 | 3300005456 | Bacteria | 3616 |
| 201 | Ga0070662_100026933 | 3300005457 | Bacteria | 3986 |
| 202 | Ga0070662_100038412 | 3300005457 | Bacteria | 3400 |
| 203 | Ga0070662_100047869 | 3300005457 | Bacteria | 3078 |
| 204 | Ga0070662_100049536 | 3300005457 | Bacteria | 3029 |
| 205 | Ga0070662_100050759 | 3300005457 | Bacteria | 2992 |
| 206 | Ga0070662_100057765 | 3300005457 | Bacteria | 2820 |
| 207 | Ga0070662_100140215 | 3300005457 | Bacteria | 1872 |
| 208 | Ga0070681_10001589 | 3300005458 | Bacteria | 20194 |
| 209 | Ga0070681_10008439 | 3300005458 | Bacteria | 10084 |
| 210 | Ga0070681_10044648 | 3300005458 | Bacteria | 4436 |
| 211 | Ga0068867_100000611 | 3300005459 | Bacteria | 23660 |
| 212 | Ga0068867_100008312 | 3300005459 | Bacteria | 7327 |
| 213 | Ga0068867_100015611 | 3300005459 | Bacteria | 5389 |
| 214 | Ga0068867_100023683 | 3300005459 | Bacteria | 4396 |
| 215 | Ga0068867_100027347 | 3300005459 | Bacteria | 4097 |
| 216 | Ga0070685_10023432 | 3300005466 | Bacteria | 3380 |
| 217 | Ga0070706_100002711 | 3300005467 | Bacteria | 17718 |
| 218 | Ga0070698_100142866 | 3300005471 | Bacteria | 2344 |
| 219 | Ga0070699_100013187 | 3300005518 | Bacteria | 7126 |
| 220 | Ga0070699_100028079 | 3300005518 | Bacteria | 4853 |
| 221 | Ga0070699_100039279 | 3300005518 | Bacteria | 4098 |
| 222 | Ga0070679_100006925 | 3300005530 | Bacteria | 10574 |
| 223 | Ga0070679_100008975 | 3300005530 | Bacteria | 9434 |
| 224 | Ga0070679_100026267 | 3300005530 | Bacteria | 5717 |
| 225 | Ga0070679_100078097 | 3300005530 | Bacteria | 3299 |
| 226 | Ga0068853_100016255 | 3300005539 | Bacteria | 6124 |
| 227 | Ga0068853_100019352 | 3300005539 | Bacteria | 5644 |
| 228 | Ga0068853_100036798 | 3300005539 | Bacteria | 4163 |
| 229 | Ga0068853_100098240 | 3300005539 | Bacteria | 2585 |
| 230 | Ga0068853_100105584 | 3300005539 | Bacteria | 2495 |
| 231 | Ga0070672_100001354 | 3300005543 | Bacteria | 15121 |
| 232 | Ga0070672_100001593 | 3300005543 | Bacteria | 14079 |
| 233 | Ga0070672_100002173 | 3300005543 | Bacteria | 12365 |
| 234 | Ga0070672_100002527 | 3300005543 | Bacteria | 11648 |
| 235 | Ga0070672_100014139 | 3300005543 | Bacteria | 5649 |
| 236 | Ga0070672_100040912 | 3300005543 | Bacteria | 3560 |
| 237 | Ga0070672_100069573 | 3300005543 | Bacteria | 2794 |
| 238 | Ga0070672_100108193 | 3300005543 | Bacteria | 2263 |
| 239 | Ga0070686_100072944 | 3300005544 | Bacteria | 2252 |
| 240 | Ga0070695_100005263 | 3300005545 | Bacteria | 7616 |
| 241 | Ga0070695_100017622 | 3300005545 | Bacteria | 4333 |
| 242 | Ga0070695_100095895 | 3300005545 | Bacteria | 1989 |
| 243 | Ga0070696_100005886 | 3300005546 | Bacteria | 8189 |
| 244 | Ga0070696_100041062 | 3300005546 | Bacteria | 3195 |
| 245 | Ga0070696_100124032 | 3300005546 | Bacteria | 1872 |
| 246 | Ga0070693_100001435 | 3300005547 | Bacteria | 10742 |
| 247 | Ga0070665_100003546 | 3300005548 | Bacteria | 16568 |
| 248 | Ga0070665_100011350 | 3300005548 | Bacteria | 9009 |
| 249 | Ga0070665_100018618 | 3300005548 | Bacteria | 6960 |
| 250 | Ga0070665_100024149 | 3300005548 | Bacteria | 6122 |
| 251 | Ga0070665_100082191 | 3300005548 | Bacteria | 3226 |
| 252 | Ga0070665_100139011 | 3300005548 | Bacteria | 2432 |
| 253 | Ga0070704_100024207 | 3300005549 | Bacteria | 3981 |
| 254 | Ga0068855_100001125 | 3300005563 | Bacteria | 33195 |
| 255 | Ga0068855_100021344 | 3300005563 | Bacteria | 7765 |
| 256 | Ga0068855_100074485 | 3300005563 | Bacteria | 3942 |
| 257 | Ga0068855_100145450 | 3300005563 | Bacteria | 2699 |
| 258 | Ga0070664_100001477 | 3300005564 | Bacteria | 18724 |
| 259 | Ga0070664_100001613 | 3300005564 | Bacteria | 18043 |
| 260 | Ga0070664_100016626 | 3300005564 | Bacteria | 6035 |
| 261 | Ga0070664_100156731 | 3300005564 | Bacteria | 2012 |
| 262 | Ga0070664_100165039 | 3300005564 | Bacteria | 1962 |
| 263 | Ga0068857_100009255 | 3300005577 | Bacteria | 8545 |
| 264 | Ga0068857_100078530 | 3300005577 | Bacteria | 2946 |
| 265 | Ga0068857_100173147 | 3300005577 | Bacteria | 1963 |
| 266 | Ga0068854_100030465 | 3300005578 | Bacteria | 3742 |
| 267 | Ga0068854_100161522 | 3300005578 | Bacteria | 1736 |
| 268 | Ga0068856_100002166 | 3300005614 | Bacteria | 20348 |
| 269 | Ga0068856_100007848 | 3300005614 | Bacteria | 10422 |
| 270 | Ga0068856_100008625 | 3300005614 | Bacteria | 9916 |
| 271 | Ga0068856_100017226 | 3300005614 | Bacteria | 7002 |
| 272 | Ga0068856_100027812 | 3300005614 | Bacteria | 5516 |
| 273 | Ga0068856_100089464 | 3300005614 | Bacteria | 3062 |
| 274 | Ga0068856_100129036 | 3300005614 | Bacteria | 2533 |
| 275 | Ga0070702_100068989 | 3300005615 | Bacteria | 2082 |
| 276 | Ga0068852_100000773 | 3300005616 | Bacteria | 21097 |
| 277 | Ga0068852_100001185 | 3300005616 | Bacteria | 17283 |
| 278 | Ga0068852_100005228 | 3300005616 | Bacteria | 9256 |
| 279 | Ga0068852_100008520 | 3300005616 | Bacteria | 7563 |
| 280 | Ga0068852_100015228 | 3300005616 | Bacteria | 5954 |
| 281 | Ga0068852_100170682 | 3300005616 | Bacteria | 2038 |
| 282 | Ga0068859_100002372 | 3300005617 | Bacteria | 19172 |
| 283 | Ga0068859_100003577 | 3300005617 | Bacteria | 15829 |
| 284 | Ga0068859_100035283 | 3300005617 | Bacteria | 5019 |
| 285 | Ga0068859_100042632 | 3300005617 | Bacteria | 4558 |
| 286 | Ga0068859_100059241 | 3300005617 | Bacteria | 3858 |
| 287 | Ga0068859_100215824 | 3300005617 | Bacteria | 2006 |
| 288 | Ga0068859_100223378 | 3300005617 | Bacteria | 1971 |
| 289 | Ga0068864_100001575 | 3300005618 | Bacteria | 18770 |
| 290 | Ga0068864_100002069 | 3300005618 | Bacteria | 16579 |
| 291 | Ga0068864_100006417 | 3300005618 | Bacteria | 9642 |
| 292 | Ga0068864_100008157 | 3300005618 | Bacteria | 8638 |
| 293 | Ga0068864_100014096 | 3300005618 | Bacteria | 6632 |
| 294 | Ga0068864_100023397 | 3300005618 | Bacteria | 5187 |
| 295 | Ga0068864_100024363 | 3300005618 | Bacteria | 5091 |
| 296 | Ga0068864_100040760 | 3300005618 | Bacteria | 3971 |
| 297 | Ga0068864_100061160 | 3300005618 | Bacteria | 3262 |
| 298 | Ga0068864_100080655 | 3300005618 | Bacteria | 2851 |
| 299 | Ga0068864_100090975 | 3300005618 | Bacteria | 2691 |
| 300 | Ga0068864_100098419 | 3300005618 | Bacteria | 2591 |
| 301 | Ga0068866_10002154 | 3300005718 | Bacteria | 8199 |
| 302 | Ga0068866_10018615 | 3300005718 | Bacteria | 3144 |
| 303 | Ga0068861_100000301 | 3300005719 | Bacteria | 27687 |
| 304 | Ga0068861_100020256 | 3300005719 | Bacteria | 4760 |
| 305 | Ga0068861_100037108 | 3300005719 | Bacteria | 3622 |
| 306 | Ga0068861_100062179 | 3300005719 | Bacteria | 2867 |
| 307 | Ga0068861_100155056 | 3300005719 | Bacteria | 1883 |
| 308 | Ga0068851_10003201 | 3300005834 | Bacteria | 7257 |
| 309 | Ga0068851_10004667 | 3300005834 | Bacteria | 6190 |
| 310 | Ga0068851_10004806 | 3300005834 | Bacteria | 6113 |
| 311 | Ga0068851_10058505 | 3300005834 | Bacteria | 1970 |
| 312 | Ga0068870_10001765 | 3300005840 | Bacteria | 8869 |
| 313 | Ga0068870_10043673 | 3300005840 | Bacteria | 2338 |
| 314 | Ga0068863_100003067 | 3300005841 | Bacteria | 16514 |
| 315 | Ga0068863_100017733 | 3300005841 | Bacteria | 6814 |
| 316 | Ga0068863_100022168 | 3300005841 | Bacteria | 6063 |
| 317 | Ga0068863_100025414 | 3300005841 | Bacteria | 5647 |
| 318 | Ga0068863_100043139 | 3300005841 | Bacteria | 4282 |
| 319 | Ga0068863_100148406 | 3300005841 | Bacteria | 2243 |
| 320 | Ga0068863_100151284 | 3300005841 | Bacteria | 2220 |
| 321 | Ga0068863_100175672 | 3300005841 | Bacteria | 2055 |
| 322 | Ga0068863_100269639 | 3300005841 | Bacteria | 1647 |
| 323 | Ga0068858_100006180 | 3300005842 | Bacteria | 11681 |
| 324 | Ga0068858_100007048 | 3300005842 | Bacteria | 10915 |
| 325 | Ga0068858_100014101 | 3300005842 | Bacteria | 7537 |
| 326 | Ga0068858_100021347 | 3300005842 | Bacteria | 6049 |
| 327 | Ga0068858_100047879 | 3300005842 | Bacteria | 3962 |
| 328 | Ga0068858_100057702 | 3300005842 | Bacteria | 3588 |
| 329 | Ga0068858_100089727 | 3300005842 | Bacteria | 2860 |
| 330 | Ga0068858_100094682 | 3300005842 | Bacteria | 2782 |
| 331 | Ga0068858_100103413 | 3300005842 | Bacteria | 2657 |
| 332 | Ga0068858_100171609 | 3300005842 | Bacteria | 2045 |
| 333 | Ga0068860_100002318 | 3300005843 | Bacteria | 20001 |
| 334 | Ga0068860_100012715 | 3300005843 | Bacteria | 8280 |
| 335 | Ga0068860_100022270 | 3300005843 | Bacteria | 6132 |
| 336 | Ga0068860_100028913 | 3300005843 | Bacteria | 5333 |
| 337 | Ga0068860_100041016 | 3300005843 | Bacteria | 4422 |
| 338 | Ga0068860_100066238 | 3300005843 | Bacteria | 3431 |
| 339 | Ga0068860_100092329 | 3300005843 | Bacteria | 2884 |
| 340 | Ga0068860_100120259 | 3300005843 | Bacteria | 2514 |
| 341 | Ga0068860_100136516 | 3300005843 | Bacteria | 2355 |
| 342 | Ga0068860_100140727 | 3300005843 | Bacteria | 2319 |
| 343 | Ga0068860_100145030 | 3300005843 | Bacteria | 2284 |
| 344 | Ga0068860_100233584 | 3300005843 | Bacteria | 1787 |
| 345 | Ga0068860_100264045 | 3300005843 | Bacteria | 1679 |
| 346 | Ga0068862_100003581 | 3300005844 | Bacteria | 13296 |
| 347 | Ga0068862_100020347 | 3300005844 | Bacteria | 5543 |
| 348 | Ga0068862_100041734 | 3300005844 | Bacteria | 3905 |
| 349 | Ga0068862_100056683 | 3300005844 | Bacteria | 3358 |
| 350 | Ga0068862_100061758 | 3300005844 | Bacteria | 3221 |
| 351 | Ga0081538_10017023 | 3300005981 | Bacteria | 5540 |
| 352 | Ga0070717_10017896 | 3300006028 | Bacteria | 5525 |
| 353 | Ga0075365_10020559 | 3300006038 | Bacteria | 4095 |
| 354 | Ga0075432_10031837 | 3300006058 | Bacteria | 1826 |
| 355 | Ga0070716_100005715 | 3300006173 | Bacteria | 6041 |
| 356 | Ga0070716_100027792 | 3300006173 | Bacteria | 3042 |
| 357 | Ga0070712_100031422 | 3300006175 | Bacteria | 3577 |
| 358 | Ga0070712_100043810 | 3300006175 | Bacteria | 3082 |
| 359 | Ga0075362_10003779 | 3300006177 | Bacteria | 5360 |
| 360 | Ga0075362_10013671 | 3300006177 | Bacteria | 3255 |
| 361 | Ga0075366_10012563 | 3300006195 | Bacteria | 4806 |
| 362 | Ga0075366_10014908 | 3300006195 | Bacteria | 4444 |
| 363 | Ga0075366_10033867 | 3300006195 | Bacteria | 3010 |
| 364 | Ga0075366_10108350 | 3300006195 | Bacteria | 1670 |
| 365 | Ga0097621_100001301 | 3300006237 | Bacteria | 17184 |
| 366 | Ga0097621_100007020 | 3300006237 | Bacteria | 8020 |
| 367 | Ga0097621_100009479 | 3300006237 | Bacteria | 7068 |
| 368 | Ga0097621_100009828 | 3300006237 | Bacteria | 6964 |
| 369 | Ga0097621_100034286 | 3300006237 | Bacteria | 4048 |
| 370 | Ga0097621_100083065 | 3300006237 | Bacteria | 2668 |
| 371 | Ga0097621_100115702 | 3300006237 | Bacteria | 2270 |
| 372 | Ga0097621_100131299 | 3300006237 | Bacteria | 2132 |
| 373 | Ga0075370_10001530 | 3300006353 | Bacteria | 10118 |
| 374 | Ga0075370_10001898 | 3300006353 | Bacteria | 9394 |
| 375 | Ga0075370_10003975 | 3300006353 | Bacteria | 7105 |
| 376 | Ga0075370_10008606 | 3300006353 | Bacteria | 5260 |
| 377 | Ga0068871_100000155 | 3300006358 | Bacteria | 45123 |
| 378 | Ga0068871_100004278 | 3300006358 | Bacteria | 9904 |
| 379 | Ga0068871_100010918 | 3300006358 | Bacteria | 6651 |
| 380 | Ga0068871_100015576 | 3300006358 | Bacteria | 5696 |
| 381 | Ga0068871_100020682 | 3300006358 | Bacteria | 5045 |
| 382 | Ga0068871_100025900 | 3300006358 | Bacteria | 4570 |
| 383 | Ga0068871_100078028 | 3300006358 | Bacteria | 2738 |
| 384 | Ga0075428_100008716 | 3300006844 | Bacteria | 11251 |
| 385 | Ga0075428_100094800 | 3300006844 | Bacteria | 3254 |
| 386 | Ga0075428_100145404 | 3300006844 | Bacteria | 2577 |
| 387 | Ga0075431_100000979 | 3300006847 | Bacteria | 25398 |
| 388 | Ga0075431_100020085 | 3300006847 | Bacteria | 6822 |
| 389 | Ga0075433_10033873 | 3300006852 | Bacteria | 4382 |
| 390 | Ga0075433_10115124 | 3300006852 | Bacteria | 2386 |
| 391 | Ga0075434_100026928 | 3300006871 | Bacteria | 5640 |
| 392 | Ga0075434_100089369 | 3300006871 | Bacteria | 3082 |
| 393 | Ga0075434_100108789 | 3300006871 | Bacteria | 2782 |
| 394 | Ga0075434_100217527 | 3300006871 | Bacteria | 1930 |
| 395 | Ga0068865_100013513 | 3300006881 | Bacteria | 5161 |
| 396 | Ga0068865_100029143 | 3300006881 | Bacteria | 3659 |
| 397 | Ga0068865_100055654 | 3300006881 | Bacteria | 2753 |
| 398 | Ga0075436_100022431 | 3300006914 | Bacteria | 4337 |
| 399 | Ga0097620_100002372 | 3300006931 | Bacteria | 19172 |
| 400 | Ga0097620_100003577 | 3300006931 | Bacteria | 15829 |
| 401 | Ga0097620_100035282 | 3300006931 | Bacteria | 5019 |
| 402 | Ga0097620_100042633 | 3300006931 | Bacteria | 4558 |
| 403 | Ga0097620_100059240 | 3300006931 | Bacteria | 3858 |
| 404 | Ga0097620_100215825 | 3300006931 | Bacteria | 2006 |
| 405 | Ga0097620_100223359 | 3300006931 | Bacteria | 1971 |
| 406 | Ga0099823_1000262 | 3300006944 | Bacteria | 30959 |
| 407 | Ga0075435_100029224 | 3300007076 | Bacteria | 4326 |
| 408 | Ga0099794_10009254 | 3300007265 | Bacteria | 4131 |
| 409 | Ga0099795_10000016 | 3300007788 | Bacteria | 63930 |
| 410 | Ga0099795_10000213 | 3300007788 | Bacteria | 10001 |
| 411 | Ga0099795_10009193 | 3300007788 | Bacteria | 2857 |
| 412 | Ga0105240_10009642 | 3300009093 | Bacteria | 13655 |
| 413 | Ga0105240_10013339 | 3300009093 | Bacteria | 11292 |
| 414 | Ga0105240_10021359 | 3300009093 | Bacteria | 8611 |
| 415 | Ga0105240_10037680 | 3300009093 | Bacteria | 6212 |
| 416 | Ga0105240_10038466 | 3300009093 | Bacteria | 6137 |
| 417 | Ga0105240_10160746 | 3300009093 | Bacteria | 2668 |
| 418 | Ga0105240_10197498 | 3300009093 | Bacteria | 2360 |
| 419 | Ga0111539_10001754 | 3300009094 | Bacteria | 28812 |
| 420 | Ga0111539_10002831 | 3300009094 | Bacteria | 23059 |
| 421 | Ga0111539_10039561 | 3300009094 | Bacteria | 5682 |
| 422 | Ga0111539_10115047 | 3300009094 | Bacteria | 3155 |
| 423 | Ga0111539_10166659 | 3300009094 | Bacteria | 2576 |
| 424 | Ga0105245_10029258 | 3300009098 | Bacteria | 4866 |
| 425 | Ga0105245_10033953 | 3300009098 | Bacteria | 4522 |
| 426 | Ga0105245_10151766 | 3300009098 | Bacteria | 2191 |
| 427 | Ga0105247_10031204 | 3300009101 | Bacteria | 3233 |
| 428 | Ga0105247_10032359 | 3300009101 | Bacteria | 3178 |
| 429 | Ga0105243_10017029 | 3300009148 | Bacteria | 5495 |
| 430 | Ga0105243_10028276 | 3300009148 | Bacteria | 4303 |
| 431 | Ga0105243_10035079 | 3300009148 | Bacteria | 3888 |
| 432 | Ga0105243_10058069 | 3300009148 | Bacteria | 3083 |
| 433 | Ga0105243_10070583 | 3300009148 | Bacteria | 2821 |
| 434 | Ga0105242_10004677 | 3300009176 | Bacteria | 10591 |
| 435 | Ga0105242_10006175 | 3300009176 | Bacteria | 9228 |
| 436 | Ga0105242_10012520 | 3300009176 | Bacteria | 6530 |
| 437 | Ga0105242_10021186 | 3300009176 | Bacteria | 5102 |
| 438 | Ga0105242_10022167 | 3300009176 | Bacteria | 4991 |
| 439 | Ga0105242_10064030 | 3300009176 | Bacteria | 3029 |
| 440 | Ga0105248_10002044 | 3300009177 | Bacteria | 22366 |
| 441 | Ga0105248_10009798 | 3300009177 | Bacteria | 10555 |
| 442 | Ga0105248_10015742 | 3300009177 | Bacteria | 8336 |
| 443 | Ga0105248_10018504 | 3300009177 | Bacteria | 7699 |
| 444 | Ga0105248_10020721 | 3300009177 | Bacteria | 7284 |
| 445 | Ga0105248_10021964 | 3300009177 | Bacteria | 7072 |
| 446 | Ga0105248_10074135 | 3300009177 | Bacteria | 3825 |
| 447 | Ga0105248_10097015 | 3300009177 | Bacteria | 3321 |
| 448 | Ga0105248_10102047 | 3300009177 | Bacteria | 3233 |
| 449 | Ga0105248_10116645 | 3300009177 | Bacteria | 3011 |
| 450 | Ga0105248_10166548 | 3300009177 | Bacteria | 2484 |
| 451 | Ga0105248_10215930 | 3300009177 | Bacteria | 2160 |
| 452 | Ga0105237_10014315 | 3300009545 | Bacteria | 8303 |
| 453 | Ga0105237_10040777 | 3300009545 | Bacteria | 4681 |
| 454 | Ga0105237_10186713 | 3300009545 | Bacteria | 2073 |
| 455 | Ga0105238_10002047 | 3300009551 | Bacteria | 20346 |
| 456 | Ga0105238_10025045 | 3300009551 | Bacteria | 6082 |
| 457 | Ga0105238_10038818 | 3300009551 | Bacteria | 4835 |
| 458 | Ga0105238_10045297 | 3300009551 | Bacteria | 4444 |
| 459 | Ga0105238_10095559 | 3300009551 | Bacteria | 2958 |
| 460 | Ga0105238_10212985 | 3300009551 | Bacteria | 1908 |
| 461 | Ga0105249_10017612 | 3300009553 | Bacteria | 6343 |
| 462 | Ga0105249_10024270 | 3300009553 | Bacteria | 5449 |
| 463 | Ga0105249_10049391 | 3300009553 | Bacteria | 3837 |
| 464 | Ga0105249_10111569 | 3300009553 | Bacteria | 2586 |
| 465 | Ga0099796_10000003 | 3300010159 | Bacteria | 81717 |
| 466 | Ga0105239_10040067 | 3300010375 | Bacteria | 5132 |
| 467 | Ga0105239_10204709 | 3300010375 | Bacteria | 2211 |
| 468 | Ga0157347_1000437 | 3300012502 | Bacteria | 2700 |
| 469 | Ga0157347_1000526 | 3300012502 | Bacteria | 2543 |
| 470 | Ga0157373_10038288 | 3300013100 | Bacteria | 3438 |
| 471 | Ga0157371_10001585 | 3300013102 | Bacteria | 23358 |
| 472 | Ga0157371_10025257 | 3300013102 | Bacteria | 4332 |
| 473 | Ga0157370_10004541 | 3300013104 | Bacteria | 15900 |
| 474 | Ga0157370_10014786 | 3300013104 | Bacteria | 7965 |
| 475 | Ga0157370_10023152 | 3300013104 | Bacteria | 6173 |
| 476 | Ga0157370_10030299 | 3300013104 | Bacteria | 5302 |
| 477 | Ga0157370_10033170 | 3300013104 | Bacteria | 5034 |
| 478 | Ga0157370_10062897 | 3300013104 | Bacteria | 3518 |
| 479 | Ga0157370_10079441 | 3300013104 | Bacteria | 3089 |
| 480 | Ga0157369_10007892 | 3300013105 | Bacteria | 12238 |
| 481 | Ga0157369_10010470 | 3300013105 | Bacteria | 10563 |
| 482 | Ga0157374_10039253 | 3300013296 | Bacteria | 4357 |
| 483 | Ga0157374_10047421 | 3300013296 | Bacteria | 3984 |
| 484 | Ga0157378_10010403 | 3300013297 | Bacteria | 8124 |
| 485 | Ga0157378_10018771 | 3300013297 | Bacteria | 6079 |
| 486 | Ga0157378_10029728 | 3300013297 | Bacteria | 4824 |
| 487 | Ga0157378_10043470 | 3300013297 | Bacteria | 3989 |
| 488 | Ga0163162_10002191 | 3300013306 | Bacteria | 18337 |
| 489 | Ga0163162_10040591 | 3300013306 | Bacteria | 4654 |
| 490 | Ga0163162_10040756 | 3300013306 | Bacteria | 4645 |
| 491 | Ga0163162_10092092 | 3300013306 | Bacteria | 3114 |
| 492 | Ga0163162_10100788 | 3300013306 | Bacteria | 2979 |
| 493 | Ga0163162_10208109 | 3300013306 | Bacteria | 2085 |
| 494 | Ga0163162_10288563 | 3300013306 | Bacteria | 1773 |
| 495 | Ga0157372_10004036 | 3300013307 | Bacteria | 15742 |
| 496 | Ga0157372_10035608 | 3300013307 | Bacteria | 5481 |
| 497 | Ga0157372_10088187 | 3300013307 | Bacteria | 3522 |
| 498 | Ga0157372_10095039 | 3300013307 | Bacteria | 3395 |
| 499 | Ga0157375_10000969 | 3300013308 | Bacteria | 24817 |
| 500 | Ga0157375_10010250 | 3300013308 | Bacteria | 8244 |
| 501 | Ga0157375_10051869 | 3300013308 | Bacteria | 4031 |
| 502 | Ga0157375_10054701 | 3300013308 | Bacteria | 3932 |
| 503 | Ga0157375_10054813 | 3300013308 | Bacteria | 3928 |
| 504 | Ga0157375_10066889 | 3300013308 | Bacteria | 3589 |
| 505 | Ga0157375_10183362 | 3300013308 | Bacteria | 2246 |
| 506 | Ga0157375_10183443 | 3300013308 | Bacteria | 2245 |
| 507 | Ga0163163_10001474 | 3300014325 | Bacteria | 19920 |
| 508 | Ga0163163_10017467 | 3300014325 | Bacteria | 6692 |
| 509 | Ga0163163_10115197 | 3300014325 | Bacteria | 2719 |
| 510 | Ga0163163_10162891 | 3300014325 | Bacteria | 2276 |
| 511 | Ga0163163_10184052 | 3300014325 | Bacteria | 2136 |
| 512 | Ga0157380_10030469 | 3300014326 | Bacteria | 4132 |
| 513 | Ga0157380_10032014 | 3300014326 | Bacteria | 4041 |
| 514 | Ga0157380_10045371 | 3300014326 | Bacteria | 3449 |
| 515 | Ga0157380_10095817 | 3300014326 | Bacteria | 2459 |
| 516 | Ga0182008_10000044 | 3300014497 | Bacteria | 115149 |
| 517 | Ga0182008_10003423 | 3300014497 | Bacteria | 9586 |
| 518 | Ga0182008_10049376 | 3300014497 | Bacteria | 2089 |
| 519 | Ga0157377_10017671 | 3300014745 | Bacteria | 3693 |
| 520 | Ga0157379_10000796 | 3300014968 | Bacteria | 25564 |
| 521 | Ga0157379_10005362 | 3300014968 | Bacteria | 11022 |
| 522 | Ga0157379_10007870 | 3300014968 | Bacteria | 9234 |
| 523 | Ga0157379_10020780 | 3300014968 | Bacteria | 5809 |
| 524 | Ga0157379_10021082 | 3300014968 | Bacteria | 5767 |
| 525 | Ga0157379_10045091 | 3300014968 | Bacteria | 3936 |
| 526 | Ga0157379_10053760 | 3300014968 | Bacteria | 3598 |
| 527 | Ga0157379_10091663 | 3300014968 | Bacteria | 2726 |
| 528 | Ga0157379_10145872 | 3300014968 | Bacteria | 2134 |
| 529 | Ga0157376_10004066 | 3300014969 | Bacteria | 10120 |
| 530 | Ga0157376_10024013 | 3300014969 | Bacteria | 4781 |
| 531 | Ga0157376_10039002 | 3300014969 | Bacteria | 3869 |
| 532 | Ga0157376_10062505 | 3300014969 | Bacteria | 3133 |
| 533 | Ga0157376_10067225 | 3300014969 | Bacteria | 3031 |
| 534 | Ga0157376_10094119 | 3300014969 | Bacteria | 2602 |
| 535 | Ga0157376_10122724 | 3300014969 | Bacteria | 2305 |
| 536 | Ga0157376_10124279 | 3300014969 | Bacteria | 2292 |
| 537 | Ga0182006_1007864 | 3300015261 | Bacteria | 4855 |
| 538 | Ga0182007_10003472 | 3300015262 | Bacteria | 7419 |
| 539 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 540 | Ga0163161_10000042 | 3300017792 | Bacteria | 135368 |
| 541 | Ga0163161_10000166 | 3300017792 | Bacteria | 60327 |
| 542 | Ga0163161_10010292 | 3300017792 | Bacteria | 6478 |
| 543 | Ga0163161_10021996 | 3300017792 | Bacteria | 4485 |
| 544 | Ga0163161_10195994 | 3300017792 | Bacteria | 1555 |
| 545 | Ga0213874_10009787 | 3300021377 | Bacteria | 2382 |
| 546 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 547 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 548 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 549 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 550 | Ga0209672_100015 | 3300025228 | Bacteria | 529352 |
| 551 | Ga0209672_100041 | 3300025228 | Bacteria | 278535 |
| 552 | Ga0209672_100263 | 3300025228 | Bacteria | 38912 |
| 553 | Ga0209147_100016 | 3300025229 | Bacteria | 527606 |
| 554 | Ga0209147_100226 | 3300025229 | Bacteria | 56753 |
| 555 | Ga0209147_100313 | 3300025229 | Bacteria | 37631 |
| 556 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 557 | Ga0207427_102072 | 3300025231 | Bacteria | 5925 |
| 558 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 559 | Ga0209258_100026 | 3300025242 | Bacteria | 527606 |
| 560 | Ga0209258_100309 | 3300025242 | Bacteria | 76791 |
| 561 | Ga0209258_100498 | 3300025242 | Bacteria | 38912 |
| 562 | Ga0207425_1000606 | 3300025245 | Bacteria | 20792 |
| 563 | Ga0207425_1000926 | 3300025245 | Bacteria | 13967 |
| 564 | Ga0207425_1012831 | 3300025245 | Bacteria | 1953 |
| 565 | Ga0209646_1000079 | 3300025246 | Bacteria | 207677 |
| 566 | Ga0209026_1000067 | 3300025250 | Bacteria | 207677 |
| 567 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 568 | Ga0209148_1000518 | 3300025254 | Bacteria | 38312 |
| 569 | Ga0209148_1000599 | 3300025254 | Bacteria | 32537 |
| 570 | Ga0209759_1000056 | 3300025256 | Bacteria | 207677 |
| 571 | Ga0209759_1000077 | 3300025256 | Bacteria | 175706 |
| 572 | Ga0209759_1001862 | 3300025256 | Bacteria | 10487 |
| 573 | Ga0209129_1000776 | 3300025258 | Bacteria | 20242 |
| 574 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 575 | Ga0209565_1000041 | 3300025263 | Bacteria | 251081 |
| 576 | Ga0209565_1000504 | 3300025263 | Bacteria | 28431 |
| 577 | Ga0209565_1000849 | 3300025263 | Bacteria | 17247 |
| 578 | Ga0209455_1000272 | 3300025272 | Bacteria | 57248 |
| 579 | Ga0209455_1000510 | 3300025272 | Bacteria | 27792 |
| 580 | Ga0209455_1000901 | 3300025272 | Bacteria | 15518 |
| 581 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 582 | Ga0209673_1000102 | 3300025273 | Bacteria | 189583 |
| 583 | Ga0209673_1001382 | 3300025273 | Bacteria | 23815 |
| 584 | Ga0209673_1003059 | 3300025273 | Bacteria | 10312 |
| 585 | Ga0209673_1008187 | 3300025273 | Bacteria | 4693 |
| 586 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 587 | Ga0209130_1000184 | 3300025284 | Bacteria | 87817 |
| 588 | Ga0209130_1000888 | 3300025284 | Bacteria | 24370 |
| 589 | Ga0209675_1000475 | 3300025291 | Bacteria | 30742 |
| 590 | Ga0209675_1000615 | 3300025291 | Bacteria | 25527 |
| 591 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 592 | Ga0209676_1000240 | 3300025292 | Bacteria | 117689 |
| 593 | Ga0209676_1000868 | 3300025292 | Bacteria | 38801 |
| 594 | Ga0209025_1000103 | 3300025294 | Bacteria | 228054 |
| 595 | Ga0209025_1000312 | 3300025294 | Bacteria | 107913 |
| 596 | Ga0209025_1001649 | 3300025294 | Bacteria | 27534 |
| 597 | Ga0209025_1003125 | 3300025294 | Bacteria | 16198 |
| 598 | Ga0209025_1010118 | 3300025294 | Bacteria | 6440 |
| 599 | Ga0209025_1010290 | 3300025294 | Bacteria | 6356 |
| 600 | Ga0209564_1001251 | 3300025295 | Bacteria | 28255 |
| 601 | Ga0209564_1001414 | 3300025295 | Bacteria | 24743 |
| 602 | Ga0209564_1002566 | 3300025295 | Bacteria | 13966 |
| 603 | Ga0209758_1000028 | 3300025297 | Bacteria | 530102 |
| 604 | Ga0209758_1001416 | 3300025297 | Bacteria | 28400 |
| 605 | Ga0209758_1006824 | 3300025297 | Bacteria | 8001 |
| 606 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 607 | Ga0209050_1003807 | 3300025298 | Bacteria | 10766 |
| 608 | Ga0209050_1009162 | 3300025298 | Bacteria | 5119 |
| 609 | Ga0209050_1019093 | 3300025298 | Bacteria | 2625 |
| 610 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 611 | Ga0209256_1002403 | 3300025299 | Bacteria | 15370 |
| 612 | Ga0209256_1025630 | 3300025299 | Bacteria | 1713 |
| 613 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 614 | Ga0207426_1000158 | 3300025302 | Bacteria | 177323 |
| 615 | Ga0207426_1001126 | 3300025302 | Bacteria | 24341 |
| 616 | Ga0207426_1008325 | 3300025302 | Bacteria | 4207 |
| 617 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 618 | Ga0209051_1000658 | 3300025303 | Bacteria | 39012 |
| 619 | Ga0209051_1001207 | 3300025303 | Bacteria | 23322 |
| 620 | Ga0209051_1001419 | 3300025303 | Bacteria | 20568 |
| 621 | Ga0209051_1016656 | 3300025303 | Bacteria | 3312 |
| 622 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 623 | Ga0209257_1000707 | 3300025304 | Bacteria | 51654 |
| 624 | Ga0209257_1001241 | 3300025304 | Bacteria | 31534 |
| 625 | Ga0209257_1008540 | 3300025304 | Bacteria | 5784 |
| 626 | Ga0207697_10000570 | 3300025315 | Bacteria | 20951 |
| 627 | Ga0207697_10014393 | 3300025315 | Bacteria | 3281 |
| 628 | Ga0207697_10023252 | 3300025315 | Bacteria | 2537 |
| 629 | Ga0207697_10027523 | 3300025315 | Bacteria | 2324 |
| 630 | Ga0207656_10020101 | 3300025321 | Bacteria | 2650 |
| 631 | Ga0207656_10020303 | 3300025321 | Bacteria | 2639 |
| 632 | Ga0207682_10000037 | 3300025893 | Bacteria | 54103 |
| 633 | Ga0207682_10000481 | 3300025893 | Bacteria | 18483 |
| 634 | Ga0207682_10006639 | 3300025893 | Bacteria | 4650 |
| 635 | Ga0207682_10016635 | 3300025893 | Bacteria | 2870 |
| 636 | Ga0207642_10023585 | 3300025899 | Bacteria | 2460 |
| 637 | Ga0207642_10032752 | 3300025899 | Bacteria | 2192 |
| 638 | Ga0207710_10012401 | 3300025900 | Bacteria | 3587 |
| 639 | Ga0207688_10003561 | 3300025901 | Bacteria | 8498 |
| 640 | Ga0207688_10006372 | 3300025901 | Bacteria | 6427 |
| 641 | Ga0207688_10029382 | 3300025901 | Bacteria | 3026 |
| 642 | Ga0207688_10079501 | 3300025901 | Bacteria | 1870 |
| 643 | Ga0207688_10089488 | 3300025901 | Bacteria | 1766 |
| 644 | Ga0207680_10004793 | 3300025903 | Bacteria | 6439 |
| 645 | Ga0207680_10005170 | 3300025903 | Bacteria | 6226 |
| 646 | Ga0207680_10023025 | 3300025903 | Bacteria | 3396 |
| 647 | Ga0207680_10027578 | 3300025903 | Bacteria | 3165 |
| 648 | Ga0207680_10042523 | 3300025903 | Bacteria | 2658 |
| 649 | Ga0207680_10048311 | 3300025903 | Bacteria | 2527 |
| 650 | Ga0207680_10050192 | 3300025903 | Bacteria | 2488 |
| 651 | Ga0207680_10068584 | 3300025903 | Bacteria | 2188 |
| 652 | Ga0207699_10009808 | 3300025906 | Bacteria | 4785 |
| 653 | Ga0207645_10000187 | 3300025907 | Bacteria | 49829 |
| 654 | Ga0207645_10000549 | 3300025907 | Bacteria | 31247 |
| 655 | Ga0207645_10004878 | 3300025907 | Bacteria | 9838 |
| 656 | Ga0207645_10007994 | 3300025907 | Bacteria | 7420 |
| 657 | Ga0207645_10020182 | 3300025907 | Bacteria | 4364 |
| 658 | Ga0207645_10042134 | 3300025907 | Bacteria | 2921 |
| 659 | Ga0207645_10047598 | 3300025907 | Bacteria | 2738 |
| 660 | Ga0207645_10056454 | 3300025907 | Bacteria | 2507 |
| 661 | Ga0207645_10057329 | 3300025907 | Bacteria | 2487 |
| 662 | Ga0207645_10076894 | 3300025907 | Bacteria | 2138 |
| 663 | Ga0207645_10110178 | 3300025907 | Bacteria | 1782 |
| 664 | Ga0207643_10000184 | 3300025908 | Bacteria | 43056 |
| 665 | Ga0207643_10010895 | 3300025908 | Bacteria | 4904 |
| 666 | Ga0207643_10083963 | 3300025908 | Bacteria | 1848 |
| 667 | Ga0207705_10039251 | 3300025909 | Bacteria | 3392 |
| 668 | Ga0207705_10040679 | 3300025909 | Bacteria | 3335 |
| 669 | Ga0207684_10028541 | 3300025910 | Bacteria | 4754 |
| 670 | Ga0207707_10004954 | 3300025912 | Bacteria | 11704 |
| 671 | Ga0207707_10028501 | 3300025912 | Bacteria | 4880 |
| 672 | Ga0207707_10072231 | 3300025912 | Bacteria | 3008 |
| 673 | Ga0207695_10004412 | 3300025913 | Bacteria | 19220 |
| 674 | Ga0207695_10016786 | 3300025913 | Bacteria | 8548 |
| 675 | Ga0207695_10050075 | 3300025913 | Bacteria | 4397 |
| 676 | Ga0207695_10054043 | 3300025913 | Bacteria | 4197 |
| 677 | Ga0207671_10029173 | 3300025914 | Bacteria | 4121 |
| 678 | Ga0207671_10036072 | 3300025914 | Bacteria | 3667 |
| 679 | Ga0207660_10063000 | 3300025917 | Bacteria | 2672 |
| 680 | Ga0207660_10080220 | 3300025917 | Bacteria | 2396 |
| 681 | Ga0207660_10127220 | 3300025917 | Bacteria | 1936 |
| 682 | Ga0207662_10000381 | 3300025918 | Bacteria | 19870 |
| 683 | Ga0207657_10000044 | 3300025919 | Bacteria | 116398 |
| 684 | Ga0207657_10000102 | 3300025919 | Bacteria | 82096 |
| 685 | Ga0207657_10002428 | 3300025919 | Bacteria | 20129 |
| 686 | Ga0207657_10003776 | 3300025919 | Bacteria | 16099 |
| 687 | Ga0207657_10072283 | 3300025919 | Bacteria | 2918 |
| 688 | Ga0207657_10143172 | 3300025919 | Bacteria | 1952 |
| 689 | Ga0207649_10001848 | 3300025920 | Bacteria | 12101 |
| 690 | Ga0207649_10013503 | 3300025920 | Bacteria | 4559 |
| 691 | Ga0207649_10035717 | 3300025920 | Bacteria | 2988 |
| 692 | Ga0207646_10208405 | 3300025922 | Bacteria | 1765 |
| 693 | Ga0207681_10008019 | 3300025923 | Bacteria | 6460 |
| 694 | Ga0207681_10025579 | 3300025923 | Bacteria | 3798 |
| 695 | Ga0207681_10044482 | 3300025923 | Bacteria | 2976 |
| 696 | Ga0207681_10070544 | 3300025923 | Bacteria | 2433 |
| 697 | Ga0207681_10082141 | 3300025923 | Bacteria | 2277 |
| 698 | Ga0207681_10106217 | 3300025923 | Bacteria | 2034 |
| 699 | Ga0207681_10205703 | 3300025923 | Bacteria | 1514 |
| 700 | Ga0207694_10009366 | 3300025924 | Bacteria | 7386 |
| 701 | Ga0207694_10046669 | 3300025924 | Bacteria | 3348 |
| 702 | Ga0207694_10107911 | 3300025924 | Bacteria | 2212 |
| 703 | Ga0207650_10002667 | 3300025925 | Bacteria | 12349 |
| 704 | Ga0207650_10007698 | 3300025925 | Bacteria | 7339 |
| 705 | Ga0207650_10017067 | 3300025925 | Bacteria | 5081 |
| 706 | Ga0207650_10017955 | 3300025925 | Bacteria | 4958 |
| 707 | Ga0207650_10026003 | 3300025925 | Bacteria | 4173 |
| 708 | Ga0207650_10031866 | 3300025925 | Bacteria | 3810 |
| 709 | Ga0207650_10064654 | 3300025925 | Bacteria | 2739 |
| 710 | Ga0207650_10226187 | 3300025925 | Bacteria | 1507 |
| 711 | Ga0207659_10001823 | 3300025926 | Bacteria | 12620 |
| 712 | Ga0207659_10002543 | 3300025926 | Bacteria | 10856 |
| 713 | Ga0207659_10003407 | 3300025926 | Bacteria | 9525 |
| 714 | Ga0207659_10011571 | 3300025926 | Bacteria | 5578 |
| 715 | Ga0207659_10044009 | 3300025926 | Bacteria | 3139 |
| 716 | Ga0207659_10118906 | 3300025926 | Bacteria | 2022 |
| 717 | Ga0207687_10151625 | 3300025927 | Bacteria | 1769 |
| 718 | Ga0207700_10000209 | 3300025928 | Bacteria | 35041 |
| 719 | Ga0207700_10014240 | 3300025928 | Bacteria | 5204 |
| 720 | Ga0207700_10060735 | 3300025928 | Bacteria | 2863 |
| 721 | Ga0207664_10002657 | 3300025929 | Bacteria | 11853 |
| 722 | Ga0207664_10067400 | 3300025929 | Bacteria | 2872 |
| 723 | Ga0207664_10069592 | 3300025929 | Bacteria | 2830 |
| 724 | Ga0207644_10000896 | 3300025931 | Bacteria | 18852 |
| 725 | Ga0207644_10002261 | 3300025931 | Bacteria | 12495 |
| 726 | Ga0207644_10002955 | 3300025931 | Bacteria | 10951 |
| 727 | Ga0207644_10009799 | 3300025931 | Bacteria | 6299 |
| 728 | Ga0207644_10022344 | 3300025931 | Bacteria | 4321 |
| 729 | Ga0207644_10079954 | 3300025931 | Bacteria | 2413 |
| 730 | Ga0207644_10173715 | 3300025931 | Bacteria | 1684 |
| 731 | Ga0207690_10000046 | 3300025932 | Bacteria | 116358 |
| 732 | Ga0207690_10022360 | 3300025932 | Bacteria | 3932 |
| 733 | Ga0207690_10068112 | 3300025932 | Bacteria | 2444 |
| 734 | Ga0207690_10170693 | 3300025932 | Bacteria | 1629 |
| 735 | Ga0207706_10000095 | 3300025933 | Bacteria | 92378 |
| 736 | Ga0207706_10030582 | 3300025933 | Bacteria | 4802 |
| 737 | Ga0207706_10039869 | 3300025933 | Bacteria | 4164 |
| 738 | Ga0207706_10053025 | 3300025933 | Bacteria | 3580 |
| 739 | Ga0207706_10054053 | 3300025933 | Bacteria | 3544 |
| 740 | Ga0207706_10058430 | 3300025933 | Bacteria | 3397 |
| 741 | Ga0207706_10082514 | 3300025933 | Bacteria | 2825 |
| 742 | Ga0207706_10087646 | 3300025933 | Bacteria | 2737 |
| 743 | Ga0207706_10087979 | 3300025933 | Bacteria | 2732 |
| 744 | Ga0207686_10006148 | 3300025934 | Bacteria | 6450 |
| 745 | Ga0207686_10009754 | 3300025934 | Bacteria | 5218 |
| 746 | Ga0207686_10019101 | 3300025934 | Bacteria | 3892 |
| 747 | Ga0207686_10134436 | 3300025934 | Bacteria | 1701 |
| 748 | Ga0207709_10008886 | 3300025935 | Bacteria | 5546 |
| 749 | Ga0207709_10015977 | 3300025935 | Bacteria | 4166 |
| 750 | Ga0207709_10019778 | 3300025935 | Bacteria | 3790 |
| 751 | Ga0207670_10004649 | 3300025936 | Bacteria | 7438 |
| 752 | Ga0207670_10006415 | 3300025936 | Bacteria | 6522 |
| 753 | Ga0207670_10069218 | 3300025936 | Bacteria | 2434 |
| 754 | Ga0207669_10055128 | 3300025937 | Bacteria | 2405 |
| 755 | Ga0207704_10001029 | 3300025938 | Bacteria | 12386 |
| 756 | Ga0207704_10003578 | 3300025938 | Bacteria | 7057 |
| 757 | Ga0207704_10004265 | 3300025938 | Bacteria | 6533 |
| 758 | Ga0207704_10054456 | 3300025938 | Bacteria | 2439 |
| 759 | Ga0207704_10061652 | 3300025938 | Bacteria | 2328 |
| 760 | Ga0207704_10067560 | 3300025938 | Bacteria | 2249 |
| 761 | Ga0207665_10005952 | 3300025939 | Bacteria | 8114 |
| 762 | Ga0207665_10009720 | 3300025939 | Bacteria | 6313 |
| 763 | Ga0207691_10000024 | 3300025940 | Bacteria | 132111 |
| 764 | Ga0207691_10000105 | 3300025940 | Bacteria | 74790 |
| 765 | Ga0207691_10000699 | 3300025940 | Bacteria | 33182 |
| 766 | Ga0207691_10002234 | 3300025940 | Bacteria | 18960 |
| 767 | Ga0207691_10007608 | 3300025940 | Bacteria | 10426 |
| 768 | Ga0207691_10007936 | 3300025940 | Bacteria | 10213 |
| 769 | Ga0207691_10013535 | 3300025940 | Bacteria | 7802 |
| 770 | Ga0207691_10018938 | 3300025940 | Bacteria | 6521 |
| 771 | Ga0207691_10020043 | 3300025940 | Bacteria | 6326 |
| 772 | Ga0207691_10036527 | 3300025940 | Bacteria | 4553 |
| 773 | Ga0207691_10040328 | 3300025940 | Bacteria | 4314 |
| 774 | Ga0207691_10067648 | 3300025940 | Bacteria | 3230 |
| 775 | Ga0207691_10135538 | 3300025940 | Bacteria | 2172 |
| 776 | Ga0207711_10017928 | 3300025941 | Bacteria | 5883 |
| 777 | Ga0207711_10026589 | 3300025941 | Bacteria | 4855 |
| 778 | Ga0207711_10031694 | 3300025941 | Bacteria | 4464 |
| 779 | Ga0207711_10032000 | 3300025941 | Bacteria | 4445 |
| 780 | Ga0207711_10032218 | 3300025941 | Bacteria | 4431 |
| 781 | Ga0207711_10040913 | 3300025941 | Bacteria | 3944 |
| 782 | Ga0207711_10042809 | 3300025941 | Bacteria | 3859 |
| 783 | Ga0207689_10000280 | 3300025942 | Bacteria | 46392 |
| 784 | Ga0207689_10008871 | 3300025942 | Bacteria | 8727 |
| 785 | Ga0207689_10009536 | 3300025942 | Bacteria | 8377 |
| 786 | Ga0207689_10019933 | 3300025942 | Bacteria | 5648 |
| 787 | Ga0207689_10042498 | 3300025942 | Bacteria | 3759 |
| 788 | Ga0207689_10053209 | 3300025942 | Bacteria | 3336 |
| 789 | Ga0207689_10061855 | 3300025942 | Bacteria | 3079 |
| 790 | Ga0207689_10069059 | 3300025942 | Bacteria | 2903 |
| 791 | Ga0207689_10070772 | 3300025942 | Bacteria | 2865 |
| 792 | Ga0207689_10094298 | 3300025942 | Bacteria | 2458 |
| 793 | Ga0207661_10011026 | 3300025944 | Bacteria | 6533 |
| 794 | Ga0207661_10062606 | 3300025944 | Bacteria | 3010 |
| 795 | Ga0207661_10083028 | 3300025944 | Bacteria | 2650 |
| 796 | Ga0207679_10003260 | 3300025945 | Bacteria | 10024 |
| 797 | Ga0207679_10005044 | 3300025945 | Bacteria | 8254 |
| 798 | Ga0207679_10006792 | 3300025945 | Bacteria | 7252 |
| 799 | Ga0207679_10020528 | 3300025945 | Bacteria | 4459 |
| 800 | Ga0207679_10045330 | 3300025945 | Bacteria | 3179 |
| 801 | Ga0207679_10060643 | 3300025945 | Bacteria | 2812 |
| 802 | Ga0207667_10000233 | 3300025949 | Bacteria | 77272 |
| 803 | Ga0207667_10004665 | 3300025949 | Bacteria | 16788 |
| 804 | Ga0207667_10009195 | 3300025949 | Bacteria | 11673 |
| 805 | Ga0207667_10059600 | 3300025949 | Bacteria | 3997 |
| 806 | Ga0207667_10073160 | 3300025949 | Bacteria | 3561 |
| 807 | Ga0207667_10080159 | 3300025949 | Bacteria | 3382 |
| 808 | Ga0207667_10122226 | 3300025949 | Bacteria | 2683 |
| 809 | Ga0207651_10005217 | 3300025960 | Bacteria | 6639 |
| 810 | Ga0207651_10009785 | 3300025960 | Bacteria | 5272 |
| 811 | Ga0207651_10016687 | 3300025960 | Bacteria | 4311 |
| 812 | Ga0207651_10025618 | 3300025960 | Bacteria | 3669 |
| 813 | Ga0207651_10040178 | 3300025960 | Bacteria | 3092 |
| 814 | Ga0207651_10063916 | 3300025960 | Bacteria | 2573 |
| 815 | Ga0207651_10075833 | 3300025960 | Bacteria | 2401 |
| 816 | Ga0207712_10018035 | 3300025961 | Bacteria | 4592 |
| 817 | Ga0207712_10030739 | 3300025961 | Bacteria | 3612 |
| 818 | Ga0207712_10060447 | 3300025961 | Bacteria | 2686 |
| 819 | Ga0207712_10104576 | 3300025961 | Bacteria | 2111 |
| 820 | Ga0207712_10198561 | 3300025961 | Bacteria | 1589 |
| 821 | Ga0207668_10004902 | 3300025972 | Bacteria | 7872 |
| 822 | Ga0207668_10009416 | 3300025972 | Bacteria | 5854 |
| 823 | Ga0207668_10013512 | 3300025972 | Bacteria | 5031 |
| 824 | Ga0207668_10042806 | 3300025972 | Bacteria | 3069 |
| 825 | Ga0207668_10110882 | 3300025972 | Bacteria | 2058 |
| 826 | Ga0207668_10111395 | 3300025972 | Bacteria | 2054 |
| 827 | Ga0207668_10126201 | 3300025972 | Bacteria | 1946 |
| 828 | Ga0207640_10074435 | 3300025981 | Bacteria | 2299 |
| 829 | Ga0207658_10001872 | 3300025986 | Bacteria | 15746 |
| 830 | Ga0207658_10002398 | 3300025986 | Bacteria | 13742 |
| 831 | Ga0207658_10003703 | 3300025986 | Bacteria | 10771 |
| 832 | Ga0207658_10016389 | 3300025986 | Bacteria | 5097 |
| 833 | Ga0207658_10025059 | 3300025986 | Bacteria | 4175 |
| 834 | Ga0207658_10059486 | 3300025986 | Bacteria | 2847 |
| 835 | Ga0207658_10243707 | 3300025986 | Bacteria | 1524 |
| 836 | Ga0207677_10003378 | 3300026023 | Bacteria | 8450 |
| 837 | Ga0207677_10012818 | 3300026023 | Bacteria | 4837 |
| 838 | Ga0207677_10016469 | 3300026023 | Bacteria | 4382 |
| 839 | Ga0207677_10073542 | 3300026023 | Bacteria | 2421 |
| 840 | Ga0207677_10133458 | 3300026023 | Bacteria | 1889 |
| 841 | Ga0207703_10002556 | 3300026035 | Bacteria | 15720 |
| 842 | Ga0207703_10006522 | 3300026035 | Bacteria | 9310 |
| 843 | Ga0207703_10007174 | 3300026035 | Bacteria | 8864 |
| 844 | Ga0207703_10010786 | 3300026035 | Bacteria | 7129 |
| 845 | Ga0207703_10011356 | 3300026035 | Bacteria | 6930 |
| 846 | Ga0207703_10027160 | 3300026035 | Bacteria | 4507 |
| 847 | Ga0207703_10081322 | 3300026035 | Bacteria | 2700 |
| 848 | Ga0207703_10082279 | 3300026035 | Bacteria | 2686 |
| 849 | Ga0207703_10137291 | 3300026035 | Bacteria | 2118 |
| 850 | Ga0207639_10002255 | 3300026041 | Bacteria | 12960 |
| 851 | Ga0207639_10132527 | 3300026041 | Bacteria | 2065 |
| 852 | Ga0207678_10000286 | 3300026067 | Bacteria | 45712 |
| 853 | Ga0207678_10002265 | 3300026067 | Bacteria | 17417 |
| 854 | Ga0207678_10004850 | 3300026067 | Bacteria | 12084 |
| 855 | Ga0207678_10005487 | 3300026067 | Bacteria | 11335 |
| 856 | Ga0207678_10042830 | 3300026067 | Bacteria | 3920 |
| 857 | Ga0207678_10049530 | 3300026067 | Bacteria | 3630 |
| 858 | Ga0207678_10054220 | 3300026067 | Bacteria | 3453 |
| 859 | Ga0207708_10005067 | 3300026075 | Bacteria | 9717 |
| 860 | Ga0207708_10016854 | 3300026075 | Bacteria | 5501 |
| 861 | Ga0207708_10053137 | 3300026075 | Bacteria | 3086 |
| 862 | Ga0207708_10071542 | 3300026075 | Bacteria | 2657 |
| 863 | Ga0207702_10002061 | 3300026078 | Bacteria | 19456 |
| 864 | Ga0207702_10032002 | 3300026078 | Bacteria | 4387 |
| 865 | Ga0207702_10033667 | 3300026078 | Bacteria | 4281 |
| 866 | Ga0207702_10049691 | 3300026078 | Bacteria | 3539 |
| 867 | Ga0207641_10011927 | 3300026088 | Bacteria | 7131 |
| 868 | Ga0207641_10018825 | 3300026088 | Bacteria | 5663 |
| 869 | Ga0207641_10023973 | 3300026088 | Bacteria | 5029 |
| 870 | Ga0207641_10032159 | 3300026088 | Bacteria | 4355 |
| 871 | Ga0207641_10034231 | 3300026088 | Bacteria | 4224 |
| 872 | Ga0207641_10047709 | 3300026088 | Bacteria | 3612 |
| 873 | Ga0207641_10074038 | 3300026088 | Bacteria | 2936 |
| 874 | Ga0207641_10094025 | 3300026088 | Bacteria | 2628 |
| 875 | Ga0207641_10169323 | 3300026088 | Bacteria | 1992 |
| 876 | Ga0207641_10202211 | 3300026088 | Bacteria | 1832 |
| 877 | Ga0207641_10255224 | 3300026088 | Bacteria | 1639 |
| 878 | Ga0207648_10000319 | 3300026089 | Bacteria | 52621 |
| 879 | Ga0207648_10000320 | 3300026089 | Bacteria | 52595 |
| 880 | Ga0207648_10005620 | 3300026089 | Bacteria | 12601 |
| 881 | Ga0207648_10006803 | 3300026089 | Bacteria | 11335 |
| 882 | Ga0207648_10016468 | 3300026089 | Bacteria | 6752 |
| 883 | Ga0207648_10018481 | 3300026089 | Bacteria | 6311 |
| 884 | Ga0207648_10018704 | 3300026089 | Bacteria | 6266 |
| 885 | Ga0207648_10035662 | 3300026089 | Bacteria | 4382 |
| 886 | Ga0207648_10075768 | 3300026089 | Bacteria | 2932 |
| 887 | Ga0207648_10132571 | 3300026089 | Bacteria | 2193 |
| 888 | Ga0207676_10011495 | 3300026095 | Bacteria | 6331 |
| 889 | Ga0207676_10013054 | 3300026095 | Bacteria | 5963 |
| 890 | Ga0207676_10013290 | 3300026095 | Bacteria | 5914 |
| 891 | Ga0207676_10014707 | 3300026095 | Bacteria | 5636 |
| 892 | Ga0207676_10029112 | 3300026095 | Bacteria | 4132 |
| 893 | Ga0207676_10085097 | 3300026095 | Bacteria | 2579 |
| 894 | Ga0207676_10093934 | 3300026095 | Bacteria | 2470 |
| 895 | Ga0207676_10162743 | 3300026095 | Bacteria | 1935 |
| 896 | Ga0207676_10187202 | 3300026095 | Bacteria | 1818 |
| 897 | Ga0207674_10000326 | 3300026116 | Bacteria | 60670 |
| 898 | Ga0207674_10001568 | 3300026116 | Bacteria | 29439 |
| 899 | Ga0207674_10002996 | 3300026116 | Bacteria | 20950 |
| 900 | Ga0207674_10003123 | 3300026116 | Bacteria | 20429 |
| 901 | Ga0207674_10022936 | 3300026116 | Bacteria | 6696 |
| 902 | Ga0207674_10029867 | 3300026116 | Bacteria | 5735 |
| 903 | Ga0207674_10030905 | 3300026116 | Bacteria | 5629 |
| 904 | Ga0207674_10055612 | 3300026116 | Bacteria | 4022 |
| 905 | Ga0207674_10117898 | 3300026116 | Bacteria | 2625 |
| 906 | Ga0207675_100000538 | 3300026118 | Bacteria | 36903 |
| 907 | Ga0207675_100000977 | 3300026118 | Bacteria | 28393 |
| 908 | Ga0207675_100004711 | 3300026118 | Bacteria | 13130 |
| 909 | Ga0207675_100006767 | 3300026118 | Bacteria | 10842 |
| 910 | Ga0207675_100009583 | 3300026118 | Bacteria | 9059 |
| 911 | Ga0207675_100012572 | 3300026118 | Bacteria | 7906 |
| 912 | Ga0207675_100025952 | 3300026118 | Bacteria | 5453 |
| 913 | Ga0207675_100034418 | 3300026118 | Bacteria | 4724 |
| 914 | Ga0207675_100036832 | 3300026118 | Bacteria | 4563 |
| 915 | Ga0207675_100080175 | 3300026118 | Bacteria | 3060 |
| 916 | Ga0207675_100163980 | 3300026118 | Bacteria | 2121 |
| 917 | Ga0207675_100176419 | 3300026118 | Bacteria | 2045 |
| 918 | Ga0207675_100218140 | 3300026118 | Bacteria | 1837 |
| 919 | Ga0207683_10000012 | 3300026121 | Bacteria | 134768 |
| 920 | Ga0207683_10000189 | 3300026121 | Bacteria | 52818 |
| 921 | Ga0207683_10001281 | 3300026121 | Bacteria | 22746 |
| 922 | Ga0207683_10006699 | 3300026121 | Bacteria | 9854 |
| 923 | Ga0207683_10012093 | 3300026121 | Bacteria | 7366 |
| 924 | Ga0207683_10023822 | 3300026121 | Bacteria | 5266 |
| 925 | Ga0207683_10066050 | 3300026121 | Bacteria | 3190 |
| 926 | Ga0207683_10099612 | 3300026121 | Bacteria | 2594 |
| 927 | Ga0207683_10100283 | 3300026121 | Bacteria | 2585 |
| 928 | Ga0207683_10125895 | 3300026121 | Bacteria | 2303 |
| 929 | Ga0207698_10005671 | 3300026142 | Bacteria | 7733 |
| 930 | Ga0207698_10012586 | 3300026142 | Bacteria | 5543 |
| 931 | Ga0207698_10038365 | 3300026142 | Bacteria | 3539 |
| 932 | Ga0207698_10076080 | 3300026142 | Bacteria | 2685 |
| 933 | Ga0207698_10162137 | 3300026142 | Bacteria | 1957 |
| 934 | Ga0209389_1004459 | 3300027296 | Bacteria | 11670 |
| 935 | Ga0209371_1000145 | 3300027312 | Bacteria | 116135 |
| 936 | Ga0209981_1002185 | 3300027378 | Bacteria | 2490 |
| 937 | Ga0209996_1004197 | 3300027395 | Bacteria | 1828 |
| 938 | Ga0209179_1000079 | 3300027512 | Bacteria | 15586 |
| 939 | Ga0209968_1000396 | 3300027526 | Bacteria | 7091 |
| 940 | Ga0209999_1004658 | 3300027543 | Bacteria | 2460 |
| 941 | Ga0209970_1000712 | 3300027614 | Bacteria | 5781 |
| 942 | Ga0209971_1001455 | 3300027682 | Bacteria | 5882 |
| 943 | Ga0209966_1000155 | 3300027695 | Bacteria | 28831 |
| 944 | Ga0209974_10028031 | 3300027876 | Bacteria | 1864 |
| 945 | Ga0207428_10000206 | 3300027907 | Bacteria | 82022 |
| 946 | Ga0207428_10000781 | 3300027907 | Bacteria | 36098 |
| 947 | Ga0207428_10004733 | 3300027907 | Bacteria | 12873 |
| 948 | Ga0207428_10058536 | 3300027907 | Bacteria | 3057 |
| 949 | Ga0207428_10087624 | 3300027907 | Bacteria | 2422 |
| 950 | Ga0207428_10103124 | 3300027907 | Bacteria | 2202 |
| 951 | Ga0268266_10014553 | 3300028379 | Bacteria | 6759 |
| 952 | Ga0268266_10069243 | 3300028379 | Bacteria | 3057 |
| 953 | Ga0268265_10002776 | 3300028380 | Bacteria | 12916 |
| 954 | Ga0268265_10007574 | 3300028380 | Bacteria | 7326 |
| 955 | Ga0268265_10008051 | 3300028380 | Bacteria | 7119 |
| 956 | Ga0268265_10025215 | 3300028380 | Bacteria | 4217 |
| 957 | Ga0268265_10048832 | 3300028380 | Bacteria | 3179 |
| 958 | Ga0268265_10080832 | 3300028380 | Bacteria | 2564 |
| 959 | Ga0268264_10008321 | 3300028381 | Bacteria | 8623 |
| 960 | Ga0268264_10012087 | 3300028381 | Bacteria | 7107 |
| 961 | Ga0268264_10025624 | 3300028381 | Bacteria | 4818 |
| 962 | Ga0268264_10029108 | 3300028381 | Bacteria | 4523 |
| 963 | Ga0268264_10035972 | 3300028381 | Bacteria | 4077 |
| 964 | Ga0268264_10051083 | 3300028381 | Bacteria | 3444 |
| 965 | Ga0268264_10054992 | 3300028381 | Bacteria | 3325 |
| 966 | Ga0268264_10071659 | 3300028381 | Bacteria | 2937 |
| 967 | Ga0268264_10080337 | 3300028381 | Bacteria | 2784 |
| 968 | Ga0268264_10113692 | 3300028381 | Bacteria | 2375 |
| 969 | Ga0268264_10173594 | 3300028381 | Bacteria | 1952 |
| 970 | Ga0268264_10174429 | 3300028381 | Bacteria | 1947 |
| 971 | Ga0307517_10009075 | 3300028786 | Bacteria | 14168 |
| 972 | Ga0307515_10000049 | 3300028794 | Bacteria | 278611 |
| 973 | Ga0307515_10028979 | 3300028794 | Bacteria | 9381 |
| 974 | Ga0307515_10038957 | 3300028794 | Bacteria | 7579 |
| 975 | Ga0307515_10040590 | 3300028794 | Bacteria | 7353 |
| 976 | Ga0307515_10087372 | 3300028794 | Bacteria | 3958 |
| 977 | Ga0307515_10116869 | 3300028794 | Bacteria | 3058 |
| 978 | Ga0307515_10128687 | 3300028794 | Bacteria | 2806 |
| 979 | Ga0268256_1000128 | 3300030500 | Bacteria | 108651 |
| 980 | Ga0265330_10001082 | 3300031235 | Bacteria | 16406 |
| 981 | Ga0265332_10004366 | 3300031238 | Bacteria | 6650 |
| 982 | Ga0265332_10024712 | 3300031238 | Bacteria | 2641 |
| 983 | Ga0265328_10007375 | 3300031239 | Bacteria | 4586 |
| 984 | Ga0265329_10001186 | 3300031242 | Bacteria | 12780 |
| 985 | Ga0265331_10000350 | 3300031250 | Bacteria | 48905 |
| 986 | Ga0265327_10054342 | 3300031251 | Bacteria | 2073 |
| 987 | Ga0307513_10000130 | 3300031456 | Bacteria | 106451 |
| 988 | Ga0307513_10004164 | 3300031456 | Bacteria | 19364 |
| 989 | Ga0307513_10017129 | 3300031456 | Bacteria | 8703 |
| 990 | Ga0307513_10048959 | 3300031456 | Bacteria | 4581 |
| 991 | Ga0307513_10078883 | 3300031456 | Bacteria | 3404 |
| 992 | Ga0307513_10090900 | 3300031456 | Bacteria | 3112 |
| 993 | Ga0307513_10159648 | 3300031456 | Bacteria | 2149 |
| 994 | Ga0307509_10000092 | 3300031507 | Bacteria | 124019 |
| 995 | Ga0307509_10002037 | 3300031507 | Bacteria | 33298 |
| 996 | Ga0307509_10031330 | 3300031507 | Bacteria | 5872 |
| 997 | Ga0307509_10067822 | 3300031507 | Bacteria | 3735 |
| 998 | Ga0307408_100002928 | 3300031548 | Bacteria | 11829 |
| 999 | Ga0307408_100008532 | 3300031548 | Bacteria | 6766 |
| 1000 | Ga0307408_100028855 | 3300031548 | Bacteria | 3838 |
| 1001 | Ga0307408_100032521 | 3300031548 | Bacteria | 3638 |
| 1002 | Ga0307508_10001131 | 3300031616 | Bacteria | 30761 |
| 1003 | Ga0307508_10003490 | 3300031616 | Bacteria | 15867 |
| 1004 | Ga0307508_10183344 | 3300031616 | Bacteria | 1696 |
| 1005 | Ga0307514_10098191 | 3300031649 | Bacteria | 2111 |
| 1006 | Ga0265314_10007574 | 3300031711 | Bacteria | 9407 |
| 1007 | Ga0265342_10059656 | 3300031712 | Bacteria | 2253 |
| 1008 | Ga0307516_10000921 | 3300031730 | Bacteria | 40429 |
| 1009 | Ga0307516_10084089 | 3300031730 | Bacteria | 3022 |
| 1010 | Ga0307405_10001511 | 3300031731 | Bacteria | 9852 |
| 1011 | Ga0307405_10002697 | 3300031731 | Bacteria | 7925 |
| 1012 | Ga0307405_10003255 | 3300031731 | Bacteria | 7411 |
| 1013 | Ga0307405_10010341 | 3300031731 | Bacteria | 4828 |
| 1014 | Ga0307413_10025501 | 3300031824 | Bacteria | 3241 |
| 1015 | Ga0307413_10028680 | 3300031824 | Bacteria | 3104 |
| 1016 | Ga0307410_10000988 | 3300031852 | Bacteria | 12259 |
| 1017 | Ga0307410_10001960 | 3300031852 | Bacteria | 9666 |
| 1018 | Ga0307406_10003971 | 3300031901 | Bacteria | 8041 |
| 1019 | Ga0307406_10027934 | 3300031901 | Bacteria | 3405 |
| 1020 | Ga0307406_10034955 | 3300031901 | Bacteria | 3087 |
| 1021 | Ga0307406_10040728 | 3300031901 | Bacteria | 2890 |
| 1022 | Ga0307406_10046752 | 3300031901 | Bacteria | 2724 |
| 1023 | Ga0307407_10001283 | 3300031903 | Bacteria | 8965 |
| 1024 | Ga0307412_10001820 | 3300031911 | Bacteria | 11804 |
| 1025 | Ga0307412_10135456 | 3300031911 | Bacteria | 1796 |
| 1026 | Ga0307409_100000467 | 3300031995 | Bacteria | 17264 |
| 1027 | Ga0307409_100002217 | 3300031995 | Bacteria | 10044 |
| 1028 | Ga0307409_100004831 | 3300031995 | Bacteria | 7651 |
| 1029 | Ga0307409_100071573 | 3300031995 | Bacteria | 2758 |
| 1030 | Ga0307416_100007807 | 3300032002 | Bacteria | 6839 |
| 1031 | Ga0307416_100009729 | 3300032002 | Bacteria | 6313 |
| 1032 | Ga0307416_100015808 | 3300032002 | Bacteria | 5224 |
| 1033 | Ga0307416_100019906 | 3300032002 | Bacteria | 4771 |
| 1034 | Ga0307416_100071548 | 3300032002 | Bacteria | 2882 |
| 1035 | Ga0307416_100080731 | 3300032002 | Bacteria | 2747 |
| 1036 | Ga0307414_10124632 | 3300032004 | Bacteria | 1988 |
| 1037 | Ga0307411_10012027 | 3300032005 | Bacteria | 4701 |
| 1038 | Ga0307411_10070410 | 3300032005 | Bacteria | 2367 |
| 1039 | Ga0307415_100007103 | 3300032126 | Bacteria | 6098 |
| 1040 | Ga0307415_100009800 | 3300032126 | Bacteria | 5393 |
| 1041 | Ga0307415_100026213 | 3300032126 | Bacteria | 3673 |
| 1042 | Ga0307510_10001210 | 3300033180 | Bacteria | 27978 |
| 1043 | Ga0307510_10022939 | 3300033180 | Bacteria | 7239 |
| 1044 | Ga0373928_0003384 | 3300035084 | Bacteria | 3040 |
| 1045 | Ga0373946_0014842 | 3300035171 | Bacteria | 2944 |
| 1046 | Ga0373955_0063707 | 3300035172 | Bacteria | 2042 |
| 1047 | Ga0373924_0008893 | 3300035410 | Bacteria | 3666 |
| 1048 | Ga0373931_0018365 | 3300035691 | Bacteria | 3478 |
| 1049 | Ga0373931_0078560 | 3300035691 | Bacteria | 1816 |
| 1050 | Ga0373935_0008119 | 3300035692 | Bacteria | 6292 |
| 1051 | Ga0373927_0040515 | 3300035695 | Bacteria | 3021 |
| 1052 | Ga0373947_0016263 | 3300035725 | Bacteria | 4276 |
| 1053 | Ga0373947_0082902 | 3300035725 | Bacteria | 1988 |
| 1054 | Ga0373937_0007414 | 3300036401 | Bacteria | 9496 |
| 1055 | Ga0373937_0011810 | 3300036401 | Bacteria | 7667 |
| 1056 | Ga0373937_0068068 | 3300036401 | Bacteria | 3282 |
| 1057 | Ga0373937_0116588 | 3300036401 | Bacteria | 2487 |
| 1058 | Ga0373925_0011541 | 3300037068 | Bacteria | 6393 |
| 1059 | Ga0373925_0031520 | 3300037068 | Bacteria | 3897 |
| 1060 | Ga0373925_0039429 | 3300037068 | Bacteria | 3494 |
| 1061 | Ga0395900_0045834 | 3300037418 | Bacteria | 4503 |
| 1062 | Ga0395900_0058900 | 3300037418 | Bacteria | 3954 |
| 1063 | Ga0395900_0268736 | 3300037418 | Bacteria | 1701 |
| 1064 | Ga0395898_0047369 | 3300037466 | Bacteria | 4219 |
| 1065 | Ga0395905_0000047 | 3300037471 | Bacteria | 237582 |
| 1066 | Ga0395905_0000057 | 3300037471 | Bacteria | 203452 |
| 1067 | Ga0395905_0000167 | 3300037471 | Bacteria | 107775 |
| 1068 | Ga0395905_0001267 | 3300037471 | Bacteria | 31206 |
| 1069 | Ga0395905_0020959 | 3300037471 | Bacteria | 6189 |
| 1070 | Ga0395905_0024202 | 3300037471 | Bacteria | 5731 |
| 1071 | Ga0395905_0037040 | 3300037471 | Bacteria | 4581 |
| 1072 | Ga0395901_0112026 | 3300038443 | Bacteria | 2866 |
| 1073 | Ga0436365_0960063 | 3300039437 | Bacteria | 4068 |
| 1074 | Ga0436365_1841312 | 3300039437 | Bacteria | 9531 |
| 1075 | Ga0436360_0938195 | 3300039438 | Bacteria | 1941 |
| 1076 | Ga0436363_0008183 | 3300039450 | Bacteria | 2855 |
| 1077 | Ga0436363_0510015 | 3300039450 | Bacteria | 4081 |
| 1078 | Ga0439447_000273 | 3300041407 | Bacteria | 18219 |
| 1079 | Ga0439453_0001473 | 3300041408 | Bacteria | 3036 |
| 1080 | Ga0439443_000225 | 3300042003 | Bacteria | 4335 |
| 1081 | Ga0439459_0013332 | 3300042438 | Bacteria | 1478 |
| 1082 | Ga0439464_0004023 | 3300042439 | Bacteria | 3742 |
| 1083 | Ga0451577_0003798 | 3300042876 | Bacteria | 16437 |
| 1084 | Ga0451577_0005487 | 3300042876 | Bacteria | 12985 |
| 1085 | Ga0451577_0006202 | 3300042876 | Bacteria | 11997 |
| 1086 | Ga0451577_0054128 | 3300042876 | Bacteria | 3582 |
| 1087 | Ga0451577_0060282 | 3300042876 | Bacteria | 3383 |
| 1088 | Ga0451577_0130547 | 3300042876 | Bacteria | 2253 |
| 1089 | Ga0466969_0004149 | 3300044656 | Bacteria | 7694 |
| 1090 | Ga0466977_0009695 | 3300044666 | Bacteria | 5437 |
| 1091 | Ga0453683_0066816 | 3300044673 | Bacteria | 2247 |
| 1092 | Ga0466961_0019037 | 3300044693 | Bacteria | 4417 |
| 1093 | Ga0453684_0074538 | 3300044712 | Bacteria | 4271 |
| 1094 | Ga0453684_0136057 | 3300044712 | Bacteria | 2942 |
| 1095 | Ga0453684_0368506 | 3300044712 | Bacteria | 1615 |
| 1096 | Ga0466959_0007477 | 3300045049 | Bacteria | 7668 |
| 1097 | Ga0451576_0002691 | 3300045051 | Bacteria | 25879 |
| 1098 | Ga0451576_0013845 | 3300045051 | Bacteria | 9011 |
| 1099 | Ga0451576_0078120 | 3300045051 | Bacteria | 3445 |
| 1100 | Ga0451576_0115595 | 3300045051 | Bacteria | 2793 |
| 1101 | Ga0451576_0173239 | 3300045051 | Bacteria | 2252 |
| 1102 | Ga0495627_004628 | 3300046453 | Bacteria | 5707 |
| 1103 | Ga0495592_0000413 | 3300046454 | Bacteria | 32677 |
| 1104 | Ga0495592_0058453 | 3300046454 | Bacteria | 2844 |
| 1105 | Ga0495592_0099604 | 3300046454 | Bacteria | 2073 |
| 1106 | Ga0495603_0017236 | 3300046455 | Bacteria | 4372 |
| 1107 | Ga0495629_0000020 | 3300046459 | Bacteria | 155818 |
| 1108 | Ga0495629_0000042 | 3300046459 | Bacteria | 112605 |
| 1109 | Ga0495629_0001082 | 3300046459 | Bacteria | 21638 |
| 1110 | Ga0495629_0012741 | 3300046459 | Bacteria | 6087 |
| 1111 | Ga0495629_0039444 | 3300046459 | Bacteria | 3324 |
| 1112 | Ga0495638_0014812 | 3300046460 | Bacteria | 5258 |
| 1113 | Ga0495638_0016411 | 3300046460 | Bacteria | 4960 |
| 1114 | Ga0495651_0003918 | 3300046462 | Bacteria | 11381 |
| 1115 | Ga0495651_0041791 | 3300046462 | Bacteria | 3561 |
| 1116 | Ga0495653_0000321 | 3300046463 | Bacteria | 39085 |
| 1117 | Ga0495653_0000388 | 3300046463 | Bacteria | 35251 |
| 1118 | Ga0495653_0004554 | 3300046463 | Bacteria | 11203 |
| 1119 | Ga0495650_0022112 | 3300046471 | Bacteria | 3056 |
| 1120 | Ga0495580_0000022 | 3300046472 | Bacteria | 89749 |
| 1121 | Ga0495580_0000355 | 3300046472 | Bacteria | 37382 |
| 1122 | Ga0495580_0000357 | 3300046472 | Bacteria | 37302 |
| 1123 | Ga0495580_0000527 | 3300046472 | Bacteria | 32321 |
| 1124 | Ga0495580_0005233 | 3300046472 | Bacteria | 10781 |
| 1125 | Ga0495580_0006761 | 3300046472 | Bacteria | 9299 |
| 1126 | Ga0495580_0045155 | 3300046472 | Bacteria | 3130 |
| 1127 | Ga0495580_0056957 | 3300046472 | Bacteria | 2751 |
| 1128 | Ga0495582_0000803 | 3300046473 | Bacteria | 17428 |
| 1129 | Ga0495582_0041840 | 3300046473 | Bacteria | 2524 |
| 1130 | Ga0495582_0057192 | 3300046473 | Bacteria | 2150 |
| 1131 | Ga0495605_0003499 | 3300046474 | Bacteria | 9338 |
| 1132 | Ga0495605_0036748 | 3300046474 | Bacteria | 2467 |
| 1133 | Ga0495662_0017399 | 3300046476 | Bacteria | 3479 |
| 1134 | Ga0495664_0059308 | 3300046477 | Bacteria | 2277 |
| 1135 | Ga0495594_0031581 | 3300046499 | Bacteria | 2872 |
| 1136 | Ga0495594_0044741 | 3300046499 | Bacteria | 2429 |
| 1137 | Ga0495583_0019594 | 3300046506 | Bacteria | 3527 |
| 1138 | Ga0495583_0032370 | 3300046506 | Bacteria | 2524 |
| 1139 | Ga0495606_0037544 | 3300046507 | Bacteria | 3289 |
| 1140 | Ga0495608_0004039 | 3300046511 | Bacteria | 10532 |
| 1141 | Ga0495618_0000764 | 3300046514 | Bacteria | 22494 |
| 1142 | Ga0495618_0009666 | 3300046514 | Bacteria | 5822 |
| 1143 | Ga0495620_0005754 | 3300046515 | Bacteria | 6888 |
| 1144 | Ga0495620_0035360 | 3300046515 | Bacteria | 2247 |
| 1145 | Ga0495628_0002401 | 3300046516 | Bacteria | 16892 |
| 1146 | Ga0495628_0004370 | 3300046516 | Bacteria | 12536 |
| 1147 | Ga0495628_0007611 | 3300046516 | Bacteria | 9360 |
| 1148 | Ga0495628_0010826 | 3300046516 | Bacteria | 7722 |
| 1149 | Ga0495628_0018544 | 3300046516 | Bacteria | 5761 |
| 1150 | Ga0495628_0063419 | 3300046516 | Bacteria | 2895 |
| 1151 | Ga0495628_0077324 | 3300046516 | Bacteria | 2589 |
| 1152 | Ga0495630_0003094 | 3300046517 | Bacteria | 11541 |
| 1153 | Ga0495630_0012684 | 3300046517 | Bacteria | 6124 |
| 1154 | Ga0495630_0016330 | 3300046517 | Bacteria | 5423 |
| 1155 | Ga0495630_0111536 | 3300046517 | Bacteria | 2071 |
| 1156 | Ga0495632_0028648 | 3300046519 | Bacteria | 2905 |
| 1157 | Ga0495648_0002871 | 3300046524 | Bacteria | 15523 |
| 1158 | Ga0495648_0032508 | 3300046524 | Bacteria | 3421 |
| 1159 | Ga0495648_0055057 | 3300046524 | Bacteria | 2399 |
| 1160 | Ga0495666_0000243 | 3300046526 | Bacteria | 23496 |
| 1161 | Ga0495652_0007905 | 3300046529 | Bacteria | 9763 |
| 1162 | Ga0495654_0001492 | 3300046530 | Bacteria | 16011 |
| 1163 | Ga0495654_0007291 | 3300046530 | Bacteria | 6192 |
| 1164 | Ga0495654_0026124 | 3300046530 | Bacteria | 3005 |
| 1165 | Ga0495665_0004168 | 3300046531 | Bacteria | 7796 |
| 1166 | Ga0495665_0032218 | 3300046531 | Bacteria | 2803 |
| 1167 | Ga0495640_0016325 | 3300046533 | Bacteria | 5557 |
| 1168 | Ga0495587_0007176 | 3300046536 | Bacteria | 7232 |
| 1169 | Ga0495597_0000109 | 3300046542 | Bacteria | 73193 |
| 1170 | Ga0495645_0000691 | 3300046543 | Bacteria | 23175 |
| 1171 | Ga0495645_0016092 | 3300046543 | Bacteria | 5333 |
| 1172 | Ga0495645_0025940 | 3300046543 | Bacteria | 4255 |
| 1173 | Ga0495645_0039588 | 3300046543 | Bacteria | 3438 |
| 1174 | Ga0495645_0113845 | 3300046543 | Bacteria | 1912 |
| 1175 | Ga0495622_0011113 | 3300046557 | Bacteria | 4155 |
| 1176 | Ga0495656_0000073 | 3300046615 | Bacteria | 44754 |
| 1177 | Ga0495656_0005404 | 3300046615 | Bacteria | 4409 |
| 1178 | Ga0495668_0001832 | 3300046616 | Bacteria | 19226 |
| 1179 | Ga0495634_0000449 | 3300046642 | Bacteria | 40909 |
| 1180 | Ga0495611_0014066 | 3300046648 | Bacteria | 3414 |
| 1181 | Ga0495625_0000336 | 3300046660 | Bacteria | 71606 |
| 1182 | Ga0495625_0031340 | 3300046660 | Bacteria | 3957 |
| 1183 | Ga0495635_0001225 | 3300046663 | Bacteria | 17164 |
| 1184 | Ga0495635_0062897 | 3300046663 | Bacteria | 2548 |
| 1185 | Ga0495661_0009270 | 3300046665 | Bacteria | 6761 |
| 1186 | Ga0495588_0005333 | 3300046674 | Bacteria | 5717 |
| 1187 | Ga0495588_0008426 | 3300046674 | Bacteria | 4732 |
| 1188 | Ga0495588_0010894 | 3300046674 | Bacteria | 4250 |
| 1189 | Ga0495657_0089713 | 3300046675 | Bacteria | 1974 |
| 1190 | Ga0495599_0000731 | 3300046678 | Bacteria | 18528 |
| 1191 | Ga0495599_0003001 | 3300046678 | Bacteria | 9830 |
| 1192 | Ga0495599_0009689 | 3300046678 | Bacteria | 5894 |
| 1193 | Ga0495623_0010970 | 3300046679 | Bacteria | 5863 |
| 1194 | Ga0495623_0029621 | 3300046679 | Bacteria | 3522 |
| 1195 | Ga0495623_0054742 | 3300046679 | Bacteria | 2516 |
| 1196 | Ga0495646_0000273 | 3300046680 | Bacteria | 26278 |
| 1197 | Ga0495646_0000495 | 3300046680 | Bacteria | 21056 |
| 1198 | Ga0495646_0003800 | 3300046680 | Bacteria | 9442 |
| 1199 | Ga0495647_0027804 | 3300046681 | Bacteria | 2081 |
| 1200 | Ga0495658_0071811 | 3300046683 | Bacteria | 2012 |
| 1201 | Ga0495613_0054111 | 3300046689 | Bacteria | 2951 |
| 1202 | Ga0495624_0000216 | 3300046690 | Bacteria | 44450 |
| 1203 | Ga0495624_0000591 | 3300046690 | Bacteria | 28234 |
| 1204 | Ga0495624_0005260 | 3300046690 | Bacteria | 9344 |
| 1205 | Ga0495624_0046993 | 3300046690 | Bacteria | 2743 |
| 1206 | Ga0495671_0003854 | 3300046692 | Bacteria | 9116 |
| 1207 | Ga0495600_0000574 | 3300046809 | Bacteria | 19018 |
| 1208 | Ga0495600_0071242 | 3300046809 | Bacteria | 2271 |
| 1209 | Ga0495581_0000200 | 3300047315 | Bacteria | 27892 |
| 1210 | Ga0495581_0004525 | 3300047315 | Bacteria | 8034 |
| 1211 | Ga0495604_0001161 | 3300047317 | Bacteria | 21748 |
| 1212 | Ga0495604_0001825 | 3300047317 | Bacteria | 17340 |
| 1213 | Ga0495604_0006351 | 3300047317 | Bacteria | 9372 |
| 1214 | Ga0495674_0027772 | 3300047319 | Bacteria | 5167 |
| 1215 | Ga0495674_0052470 | 3300047319 | Bacteria | 3588 |
| 1216 | Ga0495674_0115719 | 3300047319 | Bacteria | 2269 |
| 1217 | Ga0495674_0120152 | 3300047319 | Bacteria | 2220 |
| 1218 | Ga0495674_0127841 | 3300047319 | Bacteria | 2142 |
| 1219 | Ga0495672_0113394 | 3300047320 | Bacteria | 1452 |
| 1220 | Ga0495676_0014537 | 3300047321 | Bacteria | 7042 |
| 1221 | Ga0495676_0134445 | 3300047321 | Bacteria | 1781 |
| 1222 | Ga0495680_0001617 | 3300047322 | Bacteria | 23953 |
| 1223 | Ga0495683_0010201 | 3300047323 | Bacteria | 4974 |
| 1224 | Ga0495687_001245 | 3300047443 | Bacteria | 24266 |
| 1225 | Ga0495687_011843 | 3300047443 | Bacteria | 4658 |
| 1226 | Ga0495687_016528 | 3300047443 | Bacteria | 3709 |
| 1227 | Ga0495675_0031568 | 3300047444 | Bacteria | 3381 |
| 1228 | Ga0495679_000022 | 3300047446 | Bacteria | 215296 |
| 1229 | Ga0495679_000023 | 3300047446 | Bacteria | 209366 |
| 1230 | Ga0495684_0015873 | 3300047471 | Bacteria | 5798 |
| 1231 | Ga0495686_0002020 | 3300047472 | Bacteria | 20040 |
| 1232 | Ga0495593_0005313 | 3300047673 | Bacteria | 7612 |
| 1233 | Ga0495593_0010132 | 3300047673 | Bacteria | 5454 |
| 1234 | Ga0495593_0042654 | 3300047673 | Bacteria | 2434 |
| 1235 | Ga0495602_0022700 | 3300048088 | Bacteria | 6136 |
| 1236 | Ga0495602_0081917 | 3300048088 | Bacteria | 2710 |
| 1237 | Ga0495626_0013149 | 3300048091 | Bacteria | 4312 |
| 1238 | Ga0496100_0005628 | 3300048903 | Bacteria | 6770 |
| 1239 | Ga0496101_0001603 | 3300048904 | Bacteria | 13608 |
| 1240 | Ga0496101_0001874 | 3300048904 | Bacteria | 12700 |
| 1241 | Ga0496101_0001982 | 3300048904 | Bacteria | 12422 |
| 1242 | Ga0496101_0015940 | 3300048904 | Bacteria | 5070 |
| 1243 | Ga0496102_0000134 | 3300048905 | Bacteria | 101631 |
| 1244 | Ga0496102_0001296 | 3300048905 | Bacteria | 22482 |
| 1245 | Ga0496102_0019884 | 3300048905 | Bacteria | 5921 |
| 1246 | Ga0496102_0034159 | 3300048905 | Bacteria | 4573 |
| 1247 | Ga0496102_0097188 | 3300048905 | Bacteria | 2731 |
| 1248 | Ga0496102_0150641 | 3300048905 | Bacteria | 2186 |
| 1249 | Ga0496102_0202635 | 3300048905 | Bacteria | 1870 |
| 1250 | Ga0496103_0008446 | 3300048906 | Bacteria | 6117 |
| 1251 | Ga0496103_0018691 | 3300048906 | Bacteria | 4158 |
| 1252 | Ga0496104_0015582 | 3300048907 | Bacteria | 6889 |
| 1253 | Ga0496104_0019309 | 3300048907 | Bacteria | 6233 |
| 1254 | Ga0496104_0028189 | 3300048907 | Bacteria | 5204 |
| 1255 | Ga0496104_0031984 | 3300048907 | Bacteria | 4895 |
| 1256 | Ga0496104_0147391 | 3300048907 | Bacteria | 2260 |
| 1257 | Ga0496105_0001714 | 3300048908 | Bacteria | 15656 |
| 1258 | Ga0496105_0001879 | 3300048908 | Bacteria | 15072 |
| 1259 | Ga0496105_0012490 | 3300048908 | Bacteria | 6724 |
| 1260 | Ga0496105_0043715 | 3300048908 | Bacteria | 3695 |
| 1261 | Ga0496106_0014091 | 3300048909 | Bacteria | 5908 |
| 1262 | Ga0496106_0016853 | 3300048909 | Bacteria | 5407 |
| 1263 | Ga0496106_0021059 | 3300048909 | Bacteria | 4840 |
| 1264 | Ga0496106_0035476 | 3300048909 | Bacteria | 3729 |
| 1265 | Ga0496106_0139713 | 3300048909 | Bacteria | 1905 |
| 1266 | Ga0496107_0034910 | 3300048910 | Bacteria | 3604 |
| 1267 | Ga0496107_0049028 | 3300048910 | Bacteria | 3043 |
| 1268 | Ga0496107_0100942 | 3300048910 | Bacteria | 2116 |
| 1269 | Ga0496108_0000794 | 3300048911 | Bacteria | 24612 |
| 1270 | Ga0496108_0003455 | 3300048911 | Bacteria | 12673 |
| 1271 | Ga0496108_0031647 | 3300048911 | Bacteria | 4390 |
| 1272 | Ga0496109_0004794 | 3300048912 | Bacteria | 11294 |
| 1273 | Ga0496109_0043374 | 3300048912 | Bacteria | 4077 |
| 1274 | Ga0496109_0119878 | 3300048912 | Bacteria | 2450 |
| 1275 | Ga0496109_0123688 | 3300048912 | Bacteria | 2411 |
| 1276 | Ga0496110_0000815 | 3300048913 | Bacteria | 21835 |
| 1277 | Ga0496110_0012905 | 3300048913 | Bacteria | 6888 |
| 1278 | Ga0496110_0034532 | 3300048913 | Bacteria | 4381 |
| 1279 | Ga0496110_0082986 | 3300048913 | Bacteria | 2858 |
| 1280 | Ga0496110_0238846 | 3300048913 | Bacteria | 1653 |
| 1281 | Ga0496111_0015150 | 3300048914 | Bacteria | 5284 |
| 1282 | Ga0496111_0037061 | 3300048914 | Bacteria | 3489 |
| 1283 | Ga0496112_0028019 | 3300048915 | Bacteria | 5434 |
| 1284 | Ga0496112_0050856 | 3300048915 | Bacteria | 4064 |
| 1285 | Ga0496113_0076740 | 3300048916 | Bacteria | 2553 |
| 1286 | Ga0496113_0128587 | 3300048916 | Bacteria | 1986 |
| 1287 | Ga0496114_0022351 | 3300048917 | Bacteria | 5154 |
| 1288 | Ga0496114_0102079 | 3300048917 | Bacteria | 2450 |
| 1289 | Ga0496114_0107069 | 3300048917 | Bacteria | 2392 |
| 1290 | Ga0496116_0000503 | 3300048919 | Bacteria | 53433 |
| 1291 | Ga0496116_0038047 | 3300048919 | Bacteria | 3346 |
| 1292 | Ga0496118_0001420 | 3300048921 | Bacteria | 36121 |
| 1293 | Ga0496118_0032105 | 3300048921 | Bacteria | 4336 |
| 1294 | Ga0496118_0042544 | 3300048921 | Bacteria | 3582 |
| 1295 | Ga0496118_0043723 | 3300048921 | Bacteria | 3517 |
| 1296 | Ga0496119_0015463 | 3300048922 | Bacteria | 5872 |
| 1297 | Ga0496121_0006720 | 3300048924 | Bacteria | 14120 |
| 1298 | Ga0496121_0013264 | 3300048924 | Bacteria | 8874 |
| 1299 | Ga0496124_0066277 | 3300048927 | Bacteria | 3007 |
| 1300 | Ga0496125_0005958 | 3300048928 | Bacteria | 13344 |
| 1301 | Ga0496126_0000414 | 3300048929 | Bacteria | 86330 |
| 1302 | Ga0496126_0112018 | 3300048929 | Bacteria | 2376 |
| 1303 | Ga0501032_0001833 | 3300049569 | Bacteria | 16806 |
| 1304 | Ga0501033_0008938 | 3300049570 | Bacteria | 7737 |
| 1305 | Ga0501034_0000875 | 3300049571 | Bacteria | 44296 |
| 1306 | Ga0501034_0008902 | 3300049571 | Bacteria | 10548 |
| 1307 | Ga0501034_0064231 | 3300049571 | Bacteria | 3685 |
| 1308 | Ga0501036_0023251 | 3300049572 | Bacteria | 5219 |
| 1309 | Ga0501037_0005118 | 3300049573 | Bacteria | 9537 |
| 1310 | Ga0501038_0001970 | 3300049574 | Bacteria | 18956 |
| 1311 | Ga0501038_0050477 | 3300049574 | Bacteria | 3594 |
| 1312 | Ga0501039_0001598 | 3300049575 | Bacteria | 16684 |
| 1313 | Ga0501040_0009684 | 3300049576 | Bacteria | 6291 |
| 1314 | Ga0501041_0003172 | 3300049577 | Bacteria | 9459 |
| 1315 | Ga0501041_0014118 | 3300049577 | Bacteria | 4740 |
| 1316 | Ga0501042_0013253 | 3300049578 | Bacteria | 5612 |
| 1317 | Ga0501043_0000059 | 3300049579 | Bacteria | 101444 |
| 1318 | Ga0501043_0000364 | 3300049579 | Bacteria | 40997 |
| 1319 | Ga0501043_0028562 | 3300049579 | Bacteria | 4379 |
| 1320 | Ga0501046_0000082 | 3300049580 | Bacteria | 101313 |
| 1321 | Ga0501046_0000867 | 3300049580 | Bacteria | 29435 |
| 1322 | Ga0501047_0000050 | 3300049581 | Bacteria | 155628 |
| 1323 | Ga0501047_0002160 | 3300049581 | Bacteria | 18806 |
| 1324 | Ga0501047_0025367 | 3300049581 | Bacteria | 5698 |
| 1325 | Ga0501048_0007107 | 3300049582 | Bacteria | 8505 |
| 1326 | Ga0501067_0001425 | 3300049583 | Bacteria | 12977 |
| 1327 | Ga0501069_0003379 | 3300049585 | Bacteria | 8191 |
| 1328 | Ga0501069_0011483 | 3300049585 | Bacteria | 4692 |
| 1329 | Ga0501070_0001480 | 3300049586 | Bacteria | 21020 |
| 1330 | Ga0501070_0001836 | 3300049586 | Bacteria | 18720 |
| 1331 | Ga0501070_0117916 | 3300049586 | Bacteria | 2193 |
| 1332 | Ga0501072_0013754 | 3300049588 | Bacteria | 6195 |
| 1333 | Ga0501072_0126112 | 3300049588 | Bacteria | 2040 |
| 1334 | Ga0501073_0000067 | 3300049589 | Bacteria | 64981 |
| 1335 | Ga0501073_0000620 | 3300049589 | Bacteria | 25004 |
| 1336 | Ga0501073_0010743 | 3300049589 | Bacteria | 6704 |
| 1337 | Ga0501074_0000588 | 3300049590 | Bacteria | 22586 |
| 1338 | Ga0501074_0021833 | 3300049590 | Bacteria | 4647 |
| 1339 | Ga0501074_0055534 | 3300049590 | Bacteria | 2854 |
| 1340 | Ga0501075_0039065 | 3300049591 | Bacteria | 3551 |
| 1341 | Ga0501076_0070867 | 3300049592 | Bacteria | 2787 |
| 1342 | Ga0501079_0009324 | 3300049741 | Bacteria | 7438 |
| 1343 | Ga0501080_0001874 | 3300049742 | Bacteria | 18084 |
| 1344 | Ga0501080_0031615 | 3300049742 | Bacteria | 4932 |
| 1345 | Ga0501080_0034930 | 3300049742 | Bacteria | 4694 |
| 1346 | Ga0501080_0050436 | 3300049742 | Bacteria | 3873 |
| 1347 | Ga0501080_0075888 | 3300049742 | Bacteria | 3126 |
| 1348 | Ga0501080_0173142 | 3300049742 | Bacteria | 1990 |
| 1349 | Ga0501081_0004799 | 3300049743 | Bacteria | 8689 |
| 1350 | Ga0501083_0000515 | 3300049744 | Bacteria | 24650 |
| 1351 | Ga0501083_0006601 | 3300049744 | Bacteria | 8232 |
| 1352 | Ga0501083_0010787 | 3300049744 | Bacteria | 6426 |
| 1353 | Ga0501035_0006788 | 3300049822 | Bacteria | 10695 |
| 1354 | Ga0501035_0056178 | 3300049822 | Bacteria | 3513 |
| 1355 | Ga0501044_0009350 | 3300049823 | Bacteria | 10688 |
| 1356 | Ga0501044_0039230 | 3300049823 | Bacteria | 4941 |
| 1357 | Ga0501045_0005237 | 3300049824 | Bacteria | 8974 |
| 1358 | Ga0501045_0011333 | 3300049824 | Bacteria | 6259 |
| 1359 | Ga0501045_0057126 | 3300049824 | Bacteria | 2855 |
| 1360 | nmdc:mga00v17_58158_c1 | 3300050491 | Bacteria | 2367 |
| 1361 | nmdc:mga0yw44_36343_c1 | 3300050492 | Bacteria | 2902 |
| 1362 | nmdc:mga0k408_19005_c1 | 3300050493 | Bacteria | 3836 |
| 1363 | nmdc:mga0k408_7246_c1 | 3300050493 | Bacteria | 5928 |
| 1364 | nmdc:mga0k408_9560_c1 | 3300050493 | Bacteria | 5231 |
| 1365 | nmdc:mga07m45_12057_c1 | 3300050496 | Bacteria | 4559 |
| 1366 | nmdc:mga07m45_16737_c1 | 3300050496 | Bacteria | 3928 |
| 1367 | nmdc:mga07m45_75490_c1 | 3300050496 | Bacteria | 1921 |
| 1368 | nmdc:mga0qj67_95097_c1 | 3300050509 | Bacteria | 2398 |
| 1369 | nmdc:mga06r32_1173_c1 | 3300050510 | Bacteria | 23604 |
| 1370 | nmdc:mga08y16_16_c1 | 3300050511 | Bacteria | 386948 |
| 1371 | nmdc:mga08y16_215245_c1 | 3300050511 | Bacteria | 1989 |
| 1372 | nmdc:mga08y16_2283_c1 | 3300050511 | Bacteria | 19654 |
| 1373 | nmdc:mga08y16_24582_c1 | 3300050511 | Bacteria | 6357 |
| 1374 | nmdc:mga08y16_58737_c1 | 3300050511 | Bacteria | 4019 |
| 1375 | nmdc:mga0n895_108765_c1 | 3300050512 | Bacteria | 2787 |
| 1376 | nmdc:mga0n895_131858_c1 | 3300050512 | Bacteria | 2524 |
| 1377 | nmdc:mga0n895_43955_c1 | 3300050512 | Bacteria | 4356 |
| 1378 | nmdc:mga0n895_95941_c1 | 3300050512 | Bacteria | 2970 |
| 1379 | nmdc:mga0rr50_48425_c1 | 3300050513 | Bacteria | 3141 |
| 1380 | nmdc:mga08x19_16319_c1 | 3300050514 | Bacteria | 4527 |
| 1381 | nmdc:mga08x19_23730_c1 | 3300050514 | Bacteria | 3806 |
| 1382 | nmdc:mga0a205_1477_c1 | 3300050515 | Bacteria | 15134 |
| 1383 | nmdc:mga0a205_20144_c1 | 3300050515 | Bacteria | 6293 |
| 1384 | nmdc:mga0a205_40982_c1 | 3300050515 | Bacteria | 4459 |
| 1385 | Ga0495601_0008116 | 3300053077 | Bacteria | 6191 |
| 1386 | Ga0495619_0044616 | 3300053085 | Bacteria | 2910 |
| 1387 | Ga0500578_0109622 | 3300053086 | Bacteria | 1741 |
| 1388 | Ga0500643_021945 | 3300053087 | Bacteria | 2063 |
| 1389 | Ga0500644_0037720 | 3300053088 | Bacteria | 1582 |
| 1390 | Ga0500646_0027016 | 3300053090 | Bacteria | 1559 |
| 1391 | Ga0500651_0000040 | 3300053093 | Bacteria | 92649 |
| 1392 | Ga0500651_0013116 | 3300053093 | Bacteria | 5039 |
| 1393 | Ga0500566_0050220 | 3300053094 | Bacteria | 2389 |
| 1394 | Ga0500641_0043206 | 3300053096 | Bacteria | 1829 |
| 1395 | Ga0500562_004410 | 3300053108 | Bacteria | 3561 |
| 1396 | Ga0500571_000030 | 3300053110 | Bacteria | 47663 |
| 1397 | Ga0500572_011206 | 3300053111 | Bacteria | 2162 |
| 1398 | Ga0500592_004646 | 3300053116 | Bacteria | 2183 |
| 1399 | Ga0500593_000168 | 3300053117 | Bacteria | 26386 |
| 1400 | Ga0500593_000252 | 3300053117 | Bacteria | 21954 |
| 1401 | Ga0500595_001190 | 3300053119 | Bacteria | 14365 |
| 1402 | Ga0500642_0002005 | 3300053130 | Bacteria | 5906 |
| 1403 | Ga0500642_0038289 | 3300053130 | Bacteria | 2054 |
| 1404 | Ga0500655_000797 | 3300053133 | Bacteria | 6194 |
| 1405 | Ga0500559_0000017 | 3300053136 | Bacteria | 143646 |
| 1406 | Ga0500564_035954 | 3300053138 | Bacteria | 2286 |
| 1407 | Ga0500568_0003326 | 3300053139 | Bacteria | 9045 |
| 1408 | Ga0500574_002682 | 3300053141 | Bacteria | 2984 |
| 1409 | Ga0500574_003369 | 3300053141 | Bacteria | 2814 |
| 1410 | Ga0500604_0001284 | 3300053151 | Bacteria | 7030 |
| 1411 | Ga0500616_0003059 | 3300053153 | Bacteria | 13150 |
| 1412 | Ga0500622_0002180 | 3300053156 | Bacteria | 14473 |
| 1413 | Ga0500627_0005829 | 3300053158 | Bacteria | 4130 |
| 1414 | Ga0500634_0009019 | 3300053161 | Bacteria | 5017 |
| 1415 | Ga0500645_000151 | 3300053730 | Bacteria | 54244 |
| 1416 | Ga0500645_000242 | 3300053730 | Bacteria | 40854 |
| 1417 | Ga0500645_000333 | 3300053730 | Bacteria | 33591 |
| 1418 | Ga0500645_000991 | 3300053730 | Bacteria | 16014 |
| 1419 | Ga0500645_001359 | 3300053730 | Bacteria | 12598 |
| 1420 | Ga0500645_009566 | 3300053730 | Bacteria | 3250 |
| 1421 | Ga0501084_0110025 | 3300054114 | Bacteria | 2315 |
| 1422 | Ga0500661_000506 | 3300055283 | Bacteria | 7251 |
| 1423 | Ga0590075_018559 | 3300059424 | Bacteria | 1721 |
| 1424 | Ga0501082_0001879 | 3300060353 | Bacteria | 18478 |
| 1425 | Ga0530510_0003494 | 3300061734 | Bacteria | 10800 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0368506 | Ga0453684_0368506_375_1601 | 408 |
| 2 | iso_pu_bacteria | 2928084124 | 2928090891 | 432 |
| 3 | 3300005334 | Ga0068869_100069803 | Ga0068869_1000698031 | 438 |
| 4 | 3300046679 | Ga0495623_0029621 | Ga0495623_0029621_1482_2822 | 438 |
| 5 | 3300035172 | Ga0373955_0063707 | Ga0373955_0063707_23_1348 | 440 |
| 6 | 3300049586 | Ga0501070_0117916 | Ga0501070_0117916_445_1779 | 444 |
| 7 | 3300053077 | Ga0495601_0008116 | Ga0495601_0008116_3706_5157 | 446 |
| 8 | 3300025228 | Ga0209672_100041 | Ga0209672_100041250 | 447 |
| 9 | 3300025229 | Ga0209147_100226 | Ga0209147_10022625 | 447 |
| 10 | 3300025242 | Ga0209258_100309 | Ga0209258_10030952 | 447 |
| 11 | 3300035171 | Ga0373946_0014842 | Ga0373946_0014842_203_1567 | 447 |
| 12 | 3300042876 | Ga0451577_0006202 | Ga0451577_0006202_1970_3409 | 448 |
| 13 | 3300013306 | Ga0163162_10288563 | Ga0163162_102885631 | 449 |
| 14 | 3300025942 | Ga0207689_10070772 | Ga0207689_100707722 | 449 |
| 15 | 3300005339 | Ga0070660_100000040 | Ga0070660_10000004044 | 450 |
| 16 | 3300005366 | Ga0070659_100000335 | Ga0070659_10000033529 | 450 |
| 17 | 3300005455 | Ga0070663_100000273 | Ga0070663_10000027322 | 450 |
| 18 | 3300005614 | Ga0068856_100129036 | Ga0068856_1001290362 | 450 |
| 19 | 3300005842 | Ga0068858_100171609 | Ga0068858_1001716091 | 450 |
| 20 | 3300009093 | Ga0105240_10160746 | Ga0105240_101607462 | 450 |
| 21 | 3300010375 | Ga0105239_10040067 | Ga0105239_100400673 | 450 |
| 22 | 3300025914 | Ga0207671_10036072 | Ga0207671_100360722 | 450 |
| 23 | 3300025919 | Ga0207657_10000044 | Ga0207657_1000004460 | 450 |
| 24 | 3300025924 | Ga0207694_10046669 | Ga0207694_100466692 | 450 |
| 25 | 3300025932 | Ga0207690_10000046 | Ga0207690_1000004660 | 450 |
| 26 | 3300025949 | Ga0207667_10004665 | Ga0207667_100046658 | 450 |
| 27 | 3300026035 | Ga0207703_10137291 | Ga0207703_101372911 | 450 |
| 28 | 3300026067 | Ga0207678_10000286 | Ga0207678_1000028613 | 450 |
| 29 | 3300053730 | Ga0500645_000151 | Ga0500645_000151_43549_45003 | 450 |
| 30 | 3300005364 | Ga0070673_100046988 | Ga0070673_1000469882 | 451 |
| 31 | 3300005618 | Ga0068864_100061160 | Ga0068864_1000611602 | 451 |
| 32 | 3300025925 | Ga0207650_10064654 | Ga0207650_100646542 | 451 |
| 33 | 3300025940 | Ga0207691_10135538 | Ga0207691_101355382 | 451 |
| 34 | 3300001989 | JGI24739J22299_10002041 | JGI24739J22299_100020415 | 452 |
| 35 | 3300005327 | Ga0070658_10175530 | Ga0070658_101755301 | 452 |
| 36 | 3300005547 | Ga0070693_100001435 | Ga0070693_1000014358 | 452 |
| 37 | 3300025909 | Ga0207705_10040679 | Ga0207705_100406792 | 452 |
| 38 | 3300001989 | JGI24739J22299_10008446 | JGI24739J22299_100084462 | 453 |
| 39 | 3300009093 | Ga0105240_10009642 | Ga0105240_1000964211 | 453 |
| 40 | 3300009545 | Ga0105237_10014315 | Ga0105237_100143155 | 453 |
| 41 | 3300025913 | Ga0207695_10004412 | Ga0207695_1000441212 | 453 |
| 42 | 3300007788 | Ga0099795_10000016 | Ga0099795_1000001622 | 454 |
| 43 | 3300010159 | Ga0099796_10000003 | Ga0099796_1000000337 | 454 |
| 44 | 3300027512 | Ga0209179_1000079 | Ga0209179_10000795 | 454 |
| 45 | 3300014969 | Ga0157376_10122724 | Ga0157376_101227242 | 455 |
| 46 | 3300026088 | Ga0207641_10034231 | Ga0207641_100342314 | 455 |
| 47 | 3300031548 | Ga0307408_100032521 | Ga0307408_1000325212 | 455 |
| 48 | 3300031731 | Ga0307405_10010341 | Ga0307405_100103412 | 455 |
| 49 | 3300031995 | Ga0307409_100000467 | Ga0307409_10000046714 | 455 |
| 50 | 3300032002 | Ga0307416_100015808 | Ga0307416_1000158084 | 455 |
| 51 | 3300032004 | Ga0307414_10124632 | Ga0307414_101246322 | 455 |
| 52 | 3300032126 | Ga0307415_100009800 | Ga0307415_1000098002 | 455 |
| 53 | 3300046474 | Ga0495605_0003499 | Ga0495605_0003499_2810_4216 | 455 |
| 54 | 3300047446 | Ga0495679_000022 | Ga0495679_000022_40218_41624 | 455 |
| 55 | 3300005367 | Ga0070667_100027031 | Ga0070667_1000270312 | 456 |
| 56 | 3300005548 | Ga0070665_100024149 | Ga0070665_1000241495 | 456 |
| 57 | 3300005841 | Ga0068863_100017733 | Ga0068863_1000177334 | 456 |
| 58 | 3300005842 | Ga0068858_100094682 | Ga0068858_1000946822 | 456 |
| 59 | 3300005843 | Ga0068860_100066238 | Ga0068860_1000662382 | 456 |
| 60 | 3300006237 | Ga0097621_100009479 | Ga0097621_1000094794 | 456 |
| 61 | 3300006358 | Ga0068871_100004278 | Ga0068871_1000042788 | 456 |
| 62 | 3300009098 | Ga0105245_10151766 | Ga0105245_101517662 | 456 |
| 63 | 3300009101 | Ga0105247_10031204 | Ga0105247_100312043 | 456 |
| 64 | 3300009177 | Ga0105248_10018504 | Ga0105248_100185042 | 456 |
| 65 | 3300013306 | Ga0163162_10040591 | Ga0163162_100405912 | 456 |
| 66 | 3300014325 | Ga0163163_10001474 | Ga0163163_1000147417 | 456 |
| 67 | 3300014968 | Ga0157379_10000796 | Ga0157379_1000079623 | 456 |
| 68 | 3300014969 | Ga0157376_10004066 | Ga0157376_1000406610 | 456 |
| 69 | 3300025903 | Ga0207680_10048311 | Ga0207680_100483112 | 456 |
| 70 | 3300025941 | Ga0207711_10031694 | Ga0207711_100316944 | 456 |
| 71 | 3300026035 | Ga0207703_10081322 | Ga0207703_100813222 | 456 |
| 72 | 3300028381 | Ga0268264_10025624 | Ga0268264_100256242 | 456 |
| 73 | 3300037418 | Ga0395900_0268736 | Ga0395900_0268736_299_1678 | 456 |
| 74 | 3300037471 | Ga0395905_0037040 | Ga0395905_0037040_888_2267 | 456 |
| 75 | 3300045051 | Ga0451576_0002691 | Ga0451576_0002691_14005_15423 | 456 |
| 76 | 3300048907 | Ga0496104_0015582 | Ga0496104_0015582_366_1799 | 456 |
| 77 | 3300048908 | Ga0496105_0043715 | Ga0496105_0043715_981_2414 | 456 |
| 78 | 3300048911 | Ga0496108_0000794 | Ga0496108_0000794_19890_21323 | 456 |
| 79 | 3300048912 | Ga0496109_0004794 | Ga0496109_0004794_9022_10455 | 456 |
| 80 | 3300048913 | Ga0496110_0000815 | Ga0496110_0000815_4457_5890 | 456 |
| 81 | 3300048914 | Ga0496111_0015150 | Ga0496111_0015150_435_1868 | 456 |
| 82 | 3300048917 | Ga0496114_0102079 | Ga0496114_0102079_361_1794 | 456 |
| 83 | 3300009176 | Ga0105242_10012520 | Ga0105242_100125203 | 457 |
| 84 | 3300028786 | Ga0307517_10009075 | Ga0307517_1000907511 | 458 |
| 85 | 3300031616 | Ga0307508_10003490 | Ga0307508_100034904 | 458 |
| 86 | 3300005338 | Ga0068868_100112372 | Ga0068868_1001123722 | 460 |
| 87 | 3300006173 | Ga0070716_100005715 | Ga0070716_1000057152 | 460 |
| 88 | 3300009551 | Ga0105238_10095559 | Ga0105238_100955591 | 460 |
| 89 | 3300025939 | Ga0207665_10005952 | Ga0207665_100059522 | 460 |
| 90 | 3300042876 | Ga0451577_0005487 | Ga0451577_0005487_6297_7736 | 460 |
| 91 | 3300013306 | Ga0163162_10092092 | Ga0163162_100920922 | 461 |
| 92 | 3300025228 | Ga0209672_100015 | Ga0209672_100015293 | 461 |
| 93 | 3300025229 | Ga0209147_100016 | Ga0209147_100016171 | 461 |
| 94 | 3300025242 | Ga0209258_100026 | Ga0209258_100026293 | 461 |
| 95 | 3300025272 | Ga0209455_1000510 | Ga0209455_10005109 | 461 |
| 96 | 3300028379 | Ga0268266_10069243 | Ga0268266_100692432 | 461 |
| 97 | 3300050491 | nmdc:mga00v17_58158_c1 | nmdc:mga00v17_58158_c1_384_1781 | 461 |
| 98 | 3300053096 | Ga0500641_0043206 | Ga0500641_0043206_132_1529 | 461 |
| 99 | 3300006844 | Ga0075428_100145404 | Ga0075428_1001454042 | 462 |
| 100 | 3300006852 | Ga0075433_10033873 | Ga0075433_100338734 | 462 |
| 101 | 3300009094 | Ga0111539_10002831 | Ga0111539_100028312 | 462 |
| 102 | 3300014969 | Ga0157376_10124279 | Ga0157376_101242792 | 462 |
| 103 | 3300025908 | Ga0207643_10083963 | Ga0207643_100839632 | 462 |
| 104 | 3300025936 | Ga0207670_10004649 | Ga0207670_100046494 | 462 |
| 105 | 3300025940 | Ga0207691_10000699 | Ga0207691_100006992 | 462 |
| 106 | 3300025942 | Ga0207689_10053209 | Ga0207689_100532093 | 462 |
| 107 | 3300026116 | Ga0207674_10022936 | Ga0207674_100229362 | 462 |
| 108 | 3300027907 | Ga0207428_10004733 | Ga0207428_100047332 | 462 |
| 109 | 3300050511 | nmdc:mga08y16_24582_c1 | nmdc:mga08y16_24582_c1_1699_3093 | 462 |
| 110 | 3300050515 | nmdc:mga0a205_40982_c1 | nmdc:mga0a205_40982_c1_2538_3935 | 462 |
| 111 | 3300005842 | Ga0068858_100014101 | Ga0068858_1000141016 | 464 |
| 112 | 3300007265 | Ga0099794_10009254 | Ga0099794_100092543 | 464 |
| 113 | 3300009176 | Ga0105242_10021186 | Ga0105242_100211864 | 464 |
| 114 | 3300009177 | Ga0105248_10015742 | Ga0105248_100157424 | 464 |
| 115 | 3300009551 | Ga0105238_10045297 | Ga0105238_100452975 | 464 |
| 116 | 3300025934 | Ga0207686_10009754 | Ga0207686_100097542 | 464 |
| 117 | 3300025961 | Ga0207712_10198561 | Ga0207712_101985611 | 464 |
| 118 | 3300026035 | Ga0207703_10006522 | Ga0207703_100065223 | 464 |
| 119 | 3300003856 | Ga0058692_1002848 | Ga0058692_10028483 | 465 |
| 120 | 3300025273 | Ga0209673_1000102 | Ga0209673_100010249 | 465 |
| 121 | 3300027312 | Ga0209371_1000145 | Ga0209371_100014542 | 465 |
| 122 | 3300030500 | Ga0268256_1000128 | Ga0268256_100012866 | 465 |
| 123 | 3300031616 | Ga0307508_10001131 | Ga0307508_100011316 | 465 |
| 124 | 3300035695 | Ga0373927_0040515 | Ga0373927_0040515_901_2334 | 465 |
| 125 | 3300046472 | Ga0495580_0056957 | Ga0495580_0056957_950_2383 | 465 |
| 126 | 3300046473 | Ga0495582_0041840 | Ga0495582_0041840_1065_2498 | 465 |
| 127 | 3300046499 | Ga0495594_0031581 | Ga0495594_0031581_803_2236 | 465 |
| 128 | 3300046531 | Ga0495665_0004168 | Ga0495665_0004168_1224_2657 | 465 |
| 129 | 3300046663 | Ga0495635_0062897 | Ga0495635_0062897_141_1574 | 465 |
| 130 | 3300046689 | Ga0495613_0054111 | Ga0495613_0054111_514_1947 | 465 |
| 131 | 3300047315 | Ga0495581_0004525 | Ga0495581_0004525_1590_3023 | 465 |
| 132 | 3300047471 | Ga0495684_0015873 | Ga0495684_0015873_4225_5658 | 465 |
| 133 | 3300053085 | Ga0495619_0044616 | Ga0495619_0044616_982_2415 | 465 |
| 134 | 3300002774 | JGI25150J39212_1004092 | JGI25150J39212_10040923 | 466 |
| 135 | 3300003187 | JGI25151J46595_10021104 | JGI25151J46595_100211042 | 466 |
| 136 | 3300005262 | Ga0065165_1020613 | Ga0065165_10206132 | 466 |
| 137 | 3300006177 | Ga0075362_10003779 | Ga0075362_100037793 | 466 |
| 138 | 3300025245 | Ga0207425_1000606 | Ga0207425_100060615 | 466 |
| 139 | 3300025263 | Ga0209565_1000849 | Ga0209565_100084910 | 466 |
| 140 | 3300025284 | Ga0209130_1000014 | Ga0209130_1000014398 | 466 |
| 141 | 3300025294 | Ga0209025_1010118 | Ga0209025_10101184 | 466 |
| 142 | 3300025294 | Ga0209025_1010290 | Ga0209025_10102904 | 466 |
| 143 | 3300025297 | Ga0209758_1006824 | Ga0209758_10068242 | 466 |
| 144 | 3300025298 | Ga0209050_1003807 | Ga0209050_10038078 | 466 |
| 145 | 3300025302 | Ga0207426_1000091 | Ga0207426_100009119 | 466 |
| 146 | 3300031548 | Ga0307408_100002928 | Ga0307408_1000029285 | 466 |
| 147 | 3300031901 | Ga0307406_10003971 | Ga0307406_100039716 | 466 |
| 148 | 3300044712 | Ga0453684_0074538 | Ga0453684_0074538_13_1419 | 466 |
| 149 | 3300053130 | Ga0500642_0002005 | Ga0500642_0002005_3542_4951 | 466 |
| 150 | 3300001991 | JGI24743J22301_10005128 | JGI24743J22301_100051282 | 467 |
| 151 | 3300002705 | JGI25156J39149_1001101 | JGI25156J39149_10011018 | 467 |
| 152 | 3300005518 | Ga0070699_100039279 | Ga0070699_1000392793 | 467 |
| 153 | 3300005841 | Ga0068863_100022168 | Ga0068863_1000221685 | 467 |
| 154 | 3300005841 | Ga0068863_100043139 | Ga0068863_1000431393 | 467 |
| 155 | 3300006175 | Ga0070712_100043810 | Ga0070712_1000438102 | 467 |
| 156 | 3300009093 | Ga0105240_10037680 | Ga0105240_100376802 | 467 |
| 157 | 3300009093 | Ga0105240_10038466 | Ga0105240_100384664 | 467 |
| 158 | 3300009176 | Ga0105242_10064030 | Ga0105242_100640302 | 467 |
| 159 | 3300009177 | Ga0105248_10021964 | Ga0105248_100219643 | 467 |
| 160 | 3300009177 | Ga0105248_10097015 | Ga0105248_100970153 | 467 |
| 161 | 3300009545 | Ga0105237_10186713 | Ga0105237_101867132 | 467 |
| 162 | 3300009553 | Ga0105249_10111569 | Ga0105249_101115692 | 467 |
| 163 | 3300013104 | Ga0157370_10023152 | Ga0157370_100231522 | 467 |
| 164 | 3300013105 | Ga0157369_10010470 | Ga0157369_100104705 | 467 |
| 165 | 3300014326 | Ga0157380_10030469 | Ga0157380_100304692 | 467 |
| 166 | 3300014968 | Ga0157379_10145872 | Ga0157379_101458722 | 467 |
| 167 | 3300025903 | Ga0207680_10050192 | Ga0207680_100501922 | 467 |
| 168 | 3300025910 | Ga0207684_10028541 | Ga0207684_100285413 | 467 |
| 169 | 3300025919 | Ga0207657_10003776 | Ga0207657_100037762 | 467 |
| 170 | 3300025949 | Ga0207667_10059600 | Ga0207667_100596003 | 467 |
| 171 | 3300025972 | Ga0207668_10126201 | Ga0207668_101262012 | 467 |
| 172 | 3300026041 | Ga0207639_10132527 | Ga0207639_101325271 | 467 |
| 173 | 3300026116 | Ga0207674_10002996 | Ga0207674_100029969 | 467 |
| 174 | 3300031995 | Ga0307409_100071573 | Ga0307409_1000715732 | 467 |
| 175 | 3300035691 | Ga0373931_0078560 | Ga0373931_0078560_401_1804 | 467 |
| 176 | 3300035725 | Ga0373947_0082902 | Ga0373947_0082902_523_1926 | 467 |
| 177 | 3300036401 | Ga0373937_0068068 | Ga0373937_0068068_1776_3182 | 467 |
| 178 | 3300037418 | Ga0395900_0045834 | Ga0395900_0045834_3060_4463 | 467 |
| 179 | 3300042438 | Ga0439459_0013332 | Ga0439459_0013332_55_1461 | 467 |
| 180 | 3300046459 | Ga0495629_0000020 | Ga0495629_0000020_85552_86958 | 467 |
| 181 | 3300046460 | Ga0495638_0014812 | Ga0495638_0014812_31_1434 | 467 |
| 182 | 3300046463 | Ga0495653_0000388 | Ga0495653_0000388_1254_2660 | 467 |
| 183 | 3300046472 | Ga0495580_0000022 | Ga0495580_0000022_37433_38839 | 467 |
| 184 | 3300046472 | Ga0495580_0045155 | Ga0495580_0045155_1207_2613 | 467 |
| 185 | 3300046515 | Ga0495620_0035360 | Ga0495620_0035360_825_2231 | 467 |
| 186 | 3300046516 | Ga0495628_0010826 | Ga0495628_0010826_1075_2481 | 467 |
| 187 | 3300046516 | Ga0495628_0077324 | Ga0495628_0077324_258_1664 | 467 |
| 188 | 3300046517 | Ga0495630_0012684 | Ga0495630_0012684_4520_5926 | 467 |
| 189 | 3300046517 | Ga0495630_0016330 | Ga0495630_0016330_3517_4923 | 467 |
| 190 | 3300046524 | Ga0495648_0055057 | Ga0495648_0055057_641_2047 | 467 |
| 191 | 3300046531 | Ga0495665_0032218 | Ga0495665_0032218_175_1581 | 467 |
| 192 | 3300046690 | Ga0495624_0000591 | Ga0495624_0000591_1663_3069 | 467 |
| 193 | 3300046690 | Ga0495624_0046993 | Ga0495624_0046993_533_1939 | 467 |
| 194 | 3300047319 | Ga0495674_0120152 | Ga0495674_0120152_211_1617 | 467 |
| 195 | 3300047319 | Ga0495674_0127841 | Ga0495674_0127841_213_1619 | 467 |
| 196 | 3300047320 | Ga0495672_0113394 | Ga0495672_0113394_21_1427 | 467 |
| 197 | 3300047321 | Ga0495676_0134445 | Ga0495676_0134445_18_1424 | 467 |
| 198 | 3300047443 | Ga0495687_011843 | Ga0495687_011843_2737_4143 | 467 |
| 199 | 3300047673 | Ga0495593_0010132 | Ga0495593_0010132_145_1551 | 467 |
| 200 | 3300047673 | Ga0495593_0042654 | Ga0495593_0042654_267_1673 | 467 |
| 201 | 3300048907 | Ga0496104_0031984 | Ga0496104_0031984_2996_4465 | 467 |
| 202 | 3300048913 | Ga0496110_0082986 | Ga0496110_0082986_1202_2671 | 467 |
| 203 | 3300048929 | Ga0496126_0000414 | Ga0496126_0000414_42076_43482 | 467 |
| 204 | 3300050496 | nmdc:mga07m45_75490_c1 | nmdc:mga07m45_75490_c1_404_1822 | 467 |
| 205 | 3300050509 | nmdc:mga0qj67_95097_c1 | nmdc:mga0qj67_95097_c1_274_1677 | 467 |
| 206 | 3300053158 | Ga0500627_0005829 | Ga0500627_0005829_2695_4098 | 467 |
| 207 | 3300003187 | JGI25151J46595_10003002 | JGI25151J46595_100030024 | 468 |
| 208 | 3300025294 | Ga0209025_1000312 | Ga0209025_100031211 | 468 |
| 209 | 3300005334 | Ga0068869_100152623 | Ga0068869_1001526232 | 469 |
| 210 | 3300005364 | Ga0070673_100162192 | Ga0070673_1001621921 | 469 |
| 211 | 3300005435 | Ga0070714_100080266 | Ga0070714_1000802662 | 469 |
| 212 | 3300005455 | Ga0070663_100022567 | Ga0070663_1000225672 | 469 |
| 213 | 3300005545 | Ga0070695_100017622 | Ga0070695_1000176222 | 469 |
| 214 | 3300005548 | Ga0070665_100011350 | Ga0070665_1000113502 | 469 |
| 215 | 3300005614 | Ga0068856_100089464 | Ga0068856_1000894642 | 469 |
| 216 | 3300006237 | Ga0097621_100115702 | Ga0097621_1001157022 | 469 |
| 217 | 3300006847 | Ga0075431_100000979 | Ga0075431_10000097923 | 469 |
| 218 | 3300006871 | Ga0075434_100108789 | Ga0075434_1001087892 | 469 |
| 219 | 3300017792 | Ga0163161_10000166 | Ga0163161_1000016637 | 469 |
| 220 | 3300021377 | Ga0213874_10009787 | Ga0213874_100097872 | 469 |
| 221 | 3300025901 | Ga0207688_10006372 | Ga0207688_100063722 | 469 |
| 222 | 3300025906 | Ga0207699_10009808 | Ga0207699_100098083 | 469 |
| 223 | 3300025907 | Ga0207645_10004878 | Ga0207645_100048787 | 469 |
| 224 | 3300025929 | Ga0207664_10069592 | Ga0207664_100695922 | 469 |
| 225 | 3300025936 | Ga0207670_10069218 | Ga0207670_100692182 | 469 |
| 226 | 3300025940 | Ga0207691_10067648 | Ga0207691_100676482 | 469 |
| 227 | 3300025961 | Ga0207712_10060447 | Ga0207712_100604472 | 469 |
| 228 | 3300026067 | Ga0207678_10005487 | Ga0207678_100054877 | 469 |
| 229 | 3300026118 | Ga0207675_100176419 | Ga0207675_1001764192 | 469 |
| 230 | 3300026121 | Ga0207683_10006699 | Ga0207683_100066992 | 469 |
| 231 | 3300026121 | Ga0207683_10023822 | Ga0207683_100238222 | 469 |
| 232 | 3300028794 | Ga0307515_10087372 | Ga0307515_100873723 | 469 |
| 233 | 3300046674 | Ga0495588_0005333 | Ga0495588_0005333_1157_2626 | 469 |
| 234 | 3300050510 | nmdc:mga06r32_1173_c1 | nmdc:mga06r32_1173_c1_16594_18021 | 469 |
| 235 | 3300050512 | nmdc:mga0n895_108765_c1 | nmdc:mga0n895_108765_c1_1224_2639 | 469 |
| 236 | 3300005341 | Ga0070691_10028046 | Ga0070691_100280462 | 470 |
| 237 | 3300005345 | Ga0070692_10003099 | Ga0070692_100030993 | 470 |
| 238 | 3300005438 | Ga0070701_10017146 | Ga0070701_100171461 | 470 |
| 239 | 3300005444 | Ga0070694_100018184 | Ga0070694_1000181842 | 470 |
| 240 | 3300005518 | Ga0070699_100013187 | Ga0070699_1000131874 | 470 |
| 241 | 3300005545 | Ga0070695_100005263 | Ga0070695_1000052632 | 470 |
| 242 | 3300005546 | Ga0070696_100041062 | Ga0070696_1000410622 | 470 |
| 243 | 3300005577 | Ga0068857_100173147 | Ga0068857_1001731472 | 470 |
| 244 | 3300005843 | Ga0068860_100145030 | Ga0068860_1001450302 | 470 |
| 245 | 3300005844 | Ga0068862_100020347 | Ga0068862_1000203472 | 470 |
| 246 | 3300006844 | Ga0075428_100094800 | Ga0075428_1000948002 | 470 |
| 247 | 3300006852 | Ga0075433_10115124 | Ga0075433_101151242 | 470 |
| 248 | 3300006871 | Ga0075434_100026928 | Ga0075434_1000269282 | 470 |
| 249 | 3300007076 | Ga0075435_100029224 | Ga0075435_1000292242 | 470 |
| 250 | 3300009094 | Ga0111539_10001754 | Ga0111539_1000175426 | 470 |
| 251 | 3300009094 | Ga0111539_10166659 | Ga0111539_101666592 | 470 |
| 252 | 3300009176 | Ga0105242_10006175 | Ga0105242_100061752 | 470 |
| 253 | 3300025917 | Ga0207660_10063000 | Ga0207660_100630002 | 470 |
| 254 | 3300025934 | Ga0207686_10019101 | Ga0207686_100191013 | 470 |
| 255 | 3300025942 | Ga0207689_10009536 | Ga0207689_100095363 | 470 |
| 256 | 3300026089 | Ga0207648_10132571 | Ga0207648_101325712 | 470 |
| 257 | 3300027907 | Ga0207428_10000781 | Ga0207428_100007814 | 470 |
| 258 | 3300027907 | Ga0207428_10103124 | Ga0207428_101031241 | 470 |
| 259 | 3300028380 | Ga0268265_10007574 | Ga0268265_100075741 | 470 |
| 260 | 3300042876 | Ga0451577_0003798 | Ga0451577_0003798_10040_11470 | 470 |
| 261 | 3300044673 | Ga0453683_0066816 | Ga0453683_0066816_34_1464 | 470 |
| 262 | 3300045051 | Ga0451576_0078120 | Ga0451576_0078120_100_1530 | 470 |
| 263 | 3300045051 | Ga0451576_0173239 | Ga0451576_0173239_93_1523 | 470 |
| 264 | 3300049588 | Ga0501072_0126112 | Ga0501072_0126112_416_1846 | 470 |
| 265 | 3300050511 | nmdc:mga08y16_2283_c1 | nmdc:mga08y16_2283_c1_18133_19563 | 470 |
| 266 | 3300050512 | nmdc:mga0n895_43955_c1 | nmdc:mga0n895_43955_c1_76_1506 | 470 |
| 267 | 3300050513 | nmdc:mga0rr50_48425_c1 | nmdc:mga0rr50_48425_c1_44_1474 | 470 |
| 268 | 3300050515 | nmdc:mga0a205_1477_c1 | nmdc:mga0a205_1477_c1_2957_4387 | 470 |
| 269 | 3300050515 | nmdc:mga0a205_20144_c1 | nmdc:mga0a205_20144_c1_4137_5567 | 470 |
| 270 | 3300005843 | Ga0068860_100140727 | Ga0068860_1001407272 | 471 |
| 271 | 3300025245 | Ga0207425_1012831 | Ga0207425_10128311 | 471 |
| 272 | 3300026118 | Ga0207675_100163980 | Ga0207675_1001639802 | 471 |
| 273 | 3300028794 | Ga0307515_10000049 | Ga0307515_1000004992 | 471 |
| 274 | 3300028794 | Ga0307515_10028979 | Ga0307515_100289796 | 471 |
| 275 | 3300031456 | Ga0307513_10004164 | Ga0307513_1000416410 | 471 |
| 276 | 3300045051 | Ga0451576_0013845 | Ga0451576_0013845_6408_7835 | 471 |
| 277 | iso_pu_bacteria | 2643221609 | 2644063026 | 471 |
| 278 | iso_pu_bacteria | 2738543013 | 2739247407 | 471 |
| 279 | iso_pu_bacteria | 2883291878 | 2883295115 | 471 |
| 280 | iso_pu_bacteria | 2883354860 | 2883356413 | 471 |
| 281 | iso_pu_bacteria | 2904541872 | 2904542007 | 471 |
| 282 | iso_pu_bacteria | 2929160207 | 2929167297 | 471 |
| 283 | iso_pu_bacteria | 2939631187 | 2939634826 | 471 |
| 284 | 3300005335 | Ga0070666_10059851 | Ga0070666_100598512 | 472 |
| 285 | 3300005549 | Ga0070704_100024207 | Ga0070704_1000242073 | 472 |
| 286 | 3300005578 | Ga0068854_100161522 | Ga0068854_1001615222 | 472 |
| 287 | 3300006195 | Ga0075366_10033867 | Ga0075366_100338672 | 472 |
| 288 | 3300006914 | Ga0075436_100022431 | Ga0075436_1000224312 | 472 |
| 289 | 3300014325 | Ga0163163_10184052 | Ga0163163_101840522 | 472 |
| 290 | 3300014968 | Ga0157379_10021082 | Ga0157379_100210824 | 472 |
| 291 | 3300025254 | Ga0209148_1000599 | Ga0209148_100059927 | 472 |
| 292 | 3300025272 | Ga0209455_1000901 | Ga0209455_100090111 | 472 |
| 293 | 3300025893 | Ga0207682_10016635 | Ga0207682_100166353 | 472 |
| 294 | 3300025907 | Ga0207645_10047598 | Ga0207645_100475982 | 472 |
| 295 | 3300025907 | Ga0207645_10076894 | Ga0207645_100768942 | 472 |
| 296 | 3300025925 | Ga0207650_10226187 | Ga0207650_102261871 | 472 |
| 297 | 3300025933 | Ga0207706_10030582 | Ga0207706_100305825 | 472 |
| 298 | 3300025940 | Ga0207691_10007936 | Ga0207691_100079362 | 472 |
| 299 | 3300025942 | Ga0207689_10042498 | Ga0207689_100424982 | 472 |
| 300 | 3300031456 | Ga0307513_10017129 | Ga0307513_100171299 | 472 |
| 301 | 3300031507 | Ga0307509_10067822 | Ga0307509_100678222 | 472 |
| 302 | 3300031901 | Ga0307406_10034955 | Ga0307406_100349553 | 472 |
| 303 | 3300035084 | Ga0373928_0003384 | Ga0373928_0003384_1338_2774 | 472 |
| 304 | 3300036401 | Ga0373937_0116588 | Ga0373937_0116588_251_1687 | 472 |
| 305 | 3300037471 | Ga0395905_0001267 | Ga0395905_0001267_17228_18646 | 472 |
| 306 | 3300041407 | Ga0439447_000273 | Ga0439447_000273_4258_5676 | 472 |
| 307 | 3300046681 | Ga0495647_0027804 | Ga0495647_0027804_280_1719 | 472 |
| 308 | 3300047443 | Ga0495687_001245 | Ga0495687_001245_15126_16565 | 472 |
| 309 | 3300048909 | Ga0496106_0035476 | Ga0496106_0035476_1411_2865 | 472 |
| 310 | 3300048909 | Ga0496106_0139713 | Ga0496106_0139713_462_1880 | 472 |
| 311 | 3300048913 | Ga0496110_0238846 | Ga0496110_0238846_14_1486 | 472 |
| 312 | 3300048916 | Ga0496113_0128587 | Ga0496113_0128587_453_1907 | 472 |
| 313 | 3300049742 | Ga0501080_0173142 | Ga0501080_0173142_297_1730 | 472 |
| 314 | 3300049744 | Ga0501083_0010787 | Ga0501083_0010787_2996_4429 | 472 |
| 315 | 3300050514 | nmdc:mga08x19_23730_c1 | nmdc:mga08x19_23730_c1_1145_2602 | 472 |
| 316 | 3300059424 | Ga0590075_018559 | Ga0590075_018559_144_1595 | 472 |
| 317 | iso_pu_bacteria | 2643221654 | 2644305170 | 472 |
| 318 | iso_pu_bacteria | 2721755763 | 2723876275 | 472 |
| 319 | iso_pu_bacteria | 2900634093 | 2900638559 | 472 |
| 320 | 3300003215 | JGI25153J46596_10000066 | JGI25153J46596_1000006689 | 473 |
| 321 | 3300005328 | Ga0070676_10000358 | Ga0070676_100003585 | 473 |
| 322 | 3300005329 | Ga0070683_100058972 | Ga0070683_1000589722 | 473 |
| 323 | 3300005333 | Ga0070677_10000799 | Ga0070677_100007996 | 473 |
| 324 | 3300005335 | Ga0070666_10002683 | Ga0070666_100026832 | 473 |
| 325 | 3300005338 | Ga0068868_100001448 | Ga0068868_1000014482 | 473 |
| 326 | 3300005344 | Ga0070661_100001117 | Ga0070661_10000111718 | 473 |
| 327 | 3300005344 | Ga0070661_100032460 | Ga0070661_1000324602 | 473 |
| 328 | 3300005347 | Ga0070668_100001120 | Ga0070668_1000011203 | 473 |
| 329 | 3300005347 | Ga0070668_100017358 | Ga0070668_1000173584 | 473 |
| 330 | 3300005347 | Ga0070668_100036158 | Ga0070668_1000361582 | 473 |
| 331 | 3300005354 | Ga0070675_100000127 | Ga0070675_10000012731 | 473 |
| 332 | 3300005355 | Ga0070671_100000385 | Ga0070671_1000003852 | 473 |
| 333 | 3300005356 | Ga0070674_100000120 | Ga0070674_10000012020 | 473 |
| 334 | 3300005364 | Ga0070673_100000465 | Ga0070673_10000046516 | 473 |
| 335 | 3300005366 | Ga0070659_100033464 | Ga0070659_1000334642 | 473 |
| 336 | 3300005367 | Ga0070667_100001635 | Ga0070667_10000163515 | 473 |
| 337 | 3300005367 | Ga0070667_100010671 | Ga0070667_1000106714 | 473 |
| 338 | 3300005435 | Ga0070714_100001578 | Ga0070714_1000015784 | 473 |
| 339 | 3300005456 | Ga0070678_100000532 | Ga0070678_10000053217 | 473 |
| 340 | 3300005458 | Ga0070681_10008439 | Ga0070681_100084392 | 473 |
| 341 | 3300005458 | Ga0070681_10044648 | Ga0070681_100446483 | 473 |
| 342 | 3300005459 | Ga0068867_100027347 | Ga0068867_1000273472 | 473 |
| 343 | 3300005530 | Ga0070679_100008975 | Ga0070679_1000089752 | 473 |
| 344 | 3300005530 | Ga0070679_100078097 | Ga0070679_1000780972 | 473 |
| 345 | 3300005539 | Ga0068853_100016255 | Ga0068853_1000162555 | 473 |
| 346 | 3300005539 | Ga0068853_100036798 | Ga0068853_1000367982 | 473 |
| 347 | 3300005543 | Ga0070672_100014139 | Ga0070672_1000141393 | 473 |
| 348 | 3300005548 | Ga0070665_100018618 | Ga0070665_1000186187 | 473 |
| 349 | 3300005563 | Ga0068855_100021344 | Ga0068855_1000213445 | 473 |
| 350 | 3300005564 | Ga0070664_100016626 | Ga0070664_1000166265 | 473 |
| 351 | 3300005577 | Ga0068857_100009255 | Ga0068857_1000092555 | 473 |
| 352 | 3300005616 | Ga0068852_100000773 | Ga0068852_1000007733 | 473 |
| 353 | 3300005616 | Ga0068852_100008520 | Ga0068852_1000085205 | 473 |
| 354 | 3300005616 | Ga0068852_100170682 | Ga0068852_1001706822 | 473 |
| 355 | 3300005834 | Ga0068851_10003201 | Ga0068851_100032012 | 473 |
| 356 | 3300005841 | Ga0068863_100151284 | Ga0068863_1001512842 | 473 |
| 357 | 3300005842 | Ga0068858_100047879 | Ga0068858_1000478792 | 473 |
| 358 | 3300005843 | Ga0068860_100136516 | Ga0068860_1001365162 | 473 |
| 359 | 3300005843 | Ga0068860_100264045 | Ga0068860_1002640452 | 473 |
| 360 | 3300005981 | Ga0081538_10017023 | Ga0081538_100170232 | 473 |
| 361 | 3300006237 | Ga0097621_100007020 | Ga0097621_1000070204 | 473 |
| 362 | 3300006358 | Ga0068871_100025900 | Ga0068871_1000259002 | 473 |
| 363 | 3300006881 | Ga0068865_100013513 | Ga0068865_1000135134 | 473 |
| 364 | 3300009177 | Ga0105248_10074135 | Ga0105248_100741352 | 473 |
| 365 | 3300009545 | Ga0105237_10040777 | Ga0105237_100407773 | 473 |
| 366 | 3300009551 | Ga0105238_10002047 | Ga0105238_1000204719 | 473 |
| 367 | 3300013104 | Ga0157370_10030299 | Ga0157370_100302995 | 473 |
| 368 | 3300013104 | Ga0157370_10062897 | Ga0157370_100628972 | 473 |
| 369 | 3300013297 | Ga0157378_10010403 | Ga0157378_100104033 | 473 |
| 370 | 3300013307 | Ga0157372_10004036 | Ga0157372_100040362 | 473 |
| 371 | 3300013308 | Ga0157375_10000969 | Ga0157375_1000096919 | 473 |
| 372 | 3300013308 | Ga0157375_10183443 | Ga0157375_101834432 | 473 |
| 373 | 3300025297 | Ga0209758_1000028 | Ga0209758_100002841 | 473 |
| 374 | 3300025298 | Ga0209050_1019093 | Ga0209050_10190932 | 473 |
| 375 | 3300025304 | Ga0209257_1000707 | Ga0209257_100070730 | 473 |
| 376 | 3300025315 | Ga0207697_10027523 | Ga0207697_100275232 | 473 |
| 377 | 3300025321 | Ga0207656_10020303 | Ga0207656_100203032 | 473 |
| 378 | 3300025893 | Ga0207682_10006639 | Ga0207682_100066392 | 473 |
| 379 | 3300025903 | Ga0207680_10004793 | Ga0207680_100047933 | 473 |
| 380 | 3300025907 | Ga0207645_10000187 | Ga0207645_1000018710 | 473 |
| 381 | 3300025907 | Ga0207645_10110178 | Ga0207645_101101782 | 473 |
| 382 | 3300025917 | Ga0207660_10127220 | Ga0207660_101272202 | 473 |
| 383 | 3300025923 | Ga0207681_10082141 | Ga0207681_100821412 | 473 |
| 384 | 3300025923 | Ga0207681_10205703 | Ga0207681_102057031 | 473 |
| 385 | 3300025925 | Ga0207650_10017955 | Ga0207650_100179553 | 473 |
| 386 | 3300025926 | Ga0207659_10011571 | Ga0207659_100115715 | 473 |
| 387 | 3300025932 | Ga0207690_10022360 | Ga0207690_100223602 | 473 |
| 388 | 3300025938 | Ga0207704_10061652 | Ga0207704_100616522 | 473 |
| 389 | 3300025938 | Ga0207704_10067560 | Ga0207704_100675602 | 473 |
| 390 | 3300025940 | Ga0207691_10000024 | Ga0207691_1000002420 | 473 |
| 391 | 3300025940 | Ga0207691_10020043 | Ga0207691_100200432 | 473 |
| 392 | 3300025941 | Ga0207711_10032000 | Ga0207711_100320004 | 473 |
| 393 | 3300025942 | Ga0207689_10069059 | Ga0207689_100690592 | 473 |
| 394 | 3300025944 | Ga0207661_10011026 | Ga0207661_100110264 | 473 |
| 395 | 3300025945 | Ga0207679_10005044 | Ga0207679_100050445 | 473 |
| 396 | 3300025949 | Ga0207667_10080159 | Ga0207667_100801592 | 473 |
| 397 | 3300025960 | Ga0207651_10005217 | Ga0207651_100052175 | 473 |
| 398 | 3300025972 | Ga0207668_10004902 | Ga0207668_100049025 | 473 |
| 399 | 3300025972 | Ga0207668_10042806 | Ga0207668_100428062 | 473 |
| 400 | 3300025986 | Ga0207658_10001872 | Ga0207658_1000187210 | 473 |
| 401 | 3300025986 | Ga0207658_10002398 | Ga0207658_100023985 | 473 |
| 402 | 3300026023 | Ga0207677_10003378 | Ga0207677_100033787 | 473 |
| 403 | 3300026078 | Ga0207702_10002061 | Ga0207702_1000206116 | 473 |
| 404 | 3300026088 | Ga0207641_10202211 | Ga0207641_102022112 | 473 |
| 405 | 3300026089 | Ga0207648_10005620 | Ga0207648_100056208 | 473 |
| 406 | 3300026095 | Ga0207676_10093934 | Ga0207676_100939342 | 473 |
| 407 | 3300026116 | Ga0207674_10001568 | Ga0207674_100015685 | 473 |
| 408 | 3300026118 | Ga0207675_100034418 | Ga0207675_1000344182 | 473 |
| 409 | 3300026118 | Ga0207675_100080175 | Ga0207675_1000801752 | 473 |
| 410 | 3300026121 | Ga0207683_10000012 | Ga0207683_1000001278 | 473 |
| 411 | 3300026142 | Ga0207698_10038365 | Ga0207698_100383653 | 473 |
| 412 | 3300027907 | Ga0207428_10000206 | Ga0207428_1000020616 | 473 |
| 413 | 3300028379 | Ga0268266_10014553 | Ga0268266_100145535 | 473 |
| 414 | 3300028380 | Ga0268265_10008051 | Ga0268265_100080512 | 473 |
| 415 | 3300028381 | Ga0268264_10054992 | Ga0268264_100549923 | 473 |
| 416 | 3300028381 | Ga0268264_10080337 | Ga0268264_100803371 | 473 |
| 417 | 3300031456 | Ga0307513_10090900 | Ga0307513_100909002 | 473 |
| 418 | 3300031616 | Ga0307508_10183344 | Ga0307508_101833442 | 473 |
| 419 | 3300031824 | Ga0307413_10028680 | Ga0307413_100286802 | 473 |
| 420 | 3300032002 | Ga0307416_100080731 | Ga0307416_1000807312 | 473 |
| 421 | 3300037068 | Ga0373925_0039429 | Ga0373925_0039429_1410_2852 | 473 |
| 422 | 3300042876 | Ga0451577_0060282 | Ga0451577_0060282_1260_2693 | 473 |
| 423 | 3300046543 | Ga0495645_0039588 | Ga0495645_0039588_875_2308 | 473 |
| 424 | 3300048915 | Ga0496112_0028019 | Ga0496112_0028019_471_1904 | 473 |
| 425 | 3300049569 | Ga0501032_0001833 | Ga0501032_0001833_9962_11392 | 473 |
| 426 | 3300049570 | Ga0501033_0008938 | Ga0501033_0008938_5109_6539 | 473 |
| 427 | 3300049571 | Ga0501034_0008902 | Ga0501034_0008902_5415_6845 | 473 |
| 428 | 3300049571 | Ga0501034_0064231 | Ga0501034_0064231_1399_2832 | 473 |
| 429 | 3300049573 | Ga0501037_0005118 | Ga0501037_0005118_3891_5321 | 473 |
| 430 | 3300049574 | Ga0501038_0001970 | Ga0501038_0001970_3747_5177 | 473 |
| 431 | 3300049575 | Ga0501039_0001598 | Ga0501039_0001598_1685_3115 | 473 |
| 432 | 3300049579 | Ga0501043_0000364 | Ga0501043_0000364_15709_17139 | 473 |
| 433 | 3300049579 | Ga0501043_0028562 | Ga0501043_0028562_2624_4051 | 473 |
| 434 | 3300049580 | Ga0501046_0000867 | Ga0501046_0000867_7221_8651 | 473 |
| 435 | 3300049583 | Ga0501067_0001425 | Ga0501067_0001425_7287_8720 | 473 |
| 436 | 3300049585 | Ga0501069_0003379 | Ga0501069_0003379_4338_5768 | 473 |
| 437 | 3300049586 | Ga0501070_0001836 | Ga0501070_0001836_10353_11783 | 473 |
| 438 | 3300049589 | Ga0501073_0000620 | Ga0501073_0000620_8797_10227 | 473 |
| 439 | 3300049589 | Ga0501073_0010743 | Ga0501073_0010743_4743_6176 | 473 |
| 440 | 3300049590 | Ga0501074_0055534 | Ga0501074_0055534_283_1716 | 473 |
| 441 | 3300049742 | Ga0501080_0001874 | Ga0501080_0001874_16614_18047 | 473 |
| 442 | 3300049742 | Ga0501080_0031615 | Ga0501080_0031615_1817_3247 | 473 |
| 443 | 3300049742 | Ga0501080_0050436 | Ga0501080_0050436_1291_2721 | 473 |
| 444 | 3300049742 | Ga0501080_0075888 | Ga0501080_0075888_769_2199 | 473 |
| 445 | 3300049744 | Ga0501083_0006601 | Ga0501083_0006601_2042_3472 | 473 |
| 446 | 3300049822 | Ga0501035_0006788 | Ga0501035_0006788_362_1792 | 473 |
| 447 | 3300049823 | Ga0501044_0009350 | Ga0501044_0009350_1910_3340 | 473 |
| 448 | 3300049823 | Ga0501044_0039230 | Ga0501044_0039230_2437_3867 | 473 |
| 449 | 3300050511 | nmdc:mga08y16_16_c1 | nmdc:mga08y16_16_c1_134319_135752 | 473 |
| 450 | 3300053088 | Ga0500644_0037720 | Ga0500644_0037720_45_1472 | 473 |
| 451 | 3300053090 | Ga0500646_0027016 | Ga0500646_0027016_28_1458 | 473 |
| 452 | 3300053119 | Ga0500595_001190 | Ga0500595_001190_5377_6807 | 473 |
| 453 | 3300053130 | Ga0500642_0038289 | Ga0500642_0038289_36_1466 | 473 |
| 454 | 3300053139 | Ga0500568_0003326 | Ga0500568_0003326_2409_3839 | 473 |
| 455 | 3300053151 | Ga0500604_0001284 | Ga0500604_0001284_4466_5896 | 473 |
| 456 | 3300053153 | Ga0500616_0003059 | Ga0500616_0003059_4364_5794 | 473 |
| 457 | 3300054114 | Ga0501084_0110025 | Ga0501084_0110025_468_1901 | 473 |
| 458 | 3300060353 | Ga0501082_0001879 | Ga0501082_0001879_362_1792 | 473 |
| 459 | iso_pu_bacteria | 2511231002 | 2511245432 | 473 |
| 460 | 3300005331 | Ga0070670_100053796 | Ga0070670_1000537962 | 474 |
| 461 | 3300005331 | Ga0070670_100059058 | Ga0070670_1000590582 | 474 |
| 462 | 3300005334 | Ga0068869_100066870 | Ga0068869_1000668702 | 474 |
| 463 | 3300005338 | Ga0068868_100025255 | Ga0068868_1000252552 | 474 |
| 464 | 3300005338 | Ga0068868_100026903 | Ga0068868_1000269032 | 474 |
| 465 | 3300005339 | Ga0070660_100098154 | Ga0070660_1000981541 | 474 |
| 466 | 3300005353 | Ga0070669_100085187 | Ga0070669_1000851871 | 474 |
| 467 | 3300005354 | Ga0070675_100017061 | Ga0070675_1000170614 | 474 |
| 468 | 3300005354 | Ga0070675_100019717 | Ga0070675_1000197174 | 474 |
| 469 | 3300005354 | Ga0070675_100022840 | Ga0070675_1000228402 | 474 |
| 470 | 3300005364 | Ga0070673_100031470 | Ga0070673_1000314704 | 474 |
| 471 | 3300005455 | Ga0070663_100096148 | Ga0070663_1000961482 | 474 |
| 472 | 3300005457 | Ga0070662_100049536 | Ga0070662_1000495362 | 474 |
| 473 | 3300005457 | Ga0070662_100050759 | Ga0070662_1000507592 | 474 |
| 474 | 3300005467 | Ga0070706_100002711 | Ga0070706_1000027117 | 474 |
| 475 | 3300005530 | Ga0070679_100006925 | Ga0070679_1000069253 | 474 |
| 476 | 3300005539 | Ga0068853_100105584 | Ga0068853_1001055842 | 474 |
| 477 | 3300005543 | Ga0070672_100001354 | Ga0070672_10000135411 | 474 |
| 478 | 3300005543 | Ga0070672_100108193 | Ga0070672_1001081932 | 474 |
| 479 | 3300005614 | Ga0068856_100008625 | Ga0068856_1000086252 | 474 |
| 480 | 3300005618 | Ga0068864_100014096 | Ga0068864_1000140966 | 474 |
| 481 | 3300005618 | Ga0068864_100080655 | Ga0068864_1000806552 | 474 |
| 482 | 3300005842 | Ga0068858_100057702 | Ga0068858_1000577022 | 474 |
| 483 | 3300005843 | Ga0068860_100233584 | Ga0068860_1002335842 | 474 |
| 484 | 3300006177 | Ga0075362_10013671 | Ga0075362_100136712 | 474 |
| 485 | 3300006195 | Ga0075366_10014908 | Ga0075366_100149084 | 474 |
| 486 | 3300006195 | Ga0075366_10108350 | Ga0075366_101083501 | 474 |
| 487 | 3300006237 | Ga0097621_100009828 | Ga0097621_1000098282 | 474 |
| 488 | 3300006237 | Ga0097621_100083065 | Ga0097621_1000830652 | 474 |
| 489 | 3300006353 | Ga0075370_10001530 | Ga0075370_100015305 | 474 |
| 490 | 3300006353 | Ga0075370_10001898 | Ga0075370_100018987 | 474 |
| 491 | 3300006353 | Ga0075370_10003975 | Ga0075370_100039755 | 474 |
| 492 | 3300006353 | Ga0075370_10008606 | Ga0075370_100086062 | 474 |
| 493 | 3300006358 | Ga0068871_100015576 | Ga0068871_1000155764 | 474 |
| 494 | 3300009098 | Ga0105245_10033953 | Ga0105245_100339534 | 474 |
| 495 | 3300009177 | Ga0105248_10215930 | Ga0105248_102159302 | 474 |
| 496 | 3300009551 | Ga0105238_10025045 | Ga0105238_100250455 | 474 |
| 497 | 3300013306 | Ga0163162_10208109 | Ga0163162_102081092 | 474 |
| 498 | 3300013308 | Ga0157375_10051869 | Ga0157375_100518692 | 474 |
| 499 | 3300014325 | Ga0163163_10162891 | Ga0163163_101628912 | 474 |
| 500 | 3300014745 | Ga0157377_10017671 | Ga0157377_100176712 | 474 |
| 501 | 3300014968 | Ga0157379_10045091 | Ga0157379_100450913 | 474 |
| 502 | 3300014968 | Ga0157379_10053760 | Ga0157379_100537602 | 474 |
| 503 | 3300014969 | Ga0157376_10024013 | Ga0157376_100240133 | 474 |
| 504 | 3300014969 | Ga0157376_10039002 | Ga0157376_100390024 | 474 |
| 505 | 3300025273 | Ga0209673_1008187 | Ga0209673_10081875 | 474 |
| 506 | 3300025321 | Ga0207656_10020101 | Ga0207656_100201012 | 474 |
| 507 | 3300025901 | Ga0207688_10079501 | Ga0207688_100795012 | 474 |
| 508 | 3300025907 | Ga0207645_10007994 | Ga0207645_100079945 | 474 |
| 509 | 3300025907 | Ga0207645_10042134 | Ga0207645_100421342 | 474 |
| 510 | 3300025912 | Ga0207707_10072231 | Ga0207707_100722311 | 474 |
| 511 | 3300025919 | Ga0207657_10072283 | Ga0207657_100722832 | 474 |
| 512 | 3300025920 | Ga0207649_10001848 | Ga0207649_100018487 | 474 |
| 513 | 3300025922 | Ga0207646_10208405 | Ga0207646_102084051 | 474 |
| 514 | 3300025923 | Ga0207681_10106217 | Ga0207681_101062172 | 474 |
| 515 | 3300025924 | Ga0207694_10107911 | Ga0207694_101079112 | 474 |
| 516 | 3300025925 | Ga0207650_10026003 | Ga0207650_100260032 | 474 |
| 517 | 3300025926 | Ga0207659_10044009 | Ga0207659_100440092 | 474 |
| 518 | 3300025931 | Ga0207644_10173715 | Ga0207644_101737151 | 474 |
| 519 | 3300025933 | Ga0207706_10053025 | Ga0207706_100530252 | 474 |
| 520 | 3300025933 | Ga0207706_10054053 | Ga0207706_100540532 | 474 |
| 521 | 3300025940 | Ga0207691_10013535 | Ga0207691_100135352 | 474 |
| 522 | 3300025941 | Ga0207711_10040913 | Ga0207711_100409132 | 474 |
| 523 | 3300025942 | Ga0207689_10008871 | Ga0207689_100088716 | 474 |
| 524 | 3300025944 | Ga0207661_10062606 | Ga0207661_100626062 | 474 |
| 525 | 3300025949 | Ga0207667_10122226 | Ga0207667_101222263 | 474 |
| 526 | 3300025960 | Ga0207651_10075833 | Ga0207651_100758331 | 474 |
| 527 | 3300025961 | Ga0207712_10104576 | Ga0207712_101045762 | 474 |
| 528 | 3300026023 | Ga0207677_10012818 | Ga0207677_100128183 | 474 |
| 529 | 3300026035 | Ga0207703_10011356 | Ga0207703_100113566 | 474 |
| 530 | 3300026067 | Ga0207678_10042830 | Ga0207678_100428302 | 474 |
| 531 | 3300026067 | Ga0207678_10054220 | Ga0207678_100542202 | 474 |
| 532 | 3300026088 | Ga0207641_10047709 | Ga0207641_100477092 | 474 |
| 533 | 3300026089 | Ga0207648_10018481 | Ga0207648_100184814 | 474 |
| 534 | 3300026116 | Ga0207674_10029867 | Ga0207674_100298672 | 474 |
| 535 | 3300026116 | Ga0207674_10055612 | Ga0207674_100556123 | 474 |
| 536 | 3300026118 | Ga0207675_100000977 | Ga0207675_1000009774 | 474 |
| 537 | 3300028381 | Ga0268264_10113692 | Ga0268264_101136922 | 474 |
| 538 | 3300028381 | Ga0268264_10173594 | Ga0268264_101735942 | 474 |
| 539 | 3300028794 | Ga0307515_10038957 | Ga0307515_100389573 | 474 |
| 540 | 3300028794 | Ga0307515_10040590 | Ga0307515_100405903 | 474 |
| 541 | 3300031238 | Ga0265332_10024712 | Ga0265332_100247122 | 474 |
| 542 | 3300031456 | Ga0307513_10048959 | Ga0307513_100489594 | 474 |
| 543 | 3300031456 | Ga0307513_10159648 | Ga0307513_101596482 | 474 |
| 544 | 3300031507 | Ga0307509_10000092 | Ga0307509_1000009254 | 474 |
| 545 | 3300031507 | Ga0307509_10002037 | Ga0307509_100020376 | 474 |
| 546 | 3300031507 | Ga0307509_10031330 | Ga0307509_100313302 | 474 |
| 547 | 3300031649 | Ga0307514_10098191 | Ga0307514_100981912 | 474 |
| 548 | 3300031730 | Ga0307516_10000921 | Ga0307516_1000092134 | 474 |
| 549 | 3300031730 | Ga0307516_10084089 | Ga0307516_100840892 | 474 |
| 550 | 3300033180 | Ga0307510_10001210 | Ga0307510_100012108 | 474 |
| 551 | 3300033180 | Ga0307510_10022939 | Ga0307510_100229395 | 474 |
| 552 | 3300035691 | Ga0373931_0018365 | Ga0373931_0018365_1254_2705 | 474 |
| 553 | 3300037471 | Ga0395905_0000047 | Ga0395905_0000047_121489_122940 | 474 |
| 554 | 3300037471 | Ga0395905_0020959 | Ga0395905_0020959_371_1822 | 474 |
| 555 | 3300039437 | Ga0436365_1841312 | Ga0436365_1841312_7763_9211 | 474 |
| 556 | 3300039450 | Ga0436363_0008183 | Ga0436363_0008183_95_1549 | 474 |
| 557 | 3300044656 | Ga0466969_0004149 | Ga0466969_0004149_1297_2748 | 474 |
| 558 | 3300044693 | Ga0466961_0019037 | Ga0466961_0019037_1027_2478 | 474 |
| 559 | 3300045049 | Ga0466959_0007477 | Ga0466959_0007477_2671_4122 | 474 |
| 560 | 3300046454 | Ga0495592_0000413 | Ga0495592_0000413_6338_7789 | 474 |
| 561 | 3300046519 | Ga0495632_0028648 | Ga0495632_0028648_985_2433 | 474 |
| 562 | 3300046615 | Ga0495656_0005404 | Ga0495656_0005404_184_1638 | 474 |
| 563 | 3300048909 | Ga0496106_0021059 | Ga0496106_0021059_232_1677 | 474 |
| 564 | 3300048915 | Ga0496112_0050856 | Ga0496112_0050856_1004_2455 | 474 |
| 565 | 3300050493 | nmdc:mga0k408_9560_c1 | nmdc:mga0k408_9560_c1_1540_2985 | 474 |
| 566 | 3300050496 | nmdc:mga07m45_12057_c1 | nmdc:mga07m45_12057_c1_1790_3235 | 474 |
| 567 | 3300050496 | nmdc:mga07m45_16737_c1 | nmdc:mga07m45_16737_c1_474_1919 | 474 |
| 568 | 3300053086 | Ga0500578_0109622 | Ga0500578_0109622_262_1713 | 474 |
| 569 | 3300053093 | Ga0500651_0013116 | Ga0500651_0013116_521_1966 | 474 |
| 570 | 3300053136 | Ga0500559_0000017 | Ga0500559_0000017_77036_78481 | 474 |
| 571 | 3300053156 | Ga0500622_0002180 | Ga0500622_0002180_7567_9012 | 474 |
| 572 | 3300053730 | Ga0500645_001359 | Ga0500645_001359_5007_6461 | 474 |
| 573 | 3300002704 | JGI25155J39150_1000121 | JGI25155J39150_100012122 | 475 |
| 574 | 3300002705 | JGI25156J39149_1000100 | JGI25156J39149_100010022 | 475 |
| 575 | 3300002738 | JGI25154J39366_1000121 | JGI25154J39366_100012121 | 475 |
| 576 | 3300002741 | JGI25157J39369_1000130 | JGI25157J39369_100013031 | 475 |
| 577 | 3300002987 | JGI25159J45721_1000190 | JGI25159J45721_100019019 | 475 |
| 578 | 3300002987 | JGI25159J45721_1002388 | JGI25159J45721_10023884 | 475 |
| 579 | 3300003187 | JGI25151J46595_10009359 | JGI25151J46595_100093592 | 475 |
| 580 | 3300003323 | rootH1_10006056 | rootH1_100060562 | 475 |
| 581 | 3300003354 | JGI25160J50197_1000345 | JGI25160J50197_100034522 | 475 |
| 582 | 3300003374 | JGI25161J50226_1000007 | JGI25161J50226_1000007202 | 475 |
| 583 | 3300003771 | Ga0055526_1006082 | Ga0055526_10060823 | 475 |
| 584 | 3300003771 | Ga0055526_1006763 | Ga0055526_10067633 | 475 |
| 585 | 3300003773 | Ga0055537_1000183 | Ga0055537_100018329 | 475 |
| 586 | 3300003773 | Ga0055537_1000254 | Ga0055537_100025420 | 475 |
| 587 | 3300003773 | Ga0055537_1003881 | Ga0055537_10038813 | 475 |
| 588 | 3300003775 | Ga0055524_1000101 | Ga0055524_100010119 | 475 |
| 589 | 3300003784 | Ga0055534_1001577 | Ga0055534_10015774 | 475 |
| 590 | 3300003791 | Ga0055530_10001334 | Ga0055530_100013345 | 475 |
| 591 | 3300003792 | Ga0055540_1000099 | Ga0055540_100009967 | 475 |
| 592 | 3300003794 | Ga0055531_10002500 | Ga0055531_100025009 | 475 |
| 593 | 3300003794 | Ga0055531_10016598 | Ga0055531_100165983 | 475 |
| 594 | 3300004625 | Ga0055543_1001205 | Ga0055543_10012053 | 475 |
| 595 | 3300005338 | Ga0068868_100135695 | Ga0068868_1001356952 | 475 |
| 596 | 3300005440 | Ga0070705_100053755 | Ga0070705_1000537552 | 475 |
| 597 | 3300005518 | Ga0070699_100028079 | Ga0070699_1000280792 | 475 |
| 598 | 3300006038 | Ga0075365_10020559 | Ga0075365_100205592 | 475 |
| 599 | 3300006058 | Ga0075432_10031837 | Ga0075432_100318371 | 475 |
| 600 | 3300006944 | Ga0099823_1000262 | Ga0099823_100026220 | 475 |
| 601 | 3300009176 | Ga0105242_10022167 | Ga0105242_100221673 | 475 |
| 602 | 3300012502 | Ga0157347_1000437 | Ga0157347_10004372 | 475 |
| 603 | 3300025206 | Ga0209435_100008 | Ga0209435_100008308 | 475 |
| 604 | 3300025246 | Ga0209646_1000079 | Ga0209646_100007931 | 475 |
| 605 | 3300025250 | Ga0209026_1000067 | Ga0209026_100006731 | 475 |
| 606 | 3300025256 | Ga0209759_1000056 | Ga0209759_100005631 | 475 |
| 607 | 3300025263 | Ga0209565_1000041 | Ga0209565_1000041119 | 475 |
| 608 | 3300025273 | Ga0209673_1000012 | Ga0209673_100001241 | 475 |
| 609 | 3300025273 | Ga0209673_1003059 | Ga0209673_10030597 | 475 |
| 610 | 3300025284 | Ga0209130_1000184 | Ga0209130_100018464 | 475 |
| 611 | 3300025291 | Ga0209675_1000475 | Ga0209675_10004754 | 475 |
| 612 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013353 | 475 |
| 613 | 3300025294 | Ga0209025_1003125 | Ga0209025_10031254 | 475 |
| 614 | 3300025295 | Ga0209564_1001251 | Ga0209564_100125111 | 475 |
| 615 | 3300025295 | Ga0209564_1001414 | Ga0209564_100141410 | 475 |
| 616 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008353 | 475 |
| 617 | 3300025298 | Ga0209050_1009162 | Ga0209050_10091624 | 475 |
| 618 | 3300025299 | Ga0209256_1000003 | Ga0209256_100000348 | 475 |
| 619 | 3300025299 | Ga0209256_1002403 | Ga0209256_10024038 | 475 |
| 620 | 3300025299 | Ga0209256_1025630 | Ga0209256_10256302 | 475 |
| 621 | 3300025302 | Ga0207426_1008325 | Ga0207426_10083252 | 475 |
| 622 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005353 | 475 |
| 623 | 3300025303 | Ga0209051_1001419 | Ga0209051_10014193 | 475 |
| 624 | 3300025304 | Ga0209257_1000048 | Ga0209257_1000048353 | 475 |
| 625 | 3300025304 | Ga0209257_1001241 | Ga0209257_10012415 | 475 |
| 626 | 3300027296 | Ga0209389_1004459 | Ga0209389_10044597 | 475 |
| 627 | 3300027614 | Ga0209970_1000712 | Ga0209970_10007125 | 475 |
| 628 | 3300028794 | Ga0307515_10128687 | Ga0307515_101286872 | 475 |
| 629 | 3300031456 | Ga0307513_10000130 | Ga0307513_1000013087 | 475 |
| 630 | 3300031456 | Ga0307513_10078883 | Ga0307513_100788833 | 475 |
| 631 | 3300039438 | Ga0436360_0938195 | Ga0436360_0938195_146_1597 | 475 |
| 632 | 3300044666 | Ga0466977_0009695 | Ga0466977_0009695_1005_2459 | 475 |
| 633 | 3300046530 | Ga0495654_0001492 | Ga0495654_0001492_7415_8869 | 475 |
| 634 | 3300046542 | Ga0495597_0000109 | Ga0495597_0000109_50934_52388 | 475 |
| 635 | 3300048928 | Ga0496125_0005958 | Ga0496125_0005958_959_2404 | 475 |
| 636 | 3300049579 | Ga0501043_0000059 | Ga0501043_0000059_16830_18284 | 475 |
| 637 | 3300049580 | Ga0501046_0000082 | Ga0501046_0000082_16721_18175 | 475 |
| 638 | 3300049581 | Ga0501047_0000050 | Ga0501047_0000050_83161_84615 | 475 |
| 639 | 3300049581 | Ga0501047_0025367 | Ga0501047_0025367_2085_3554 | 475 |
| 640 | 3300049582 | Ga0501048_0007107 | Ga0501048_0007107_3328_4782 | 475 |
| 641 | 3300049824 | Ga0501045_0011333 | Ga0501045_0011333_695_2149 | 475 |
| 642 | 3300050492 | nmdc:mga0yw44_36343_c1 | nmdc:mga0yw44_36343_c1_989_2494 | 475 |
| 643 | 3300050493 | nmdc:mga0k408_19005_c1 | nmdc:mga0k408_19005_c1_1788_3245 | 475 |
| 644 | 3300053094 | Ga0500566_0050220 | Ga0500566_0050220_254_1711 | 475 |
| 645 | 3300053117 | Ga0500593_000168 | Ga0500593_000168_10939_12399 | 475 |
| 646 | 3300053730 | Ga0500645_000333 | Ga0500645_000333_10113_11573 | 475 |
| 647 | 3300053730 | Ga0500645_009566 | Ga0500645_009566_49_1509 | 475 |
| 648 | 3300055283 | Ga0500661_000506 | Ga0500661_000506_5364_6821 | 475 |
| 649 | iso_pu_bacteria | 2548876994 | 2550695027 | 475 |
| 650 | iso_pu_bacteria | 2643221654 | 2644302557 | 475 |
| 651 | iso_pu_bacteria | 2818991436 | 2819544620 | 475 |
| 652 | iso_pu_bacteria | 2884811622 | 2884812502 | 475 |
| 653 | iso_pu_bacteria | 2884836552 | 2884839490 | 475 |
| 654 | iso_pu_bacteria | 2884852848 | 2884856700 | 475 |
| 655 | iso_pu_bacteria | 2894023352 | 2894027804 | 475 |
| 656 | iso_pu_bacteria | 2896154374 | 2896158046 | 475 |
| 657 | iso_pu_bacteria | 2945909444 | 2945913075 | 475 |
| 658 | iso_pu_bacteria | 2945984333 | 2945984638 | 475 |
| 659 | 3300005327 | Ga0070658_10005585 | Ga0070658_100055858 | 476 |
| 660 | 3300005329 | Ga0070683_100059613 | Ga0070683_1000596132 | 476 |
| 661 | 3300005339 | Ga0070660_100007070 | Ga0070660_1000070704 | 476 |
| 662 | 3300005366 | Ga0070659_100047925 | Ga0070659_1000479252 | 476 |
| 663 | 3300005434 | Ga0070709_10020613 | Ga0070709_100206133 | 476 |
| 664 | 3300005435 | Ga0070714_100021635 | Ga0070714_1000216353 | 476 |
| 665 | 3300005436 | Ga0070713_100020020 | Ga0070713_1000200202 | 476 |
| 666 | 3300005455 | Ga0070663_100005582 | Ga0070663_1000055823 | 476 |
| 667 | 3300005530 | Ga0070679_100026267 | Ga0070679_1000262673 | 476 |
| 668 | 3300005539 | Ga0068853_100019352 | Ga0068853_1000193522 | 476 |
| 669 | 3300005543 | Ga0070672_100040912 | Ga0070672_1000409122 | 476 |
| 670 | 3300005546 | Ga0070696_100005886 | Ga0070696_1000058863 | 476 |
| 671 | 3300005563 | Ga0068855_100074485 | Ga0068855_1000744852 | 476 |
| 672 | 3300005564 | Ga0070664_100165039 | Ga0070664_1001650392 | 476 |
| 673 | 3300005614 | Ga0068856_100007848 | Ga0068856_1000078482 | 476 |
| 674 | 3300005614 | Ga0068856_100027812 | Ga0068856_1000278122 | 476 |
| 675 | 3300005719 | Ga0068861_100155056 | Ga0068861_1001550562 | 476 |
| 676 | 3300005834 | Ga0068851_10004806 | Ga0068851_100048065 | 476 |
| 677 | 3300007788 | Ga0099795_10009193 | Ga0099795_100091933 | 476 |
| 678 | 3300009093 | Ga0105240_10013339 | Ga0105240_100133392 | 476 |
| 679 | 3300009551 | Ga0105238_10038818 | Ga0105238_100388182 | 476 |
| 680 | 3300010375 | Ga0105239_10204709 | Ga0105239_102047092 | 476 |
| 681 | 3300013100 | Ga0157373_10038288 | Ga0157373_100382882 | 476 |
| 682 | 3300013102 | Ga0157371_10025257 | Ga0157371_100252572 | 476 |
| 683 | 3300013104 | Ga0157370_10004541 | Ga0157370_100045413 | 476 |
| 684 | 3300013104 | Ga0157370_10033170 | Ga0157370_100331703 | 476 |
| 685 | 3300013104 | Ga0157370_10079441 | Ga0157370_100794412 | 476 |
| 686 | 3300013306 | Ga0163162_10040756 | Ga0163162_100407562 | 476 |
| 687 | 3300013307 | Ga0157372_10035608 | Ga0157372_100356086 | 476 |
| 688 | 3300013307 | Ga0157372_10095039 | Ga0157372_100950392 | 476 |
| 689 | 3300025901 | Ga0207688_10029382 | Ga0207688_100293821 | 476 |
| 690 | 3300025909 | Ga0207705_10039251 | Ga0207705_100392512 | 476 |
| 691 | 3300025912 | Ga0207707_10028501 | Ga0207707_100285012 | 476 |
| 692 | 3300025913 | Ga0207695_10050075 | Ga0207695_100500752 | 476 |
| 693 | 3300025919 | Ga0207657_10000102 | Ga0207657_1000010255 | 476 |
| 694 | 3300025920 | Ga0207649_10035717 | Ga0207649_100357172 | 476 |
| 695 | 3300025924 | Ga0207694_10009366 | Ga0207694_100093662 | 476 |
| 696 | 3300025929 | Ga0207664_10002657 | Ga0207664_100026574 | 476 |
| 697 | 3300025932 | Ga0207690_10170693 | Ga0207690_101706932 | 476 |
| 698 | 3300025933 | Ga0207706_10087646 | Ga0207706_100876462 | 476 |
| 699 | 3300025940 | Ga0207691_10036527 | Ga0207691_100365273 | 476 |
| 700 | 3300025945 | Ga0207679_10045330 | Ga0207679_100453302 | 476 |
| 701 | 3300025945 | Ga0207679_10060643 | Ga0207679_100606431 | 476 |
| 702 | 3300025949 | Ga0207667_10009195 | Ga0207667_100091953 | 476 |
| 703 | 3300026041 | Ga0207639_10002255 | Ga0207639_1000225512 | 476 |
| 704 | 3300026067 | Ga0207678_10004850 | Ga0207678_100048504 | 476 |
| 705 | 3300026078 | Ga0207702_10032002 | Ga0207702_100320022 | 476 |
| 706 | 3300026116 | Ga0207674_10000326 | Ga0207674_100003263 | 476 |
| 707 | 3300026118 | Ga0207675_100218140 | Ga0207675_1002181402 | 476 |
| 708 | 3300037466 | Ga0395898_0047369 | Ga0395898_0047369_88_1542 | 476 |
| 709 | 3300038443 | Ga0395901_0112026 | Ga0395901_0112026_697_2151 | 476 |
| 710 | 3300042876 | Ga0451577_0130547 | Ga0451577_0130547_445_1884 | 476 |
| 711 | 3300047472 | Ga0495686_0002020 | Ga0495686_0002020_3939_5396 | 476 |
| 712 | iso_pu_bacteria | 2928170801 | 2928172485 | 476 |
| 713 | iso_pu_bacteria | 8018845410 | 8018849687 | 476 |
| 714 | iso_pu_bacteria | 8021120328 | 8021120753 | 476 |
| 715 | 3300002737 | JGI25162J39368_1000040 | JGI25162J39368_1000040152 | 477 |
| 716 | 3300003214 | JGI25165J46597_1000051 | JGI25165J46597_100005147 | 477 |
| 717 | 3300003751 | Ga0055538_1000025 | Ga0055538_1000025186 | 477 |
| 718 | 3300003752 | Ga0055539_1000032 | Ga0055539_100003247 | 477 |
| 719 | 3300003756 | Ga0055533_1000042 | Ga0055533_1000042186 | 477 |
| 720 | 3300003759 | Ga0055525_1000050 | Ga0055525_1000050186 | 477 |
| 721 | 3300003841 | Ga0055541_1000023 | Ga0055541_1000023185 | 477 |
| 722 | 3300005293 | Ga0065715_10023900 | Ga0065715_100239002 | 477 |
| 723 | 3300005328 | Ga0070676_10000148 | Ga0070676_1000014818 | 477 |
| 724 | 3300005330 | Ga0070690_100087458 | Ga0070690_1000874582 | 477 |
| 725 | 3300005331 | Ga0070670_100001361 | Ga0070670_1000013612 | 477 |
| 726 | 3300005331 | Ga0070670_100005248 | Ga0070670_1000052487 | 477 |
| 727 | 3300005331 | Ga0070670_100029684 | Ga0070670_1000296844 | 477 |
| 728 | 3300005331 | Ga0070670_100033630 | Ga0070670_1000336301 | 477 |
| 729 | 3300005334 | Ga0068869_100001654 | Ga0068869_1000016543 | 477 |
| 730 | 3300005334 | Ga0068869_100016511 | Ga0068869_1000165114 | 477 |
| 731 | 3300005335 | Ga0070666_10004155 | Ga0070666_100041554 | 477 |
| 732 | 3300005338 | Ga0068868_100001446 | Ga0068868_1000014467 | 477 |
| 733 | 3300005338 | Ga0068868_100027849 | Ga0068868_1000278492 | 477 |
| 734 | 3300005338 | Ga0068868_100120218 | Ga0068868_1001202182 | 477 |
| 735 | 3300005345 | Ga0070692_10023354 | Ga0070692_100233542 | 477 |
| 736 | 3300005347 | Ga0070668_100001207 | Ga0070668_1000012072 | 477 |
| 737 | 3300005347 | Ga0070668_100002539 | Ga0070668_1000025396 | 477 |
| 738 | 3300005347 | Ga0070668_100015868 | Ga0070668_1000158685 | 477 |
| 739 | 3300005353 | Ga0070669_100015487 | Ga0070669_1000154873 | 477 |
| 740 | 3300005354 | Ga0070675_100006009 | Ga0070675_1000060094 | 477 |
| 741 | 3300005354 | Ga0070675_100020291 | Ga0070675_1000202913 | 477 |
| 742 | 3300005355 | Ga0070671_100001859 | Ga0070671_1000018597 | 477 |
| 743 | 3300005355 | Ga0070671_100023725 | Ga0070671_1000237253 | 477 |
| 744 | 3300005355 | Ga0070671_100038568 | Ga0070671_1000385684 | 477 |
| 745 | 3300005355 | Ga0070671_100171910 | Ga0070671_1001719102 | 477 |
| 746 | 3300005364 | Ga0070673_100022841 | Ga0070673_1000228412 | 477 |
| 747 | 3300005364 | Ga0070673_100023139 | Ga0070673_1000231392 | 477 |
| 748 | 3300005365 | Ga0070688_100012229 | Ga0070688_1000122292 | 477 |
| 749 | 3300005367 | Ga0070667_100002817 | Ga0070667_10000281710 | 477 |
| 750 | 3300005367 | Ga0070667_100019721 | Ga0070667_1000197212 | 477 |
| 751 | 3300005436 | Ga0070713_100000030 | Ga0070713_10000003077 | 477 |
| 752 | 3300005440 | Ga0070705_100054282 | Ga0070705_1000542821 | 477 |
| 753 | 3300005441 | Ga0070700_100002594 | Ga0070700_1000025946 | 477 |
| 754 | 3300005445 | Ga0070708_100000315 | Ga0070708_10000031522 | 477 |
| 755 | 3300005445 | Ga0070708_100133133 | Ga0070708_1001331332 | 477 |
| 756 | 3300005456 | Ga0070678_100027467 | Ga0070678_1000274671 | 477 |
| 757 | 3300005457 | Ga0070662_100026933 | Ga0070662_1000269332 | 477 |
| 758 | 3300005457 | Ga0070662_100047869 | Ga0070662_1000478692 | 477 |
| 759 | 3300005457 | Ga0070662_100140215 | Ga0070662_1001402152 | 477 |
| 760 | 3300005459 | Ga0068867_100000611 | Ga0068867_1000006118 | 477 |
| 761 | 3300005459 | Ga0068867_100008312 | Ga0068867_1000083122 | 477 |
| 762 | 3300005459 | Ga0068867_100015611 | Ga0068867_1000156113 | 477 |
| 763 | 3300005471 | Ga0070698_100142866 | Ga0070698_1001428662 | 477 |
| 764 | 3300005543 | Ga0070672_100001593 | Ga0070672_1000015934 | 477 |
| 765 | 3300005543 | Ga0070672_100002173 | Ga0070672_1000021738 | 477 |
| 766 | 3300005543 | Ga0070672_100002527 | Ga0070672_1000025274 | 477 |
| 767 | 3300005548 | Ga0070665_100003546 | Ga0070665_1000035463 | 477 |
| 768 | 3300005563 | Ga0068855_100145450 | Ga0068855_1001454502 | 477 |
| 769 | 3300005564 | Ga0070664_100156731 | Ga0070664_1001567312 | 477 |
| 770 | 3300005577 | Ga0068857_100078530 | Ga0068857_1000785302 | 477 |
| 771 | 3300005614 | Ga0068856_100017226 | Ga0068856_1000172265 | 477 |
| 772 | 3300005617 | Ga0068859_100002372 | Ga0068859_1000023724 | 477 |
| 773 | 3300005617 | Ga0068859_100003577 | Ga0068859_10000357716 | 477 |
| 774 | 3300005617 | Ga0068859_100042632 | Ga0068859_1000426322 | 477 |
| 775 | 3300005617 | Ga0068859_100059241 | Ga0068859_1000592412 | 477 |
| 776 | 3300005618 | Ga0068864_100001575 | Ga0068864_10000157510 | 477 |
| 777 | 3300005618 | Ga0068864_100002069 | Ga0068864_1000020692 | 477 |
| 778 | 3300005618 | Ga0068864_100008157 | Ga0068864_1000081575 | 477 |
| 779 | 3300005618 | Ga0068864_100023397 | Ga0068864_1000233972 | 477 |
| 780 | 3300005618 | Ga0068864_100040760 | Ga0068864_1000407603 | 477 |
| 781 | 3300005618 | Ga0068864_100090975 | Ga0068864_1000909752 | 477 |
| 782 | 3300005618 | Ga0068864_100098419 | Ga0068864_1000984192 | 477 |
| 783 | 3300005719 | Ga0068861_100000301 | Ga0068861_10000030111 | 477 |
| 784 | 3300005719 | Ga0068861_100037108 | Ga0068861_1000371083 | 477 |
| 785 | 3300005719 | Ga0068861_100062179 | Ga0068861_1000621792 | 477 |
| 786 | 3300005840 | Ga0068870_10043673 | Ga0068870_100436732 | 477 |
| 787 | 3300005841 | Ga0068863_100003067 | Ga0068863_1000030677 | 477 |
| 788 | 3300005841 | Ga0068863_100025414 | Ga0068863_1000254143 | 477 |
| 789 | 3300005841 | Ga0068863_100269639 | Ga0068863_1002696392 | 477 |
| 790 | 3300005842 | Ga0068858_100006180 | Ga0068858_1000061802 | 477 |
| 791 | 3300005842 | Ga0068858_100007048 | Ga0068858_10000704811 | 477 |
| 792 | 3300005842 | Ga0068858_100021347 | Ga0068858_1000213474 | 477 |
| 793 | 3300005843 | Ga0068860_100012715 | Ga0068860_1000127155 | 477 |
| 794 | 3300005843 | Ga0068860_100028913 | Ga0068860_1000289134 | 477 |
| 795 | 3300005843 | Ga0068860_100092329 | Ga0068860_1000923292 | 477 |
| 796 | 3300005844 | Ga0068862_100041734 | Ga0068862_1000417342 | 477 |
| 797 | 3300005844 | Ga0068862_100056683 | Ga0068862_1000566832 | 477 |
| 798 | 3300005844 | Ga0068862_100061758 | Ga0068862_1000617582 | 477 |
| 799 | 3300006237 | Ga0097621_100034286 | Ga0097621_1000342862 | 477 |
| 800 | 3300006237 | Ga0097621_100131299 | Ga0097621_1001312992 | 477 |
| 801 | 3300006358 | Ga0068871_100010918 | Ga0068871_1000109183 | 477 |
| 802 | 3300006358 | Ga0068871_100020682 | Ga0068871_1000206822 | 477 |
| 803 | 3300006358 | Ga0068871_100078028 | Ga0068871_1000780282 | 477 |
| 804 | 3300006871 | Ga0075434_100217527 | Ga0075434_1002175272 | 477 |
| 805 | 3300006881 | Ga0068865_100029143 | Ga0068865_1000291433 | 477 |
| 806 | 3300006931 | Ga0097620_100002372 | Ga0097620_10000237215 | 477 |
| 807 | 3300006931 | Ga0097620_100003577 | Ga0097620_10000357716 | 477 |
| 808 | 3300006931 | Ga0097620_100042633 | Ga0097620_1000426332 | 477 |
| 809 | 3300006931 | Ga0097620_100059240 | Ga0097620_1000592402 | 477 |
| 810 | 3300009094 | Ga0111539_10115047 | Ga0111539_101150472 | 477 |
| 811 | 3300009098 | Ga0105245_10029258 | Ga0105245_100292582 | 477 |
| 812 | 3300009101 | Ga0105247_10032359 | Ga0105247_100323593 | 477 |
| 813 | 3300009148 | Ga0105243_10035079 | Ga0105243_100350793 | 477 |
| 814 | 3300009177 | Ga0105248_10002044 | Ga0105248_100020443 | 477 |
| 815 | 3300009177 | Ga0105248_10009798 | Ga0105248_100097985 | 477 |
| 816 | 3300009177 | Ga0105248_10020721 | Ga0105248_100207211 | 477 |
| 817 | 3300009177 | Ga0105248_10166548 | Ga0105248_101665482 | 477 |
| 818 | 3300009553 | Ga0105249_10049391 | Ga0105249_100493912 | 477 |
| 819 | 3300013308 | Ga0157375_10010250 | Ga0157375_100102502 | 477 |
| 820 | 3300013308 | Ga0157375_10054701 | Ga0157375_100547012 | 477 |
| 821 | 3300013308 | Ga0157375_10054813 | Ga0157375_100548132 | 477 |
| 822 | 3300013308 | Ga0157375_10066889 | Ga0157375_100668893 | 477 |
| 823 | 3300014325 | Ga0163163_10017467 | Ga0163163_100174674 | 477 |
| 824 | 3300014325 | Ga0163163_10115197 | Ga0163163_101151972 | 477 |
| 825 | 3300014326 | Ga0157380_10032014 | Ga0157380_100320142 | 477 |
| 826 | 3300014497 | Ga0182008_10049376 | Ga0182008_100493762 | 477 |
| 827 | 3300014968 | Ga0157379_10007870 | Ga0157379_100078704 | 477 |
| 828 | 3300014968 | Ga0157379_10020780 | Ga0157379_100207803 | 477 |
| 829 | 3300014969 | Ga0157376_10094119 | Ga0157376_100941192 | 477 |
| 830 | 3300015261 | Ga0182006_1007864 | Ga0182006_10078643 | 477 |
| 831 | 3300017792 | Ga0163161_10021996 | Ga0163161_100219964 | 477 |
| 832 | 3300025224 | Ga0209784_100010 | Ga0209784_100010564 | 477 |
| 833 | 3300025225 | Ga0209566_100008 | Ga0209566_100008564 | 477 |
| 834 | 3300025226 | Ga0209674_100019 | Ga0209674_100019564 | 477 |
| 835 | 3300025230 | Ga0209563_100021 | Ga0209563_100021564 | 477 |
| 836 | 3300025231 | Ga0207427_102072 | Ga0207427_1020725 | 477 |
| 837 | 3300025233 | Ga0209437_100019 | Ga0209437_100019564 | 477 |
| 838 | 3300025253 | Ga0209677_100011 | Ga0209677_100011564 | 477 |
| 839 | 3300025261 | Ga0209233_1000025 | Ga0209233_1000025564 | 477 |
| 840 | 3300025315 | Ga0207697_10014393 | Ga0207697_100143932 | 477 |
| 841 | 3300025315 | Ga0207697_10023252 | Ga0207697_100232522 | 477 |
| 842 | 3300025900 | Ga0207710_10012401 | Ga0207710_100124013 | 477 |
| 843 | 3300025901 | Ga0207688_10089488 | Ga0207688_100894882 | 477 |
| 844 | 3300025903 | Ga0207680_10005170 | Ga0207680_100051702 | 477 |
| 845 | 3300025903 | Ga0207680_10023025 | Ga0207680_100230252 | 477 |
| 846 | 3300025907 | Ga0207645_10000549 | Ga0207645_1000054917 | 477 |
| 847 | 3300025907 | Ga0207645_10056454 | Ga0207645_100564542 | 477 |
| 848 | 3300025908 | Ga0207643_10010895 | Ga0207643_100108952 | 477 |
| 849 | 3300025917 | Ga0207660_10080220 | Ga0207660_100802202 | 477 |
| 850 | 3300025923 | Ga0207681_10008019 | Ga0207681_100080195 | 477 |
| 851 | 3300025923 | Ga0207681_10025579 | Ga0207681_100255794 | 477 |
| 852 | 3300025925 | Ga0207650_10007698 | Ga0207650_100076986 | 477 |
| 853 | 3300025926 | Ga0207659_10001823 | Ga0207659_100018234 | 477 |
| 854 | 3300025926 | Ga0207659_10002543 | Ga0207659_100025439 | 477 |
| 855 | 3300025928 | Ga0207700_10000209 | Ga0207700_1000020915 | 477 |
| 856 | 3300025931 | Ga0207644_10002955 | Ga0207644_100029557 | 477 |
| 857 | 3300025933 | Ga0207706_10039869 | Ga0207706_100398692 | 477 |
| 858 | 3300025933 | Ga0207706_10082514 | Ga0207706_100825143 | 477 |
| 859 | 3300025935 | Ga0207709_10019778 | Ga0207709_100197782 | 477 |
| 860 | 3300025937 | Ga0207669_10055128 | Ga0207669_100551282 | 477 |
| 861 | 3300025938 | Ga0207704_10001029 | Ga0207704_100010292 | 477 |
| 862 | 3300025938 | Ga0207704_10003578 | Ga0207704_100035783 | 477 |
| 863 | 3300025938 | Ga0207704_10054456 | Ga0207704_100544562 | 477 |
| 864 | 3300025940 | Ga0207691_10000105 | Ga0207691_1000010555 | 477 |
| 865 | 3300025940 | Ga0207691_10018938 | Ga0207691_100189382 | 477 |
| 866 | 3300025940 | Ga0207691_10040328 | Ga0207691_100403283 | 477 |
| 867 | 3300025941 | Ga0207711_10032218 | Ga0207711_100322182 | 477 |
| 868 | 3300025942 | Ga0207689_10000280 | Ga0207689_100002804 | 477 |
| 869 | 3300025942 | Ga0207689_10061855 | Ga0207689_100618552 | 477 |
| 870 | 3300025942 | Ga0207689_10094298 | Ga0207689_100942982 | 477 |
| 871 | 3300025960 | Ga0207651_10009785 | Ga0207651_100097855 | 477 |
| 872 | 3300025960 | Ga0207651_10040178 | Ga0207651_100401782 | 477 |
| 873 | 3300025960 | Ga0207651_10063916 | Ga0207651_100639162 | 477 |
| 874 | 3300025961 | Ga0207712_10018035 | Ga0207712_100180352 | 477 |
| 875 | 3300025972 | Ga0207668_10009416 | Ga0207668_100094164 | 477 |
| 876 | 3300025972 | Ga0207668_10013512 | Ga0207668_100135124 | 477 |
| 877 | 3300025972 | Ga0207668_10111395 | Ga0207668_101113952 | 477 |
| 878 | 3300025986 | Ga0207658_10003703 | Ga0207658_100037032 | 477 |
| 879 | 3300025986 | Ga0207658_10016389 | Ga0207658_100163892 | 477 |
| 880 | 3300025986 | Ga0207658_10243707 | Ga0207658_102437071 | 477 |
| 881 | 3300026023 | Ga0207677_10016469 | Ga0207677_100164692 | 477 |
| 882 | 3300026035 | Ga0207703_10002556 | Ga0207703_100025562 | 477 |
| 883 | 3300026035 | Ga0207703_10007174 | Ga0207703_100071749 | 477 |
| 884 | 3300026035 | Ga0207703_10010786 | Ga0207703_100107864 | 477 |
| 885 | 3300026067 | Ga0207678_10049530 | Ga0207678_100495303 | 477 |
| 886 | 3300026075 | Ga0207708_10053137 | Ga0207708_100531372 | 477 |
| 887 | 3300026075 | Ga0207708_10071542 | Ga0207708_100715422 | 477 |
| 888 | 3300026078 | Ga0207702_10049691 | Ga0207702_100496913 | 477 |
| 889 | 3300026088 | Ga0207641_10018825 | Ga0207641_100188253 | 477 |
| 890 | 3300026088 | Ga0207641_10023973 | Ga0207641_100239735 | 477 |
| 891 | 3300026088 | Ga0207641_10094025 | Ga0207641_100940252 | 477 |
| 892 | 3300026088 | Ga0207641_10169323 | Ga0207641_101693232 | 477 |
| 893 | 3300026088 | Ga0207641_10255224 | Ga0207641_102552242 | 477 |
| 894 | 3300026089 | Ga0207648_10000320 | Ga0207648_1000032016 | 477 |
| 895 | 3300026089 | Ga0207648_10006803 | Ga0207648_100068035 | 477 |
| 896 | 3300026089 | Ga0207648_10016468 | Ga0207648_100164684 | 477 |
| 897 | 3300026089 | Ga0207648_10035662 | Ga0207648_100356622 | 477 |
| 898 | 3300026095 | Ga0207676_10011495 | Ga0207676_100114953 | 477 |
| 899 | 3300026095 | Ga0207676_10013054 | Ga0207676_100130543 | 477 |
| 900 | 3300026095 | Ga0207676_10013290 | Ga0207676_100132902 | 477 |
| 901 | 3300026095 | Ga0207676_10029112 | Ga0207676_100291123 | 477 |
| 902 | 3300026095 | Ga0207676_10162743 | Ga0207676_101627432 | 477 |
| 903 | 3300026095 | Ga0207676_10187202 | Ga0207676_101872022 | 477 |
| 904 | 3300026116 | Ga0207674_10030905 | Ga0207674_100309053 | 477 |
| 905 | 3300026118 | Ga0207675_100009583 | Ga0207675_1000095832 | 477 |
| 906 | 3300026118 | Ga0207675_100012572 | Ga0207675_1000125725 | 477 |
| 907 | 3300026118 | Ga0207675_100036832 | Ga0207675_1000368322 | 477 |
| 908 | 3300026121 | Ga0207683_10001281 | Ga0207683_1000128121 | 477 |
| 909 | 3300026121 | Ga0207683_10012093 | Ga0207683_100120936 | 477 |
| 910 | 3300026121 | Ga0207683_10099612 | Ga0207683_100996122 | 477 |
| 911 | 3300026121 | Ga0207683_10125895 | Ga0207683_101258952 | 477 |
| 912 | 3300026142 | Ga0207698_10005671 | Ga0207698_100056712 | 477 |
| 913 | 3300027907 | Ga0207428_10058536 | Ga0207428_100585362 | 477 |
| 914 | 3300027907 | Ga0207428_10087624 | Ga0207428_100876242 | 477 |
| 915 | 3300028380 | Ga0268265_10025215 | Ga0268265_100252153 | 477 |
| 916 | 3300028380 | Ga0268265_10048832 | Ga0268265_100488322 | 477 |
| 917 | 3300028381 | Ga0268264_10008321 | Ga0268264_100083216 | 477 |
| 918 | 3300028381 | Ga0268264_10035972 | Ga0268264_100359725 | 477 |
| 919 | 3300028381 | Ga0268264_10071659 | Ga0268264_100716592 | 477 |
| 920 | 3300031548 | Ga0307408_100028855 | Ga0307408_1000288552 | 477 |
| 921 | 3300031731 | Ga0307405_10003255 | Ga0307405_100032552 | 477 |
| 922 | 3300031852 | Ga0307410_10001960 | Ga0307410_100019602 | 477 |
| 923 | 3300031901 | Ga0307406_10027934 | Ga0307406_100279343 | 477 |
| 924 | 3300031901 | Ga0307406_10040728 | Ga0307406_100407282 | 477 |
| 925 | 3300031903 | Ga0307407_10001283 | Ga0307407_100012832 | 477 |
| 926 | 3300031911 | Ga0307412_10001820 | Ga0307412_100018203 | 477 |
| 927 | 3300031911 | Ga0307412_10135456 | Ga0307412_101354562 | 477 |
| 928 | 3300031995 | Ga0307409_100004831 | Ga0307409_1000048315 | 477 |
| 929 | 3300032002 | Ga0307416_100007807 | Ga0307416_1000078072 | 477 |
| 930 | 3300032002 | Ga0307416_100019906 | Ga0307416_1000199062 | 477 |
| 931 | 3300032005 | Ga0307411_10012027 | Ga0307411_100120273 | 477 |
| 932 | 3300032005 | Ga0307411_10070410 | Ga0307411_100704102 | 477 |
| 933 | 3300032126 | Ga0307415_100007103 | Ga0307415_1000071032 | 477 |
| 934 | 3300035692 | Ga0373935_0008119 | Ga0373935_0008119_2178_3638 | 477 |
| 935 | 3300035725 | Ga0373947_0016263 | Ga0373947_0016263_1674_3134 | 477 |
| 936 | 3300036401 | Ga0373937_0007414 | Ga0373937_0007414_1615_3075 | 477 |
| 937 | 3300037068 | Ga0373925_0031520 | Ga0373925_0031520_1924_3378 | 477 |
| 938 | 3300037471 | Ga0395905_0000167 | Ga0395905_0000167_99516_100979 | 477 |
| 939 | 3300042439 | Ga0439464_0004023 | Ga0439464_0004023_445_1881 | 477 |
| 940 | 3300046454 | Ga0495592_0058453 | Ga0495592_0058453_55_1515 | 477 |
| 941 | 3300046462 | Ga0495651_0003918 | Ga0495651_0003918_7498_8958 | 477 |
| 942 | 3300046463 | Ga0495653_0004554 | Ga0495653_0004554_5992_7452 | 477 |
| 943 | 3300046511 | Ga0495608_0004039 | Ga0495608_0004039_4803_6263 | 477 |
| 944 | 3300046514 | Ga0495618_0009666 | Ga0495618_0009666_1014_2474 | 477 |
| 945 | 3300046516 | Ga0495628_0002401 | Ga0495628_0002401_10414_11874 | 477 |
| 946 | 3300046516 | Ga0495628_0004370 | Ga0495628_0004370_5619_7079 | 477 |
| 947 | 3300046529 | Ga0495652_0007905 | Ga0495652_0007905_2619_4076 | 477 |
| 948 | 3300046543 | Ga0495645_0016092 | Ga0495645_0016092_2441_3901 | 477 |
| 949 | 3300046543 | Ga0495645_0025940 | Ga0495645_0025940_670_2130 | 477 |
| 950 | 3300046660 | Ga0495625_0000336 | Ga0495625_0000336_48250_49707 | 477 |
| 951 | 3300046675 | Ga0495657_0089713 | Ga0495657_0089713_288_1748 | 477 |
| 952 | 3300046678 | Ga0495599_0000731 | Ga0495599_0000731_15699_17159 | 477 |
| 953 | 3300046680 | Ga0495646_0003800 | Ga0495646_0003800_7600_9060 | 477 |
| 954 | 3300046683 | Ga0495658_0071811 | Ga0495658_0071811_359_1816 | 477 |
| 955 | 3300046809 | Ga0495600_0000574 | Ga0495600_0000574_12603_14063 | 477 |
| 956 | 3300047317 | Ga0495604_0006351 | Ga0495604_0006351_4510_5970 | 477 |
| 957 | 3300048088 | Ga0495602_0081917 | Ga0495602_0081917_1208_2668 | 477 |
| 958 | 3300048905 | Ga0496102_0034159 | Ga0496102_0034159_1434_2888 | 477 |
| 959 | 3300048907 | Ga0496104_0028189 | Ga0496104_0028189_410_1846 | 477 |
| 960 | 3300049581 | Ga0501047_0002160 | Ga0501047_0002160_4153_5610 | 477 |
| 961 | 3300049585 | Ga0501069_0011483 | Ga0501069_0011483_2819_4276 | 477 |
| 962 | 3300049586 | Ga0501070_0001480 | Ga0501070_0001480_7969_9426 | 477 |
| 963 | 3300049589 | Ga0501073_0000067 | Ga0501073_0000067_34698_36155 | 477 |
| 964 | 3300049590 | Ga0501074_0000588 | Ga0501074_0000588_10056_11513 | 477 |
| 965 | 3300049742 | Ga0501080_0034930 | Ga0501080_0034930_164_1621 | 477 |
| 966 | 3300049744 | Ga0501083_0000515 | Ga0501083_0000515_11548_13005 | 477 |
| 967 | 3300049822 | Ga0501035_0056178 | Ga0501035_0056178_1701_3158 | 477 |
| 968 | 3300050512 | nmdc:mga0n895_131858_c1 | nmdc:mga0n895_131858_c1_158_1618 | 477 |
| 969 | 3300053141 | Ga0500574_002682 | Ga0500574_002682_486_1946 | 477 |
| 970 | iso_pu_bacteria | 2513237150 | 2513952653 | 477 |
| 971 | iso_pu_bacteria | 2513237165 | 2514045193 | 477 |
| 972 | iso_pu_bacteria | 644736347 | 644750736 | 477 |
| 973 | 3300002244 | JGI24742J22300_10004324 | JGI24742J22300_100043242 | 478 |
| 974 | 3300005290 | Ga0065712_10076177 | Ga0065712_100761772 | 478 |
| 975 | 3300005328 | Ga0070676_10043269 | Ga0070676_100432692 | 478 |
| 976 | 3300005329 | Ga0070683_100017202 | Ga0070683_1000172022 | 478 |
| 977 | 3300005330 | Ga0070690_100022632 | Ga0070690_1000226322 | 478 |
| 978 | 3300005331 | Ga0070670_100024381 | Ga0070670_1000243813 | 478 |
| 979 | 3300005333 | Ga0070677_10023498 | Ga0070677_100234982 | 478 |
| 980 | 3300005340 | Ga0070689_100005644 | Ga0070689_1000056444 | 478 |
| 981 | 3300005343 | Ga0070687_100000725 | Ga0070687_1000007255 | 478 |
| 982 | 3300005344 | Ga0070661_100013669 | Ga0070661_1000136694 | 478 |
| 983 | 3300005345 | Ga0070692_10018619 | Ga0070692_100186192 | 478 |
| 984 | 3300005354 | Ga0070675_100177231 | Ga0070675_1001772312 | 478 |
| 985 | 3300005356 | Ga0070674_100098106 | Ga0070674_1000981062 | 478 |
| 986 | 3300005365 | Ga0070688_100007940 | Ga0070688_1000079402 | 478 |
| 987 | 3300005366 | Ga0070659_100069679 | Ga0070659_1000696792 | 478 |
| 988 | 3300005438 | Ga0070701_10083976 | Ga0070701_100839761 | 478 |
| 989 | 3300005457 | Ga0070662_100057765 | Ga0070662_1000577652 | 478 |
| 990 | 3300005466 | Ga0070685_10023432 | Ga0070685_100234322 | 478 |
| 991 | 3300005539 | Ga0068853_100098240 | Ga0068853_1000982402 | 478 |
| 992 | 3300005544 | Ga0070686_100072944 | Ga0070686_1000729442 | 478 |
| 993 | 3300005616 | Ga0068852_100015228 | Ga0068852_1000152282 | 478 |
| 994 | 3300005617 | Ga0068859_100035283 | Ga0068859_1000352833 | 478 |
| 995 | 3300005617 | Ga0068859_100223378 | Ga0068859_1002233782 | 478 |
| 996 | 3300005618 | Ga0068864_100006417 | Ga0068864_1000064172 | 478 |
| 997 | 3300005718 | Ga0068866_10002154 | Ga0068866_100021543 | 478 |
| 998 | 3300005719 | Ga0068861_100020256 | Ga0068861_1000202562 | 478 |
| 999 | 3300005834 | Ga0068851_10004667 | Ga0068851_100046673 | 478 |
| 1000 | 3300005840 | Ga0068870_10001765 | Ga0068870_100017656 | 478 |
| 1001 | 3300005841 | Ga0068863_100148406 | Ga0068863_1001484062 | 478 |
| 1002 | 3300005842 | Ga0068858_100089727 | Ga0068858_1000897273 | 478 |
| 1003 | 3300005843 | Ga0068860_100041016 | Ga0068860_1000410162 | 478 |
| 1004 | 3300006931 | Ga0097620_100035282 | Ga0097620_1000352823 | 478 |
| 1005 | 3300006931 | Ga0097620_100223359 | Ga0097620_1002233592 | 478 |
| 1006 | 3300009094 | Ga0111539_10039561 | Ga0111539_100395612 | 478 |
| 1007 | 3300009148 | Ga0105243_10070583 | Ga0105243_100705832 | 478 |
| 1008 | 3300009177 | Ga0105248_10116645 | Ga0105248_101166452 | 478 |
| 1009 | 3300009551 | Ga0105238_10212985 | Ga0105238_102129852 | 478 |
| 1010 | 3300009553 | Ga0105249_10024270 | Ga0105249_100242702 | 478 |
| 1011 | 3300013296 | Ga0157374_10039253 | Ga0157374_100392533 | 478 |
| 1012 | 3300013296 | Ga0157374_10047421 | Ga0157374_100474213 | 478 |
| 1013 | 3300013297 | Ga0157378_10043470 | Ga0157378_100434703 | 478 |
| 1014 | 3300013306 | Ga0163162_10100788 | Ga0163162_101007882 | 478 |
| 1015 | 3300013308 | Ga0157375_10183362 | Ga0157375_101833622 | 478 |
| 1016 | 3300014326 | Ga0157380_10045371 | Ga0157380_100453711 | 478 |
| 1017 | 3300014968 | Ga0157379_10005362 | Ga0157379_100053623 | 478 |
| 1018 | 3300014969 | Ga0157376_10062505 | Ga0157376_100625053 | 478 |
| 1019 | 3300017792 | Ga0163161_10010292 | Ga0163161_100102922 | 478 |
| 1020 | 3300025315 | Ga0207697_10000570 | Ga0207697_100005702 | 478 |
| 1021 | 3300025893 | Ga0207682_10000037 | Ga0207682_1000003739 | 478 |
| 1022 | 3300025899 | Ga0207642_10032752 | Ga0207642_100327522 | 478 |
| 1023 | 3300025908 | Ga0207643_10000184 | Ga0207643_100001846 | 478 |
| 1024 | 3300025913 | Ga0207695_10054043 | Ga0207695_100540434 | 478 |
| 1025 | 3300025918 | Ga0207662_10000381 | Ga0207662_100003812 | 478 |
| 1026 | 3300025919 | Ga0207657_10143172 | Ga0207657_101431721 | 478 |
| 1027 | 3300025923 | Ga0207681_10070544 | Ga0207681_100705442 | 478 |
| 1028 | 3300025925 | Ga0207650_10002667 | Ga0207650_100026674 | 478 |
| 1029 | 3300025925 | Ga0207650_10031866 | Ga0207650_100318663 | 478 |
| 1030 | 3300025926 | Ga0207659_10003407 | Ga0207659_100034075 | 478 |
| 1031 | 3300025931 | Ga0207644_10009799 | Ga0207644_100097993 | 478 |
| 1032 | 3300025934 | Ga0207686_10006148 | Ga0207686_100061483 | 478 |
| 1033 | 3300025936 | Ga0207670_10006415 | Ga0207670_100064156 | 478 |
| 1034 | 3300025938 | Ga0207704_10004265 | Ga0207704_100042655 | 478 |
| 1035 | 3300025940 | Ga0207691_10002234 | Ga0207691_100022347 | 478 |
| 1036 | 3300025941 | Ga0207711_10042809 | Ga0207711_100428093 | 478 |
| 1037 | 3300025942 | Ga0207689_10019933 | Ga0207689_100199333 | 478 |
| 1038 | 3300025945 | Ga0207679_10006792 | Ga0207679_100067925 | 478 |
| 1039 | 3300025960 | Ga0207651_10025618 | Ga0207651_100256182 | 478 |
| 1040 | 3300025972 | Ga0207668_10110882 | Ga0207668_101108822 | 478 |
| 1041 | 3300025986 | Ga0207658_10059486 | Ga0207658_100594862 | 478 |
| 1042 | 3300026023 | Ga0207677_10073542 | Ga0207677_100735422 | 478 |
| 1043 | 3300026035 | Ga0207703_10027160 | Ga0207703_100271603 | 478 |
| 1044 | 3300026075 | Ga0207708_10005067 | Ga0207708_100050677 | 478 |
| 1045 | 3300026088 | Ga0207641_10074038 | Ga0207641_100740382 | 478 |
| 1046 | 3300026095 | Ga0207676_10014707 | Ga0207676_100147075 | 478 |
| 1047 | 3300026116 | Ga0207674_10003123 | Ga0207674_1000312311 | 478 |
| 1048 | 3300026118 | Ga0207675_100000538 | Ga0207675_10000053827 | 478 |
| 1049 | 3300026142 | Ga0207698_10076080 | Ga0207698_100760802 | 478 |
| 1050 | 3300027378 | Ga0209981_1002185 | Ga0209981_10021854 | 478 |
| 1051 | 3300037418 | Ga0395900_0058900 | Ga0395900_0058900_366_1805 | 478 |
| 1052 | 3300037471 | Ga0395905_0024202 | Ga0395905_0024202_1685_3124 | 478 |
| 1053 | 3300042876 | Ga0451577_0054128 | Ga0451577_0054128_1435_2883 | 478 |
| 1054 | 3300044712 | Ga0453684_0136057 | Ga0453684_0136057_612_2060 | 478 |
| 1055 | 3300045051 | Ga0451576_0115595 | Ga0451576_0115595_754_2211 | 478 |
| 1056 | 3300048904 | Ga0496101_0015940 | Ga0496101_0015940_1146_2606 | 478 |
| 1057 | 3300048905 | Ga0496102_0097188 | Ga0496102_0097188_900_2360 | 478 |
| 1058 | 3300048908 | Ga0496105_0012490 | Ga0496105_0012490_2348_3808 | 478 |
| 1059 | 3300048909 | Ga0496106_0014091 | Ga0496106_0014091_2060_3520 | 478 |
| 1060 | 3300048910 | Ga0496107_0034910 | Ga0496107_0034910_879_2339 | 478 |
| 1061 | 3300048911 | Ga0496108_0031647 | Ga0496108_0031647_2420_3880 | 478 |
| 1062 | 3300048912 | Ga0496109_0043374 | Ga0496109_0043374_2128_3588 | 478 |
| 1063 | 3300048913 | Ga0496110_0012905 | Ga0496110_0012905_4232_5692 | 478 |
| 1064 | 3300048917 | Ga0496114_0107069 | Ga0496114_0107069_594_2054 | 478 |
| 1065 | 3300050511 | nmdc:mga08y16_58737_c1 | nmdc:mga08y16_58737_c1_2164_3624 | 478 |
| 1066 | iso_pu_bacteria | 2513237166 | 2514051201 | 478 |
| 1067 | iso_pu_bacteria | 2562617112 | 2563056455 | 478 |
| 1068 | iso_pu_bacteria | 2599185214 | 2599622547 | 478 |
| 1069 | iso_pu_bacteria | 2599185226 | 2599671026 | 478 |
| 1070 | iso_pu_bacteria | 2599185227 | 2599679937 | 478 |
| 1071 | iso_pu_bacteria | 2599185229 | 2599691953 | 478 |
| 1072 | iso_pu_bacteria | 2599185240 | 2599744459 | 478 |
| 1073 | iso_pu_bacteria | 2599185355 | 2600206496 | 478 |
| 1074 | iso_pu_bacteria | 2643221683 | 2644468913 | 478 |
| 1075 | iso_pu_bacteria | 2675903129 | 2676744664 | 478 |
| 1076 | iso_pu_bacteria | 2711768613 | 2713481537 | 478 |
| 1077 | iso_pu_bacteria | 2738541277 | 2738722136 | 478 |
| 1078 | iso_pu_bacteria | 2738541307 | 2738883058 | 478 |
| 1079 | iso_pu_bacteria | 2738543019 | 2739282500 | 478 |
| 1080 | iso_pu_bacteria | 2744054900 | 2746087591 | 478 |
| 1081 | iso_pu_bacteria | 2744054900 | 2746089086 | 478 |
| 1082 | iso_pu_bacteria | 2744054901 | 2746095953 | 478 |
| 1083 | iso_pu_bacteria | 2744054901 | 2746097218 | 478 |
| 1084 | iso_pu_bacteria | 2791355137 | 2792835200 | 478 |
| 1085 | iso_pu_bacteria | 2831265667 | 2831271413 | 478 |
| 1086 | iso_pu_bacteria | 2842324504 | 2842325548 | 478 |
| 1087 | iso_pu_bacteria | 2842348783 | 2842349827 | 478 |
| 1088 | iso_pu_bacteria | 2842454564 | 2842454936 | 478 |
| 1089 | iso_pu_bacteria | 2863421361 | 2863426175 | 478 |
| 1090 | iso_pu_bacteria | 2870068957 | 2870069764 | 478 |
| 1091 | iso_pu_bacteria | 2900634093 | 2900639910 | 478 |
| 1092 | iso_pu_bacteria | 2904541872 | 2904544283 | 478 |
| 1093 | iso_pu_bacteria | 2904564687 | 2904570857 | 478 |
| 1094 | iso_pu_bacteria | 2904571731 | 2904578021 | 478 |
| 1095 | iso_pu_bacteria | 2904615490 | 2904621078 | 478 |
| 1096 | iso_pu_bacteria | 2921643360 | 2921643460 | 478 |
| 1097 | iso_pu_bacteria | 2928070936 | 2928077572 | 478 |
| 1098 | iso_pu_bacteria | 2928157003 | 2928161704 | 478 |
| 1099 | iso_pu_bacteria | 2928163908 | 2928170727 | 478 |
| 1100 | iso_pu_bacteria | 2928170801 | 2928176712 | 478 |
| 1101 | iso_pu_bacteria | 2928536128 | 2928539346 | 478 |
| 1102 | iso_pu_bacteria | 2929160207 | 2929162145 | 478 |
| 1103 | iso_pu_bacteria | 2945909444 | 2945913450 | 478 |
| 1104 | iso_pu_bacteria | 2945984333 | 2945991157 | 478 |
| 1105 | iso_pu_bacteria | 2954767861 | 2954767932 | 478 |
| 1106 | iso_pu_bacteria | 2981990288 | 2981993131 | 478 |
| 1107 | iso_pu_bacteria | 641736154 | 642414755 | 478 |
| 1108 | iso_pu_bacteria | 642555113 | 642615464 | 478 |
| 1109 | iso_pu_bacteria | 8020938398 | 8020940783 | 478 |
| 1110 | iso_pu_bacteria | 8020945358 | 8020949034 | 478 |
| 1111 | iso_pu_bacteria | 8020953355 | 8020956353 | 478 |
| 1112 | iso_pu_bacteria | 8055266321 | 8055272939 | 478 |
| 1113 | 3300005336 | Ga0070680_100003143 | Ga0070680_1000031436 | 479 |
| 1114 | 3300005344 | Ga0070661_100014791 | Ga0070661_1000147913 | 479 |
| 1115 | 3300005345 | Ga0070692_10006942 | Ga0070692_100069424 | 479 |
| 1116 | 3300005354 | Ga0070675_100061149 | Ga0070675_1000611491 | 479 |
| 1117 | 3300005355 | Ga0070671_100034527 | Ga0070671_1000345272 | 479 |
| 1118 | 3300005355 | Ga0070671_100037375 | Ga0070671_1000373752 | 479 |
| 1119 | 3300005364 | Ga0070673_100049389 | Ga0070673_1000493892 | 479 |
| 1120 | 3300005366 | Ga0070659_100003843 | Ga0070659_1000038436 | 479 |
| 1121 | 3300005444 | Ga0070694_100006213 | Ga0070694_1000062134 | 479 |
| 1122 | 3300005455 | Ga0070663_100026453 | Ga0070663_1000264533 | 479 |
| 1123 | 3300005545 | Ga0070695_100095895 | Ga0070695_1000958951 | 479 |
| 1124 | 3300005546 | Ga0070696_100124032 | Ga0070696_1001240321 | 479 |
| 1125 | 3300005563 | Ga0068855_100001125 | Ga0068855_1000011254 | 479 |
| 1126 | 3300005564 | Ga0070664_100001613 | Ga0070664_1000016134 | 479 |
| 1127 | 3300005614 | Ga0068856_100002166 | Ga0068856_1000021662 | 479 |
| 1128 | 3300005616 | Ga0068852_100005228 | Ga0068852_1000052282 | 479 |
| 1129 | 3300005617 | Ga0068859_100215824 | Ga0068859_1002158241 | 479 |
| 1130 | 3300005834 | Ga0068851_10058505 | Ga0068851_100585051 | 479 |
| 1131 | 3300005843 | Ga0068860_100022270 | Ga0068860_1000222703 | 479 |
| 1132 | 3300005844 | Ga0068862_100003581 | Ga0068862_10000358116 | 479 |
| 1133 | 3300006195 | Ga0075366_10012563 | Ga0075366_100125634 | 479 |
| 1134 | 3300006844 | Ga0075428_100008716 | Ga0075428_1000087163 | 479 |
| 1135 | 3300006847 | Ga0075431_100020085 | Ga0075431_1000200855 | 479 |
| 1136 | 3300006931 | Ga0097620_100215825 | Ga0097620_1002158251 | 479 |
| 1137 | 3300009148 | Ga0105243_10058069 | Ga0105243_100580692 | 479 |
| 1138 | 3300013102 | Ga0157371_10001585 | Ga0157371_100015852 | 479 |
| 1139 | 3300013307 | Ga0157372_10088187 | Ga0157372_100881872 | 479 |
| 1140 | 3300025907 | Ga0207645_10057329 | Ga0207645_100573292 | 479 |
| 1141 | 3300025919 | Ga0207657_10002428 | Ga0207657_100024284 | 479 |
| 1142 | 3300025920 | Ga0207649_10013503 | Ga0207649_100135032 | 479 |
| 1143 | 3300025931 | Ga0207644_10022344 | Ga0207644_100223443 | 479 |
| 1144 | 3300025932 | Ga0207690_10068112 | Ga0207690_100681122 | 479 |
| 1145 | 3300025933 | Ga0207706_10000095 | Ga0207706_1000009568 | 479 |
| 1146 | 3300025945 | Ga0207679_10003260 | Ga0207679_100032606 | 479 |
| 1147 | 3300025949 | Ga0207667_10000233 | Ga0207667_1000023340 | 479 |
| 1148 | 3300025960 | Ga0207651_10016687 | Ga0207651_100166872 | 479 |
| 1149 | 3300025981 | Ga0207640_10074435 | Ga0207640_100744352 | 479 |
| 1150 | 3300026067 | Ga0207678_10002265 | Ga0207678_1000226515 | 479 |
| 1151 | 3300026078 | Ga0207702_10033667 | Ga0207702_100336672 | 479 |
| 1152 | 3300026142 | Ga0207698_10162137 | Ga0207698_101621371 | 479 |
| 1153 | 3300027395 | Ga0209996_1004197 | Ga0209996_10041971 | 479 |
| 1154 | 3300027526 | Ga0209968_1000396 | Ga0209968_10003965 | 479 |
| 1155 | 3300027543 | Ga0209999_1004658 | Ga0209999_10046581 | 479 |
| 1156 | 3300027682 | Ga0209971_1001455 | Ga0209971_10014553 | 479 |
| 1157 | 3300027695 | Ga0209966_1000155 | Ga0209966_100015514 | 479 |
| 1158 | 3300027876 | Ga0209974_10028031 | Ga0209974_100280312 | 479 |
| 1159 | 3300028380 | Ga0268265_10080832 | Ga0268265_100808321 | 479 |
| 1160 | 3300028381 | Ga0268264_10029108 | Ga0268264_100291083 | 479 |
| 1161 | 3300031235 | Ga0265330_10001082 | Ga0265330_1000108211 | 479 |
| 1162 | 3300031238 | Ga0265332_10004366 | Ga0265332_100043662 | 479 |
| 1163 | 3300031242 | Ga0265329_10001186 | Ga0265329_100011862 | 479 |
| 1164 | 3300031250 | Ga0265331_10000350 | Ga0265331_1000035016 | 479 |
| 1165 | 3300031711 | Ga0265314_10007574 | Ga0265314_100075743 | 479 |
| 1166 | 3300031712 | Ga0265342_10059656 | Ga0265342_100596562 | 479 |
| 1167 | 3300031731 | Ga0307405_10001511 | Ga0307405_100015113 | 479 |
| 1168 | 3300031824 | Ga0307413_10025501 | Ga0307413_100255012 | 479 |
| 1169 | 3300031852 | Ga0307410_10000988 | Ga0307410_100009887 | 479 |
| 1170 | 3300031901 | Ga0307406_10046752 | Ga0307406_100467522 | 479 |
| 1171 | 3300031995 | Ga0307409_100002217 | Ga0307409_1000022172 | 479 |
| 1172 | 3300032126 | Ga0307415_100026213 | Ga0307415_1000262132 | 479 |
| 1173 | 3300036401 | Ga0373937_0011810 | Ga0373937_0011810_1106_2569 | 479 |
| 1174 | 3300041408 | Ga0439453_0001473 | Ga0439453_0001473_1507_2955 | 479 |
| 1175 | 3300042003 | Ga0439443_000225 | Ga0439443_000225_817_2265 | 479 |
| 1176 | 3300046459 | Ga0495629_0039444 | Ga0495629_0039444_940_2403 | 479 |
| 1177 | 3300048905 | Ga0496102_0019884 | Ga0496102_0019884_2997_4457 | 479 |
| 1178 | 3300048905 | Ga0496102_0202635 | Ga0496102_0202635_118_1578 | 479 |
| 1179 | 3300048906 | Ga0496103_0018691 | Ga0496103_0018691_752_2212 | 479 |
| 1180 | 3300048921 | Ga0496118_0043723 | Ga0496118_0043723_884_2344 | 479 |
| 1181 | 3300049572 | Ga0501036_0023251 | Ga0501036_0023251_1900_3348 | 479 |
| 1182 | 3300049574 | Ga0501038_0050477 | Ga0501038_0050477_484_1932 | 479 |
| 1183 | 3300049576 | Ga0501040_0009684 | Ga0501040_0009684_3821_5269 | 479 |
| 1184 | 3300049577 | Ga0501041_0003172 | Ga0501041_0003172_3450_4898 | 479 |
| 1185 | 3300049577 | Ga0501041_0014118 | Ga0501041_0014118_3265_4713 | 479 |
| 1186 | 3300049578 | Ga0501042_0013253 | Ga0501042_0013253_1665_3113 | 479 |
| 1187 | 3300049588 | Ga0501072_0013754 | Ga0501072_0013754_2211_3659 | 479 |
| 1188 | 3300049590 | Ga0501074_0021833 | Ga0501074_0021833_3091_4542 | 479 |
| 1189 | 3300049591 | Ga0501075_0039065 | Ga0501075_0039065_1311_2759 | 479 |
| 1190 | 3300049592 | Ga0501076_0070867 | Ga0501076_0070867_721_2169 | 479 |
| 1191 | 3300049741 | Ga0501079_0009324 | Ga0501079_0009324_2022_3470 | 479 |
| 1192 | 3300049743 | Ga0501081_0004799 | Ga0501081_0004799_3849_5297 | 479 |
| 1193 | 3300049824 | Ga0501045_0005237 | Ga0501045_0005237_4242_5690 | 479 |
| 1194 | 3300049824 | Ga0501045_0057126 | Ga0501045_0057126_1269_2717 | 479 |
| 1195 | 3300050493 | nmdc:mga0k408_7246_c1 | nmdc:mga0k408_7246_c1_1757_3199 | 479 |
| 1196 | 3300061734 | Ga0530510_0003494 | Ga0530510_0003494_2650_4098 | 479 |
| 1197 | iso_pu_bacteria | 2885198086 | 2885200496 | 479 |
| 1198 | iso_pu_bacteria | 2885211737 | 2885214721 | 479 |
| 1199 | 3300003354 | JGI25160J50197_1000031 | JGI25160J50197_100003113 | 480 |
| 1200 | 3300003758 | Ga0055532_1003245 | Ga0055532_10032452 | 480 |
| 1201 | 3300003761 | Ga0055535_1001815 | Ga0055535_10018152 | 480 |
| 1202 | 3300003762 | Ga0055542_1001741 | Ga0055542_10017412 | 480 |
| 1203 | 3300003763 | Ga0055529_1000475 | Ga0055529_10004759 | 480 |
| 1204 | 3300005262 | Ga0065165_1000075 | Ga0065165_100007514 | 480 |
| 1205 | 3300005328 | Ga0070676_10023184 | Ga0070676_100231842 | 480 |
| 1206 | 3300005329 | Ga0070683_100008040 | Ga0070683_1000080408 | 480 |
| 1207 | 3300005331 | Ga0070670_100059254 | Ga0070670_1000592542 | 480 |
| 1208 | 3300005331 | Ga0070670_100166491 | Ga0070670_1001664912 | 480 |
| 1209 | 3300005347 | Ga0070668_100008228 | Ga0070668_1000082286 | 480 |
| 1210 | 3300005355 | Ga0070671_100005362 | Ga0070671_1000053627 | 480 |
| 1211 | 3300005355 | Ga0070671_100033607 | Ga0070671_1000336072 | 480 |
| 1212 | 3300005364 | Ga0070673_100057489 | Ga0070673_1000574891 | 480 |
| 1213 | 3300005458 | Ga0070681_10001589 | Ga0070681_1000158910 | 480 |
| 1214 | 3300005459 | Ga0068867_100023683 | Ga0068867_1000236832 | 480 |
| 1215 | 3300005543 | Ga0070672_100069573 | Ga0070672_1000695732 | 480 |
| 1216 | 3300005548 | Ga0070665_100139011 | Ga0070665_1001390112 | 480 |
| 1217 | 3300005564 | Ga0070664_100001477 | Ga0070664_1000014773 | 480 |
| 1218 | 3300005615 | Ga0070702_100068989 | Ga0070702_1000689891 | 480 |
| 1219 | 3300005616 | Ga0068852_100001185 | Ga0068852_1000011853 | 480 |
| 1220 | 3300005618 | Ga0068864_100024363 | Ga0068864_1000243632 | 480 |
| 1221 | 3300005841 | Ga0068863_100175672 | Ga0068863_1001756722 | 480 |
| 1222 | 3300005843 | Ga0068860_100120259 | Ga0068860_1001202591 | 480 |
| 1223 | 3300006237 | Ga0097621_100001301 | Ga0097621_10000130117 | 480 |
| 1224 | 3300006358 | Ga0068871_100000155 | Ga0068871_10000015529 | 480 |
| 1225 | 3300006881 | Ga0068865_100055654 | Ga0068865_1000556542 | 480 |
| 1226 | 3300007788 | Ga0099795_10000213 | Ga0099795_100002132 | 480 |
| 1227 | 3300009148 | Ga0105243_10017029 | Ga0105243_100170294 | 480 |
| 1228 | 3300009177 | Ga0105248_10102047 | Ga0105248_101020472 | 480 |
| 1229 | 3300013105 | Ga0157369_10007892 | Ga0157369_1000789211 | 480 |
| 1230 | 3300013297 | Ga0157378_10018771 | Ga0157378_100187713 | 480 |
| 1231 | 3300014326 | Ga0157380_10095817 | Ga0157380_100958172 | 480 |
| 1232 | 3300014968 | Ga0157379_10091663 | Ga0157379_100916632 | 480 |
| 1233 | 3300014969 | Ga0157376_10067225 | Ga0157376_100672252 | 480 |
| 1234 | 3300015683 | Ga0183362_10002 | Ga0183362_10002731 | 480 |
| 1235 | 3300017792 | Ga0163161_10195994 | Ga0163161_101959941 | 480 |
| 1236 | 3300025228 | Ga0209672_100263 | Ga0209672_10026310 | 480 |
| 1237 | 3300025229 | Ga0209147_100313 | Ga0209147_10031310 | 480 |
| 1238 | 3300025242 | Ga0209258_100498 | Ga0209258_10049810 | 480 |
| 1239 | 3300025254 | Ga0209148_1000518 | Ga0209148_100051810 | 480 |
| 1240 | 3300025256 | Ga0209759_1000077 | Ga0209759_100007793 | 480 |
| 1241 | 3300025256 | Ga0209759_1001862 | Ga0209759_10018624 | 480 |
| 1242 | 3300025272 | Ga0209455_1000272 | Ga0209455_10002729 | 480 |
| 1243 | 3300025302 | Ga0207426_1000158 | Ga0207426_1000158139 | 480 |
| 1244 | 3300025303 | Ga0209051_1016656 | Ga0209051_10166563 | 480 |
| 1245 | 3300025893 | Ga0207682_10000481 | Ga0207682_100004814 | 480 |
| 1246 | 3300025901 | Ga0207688_10003561 | Ga0207688_100035612 | 480 |
| 1247 | 3300025903 | Ga0207680_10027578 | Ga0207680_100275782 | 480 |
| 1248 | 3300025903 | Ga0207680_10042523 | Ga0207680_100425232 | 480 |
| 1249 | 3300025907 | Ga0207645_10020182 | Ga0207645_100201822 | 480 |
| 1250 | 3300025912 | Ga0207707_10004954 | Ga0207707_100049547 | 480 |
| 1251 | 3300025925 | Ga0207650_10017067 | Ga0207650_100170674 | 480 |
| 1252 | 3300025927 | Ga0207687_10151625 | Ga0207687_101516252 | 480 |
| 1253 | 3300025931 | Ga0207644_10000896 | Ga0207644_1000089618 | 480 |
| 1254 | 3300025931 | Ga0207644_10002261 | Ga0207644_100022619 | 480 |
| 1255 | 3300025933 | Ga0207706_10087979 | Ga0207706_100879792 | 480 |
| 1256 | 3300025935 | Ga0207709_10008886 | Ga0207709_100088862 | 480 |
| 1257 | 3300025940 | Ga0207691_10007608 | Ga0207691_100076085 | 480 |
| 1258 | 3300025941 | Ga0207711_10017928 | Ga0207711_100179282 | 480 |
| 1259 | 3300025941 | Ga0207711_10026589 | Ga0207711_100265893 | 480 |
| 1260 | 3300025944 | Ga0207661_10083028 | Ga0207661_100830282 | 480 |
| 1261 | 3300025945 | Ga0207679_10020528 | Ga0207679_100205285 | 480 |
| 1262 | 3300026023 | Ga0207677_10133458 | Ga0207677_101334582 | 480 |
| 1263 | 3300026075 | Ga0207708_10016854 | Ga0207708_100168542 | 480 |
| 1264 | 3300026088 | Ga0207641_10011927 | Ga0207641_100119277 | 480 |
| 1265 | 3300026088 | Ga0207641_10032159 | Ga0207641_100321591 | 480 |
| 1266 | 3300026089 | Ga0207648_10018704 | Ga0207648_100187042 | 480 |
| 1267 | 3300026089 | Ga0207648_10075768 | Ga0207648_100757682 | 480 |
| 1268 | 3300026095 | Ga0207676_10085097 | Ga0207676_100850971 | 480 |
| 1269 | 3300026118 | Ga0207675_100006767 | Ga0207675_1000067675 | 480 |
| 1270 | 3300026118 | Ga0207675_100025952 | Ga0207675_1000259524 | 480 |
| 1271 | 3300026121 | Ga0207683_10000189 | Ga0207683_1000018923 | 480 |
| 1272 | 3300026142 | Ga0207698_10012586 | Ga0207698_100125866 | 480 |
| 1273 | 3300028381 | Ga0268264_10174429 | Ga0268264_101744291 | 480 |
| 1274 | 3300031239 | Ga0265328_10007375 | Ga0265328_100073753 | 480 |
| 1275 | 3300031251 | Ga0265327_10054342 | Ga0265327_100543422 | 480 |
| 1276 | 3300031548 | Ga0307408_100008532 | Ga0307408_1000085323 | 480 |
| 1277 | 3300037471 | Ga0395905_0000057 | Ga0395905_0000057_95560_97017 | 480 |
| 1278 | 3300039437 | Ga0436365_0960063 | Ga0436365_0960063_2478_3944 | 480 |
| 1279 | 3300046455 | Ga0495603_0017236 | Ga0495603_0017236_390_1847 | 480 |
| 1280 | 3300046459 | Ga0495629_0000042 | Ga0495629_0000042_37581_39053 | 480 |
| 1281 | 3300046459 | Ga0495629_0001082 | Ga0495629_0001082_4668_6125 | 480 |
| 1282 | 3300046459 | Ga0495629_0012741 | Ga0495629_0012741_845_2302 | 480 |
| 1283 | 3300046463 | Ga0495653_0000321 | Ga0495653_0000321_27156_28628 | 480 |
| 1284 | 3300046471 | Ga0495650_0022112 | Ga0495650_0022112_456_1928 | 480 |
| 1285 | 3300046472 | Ga0495580_0000355 | Ga0495580_0000355_9091_10545 | 480 |
| 1286 | 3300046472 | Ga0495580_0000357 | Ga0495580_0000357_20442_21899 | 480 |
| 1287 | 3300046472 | Ga0495580_0005233 | Ga0495580_0005233_8334_9806 | 480 |
| 1288 | 3300046473 | Ga0495582_0000803 | Ga0495582_0000803_955_2412 | 480 |
| 1289 | 3300046473 | Ga0495582_0057192 | Ga0495582_0057192_471_1943 | 480 |
| 1290 | 3300046474 | Ga0495605_0036748 | Ga0495605_0036748_615_2072 | 480 |
| 1291 | 3300046476 | Ga0495662_0017399 | Ga0495662_0017399_541_1998 | 480 |
| 1292 | 3300046477 | Ga0495664_0059308 | Ga0495664_0059308_44_1501 | 480 |
| 1293 | 3300046499 | Ga0495594_0044741 | Ga0495594_0044741_128_1585 | 480 |
| 1294 | 3300046506 | Ga0495583_0019594 | Ga0495583_0019594_1271_2728 | 480 |
| 1295 | 3300046506 | Ga0495583_0032370 | Ga0495583_0032370_981_2453 | 480 |
| 1296 | 3300046507 | Ga0495606_0037544 | Ga0495606_0037544_147_1619 | 480 |
| 1297 | 3300046514 | Ga0495618_0000764 | Ga0495618_0000764_517_1974 | 480 |
| 1298 | 3300046515 | Ga0495620_0005754 | Ga0495620_0005754_1379_2851 | 480 |
| 1299 | 3300046516 | Ga0495628_0007611 | Ga0495628_0007611_2219_3676 | 480 |
| 1300 | 3300046516 | Ga0495628_0018544 | Ga0495628_0018544_1150_2604 | 480 |
| 1301 | 3300046516 | Ga0495628_0063419 | Ga0495628_0063419_1345_2817 | 480 |
| 1302 | 3300046517 | Ga0495630_0003094 | Ga0495630_0003094_4930_6387 | 480 |
| 1303 | 3300046517 | Ga0495630_0111536 | Ga0495630_0111536_383_1837 | 480 |
| 1304 | 3300046524 | Ga0495648_0002871 | Ga0495648_0002871_12509_13966 | 480 |
| 1305 | 3300046524 | Ga0495648_0032508 | Ga0495648_0032508_646_2103 | 480 |
| 1306 | 3300046526 | Ga0495666_0000243 | Ga0495666_0000243_1482_2939 | 480 |
| 1307 | 3300046533 | Ga0495640_0016325 | Ga0495640_0016325_3591_5048 | 480 |
| 1308 | 3300046536 | Ga0495587_0007176 | Ga0495587_0007176_659_2116 | 480 |
| 1309 | 3300046543 | Ga0495645_0000691 | Ga0495645_0000691_487_1944 | 480 |
| 1310 | 3300046557 | Ga0495622_0011113 | Ga0495622_0011113_424_1881 | 480 |
| 1311 | 3300046616 | Ga0495668_0001832 | Ga0495668_0001832_2733_4178 | 480 |
| 1312 | 3300046642 | Ga0495634_0000449 | Ga0495634_0000449_15274_16731 | 480 |
| 1313 | 3300046648 | Ga0495611_0014066 | Ga0495611_0014066_828_2285 | 480 |
| 1314 | 3300046660 | Ga0495625_0031340 | Ga0495625_0031340_718_2190 | 480 |
| 1315 | 3300046663 | Ga0495635_0001225 | Ga0495635_0001225_14567_16024 | 480 |
| 1316 | 3300046665 | Ga0495661_0009270 | Ga0495661_0009270_200_1672 | 480 |
| 1317 | 3300046678 | Ga0495599_0003001 | Ga0495599_0003001_8267_9724 | 480 |
| 1318 | 3300046678 | Ga0495599_0009689 | Ga0495599_0009689_3068_4522 | 480 |
| 1319 | 3300046679 | Ga0495623_0010970 | Ga0495623_0010970_1108_2562 | 480 |
| 1320 | 3300046679 | Ga0495623_0054742 | Ga0495623_0054742_490_1947 | 480 |
| 1321 | 3300046680 | Ga0495646_0000273 | Ga0495646_0000273_24812_26266 | 480 |
| 1322 | 3300046680 | Ga0495646_0000495 | Ga0495646_0000495_14542_15999 | 480 |
| 1323 | 3300046690 | Ga0495624_0000216 | Ga0495624_0000216_37581_39053 | 480 |
| 1324 | 3300046690 | Ga0495624_0005260 | Ga0495624_0005260_2661_4115 | 480 |
| 1325 | 3300046809 | Ga0495600_0071242 | Ga0495600_0071242_802_2259 | 480 |
| 1326 | 3300047315 | Ga0495581_0000200 | Ga0495581_0000200_8935_10392 | 480 |
| 1327 | 3300047317 | Ga0495604_0001161 | Ga0495604_0001161_15707_17161 | 480 |
| 1328 | 3300047317 | Ga0495604_0001825 | Ga0495604_0001825_632_2089 | 480 |
| 1329 | 3300047319 | Ga0495674_0027772 | Ga0495674_0027772_2148_3620 | 480 |
| 1330 | 3300047319 | Ga0495674_0052470 | Ga0495674_0052470_1013_2470 | 480 |
| 1331 | 3300047319 | Ga0495674_0115719 | Ga0495674_0115719_641_2098 | 480 |
| 1332 | 3300047321 | Ga0495676_0014537 | Ga0495676_0014537_550_2007 | 480 |
| 1333 | 3300047322 | Ga0495680_0001617 | Ga0495680_0001617_1444_2901 | 480 |
| 1334 | 3300047323 | Ga0495683_0010201 | Ga0495683_0010201_1321_2778 | 480 |
| 1335 | 3300047443 | Ga0495687_016528 | Ga0495687_016528_34_1491 | 480 |
| 1336 | 3300047444 | Ga0495675_0031568 | Ga0495675_0031568_1461_2915 | 480 |
| 1337 | 3300047446 | Ga0495679_000023 | Ga0495679_000023_77391_78863 | 480 |
| 1338 | 3300047673 | Ga0495593_0005313 | Ga0495593_0005313_1447_2904 | 480 |
| 1339 | 3300048088 | Ga0495602_0022700 | Ga0495602_0022700_589_2043 | 480 |
| 1340 | 3300048091 | Ga0495626_0013149 | Ga0495626_0013149_2399_3856 | 480 |
| 1341 | 3300048903 | Ga0496100_0005628 | Ga0496100_0005628_1202_2659 | 480 |
| 1342 | 3300048904 | Ga0496101_0001603 | Ga0496101_0001603_2745_4202 | 480 |
| 1343 | 3300048905 | Ga0496102_0000134 | Ga0496102_0000134_44571_46028 | 480 |
| 1344 | 3300048905 | Ga0496102_0150641 | Ga0496102_0150641_251_1711 | 480 |
| 1345 | 3300048906 | Ga0496103_0008446 | Ga0496103_0008446_930_2387 | 480 |
| 1346 | 3300048907 | Ga0496104_0019309 | Ga0496104_0019309_969_2423 | 480 |
| 1347 | 3300048908 | Ga0496105_0001879 | Ga0496105_0001879_2045_3499 | 480 |
| 1348 | 3300048910 | Ga0496107_0100942 | Ga0496107_0100942_19_1473 | 480 |
| 1349 | 3300048911 | Ga0496108_0003455 | Ga0496108_0003455_4326_5786 | 480 |
| 1350 | 3300048913 | Ga0496110_0034532 | Ga0496110_0034532_1140_2600 | 480 |
| 1351 | 3300048916 | Ga0496113_0076740 | Ga0496113_0076740_319_1767 | 480 |
| 1352 | 3300048919 | Ga0496116_0000503 | Ga0496116_0000503_17564_19006 | 480 |
| 1353 | 3300048919 | Ga0496116_0038047 | Ga0496116_0038047_843_2288 | 480 |
| 1354 | 3300048921 | Ga0496118_0001420 | Ga0496118_0001420_1261_2718 | 480 |
| 1355 | 3300048921 | Ga0496118_0042544 | Ga0496118_0042544_1020_2492 | 480 |
| 1356 | 3300048924 | Ga0496121_0006720 | Ga0496121_0006720_10554_12011 | 480 |
| 1357 | 3300049571 | Ga0501034_0000875 | Ga0501034_0000875_19917_21362 | 480 |
| 1358 | 3300050511 | nmdc:mga08y16_215245_c1 | nmdc:mga08y16_215245_c1_13_1515 | 480 |
| 1359 | iso_pu_bacteria | 2818991452 | 2819635891 | 480 |
| 1360 | iso_pu_bacteria | 8018845410 | 8018847106 | 480 |
| 1361 | iso_pu_bacteria | 8021120328 | 8021128100 | 480 |
| 1362 | 3300001979 | JGI24740J21852_10013044 | JGI24740J21852_100130443 | 482 |
| 1363 | 3300001989 | JGI24739J22299_10005780 | JGI24739J22299_100057805 | 482 |
| 1364 | 3300002773 | JGI25152J39213_1000666 | JGI25152J39213_100066610 | 482 |
| 1365 | 3300002987 | JGI25159J45721_1002971 | JGI25159J45721_10029712 | 482 |
| 1366 | 3300003187 | JGI25151J46595_10001588 | JGI25151J46595_100015887 | 482 |
| 1367 | 3300003187 | JGI25151J46595_10003463 | JGI25151J46595_100034638 | 482 |
| 1368 | 3300003215 | JGI25153J46596_10000914 | JGI25153J46596_1000091410 | 482 |
| 1369 | 3300003773 | Ga0055537_1000640 | Ga0055537_100064011 | 482 |
| 1370 | 3300003781 | Ga0055536_1000680 | Ga0055536_10006809 | 482 |
| 1371 | 3300003781 | Ga0055536_1003212 | Ga0055536_10032124 | 482 |
| 1372 | 3300003784 | Ga0055534_1000579 | Ga0055534_100057910 | 482 |
| 1373 | 3300003790 | Ga0055528_1001018 | Ga0055528_100101811 | 482 |
| 1374 | 3300003792 | Ga0055540_1001144 | Ga0055540_100114412 | 482 |
| 1375 | 3300003792 | Ga0055540_1001339 | Ga0055540_100133911 | 482 |
| 1376 | 3300005262 | Ga0065165_1002503 | Ga0065165_100250313 | 482 |
| 1377 | 3300005288 | Ga0065714_10094400 | Ga0065714_100944002 | 482 |
| 1378 | 3300005295 | Ga0065707_10086095 | Ga0065707_100860953 | 482 |
| 1379 | 3300005334 | Ga0068869_100032567 | Ga0068869_1000325672 | 482 |
| 1380 | 3300005355 | Ga0070671_100031223 | Ga0070671_1000312232 | 482 |
| 1381 | 3300005356 | Ga0070674_100040651 | Ga0070674_1000406513 | 482 |
| 1382 | 3300005366 | Ga0070659_100126174 | Ga0070659_1001261742 | 482 |
| 1383 | 3300005435 | Ga0070714_100028074 | Ga0070714_1000280742 | 482 |
| 1384 | 3300005436 | Ga0070713_100007351 | Ga0070713_1000073512 | 482 |
| 1385 | 3300005436 | Ga0070713_100023150 | Ga0070713_1000231503 | 482 |
| 1386 | 3300005437 | Ga0070710_10004978 | Ga0070710_100049785 | 482 |
| 1387 | 3300005439 | Ga0070711_100019510 | Ga0070711_1000195101 | 482 |
| 1388 | 3300005439 | Ga0070711_100086840 | Ga0070711_1000868402 | 482 |
| 1389 | 3300005456 | Ga0070678_100032420 | Ga0070678_1000324203 | 482 |
| 1390 | 3300005457 | Ga0070662_100038412 | Ga0070662_1000384123 | 482 |
| 1391 | 3300005548 | Ga0070665_100082191 | Ga0070665_1000821912 | 482 |
| 1392 | 3300005578 | Ga0068854_100030465 | Ga0068854_1000304652 | 482 |
| 1393 | 3300005718 | Ga0068866_10018615 | Ga0068866_100186152 | 482 |
| 1394 | 3300005842 | Ga0068858_100103413 | Ga0068858_1001034133 | 482 |
| 1395 | 3300005843 | Ga0068860_100002318 | Ga0068860_10000231811 | 482 |
| 1396 | 3300006028 | Ga0070717_10017896 | Ga0070717_100178965 | 482 |
| 1397 | 3300006173 | Ga0070716_100027792 | Ga0070716_1000277922 | 482 |
| 1398 | 3300006175 | Ga0070712_100031422 | Ga0070712_1000314222 | 482 |
| 1399 | 3300006871 | Ga0075434_100089369 | Ga0075434_1000893692 | 482 |
| 1400 | 3300009093 | Ga0105240_10021359 | Ga0105240_100213595 | 482 |
| 1401 | 3300009093 | Ga0105240_10197498 | Ga0105240_101974982 | 482 |
| 1402 | 3300009148 | Ga0105243_10028276 | Ga0105243_100282762 | 482 |
| 1403 | 3300009176 | Ga0105242_10004677 | Ga0105242_100046774 | 482 |
| 1404 | 3300009553 | Ga0105249_10017612 | Ga0105249_100176123 | 482 |
| 1405 | 3300012502 | Ga0157347_1000526 | Ga0157347_10005262 | 482 |
| 1406 | 3300013104 | Ga0157370_10014786 | Ga0157370_100147863 | 482 |
| 1407 | 3300013297 | Ga0157378_10029728 | Ga0157378_100297283 | 482 |
| 1408 | 3300013306 | Ga0163162_10002191 | Ga0163162_100021914 | 482 |
| 1409 | 3300014497 | Ga0182008_10000044 | Ga0182008_1000004437 | 482 |
| 1410 | 3300014497 | Ga0182008_10003423 | Ga0182008_100034232 | 482 |
| 1411 | 3300015262 | Ga0182007_10003472 | Ga0182007_100034728 | 482 |
| 1412 | 3300017792 | Ga0163161_10000042 | Ga0163161_10000042112 | 482 |
| 1413 | 3300025245 | Ga0207425_1000926 | Ga0207425_10009266 | 482 |
| 1414 | 3300025258 | Ga0209129_1000776 | Ga0209129_100077611 | 482 |
| 1415 | 3300025263 | Ga0209565_1000504 | Ga0209565_100050424 | 482 |
| 1416 | 3300025273 | Ga0209673_1001382 | Ga0209673_100138220 | 482 |
| 1417 | 3300025284 | Ga0209130_1000888 | Ga0209130_100088810 | 482 |
| 1418 | 3300025291 | Ga0209675_1000615 | Ga0209675_100061510 | 482 |
| 1419 | 3300025292 | Ga0209676_1000240 | Ga0209676_100024038 | 482 |
| 1420 | 3300025292 | Ga0209676_1000868 | Ga0209676_10008685 | 482 |
| 1421 | 3300025294 | Ga0209025_1000103 | Ga0209025_100010346 | 482 |
| 1422 | 3300025294 | Ga0209025_1001649 | Ga0209025_100164922 | 482 |
| 1423 | 3300025295 | Ga0209564_1002566 | Ga0209564_100256610 | 482 |
| 1424 | 3300025297 | Ga0209758_1001416 | Ga0209758_100141624 | 482 |
| 1425 | 3300025302 | Ga0207426_1001126 | Ga0207426_100112610 | 482 |
| 1426 | 3300025303 | Ga0209051_1000658 | Ga0209051_10006585 | 482 |
| 1427 | 3300025303 | Ga0209051_1001207 | Ga0209051_100120712 | 482 |
| 1428 | 3300025304 | Ga0209257_1008540 | Ga0209257_10085404 | 482 |
| 1429 | 3300025899 | Ga0207642_10023585 | Ga0207642_100235852 | 482 |
| 1430 | 3300025903 | Ga0207680_10068584 | Ga0207680_100685842 | 482 |
| 1431 | 3300025913 | Ga0207695_10016786 | Ga0207695_100167865 | 482 |
| 1432 | 3300025914 | Ga0207671_10029173 | Ga0207671_100291732 | 482 |
| 1433 | 3300025923 | Ga0207681_10044482 | Ga0207681_100444822 | 482 |
| 1434 | 3300025926 | Ga0207659_10118906 | Ga0207659_101189062 | 482 |
| 1435 | 3300025928 | Ga0207700_10014240 | Ga0207700_100142405 | 482 |
| 1436 | 3300025928 | Ga0207700_10060735 | Ga0207700_100607352 | 482 |
| 1437 | 3300025929 | Ga0207664_10067400 | Ga0207664_100674002 | 482 |
| 1438 | 3300025931 | Ga0207644_10079954 | Ga0207644_100799542 | 482 |
| 1439 | 3300025933 | Ga0207706_10058430 | Ga0207706_100584303 | 482 |
| 1440 | 3300025934 | Ga0207686_10134436 | Ga0207686_101344361 | 482 |
| 1441 | 3300025935 | Ga0207709_10015977 | Ga0207709_100159774 | 482 |
| 1442 | 3300025939 | Ga0207665_10009720 | Ga0207665_100097202 | 482 |
| 1443 | 3300025949 | Ga0207667_10073160 | Ga0207667_100731602 | 482 |
| 1444 | 3300025961 | Ga0207712_10030739 | Ga0207712_100307393 | 482 |
| 1445 | 3300025986 | Ga0207658_10025059 | Ga0207658_100250593 | 482 |
| 1446 | 3300026035 | Ga0207703_10082279 | Ga0207703_100822792 | 482 |
| 1447 | 3300026089 | Ga0207648_10000319 | Ga0207648_100003194 | 482 |
| 1448 | 3300026116 | Ga0207674_10117898 | Ga0207674_101178982 | 482 |
| 1449 | 3300026118 | Ga0207675_100004711 | Ga0207675_1000047115 | 482 |
| 1450 | 3300026121 | Ga0207683_10066050 | Ga0207683_100660502 | 482 |
| 1451 | 3300026121 | Ga0207683_10100283 | Ga0207683_101002832 | 482 |
| 1452 | 3300028380 | Ga0268265_10002776 | Ga0268265_100027762 | 482 |
| 1453 | 3300028381 | Ga0268264_10012087 | Ga0268264_100120876 | 482 |
| 1454 | 3300028381 | Ga0268264_10051083 | Ga0268264_100510834 | 482 |
| 1455 | 3300028794 | Ga0307515_10116869 | Ga0307515_101168692 | 482 |
| 1456 | 3300031731 | Ga0307405_10002697 | Ga0307405_100026976 | 482 |
| 1457 | 3300032002 | Ga0307416_100009729 | Ga0307416_1000097293 | 482 |
| 1458 | 3300032002 | Ga0307416_100071548 | Ga0307416_1000715482 | 482 |
| 1459 | 3300035410 | Ga0373924_0008893 | Ga0373924_0008893_2051_3520 | 482 |
| 1460 | 3300037068 | Ga0373925_0011541 | Ga0373925_0011541_2907_4370 | 482 |
| 1461 | 3300039450 | Ga0436363_0510015 | Ga0436363_0510015_527_2005 | 482 |
| 1462 | 3300046453 | Ga0495627_004628 | Ga0495627_004628_2099_3547 | 482 |
| 1463 | 3300046454 | Ga0495592_0099604 | Ga0495592_0099604_274_1743 | 482 |
| 1464 | 3300046460 | Ga0495638_0016411 | Ga0495638_0016411_2766_4214 | 482 |
| 1465 | 3300046462 | Ga0495651_0041791 | Ga0495651_0041791_229_1677 | 482 |
| 1466 | 3300046472 | Ga0495580_0000527 | Ga0495580_0000527_16884_18353 | 482 |
| 1467 | 3300046472 | Ga0495580_0006761 | Ga0495580_0006761_6211_7680 | 482 |
| 1468 | 3300046530 | Ga0495654_0007291 | Ga0495654_0007291_3050_4498 | 482 |
| 1469 | 3300046530 | Ga0495654_0026124 | Ga0495654_0026124_994_2442 | 482 |
| 1470 | 3300046543 | Ga0495645_0113845 | Ga0495645_0113845_288_1736 | 482 |
| 1471 | 3300046615 | Ga0495656_0000073 | Ga0495656_0000073_7337_8785 | 482 |
| 1472 | 3300046674 | Ga0495588_0008426 | Ga0495588_0008426_1841_3289 | 482 |
| 1473 | 3300046674 | Ga0495588_0010894 | Ga0495588_0010894_307_1755 | 482 |
| 1474 | 3300046692 | Ga0495671_0003854 | Ga0495671_0003854_7575_9023 | 482 |
| 1475 | 3300048904 | Ga0496101_0001874 | Ga0496101_0001874_3485_4933 | 482 |
| 1476 | 3300048904 | Ga0496101_0001982 | Ga0496101_0001982_10319_11767 | 482 |
| 1477 | 3300048905 | Ga0496102_0001296 | Ga0496102_0001296_3116_4564 | 482 |
| 1478 | 3300048907 | Ga0496104_0147391 | Ga0496104_0147391_545_2023 | 482 |
| 1479 | 3300048908 | Ga0496105_0001714 | Ga0496105_0001714_2882_4330 | 482 |
| 1480 | 3300048909 | Ga0496106_0016853 | Ga0496106_0016853_1068_2516 | 482 |
| 1481 | 3300048910 | Ga0496107_0049028 | Ga0496107_0049028_1280_2728 | 482 |
| 1482 | 3300048912 | Ga0496109_0119878 | Ga0496109_0119878_438_1886 | 482 |
| 1483 | 3300048912 | Ga0496109_0123688 | Ga0496109_0123688_840_2309 | 482 |
| 1484 | 3300048914 | Ga0496111_0037061 | Ga0496111_0037061_1320_2768 | 482 |
| 1485 | 3300048917 | Ga0496114_0022351 | Ga0496114_0022351_1562_3010 | 482 |
| 1486 | 3300048921 | Ga0496118_0032105 | Ga0496118_0032105_105_1553 | 482 |
| 1487 | 3300048922 | Ga0496119_0015463 | Ga0496119_0015463_2626_4074 | 482 |
| 1488 | 3300048924 | Ga0496121_0013264 | Ga0496121_0013264_293_1759 | 482 |
| 1489 | 3300048927 | Ga0496124_0066277 | Ga0496124_0066277_776_2224 | 482 |
| 1490 | 3300048929 | Ga0496126_0112018 | Ga0496126_0112018_474_1922 | 482 |
| 1491 | 3300050512 | nmdc:mga0n895_95941_c1 | nmdc:mga0n895_95941_c1_844_2322 | 482 |
| 1492 | 3300050514 | nmdc:mga08x19_16319_c1 | nmdc:mga08x19_16319_c1_2825_4303 | 482 |
| 1493 | 3300053087 | Ga0500643_021945 | Ga0500643_021945_285_1736 | 482 |
| 1494 | 3300053093 | Ga0500651_0000040 | Ga0500651_0000040_89636_91087 | 482 |
| 1495 | 3300053108 | Ga0500562_004410 | Ga0500562_004410_1360_2808 | 482 |
| 1496 | 3300053110 | Ga0500571_000030 | Ga0500571_000030_34760_36211 | 482 |
| 1497 | 3300053111 | Ga0500572_011206 | Ga0500572_011206_455_1903 | 482 |
| 1498 | 3300053116 | Ga0500592_004646 | Ga0500592_004646_580_2028 | 482 |
| 1499 | 3300053117 | Ga0500593_000252 | Ga0500593_000252_2451_3899 | 482 |
| 1500 | 3300053133 | Ga0500655_000797 | Ga0500655_000797_1333_2784 | 482 |
| 1501 | 3300053138 | Ga0500564_035954 | Ga0500564_035954_207_1658 | 482 |
| 1502 | 3300053141 | Ga0500574_003369 | Ga0500574_003369_1191_2642 | 482 |
| 1503 | 3300053161 | Ga0500634_0009019 | Ga0500634_0009019_2547_3995 | 482 |
| 1504 | 3300053730 | Ga0500645_000242 | Ga0500645_000242_25646_27094 | 482 |
| 1505 | 3300053730 | Ga0500645_000991 | Ga0500645_000991_5315_6763 | 482 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i3x-assembly2.cif.gz_C | structure of phosphonoacetaldehyde dehydrogenase in complex with phosphonoacetate and cofactor nad+ | 0.9732 | 12 | 482 |
| 4i3x-assembly2.cif.gz_C | structure of phosphonoacetaldehyde dehydrogenase in complex with phosphonoacetate and cofactor nad+ | 0.9632 | 12 | 482 |
| 1euh-assembly1.cif.gz_A | apo form of a nadp dependent aldehyde dehydrogenase from streptococcus mutans | 0.9524 | 11 | 482 |
| 2qe0-assembly1.cif.gz_C | thioacylenzyme intermediate of gapn from s. mutans, new data integration and refinement. | 0.9508 | 11 | 482 |
| 1qi1-assembly1.cif.gz_A | ternary complex of an nadp dependent aldehyde dehydrogenase | 0.9505 | 11 | 482 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4i3xF01 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9752 | 11 | 261 | 3.40.605.10 |
| af_Q55CJ9_31_264_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9616 | 29 | 259 | 3.40.605.10 |
| af_A0A1D6MRK0_1_96_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9588 | 169 | 258 | 3.40.605.10 |
| af_P76149_240_424_3.40.309.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9552 | 262 | 440 | 3.40.309.10 |
| af_Q55CJ9_14_489_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9552 | 14 | 480 | 3.40.605.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4QIP1-F1-model_v4 | Phosphonoacetaldehyde dehydrogenase | 0.9805 | 211 | 428 |
GO:0008911
|
| AF-A0A3N8PFR1-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9772 | 155 | 369 |
GO:0008911
|
| AF-A0A3C1B6M9-F1-model_v4 | Phosphonoacetaldehyde dehydrogenase | 0.9766 | 7 | 387 |
GO:0008911
|
| AF-A0A853QX01-F1-model_v4 | deleted | 0.973 | 101 | 482 |
|
| AF-A0A353DWU0-F1-model_v4 | Phosphonoacetaldehyde dehydrogenase | 0.9723 | 49 | 482 |
GO:0008911
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar