F494436

General Info

Members Datasets Scaffolds Average Seq Length
1505 562 1425 480

Family's Representative Sequence

Representative Sequence 3300047446|Ga0495679_000022|Ga0495679_000022_40218_41624
Length 456
Sequence MRIGGEKITHTEIIEVFNPYTRELVGTVPKATVDDVRHAFEYAHAYRARLTRYERAQILRRAADIVRERTAEIADLITAESGLCKKDSLYEAGRVSDVLVFGANEALKDDGQVFSCDLTPHGKQRRVYTQREPLLGVICAITPFNHPMNQVAHKIVPSIATNNRIVVKPSEKVPLSTCLLADILYSAGLPPQLLQVVTGDPKDIADELITNRHVDLITFTGGVAIGKYIANKMGYRRAVLELGGNDPIIVMEDADLDEASTLAVSGSYKNSGQRCTAIKRMLVHEAVADRFVELLVEKTRAIRYGDPADPATDMGTVIDEDAAKFFEAQVNDAVSRGAKLLVGNVRRGALYSPTVVDRVTPDMPLVRYETFGPVIRISNSTDYGLSSSVCTNRLDYITRFIAELEVGSVNVREVPGYRLELTPFGGIKDSGLGYKEGVQEAIKSFTNVKTYSLPWQ

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
5 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
6 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
12 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
13 2643221609 Acidovorax sp. Root217 Isolate Unclassified
14 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
17 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
18 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
19 2738541277 Variovorax sp. GV051 Isolate Unclassified
20 2738541307 Variovorax sp. GV008 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
24 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
25 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
26 2818991436 Collimonas arenae 515 Isolate Unclassified
27 2818991452 Burkholderia cepacia 561 Isolate Unclassified
28 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
29 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
30 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
31 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
32 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
33 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
34 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
35 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
36 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
37 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
38 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
39 2885198086 Variovorax sp. 679 Isolate Unclassified
40 2885211737 Variovorax sp. 553 Isolate Unclassified
41 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
42 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
43 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
44 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
45 2904564687 Burkholderia sp. 571 Isolate Unclassified
46 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
47 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
48 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
49 2928070936 Variovorax gossypii 1167 Isolate Unclassified
50 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
51 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
52 2928163908 Burkholderia sp. 567 Isolate Unclassified
53 2928170801 Burkholderia sp. 572 Isolate Unclassified
54 2928536128 Burkholderia sola 565 Isolate Unclassified
55 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
56 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
57 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
58 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
59 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
60 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
63 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
64 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
65 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
66 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
67 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
68 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
69 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
70 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
71 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
72 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
73 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
74 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
75 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
78 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
79 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
80 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
81 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
82 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
83 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
84 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
85 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
86 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
87 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
88 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
89 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
90 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
91 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
92 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
93 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
94 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
95 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
96 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
97 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
98 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
99 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
100 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
101 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
102 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
103 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
104 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
105 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
106 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
107 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
108 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
109 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
110 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
111 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
112 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
113 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
114 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
115 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
116 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
117 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
118 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
119 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
120 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
121 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
122 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
123 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
124 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
125 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
126 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
127 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
128 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
129 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
130 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
131 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
132 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
133 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
134 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
135 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
136 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
137 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
138 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
139 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
140 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
141 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
142 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
143 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
144 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
145 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
146 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
147 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
148 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
149 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
150 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
151 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
152 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
153 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
154 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
157 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
158 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
159 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
160 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
161 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
162 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
163 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
164 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
165 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
166 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
167 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
168 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
169 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
170 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
171 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
172 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
173 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
174 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
175 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
176 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
177 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
178 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
179 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
180 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
181 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
182 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
184 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
185 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
186 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
187 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
188 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
189 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
190 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
191 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
192 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
193 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
194 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
195 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
196 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
197 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
198 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
199 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
200 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
201 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
202 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
203 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
204 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
205 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
206 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
207 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
208 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
209 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
210 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
211 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
212 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
213 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
214 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
215 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
216 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
217 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
218 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
219 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
220 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
221 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
222 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
223 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
224 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
225 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
226 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
227 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
228 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
229 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
230 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
237 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
238 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
240 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
241 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
242 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
245 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
246 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
247 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
251 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
252 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
254 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
255 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
256 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
258 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
259 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
322 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
333 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
337 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
338 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
339 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
340 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
341 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
342 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
343 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
344 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
345 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
346 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
347 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
348 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
349 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
350 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
351 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
352 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
353 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
354 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
355 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
356 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
357 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
358 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
359 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
360 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
361 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
362 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
363 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
364 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
365 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
366 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
367 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
368 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
369 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
370 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
371 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
372 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
373 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
374 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
375 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
376 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
377 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
378 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
379 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
380 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
381 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
382 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
383 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
384 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
385 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
386 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
387 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
388 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
389 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
390 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
391 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
392 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
393 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
394 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
395 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
396 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
397 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
398 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
399 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
400 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
401 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
402 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
403 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
404 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
405 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
406 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
407 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
408 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
409 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
410 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
411 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
412 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
413 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
414 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
415 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
416 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
417 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
418 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
419 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
420 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
421 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
422 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
423 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
424 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
425 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
426 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
427 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
428 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
429 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
430 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
431 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
432 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
433 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
434 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
435 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
436 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
437 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
438 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
439 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
440 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
441 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
442 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
443 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
444 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
445 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
446 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
447 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
448 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
449 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
450 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
451 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
452 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
453 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
454 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
455 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
456 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
457 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
458 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
459 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
460 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
461 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
462 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
463 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
464 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
465 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
466 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
467 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
468 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
469 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
470 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
471 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
472 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
473 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
474 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
475 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
476 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
477 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
478 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
479 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
480 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
481 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
482 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
489 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
497 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
498 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
499 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
503 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
504 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
505 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
506 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
507 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
508 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
511 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
512 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
513 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
514 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
515 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
516 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
517 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
518 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
519 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
520 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
521 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
522 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
523 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
524 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
525 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
526 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
527 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
528 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
529 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
530 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
531 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
532 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
533 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
534 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
535 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
536 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
537 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
538 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
539 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
540 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
541 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
542 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
543 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
544 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
545 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
546 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
547 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
548 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
549 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
550 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
551 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
552 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
553 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
554 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
555 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
556 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
557 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
558 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
559 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
560 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
561 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
562 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.68
Metatranscriptomes 0
Isolates 5.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0.93
Rhizoplane 3.85
Rhizosphere 77.21
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013044 3300001979 Bacteria 3116
2 JGI24739J22299_10002041 3300001989 Bacteria 7737
3 JGI24739J22299_10005780 3300001989 Bacteria 4687
4 JGI24739J22299_10008446 3300001989 Bacteria 3846
5 JGI24743J22301_10005128 3300001991 Bacteria 2173
6 JGI24742J22300_10004324 3300002244 Bacteria 2321
7 JGI25155J39150_1000121 3300002704 Bacteria 38491
8 JGI25156J39149_1000100 3300002705 Bacteria 63565
9 JGI25156J39149_1001101 3300002705 Bacteria 12310
10 JGI25162J39368_1000040 3300002737 Bacteria 175938
11 JGI25154J39366_1000121 3300002738 Bacteria 62887
12 JGI25157J39369_1000130 3300002741 Bacteria 63360
13 JGI25152J39213_1000666 3300002773 Bacteria 17941
14 JGI25150J39212_1004092 3300002774 Bacteria 3295
15 JGI25159J45721_1000190 3300002987 Bacteria 28606
16 JGI25159J45721_1002388 3300002987 Bacteria 7155
17 JGI25159J45721_1002971 3300002987 Bacteria 6163
18 JGI25151J46595_10001588 3300003187 Bacteria 15088
19 JGI25151J46595_10003002 3300003187 Bacteria 9597
20 JGI25151J46595_10003463 3300003187 Bacteria 8708
21 JGI25151J46595_10009359 3300003187 Bacteria 4645
22 JGI25151J46595_10021104 3300003187 Bacteria 2732
23 JGI25165J46597_1000051 3300003214 Bacteria 241012
24 JGI25153J46596_10000066 3300003215 Bacteria 123268
25 JGI25153J46596_10000914 3300003215 Bacteria 17941
26 rootH1_10006056 3300003323 Bacteria 45984
27 JGI25160J50197_1000031 3300003354 Bacteria 175708
28 JGI25160J50197_1000345 3300003354 Bacteria 30950
29 JGI25161J50226_1000007 3300003374 Bacteria 256181
30 Ga0055538_1000025 3300003751 Bacteria 241012
31 Ga0055539_1000032 3300003752 Bacteria 241012
32 Ga0055533_1000042 3300003756 Bacteria 241012
33 Ga0055532_1003245 3300003758 Bacteria 2885
34 Ga0055525_1000050 3300003759 Bacteria 241012
35 Ga0055535_1001815 3300003761 Bacteria 9255
36 Ga0055542_1001741 3300003762 Bacteria 9255
37 Ga0055529_1000475 3300003763 Bacteria 38260
38 Ga0055526_1006082 3300003771 Bacteria 6668
39 Ga0055526_1006763 3300003771 Bacteria 6131
40 Ga0055537_1000183 3300003773 Bacteria 46516
41 Ga0055537_1000254 3300003773 Bacteria 38945
42 Ga0055537_1000640 3300003773 Bacteria 18595
43 Ga0055537_1003881 3300003773 Bacteria 4451
44 Ga0055524_1000101 3300003775 Bacteria 106527
45 Ga0055536_1000680 3300003781 Bacteria 22876
46 Ga0055536_1003212 3300003781 Bacteria 8860
47 Ga0055534_1000579 3300003784 Bacteria 19225
48 Ga0055534_1001577 3300003784 Bacteria 8856
49 Ga0055528_1001018 3300003790 Bacteria 18595
50 Ga0055530_10001334 3300003791 Bacteria 18475
51 Ga0055540_1000099 3300003792 Bacteria 96187
52 Ga0055540_1001144 3300003792 Bacteria 16551
53 Ga0055540_1001339 3300003792 Bacteria 14844
54 Ga0055531_10002500 3300003794 Bacteria 12247
55 Ga0055531_10016598 3300003794 Bacteria 3166
56 Ga0055541_1000023 3300003841 Bacteria 241012
57 Ga0058692_1002848 3300003856 Bacteria 5655
58 Ga0055543_1001205 3300004625 Bacteria 10864
59 Ga0065165_1000075 3300005262 Bacteria 164281
60 Ga0065165_1002503 3300005262 Bacteria 15365
61 Ga0065165_1020613 3300005262 Bacteria 2315
62 Ga0065714_10094400 3300005288 Bacteria 1817
63 Ga0065712_10076177 3300005290 Bacteria 3715
64 Ga0065715_10023900 3300005293 Bacteria 1651
65 Ga0065707_10086095 3300005295 Bacteria 5670
66 Ga0070658_10005585 3300005327 Bacteria 10200
67 Ga0070658_10175530 3300005327 Bacteria 1802
68 Ga0070676_10000148 3300005328 Bacteria 27670
69 Ga0070676_10000358 3300005328 Bacteria 20978
70 Ga0070676_10023184 3300005328 Bacteria 3487
71 Ga0070676_10043269 3300005328 Bacteria 2617
72 Ga0070683_100008040 3300005329 Bacteria 8955
73 Ga0070683_100017202 3300005329 Bacteria 6386
74 Ga0070683_100058972 3300005329 Bacteria 3566
75 Ga0070683_100059613 3300005329 Bacteria 3546
76 Ga0070690_100022632 3300005330 Bacteria 3846
77 Ga0070690_100087458 3300005330 Bacteria 2047
78 Ga0070670_100001361 3300005331 Bacteria 19584
79 Ga0070670_100005248 3300005331 Bacteria 10910
80 Ga0070670_100024381 3300005331 Bacteria 5202
81 Ga0070670_100029684 3300005331 Bacteria 4708
82 Ga0070670_100033630 3300005331 Bacteria 4416
83 Ga0070670_100053796 3300005331 Bacteria 3456
84 Ga0070670_100059058 3300005331 Bacteria 3292
85 Ga0070670_100059254 3300005331 Bacteria 3286
86 Ga0070670_100166491 3300005331 Bacteria 1911
87 Ga0070677_10000799 3300005333 Bacteria 10454
88 Ga0070677_10023498 3300005333 Bacteria 2283
89 Ga0068869_100001654 3300005334 Bacteria 13305
90 Ga0068869_100016511 3300005334 Bacteria 4978
91 Ga0068869_100032567 3300005334 Bacteria 3674
92 Ga0068869_100066870 3300005334 Bacteria 2650
93 Ga0068869_100069803 3300005334 Bacteria 2599
94 Ga0068869_100152623 3300005334 Bacteria 1792
95 Ga0070666_10002683 3300005335 Bacteria 10735
96 Ga0070666_10004155 3300005335 Bacteria 8787
97 Ga0070666_10059851 3300005335 Bacteria 2577
98 Ga0070680_100003143 3300005336 Bacteria 12265
99 Ga0068868_100001446 3300005338 Bacteria 16366
100 Ga0068868_100001448 3300005338 Bacteria 16365
101 Ga0068868_100025255 3300005338 Bacteria 4516
102 Ga0068868_100026903 3300005338 Bacteria 4385
103 Ga0068868_100027849 3300005338 Bacteria 4313
104 Ga0068868_100112372 3300005338 Bacteria 2214
105 Ga0068868_100120218 3300005338 Bacteria 2142
106 Ga0068868_100135695 3300005338 Bacteria 2017
107 Ga0070660_100000040 3300005339 Bacteria 75773
108 Ga0070660_100007070 3300005339 Bacteria 7798
109 Ga0070660_100098154 3300005339 Bacteria 2318
110 Ga0070689_100005644 3300005340 Bacteria 8571
111 Ga0070691_10028046 3300005341 Bacteria 2629
112 Ga0070687_100000725 3300005343 Bacteria 10957
113 Ga0070661_100001117 3300005344 Bacteria 18832
114 Ga0070661_100013669 3300005344 Bacteria 5701
115 Ga0070661_100014791 3300005344 Bacteria 5502
116 Ga0070661_100032460 3300005344 Bacteria 3780
117 Ga0070692_10003099 3300005345 Bacteria 6654
118 Ga0070692_10006942 3300005345 Bacteria 4954
119 Ga0070692_10018619 3300005345 Bacteria 3343
120 Ga0070692_10023354 3300005345 Bacteria 3029
121 Ga0070668_100001120 3300005347 Bacteria 18884
122 Ga0070668_100001207 3300005347 Bacteria 18349
123 Ga0070668_100002539 3300005347 Bacteria 13436
124 Ga0070668_100008228 3300005347 Bacteria 7744
125 Ga0070668_100015868 3300005347 Bacteria 5635
126 Ga0070668_100017358 3300005347 Bacteria 5391
127 Ga0070668_100036158 3300005347 Bacteria 3769
128 Ga0070669_100015487 3300005353 Bacteria 5434
129 Ga0070669_100085187 3300005353 Bacteria 2360
130 Ga0070675_100000127 3300005354 Bacteria 45462
131 Ga0070675_100006009 3300005354 Bacteria 9302
132 Ga0070675_100017061 3300005354 Bacteria 5771
133 Ga0070675_100019717 3300005354 Bacteria 5377
134 Ga0070675_100020291 3300005354 Bacteria 5303
135 Ga0070675_100022840 3300005354 Bacteria 4998
136 Ga0070675_100061149 3300005354 Bacteria 3110
137 Ga0070675_100177231 3300005354 Bacteria 1841
138 Ga0070671_100000385 3300005355 Bacteria 30358
139 Ga0070671_100001859 3300005355 Bacteria 16109
140 Ga0070671_100005362 3300005355 Bacteria 10225
141 Ga0070671_100023725 3300005355 Bacteria 5021
142 Ga0070671_100031223 3300005355 Bacteria 4399
143 Ga0070671_100033607 3300005355 Bacteria 4244
144 Ga0070671_100034527 3300005355 Bacteria 4186
145 Ga0070671_100037375 3300005355 Bacteria 4026
146 Ga0070671_100038568 3300005355 Bacteria 3965
147 Ga0070671_100171910 3300005355 Bacteria 1833
148 Ga0070674_100000120 3300005356 Bacteria 35826
149 Ga0070674_100040651 3300005356 Bacteria 3147
150 Ga0070674_100098106 3300005356 Bacteria 2129
151 Ga0070673_100000465 3300005364 Bacteria 21543
152 Ga0070673_100022841 3300005364 Bacteria 4561
153 Ga0070673_100023139 3300005364 Bacteria 4536
154 Ga0070673_100031470 3300005364 Bacteria 3981
155 Ga0070673_100046988 3300005364 Bacteria 3356
156 Ga0070673_100049389 3300005364 Bacteria 3285
157 Ga0070673_100057489 3300005364 Bacteria 3073
158 Ga0070673_100162192 3300005364 Bacteria 1902
159 Ga0070688_100007940 3300005365 Bacteria 5739
160 Ga0070688_100012229 3300005365 Bacteria 4804
161 Ga0070659_100000335 3300005366 Bacteria 36311
162 Ga0070659_100003843 3300005366 Bacteria 10708
163 Ga0070659_100033464 3300005366 Bacteria 3992
164 Ga0070659_100047925 3300005366 Bacteria 3354
165 Ga0070659_100069679 3300005366 Bacteria 2792
166 Ga0070659_100126174 3300005366 Bacteria 2076
167 Ga0070667_100001635 3300005367 Bacteria 20037
168 Ga0070667_100002817 3300005367 Bacteria 15004
169 Ga0070667_100010671 3300005367 Bacteria 7589
170 Ga0070667_100019721 3300005367 Bacteria 5594
171 Ga0070667_100027031 3300005367 Bacteria 4773
172 Ga0070709_10020613 3300005434 Bacteria 3827
173 Ga0070714_100001578 3300005435 Bacteria 16557
174 Ga0070714_100021635 3300005435 Bacteria 5263
175 Ga0070714_100028074 3300005435 Bacteria 4665
176 Ga0070714_100080266 3300005435 Bacteria 2839
177 Ga0070713_100000030 3300005436 Bacteria 88948
178 Ga0070713_100007351 3300005436 Bacteria 7722
179 Ga0070713_100020020 3300005436 Bacteria 5122
180 Ga0070713_100023150 3300005436 Bacteria 4814
181 Ga0070710_10004978 3300005437 Bacteria 6290
182 Ga0070701_10017146 3300005438 Bacteria 3381
183 Ga0070701_10083976 3300005438 Bacteria 1731
184 Ga0070711_100019510 3300005439 Bacteria 4350
185 Ga0070711_100086840 3300005439 Bacteria 2244
186 Ga0070705_100053755 3300005440 Bacteria 2359
187 Ga0070705_100054282 3300005440 Bacteria 2350
188 Ga0070700_100002594 3300005441 Bacteria 9240
189 Ga0070694_100006213 3300005444 Bacteria 7251
190 Ga0070694_100018184 3300005444 Bacteria 4458
191 Ga0070708_100000315 3300005445 Bacteria 36417
192 Ga0070708_100133133 3300005445 Bacteria 2302
193 Ga0070663_100000273 3300005455 Bacteria 26046
194 Ga0070663_100005582 3300005455 Bacteria 7488
195 Ga0070663_100022567 3300005455 Bacteria 4209
196 Ga0070663_100026453 3300005455 Bacteria 3931
197 Ga0070663_100096148 3300005455 Bacteria 2203
198 Ga0070678_100000532 3300005456 Bacteria 18540
199 Ga0070678_100027467 3300005456 Bacteria 3864
200 Ga0070678_100032420 3300005456 Bacteria 3616
201 Ga0070662_100026933 3300005457 Bacteria 3986
202 Ga0070662_100038412 3300005457 Bacteria 3400
203 Ga0070662_100047869 3300005457 Bacteria 3078
204 Ga0070662_100049536 3300005457 Bacteria 3029
205 Ga0070662_100050759 3300005457 Bacteria 2992
206 Ga0070662_100057765 3300005457 Bacteria 2820
207 Ga0070662_100140215 3300005457 Bacteria 1872
208 Ga0070681_10001589 3300005458 Bacteria 20194
209 Ga0070681_10008439 3300005458 Bacteria 10084
210 Ga0070681_10044648 3300005458 Bacteria 4436
211 Ga0068867_100000611 3300005459 Bacteria 23660
212 Ga0068867_100008312 3300005459 Bacteria 7327
213 Ga0068867_100015611 3300005459 Bacteria 5389
214 Ga0068867_100023683 3300005459 Bacteria 4396
215 Ga0068867_100027347 3300005459 Bacteria 4097
216 Ga0070685_10023432 3300005466 Bacteria 3380
217 Ga0070706_100002711 3300005467 Bacteria 17718
218 Ga0070698_100142866 3300005471 Bacteria 2344
219 Ga0070699_100013187 3300005518 Bacteria 7126
220 Ga0070699_100028079 3300005518 Bacteria 4853
221 Ga0070699_100039279 3300005518 Bacteria 4098
222 Ga0070679_100006925 3300005530 Bacteria 10574
223 Ga0070679_100008975 3300005530 Bacteria 9434
224 Ga0070679_100026267 3300005530 Bacteria 5717
225 Ga0070679_100078097 3300005530 Bacteria 3299
226 Ga0068853_100016255 3300005539 Bacteria 6124
227 Ga0068853_100019352 3300005539 Bacteria 5644
228 Ga0068853_100036798 3300005539 Bacteria 4163
229 Ga0068853_100098240 3300005539 Bacteria 2585
230 Ga0068853_100105584 3300005539 Bacteria 2495
231 Ga0070672_100001354 3300005543 Bacteria 15121
232 Ga0070672_100001593 3300005543 Bacteria 14079
233 Ga0070672_100002173 3300005543 Bacteria 12365
234 Ga0070672_100002527 3300005543 Bacteria 11648
235 Ga0070672_100014139 3300005543 Bacteria 5649
236 Ga0070672_100040912 3300005543 Bacteria 3560
237 Ga0070672_100069573 3300005543 Bacteria 2794
238 Ga0070672_100108193 3300005543 Bacteria 2263
239 Ga0070686_100072944 3300005544 Bacteria 2252
240 Ga0070695_100005263 3300005545 Bacteria 7616
241 Ga0070695_100017622 3300005545 Bacteria 4333
242 Ga0070695_100095895 3300005545 Bacteria 1989
243 Ga0070696_100005886 3300005546 Bacteria 8189
244 Ga0070696_100041062 3300005546 Bacteria 3195
245 Ga0070696_100124032 3300005546 Bacteria 1872
246 Ga0070693_100001435 3300005547 Bacteria 10742
247 Ga0070665_100003546 3300005548 Bacteria 16568
248 Ga0070665_100011350 3300005548 Bacteria 9009
249 Ga0070665_100018618 3300005548 Bacteria 6960
250 Ga0070665_100024149 3300005548 Bacteria 6122
251 Ga0070665_100082191 3300005548 Bacteria 3226
252 Ga0070665_100139011 3300005548 Bacteria 2432
253 Ga0070704_100024207 3300005549 Bacteria 3981
254 Ga0068855_100001125 3300005563 Bacteria 33195
255 Ga0068855_100021344 3300005563 Bacteria 7765
256 Ga0068855_100074485 3300005563 Bacteria 3942
257 Ga0068855_100145450 3300005563 Bacteria 2699
258 Ga0070664_100001477 3300005564 Bacteria 18724
259 Ga0070664_100001613 3300005564 Bacteria 18043
260 Ga0070664_100016626 3300005564 Bacteria 6035
261 Ga0070664_100156731 3300005564 Bacteria 2012
262 Ga0070664_100165039 3300005564 Bacteria 1962
263 Ga0068857_100009255 3300005577 Bacteria 8545
264 Ga0068857_100078530 3300005577 Bacteria 2946
265 Ga0068857_100173147 3300005577 Bacteria 1963
266 Ga0068854_100030465 3300005578 Bacteria 3742
267 Ga0068854_100161522 3300005578 Bacteria 1736
268 Ga0068856_100002166 3300005614 Bacteria 20348
269 Ga0068856_100007848 3300005614 Bacteria 10422
270 Ga0068856_100008625 3300005614 Bacteria 9916
271 Ga0068856_100017226 3300005614 Bacteria 7002
272 Ga0068856_100027812 3300005614 Bacteria 5516
273 Ga0068856_100089464 3300005614 Bacteria 3062
274 Ga0068856_100129036 3300005614 Bacteria 2533
275 Ga0070702_100068989 3300005615 Bacteria 2082
276 Ga0068852_100000773 3300005616 Bacteria 21097
277 Ga0068852_100001185 3300005616 Bacteria 17283
278 Ga0068852_100005228 3300005616 Bacteria 9256
279 Ga0068852_100008520 3300005616 Bacteria 7563
280 Ga0068852_100015228 3300005616 Bacteria 5954
281 Ga0068852_100170682 3300005616 Bacteria 2038
282 Ga0068859_100002372 3300005617 Bacteria 19172
283 Ga0068859_100003577 3300005617 Bacteria 15829
284 Ga0068859_100035283 3300005617 Bacteria 5019
285 Ga0068859_100042632 3300005617 Bacteria 4558
286 Ga0068859_100059241 3300005617 Bacteria 3858
287 Ga0068859_100215824 3300005617 Bacteria 2006
288 Ga0068859_100223378 3300005617 Bacteria 1971
289 Ga0068864_100001575 3300005618 Bacteria 18770
290 Ga0068864_100002069 3300005618 Bacteria 16579
291 Ga0068864_100006417 3300005618 Bacteria 9642
292 Ga0068864_100008157 3300005618 Bacteria 8638
293 Ga0068864_100014096 3300005618 Bacteria 6632
294 Ga0068864_100023397 3300005618 Bacteria 5187
295 Ga0068864_100024363 3300005618 Bacteria 5091
296 Ga0068864_100040760 3300005618 Bacteria 3971
297 Ga0068864_100061160 3300005618 Bacteria 3262
298 Ga0068864_100080655 3300005618 Bacteria 2851
299 Ga0068864_100090975 3300005618 Bacteria 2691
300 Ga0068864_100098419 3300005618 Bacteria 2591
301 Ga0068866_10002154 3300005718 Bacteria 8199
302 Ga0068866_10018615 3300005718 Bacteria 3144
303 Ga0068861_100000301 3300005719 Bacteria 27687
304 Ga0068861_100020256 3300005719 Bacteria 4760
305 Ga0068861_100037108 3300005719 Bacteria 3622
306 Ga0068861_100062179 3300005719 Bacteria 2867
307 Ga0068861_100155056 3300005719 Bacteria 1883
308 Ga0068851_10003201 3300005834 Bacteria 7257
309 Ga0068851_10004667 3300005834 Bacteria 6190
310 Ga0068851_10004806 3300005834 Bacteria 6113
311 Ga0068851_10058505 3300005834 Bacteria 1970
312 Ga0068870_10001765 3300005840 Bacteria 8869
313 Ga0068870_10043673 3300005840 Bacteria 2338
314 Ga0068863_100003067 3300005841 Bacteria 16514
315 Ga0068863_100017733 3300005841 Bacteria 6814
316 Ga0068863_100022168 3300005841 Bacteria 6063
317 Ga0068863_100025414 3300005841 Bacteria 5647
318 Ga0068863_100043139 3300005841 Bacteria 4282
319 Ga0068863_100148406 3300005841 Bacteria 2243
320 Ga0068863_100151284 3300005841 Bacteria 2220
321 Ga0068863_100175672 3300005841 Bacteria 2055
322 Ga0068863_100269639 3300005841 Bacteria 1647
323 Ga0068858_100006180 3300005842 Bacteria 11681
324 Ga0068858_100007048 3300005842 Bacteria 10915
325 Ga0068858_100014101 3300005842 Bacteria 7537
326 Ga0068858_100021347 3300005842 Bacteria 6049
327 Ga0068858_100047879 3300005842 Bacteria 3962
328 Ga0068858_100057702 3300005842 Bacteria 3588
329 Ga0068858_100089727 3300005842 Bacteria 2860
330 Ga0068858_100094682 3300005842 Bacteria 2782
331 Ga0068858_100103413 3300005842 Bacteria 2657
332 Ga0068858_100171609 3300005842 Bacteria 2045
333 Ga0068860_100002318 3300005843 Bacteria 20001
334 Ga0068860_100012715 3300005843 Bacteria 8280
335 Ga0068860_100022270 3300005843 Bacteria 6132
336 Ga0068860_100028913 3300005843 Bacteria 5333
337 Ga0068860_100041016 3300005843 Bacteria 4422
338 Ga0068860_100066238 3300005843 Bacteria 3431
339 Ga0068860_100092329 3300005843 Bacteria 2884
340 Ga0068860_100120259 3300005843 Bacteria 2514
341 Ga0068860_100136516 3300005843 Bacteria 2355
342 Ga0068860_100140727 3300005843 Bacteria 2319
343 Ga0068860_100145030 3300005843 Bacteria 2284
344 Ga0068860_100233584 3300005843 Bacteria 1787
345 Ga0068860_100264045 3300005843 Bacteria 1679
346 Ga0068862_100003581 3300005844 Bacteria 13296
347 Ga0068862_100020347 3300005844 Bacteria 5543
348 Ga0068862_100041734 3300005844 Bacteria 3905
349 Ga0068862_100056683 3300005844 Bacteria 3358
350 Ga0068862_100061758 3300005844 Bacteria 3221
351 Ga0081538_10017023 3300005981 Bacteria 5540
352 Ga0070717_10017896 3300006028 Bacteria 5525
353 Ga0075365_10020559 3300006038 Bacteria 4095
354 Ga0075432_10031837 3300006058 Bacteria 1826
355 Ga0070716_100005715 3300006173 Bacteria 6041
356 Ga0070716_100027792 3300006173 Bacteria 3042
357 Ga0070712_100031422 3300006175 Bacteria 3577
358 Ga0070712_100043810 3300006175 Bacteria 3082
359 Ga0075362_10003779 3300006177 Bacteria 5360
360 Ga0075362_10013671 3300006177 Bacteria 3255
361 Ga0075366_10012563 3300006195 Bacteria 4806
362 Ga0075366_10014908 3300006195 Bacteria 4444
363 Ga0075366_10033867 3300006195 Bacteria 3010
364 Ga0075366_10108350 3300006195 Bacteria 1670
365 Ga0097621_100001301 3300006237 Bacteria 17184
366 Ga0097621_100007020 3300006237 Bacteria 8020
367 Ga0097621_100009479 3300006237 Bacteria 7068
368 Ga0097621_100009828 3300006237 Bacteria 6964
369 Ga0097621_100034286 3300006237 Bacteria 4048
370 Ga0097621_100083065 3300006237 Bacteria 2668
371 Ga0097621_100115702 3300006237 Bacteria 2270
372 Ga0097621_100131299 3300006237 Bacteria 2132
373 Ga0075370_10001530 3300006353 Bacteria 10118
374 Ga0075370_10001898 3300006353 Bacteria 9394
375 Ga0075370_10003975 3300006353 Bacteria 7105
376 Ga0075370_10008606 3300006353 Bacteria 5260
377 Ga0068871_100000155 3300006358 Bacteria 45123
378 Ga0068871_100004278 3300006358 Bacteria 9904
379 Ga0068871_100010918 3300006358 Bacteria 6651
380 Ga0068871_100015576 3300006358 Bacteria 5696
381 Ga0068871_100020682 3300006358 Bacteria 5045
382 Ga0068871_100025900 3300006358 Bacteria 4570
383 Ga0068871_100078028 3300006358 Bacteria 2738
384 Ga0075428_100008716 3300006844 Bacteria 11251
385 Ga0075428_100094800 3300006844 Bacteria 3254
386 Ga0075428_100145404 3300006844 Bacteria 2577
387 Ga0075431_100000979 3300006847 Bacteria 25398
388 Ga0075431_100020085 3300006847 Bacteria 6822
389 Ga0075433_10033873 3300006852 Bacteria 4382
390 Ga0075433_10115124 3300006852 Bacteria 2386
391 Ga0075434_100026928 3300006871 Bacteria 5640
392 Ga0075434_100089369 3300006871 Bacteria 3082
393 Ga0075434_100108789 3300006871 Bacteria 2782
394 Ga0075434_100217527 3300006871 Bacteria 1930
395 Ga0068865_100013513 3300006881 Bacteria 5161
396 Ga0068865_100029143 3300006881 Bacteria 3659
397 Ga0068865_100055654 3300006881 Bacteria 2753
398 Ga0075436_100022431 3300006914 Bacteria 4337
399 Ga0097620_100002372 3300006931 Bacteria 19172
400 Ga0097620_100003577 3300006931 Bacteria 15829
401 Ga0097620_100035282 3300006931 Bacteria 5019
402 Ga0097620_100042633 3300006931 Bacteria 4558
403 Ga0097620_100059240 3300006931 Bacteria 3858
404 Ga0097620_100215825 3300006931 Bacteria 2006
405 Ga0097620_100223359 3300006931 Bacteria 1971
406 Ga0099823_1000262 3300006944 Bacteria 30959
407 Ga0075435_100029224 3300007076 Bacteria 4326
408 Ga0099794_10009254 3300007265 Bacteria 4131
409 Ga0099795_10000016 3300007788 Bacteria 63930
410 Ga0099795_10000213 3300007788 Bacteria 10001
411 Ga0099795_10009193 3300007788 Bacteria 2857
412 Ga0105240_10009642 3300009093 Bacteria 13655
413 Ga0105240_10013339 3300009093 Bacteria 11292
414 Ga0105240_10021359 3300009093 Bacteria 8611
415 Ga0105240_10037680 3300009093 Bacteria 6212
416 Ga0105240_10038466 3300009093 Bacteria 6137
417 Ga0105240_10160746 3300009093 Bacteria 2668
418 Ga0105240_10197498 3300009093 Bacteria 2360
419 Ga0111539_10001754 3300009094 Bacteria 28812
420 Ga0111539_10002831 3300009094 Bacteria 23059
421 Ga0111539_10039561 3300009094 Bacteria 5682
422 Ga0111539_10115047 3300009094 Bacteria 3155
423 Ga0111539_10166659 3300009094 Bacteria 2576
424 Ga0105245_10029258 3300009098 Bacteria 4866
425 Ga0105245_10033953 3300009098 Bacteria 4522
426 Ga0105245_10151766 3300009098 Bacteria 2191
427 Ga0105247_10031204 3300009101 Bacteria 3233
428 Ga0105247_10032359 3300009101 Bacteria 3178
429 Ga0105243_10017029 3300009148 Bacteria 5495
430 Ga0105243_10028276 3300009148 Bacteria 4303
431 Ga0105243_10035079 3300009148 Bacteria 3888
432 Ga0105243_10058069 3300009148 Bacteria 3083
433 Ga0105243_10070583 3300009148 Bacteria 2821
434 Ga0105242_10004677 3300009176 Bacteria 10591
435 Ga0105242_10006175 3300009176 Bacteria 9228
436 Ga0105242_10012520 3300009176 Bacteria 6530
437 Ga0105242_10021186 3300009176 Bacteria 5102
438 Ga0105242_10022167 3300009176 Bacteria 4991
439 Ga0105242_10064030 3300009176 Bacteria 3029
440 Ga0105248_10002044 3300009177 Bacteria 22366
441 Ga0105248_10009798 3300009177 Bacteria 10555
442 Ga0105248_10015742 3300009177 Bacteria 8336
443 Ga0105248_10018504 3300009177 Bacteria 7699
444 Ga0105248_10020721 3300009177 Bacteria 7284
445 Ga0105248_10021964 3300009177 Bacteria 7072
446 Ga0105248_10074135 3300009177 Bacteria 3825
447 Ga0105248_10097015 3300009177 Bacteria 3321
448 Ga0105248_10102047 3300009177 Bacteria 3233
449 Ga0105248_10116645 3300009177 Bacteria 3011
450 Ga0105248_10166548 3300009177 Bacteria 2484
451 Ga0105248_10215930 3300009177 Bacteria 2160
452 Ga0105237_10014315 3300009545 Bacteria 8303
453 Ga0105237_10040777 3300009545 Bacteria 4681
454 Ga0105237_10186713 3300009545 Bacteria 2073
455 Ga0105238_10002047 3300009551 Bacteria 20346
456 Ga0105238_10025045 3300009551 Bacteria 6082
457 Ga0105238_10038818 3300009551 Bacteria 4835
458 Ga0105238_10045297 3300009551 Bacteria 4444
459 Ga0105238_10095559 3300009551 Bacteria 2958
460 Ga0105238_10212985 3300009551 Bacteria 1908
461 Ga0105249_10017612 3300009553 Bacteria 6343
462 Ga0105249_10024270 3300009553 Bacteria 5449
463 Ga0105249_10049391 3300009553 Bacteria 3837
464 Ga0105249_10111569 3300009553 Bacteria 2586
465 Ga0099796_10000003 3300010159 Bacteria 81717
466 Ga0105239_10040067 3300010375 Bacteria 5132
467 Ga0105239_10204709 3300010375 Bacteria 2211
468 Ga0157347_1000437 3300012502 Bacteria 2700
469 Ga0157347_1000526 3300012502 Bacteria 2543
470 Ga0157373_10038288 3300013100 Bacteria 3438
471 Ga0157371_10001585 3300013102 Bacteria 23358
472 Ga0157371_10025257 3300013102 Bacteria 4332
473 Ga0157370_10004541 3300013104 Bacteria 15900
474 Ga0157370_10014786 3300013104 Bacteria 7965
475 Ga0157370_10023152 3300013104 Bacteria 6173
476 Ga0157370_10030299 3300013104 Bacteria 5302
477 Ga0157370_10033170 3300013104 Bacteria 5034
478 Ga0157370_10062897 3300013104 Bacteria 3518
479 Ga0157370_10079441 3300013104 Bacteria 3089
480 Ga0157369_10007892 3300013105 Bacteria 12238
481 Ga0157369_10010470 3300013105 Bacteria 10563
482 Ga0157374_10039253 3300013296 Bacteria 4357
483 Ga0157374_10047421 3300013296 Bacteria 3984
484 Ga0157378_10010403 3300013297 Bacteria 8124
485 Ga0157378_10018771 3300013297 Bacteria 6079
486 Ga0157378_10029728 3300013297 Bacteria 4824
487 Ga0157378_10043470 3300013297 Bacteria 3989
488 Ga0163162_10002191 3300013306 Bacteria 18337
489 Ga0163162_10040591 3300013306 Bacteria 4654
490 Ga0163162_10040756 3300013306 Bacteria 4645
491 Ga0163162_10092092 3300013306 Bacteria 3114
492 Ga0163162_10100788 3300013306 Bacteria 2979
493 Ga0163162_10208109 3300013306 Bacteria 2085
494 Ga0163162_10288563 3300013306 Bacteria 1773
495 Ga0157372_10004036 3300013307 Bacteria 15742
496 Ga0157372_10035608 3300013307 Bacteria 5481
497 Ga0157372_10088187 3300013307 Bacteria 3522
498 Ga0157372_10095039 3300013307 Bacteria 3395
499 Ga0157375_10000969 3300013308 Bacteria 24817
500 Ga0157375_10010250 3300013308 Bacteria 8244
501 Ga0157375_10051869 3300013308 Bacteria 4031
502 Ga0157375_10054701 3300013308 Bacteria 3932
503 Ga0157375_10054813 3300013308 Bacteria 3928
504 Ga0157375_10066889 3300013308 Bacteria 3589
505 Ga0157375_10183362 3300013308 Bacteria 2246
506 Ga0157375_10183443 3300013308 Bacteria 2245
507 Ga0163163_10001474 3300014325 Bacteria 19920
508 Ga0163163_10017467 3300014325 Bacteria 6692
509 Ga0163163_10115197 3300014325 Bacteria 2719
510 Ga0163163_10162891 3300014325 Bacteria 2276
511 Ga0163163_10184052 3300014325 Bacteria 2136
512 Ga0157380_10030469 3300014326 Bacteria 4132
513 Ga0157380_10032014 3300014326 Bacteria 4041
514 Ga0157380_10045371 3300014326 Bacteria 3449
515 Ga0157380_10095817 3300014326 Bacteria 2459
516 Ga0182008_10000044 3300014497 Bacteria 115149
517 Ga0182008_10003423 3300014497 Bacteria 9586
518 Ga0182008_10049376 3300014497 Bacteria 2089
519 Ga0157377_10017671 3300014745 Bacteria 3693
520 Ga0157379_10000796 3300014968 Bacteria 25564
521 Ga0157379_10005362 3300014968 Bacteria 11022
522 Ga0157379_10007870 3300014968 Bacteria 9234
523 Ga0157379_10020780 3300014968 Bacteria 5809
524 Ga0157379_10021082 3300014968 Bacteria 5767
525 Ga0157379_10045091 3300014968 Bacteria 3936
526 Ga0157379_10053760 3300014968 Bacteria 3598
527 Ga0157379_10091663 3300014968 Bacteria 2726
528 Ga0157379_10145872 3300014968 Bacteria 2134
529 Ga0157376_10004066 3300014969 Bacteria 10120
530 Ga0157376_10024013 3300014969 Bacteria 4781
531 Ga0157376_10039002 3300014969 Bacteria 3869
532 Ga0157376_10062505 3300014969 Bacteria 3133
533 Ga0157376_10067225 3300014969 Bacteria 3031
534 Ga0157376_10094119 3300014969 Bacteria 2602
535 Ga0157376_10122724 3300014969 Bacteria 2305
536 Ga0157376_10124279 3300014969 Bacteria 2292
537 Ga0182006_1007864 3300015261 Bacteria 4855
538 Ga0182007_10003472 3300015262 Bacteria 7419
539 Ga0183362_10002 3300015683 Bacteria 1432711
540 Ga0163161_10000042 3300017792 Bacteria 135368
541 Ga0163161_10000166 3300017792 Bacteria 60327
542 Ga0163161_10010292 3300017792 Bacteria 6478
543 Ga0163161_10021996 3300017792 Bacteria 4485
544 Ga0163161_10195994 3300017792 Bacteria 1555
545 Ga0213874_10009787 3300021377 Bacteria 2382
546 Ga0209435_100008 3300025206 Bacteria 503644
547 Ga0209784_100010 3300025224 Bacteria 683664
548 Ga0209566_100008 3300025225 Bacteria 683664
549 Ga0209674_100019 3300025226 Bacteria 683664
550 Ga0209672_100015 3300025228 Bacteria 529352
551 Ga0209672_100041 3300025228 Bacteria 278535
552 Ga0209672_100263 3300025228 Bacteria 38912
553 Ga0209147_100016 3300025229 Bacteria 527606
554 Ga0209147_100226 3300025229 Bacteria 56753
555 Ga0209147_100313 3300025229 Bacteria 37631
556 Ga0209563_100021 3300025230 Bacteria 683764
557 Ga0207427_102072 3300025231 Bacteria 5925
558 Ga0209437_100019 3300025233 Bacteria 683764
559 Ga0209258_100026 3300025242 Bacteria 527606
560 Ga0209258_100309 3300025242 Bacteria 76791
561 Ga0209258_100498 3300025242 Bacteria 38912
562 Ga0207425_1000606 3300025245 Bacteria 20792
563 Ga0207425_1000926 3300025245 Bacteria 13967
564 Ga0207425_1012831 3300025245 Bacteria 1953
565 Ga0209646_1000079 3300025246 Bacteria 207677
566 Ga0209026_1000067 3300025250 Bacteria 207677
567 Ga0209677_100011 3300025253 Bacteria 683664
568 Ga0209148_1000518 3300025254 Bacteria 38312
569 Ga0209148_1000599 3300025254 Bacteria 32537
570 Ga0209759_1000056 3300025256 Bacteria 207677
571 Ga0209759_1000077 3300025256 Bacteria 175706
572 Ga0209759_1001862 3300025256 Bacteria 10487
573 Ga0209129_1000776 3300025258 Bacteria 20242
574 Ga0209233_1000025 3300025261 Bacteria 683764
575 Ga0209565_1000041 3300025263 Bacteria 251081
576 Ga0209565_1000504 3300025263 Bacteria 28431
577 Ga0209565_1000849 3300025263 Bacteria 17247
578 Ga0209455_1000272 3300025272 Bacteria 57248
579 Ga0209455_1000510 3300025272 Bacteria 27792
580 Ga0209455_1000901 3300025272 Bacteria 15518
581 Ga0209673_1000012 3300025273 Bacteria 579480
582 Ga0209673_1000102 3300025273 Bacteria 189583
583 Ga0209673_1001382 3300025273 Bacteria 23815
584 Ga0209673_1003059 3300025273 Bacteria 10312
585 Ga0209673_1008187 3300025273 Bacteria 4693
586 Ga0209130_1000014 3300025284 Bacteria 412039
587 Ga0209130_1000184 3300025284 Bacteria 87817
588 Ga0209130_1000888 3300025284 Bacteria 24370
589 Ga0209675_1000475 3300025291 Bacteria 30742
590 Ga0209675_1000615 3300025291 Bacteria 25527
591 Ga0209676_1000013 3300025292 Bacteria 816080
592 Ga0209676_1000240 3300025292 Bacteria 117689
593 Ga0209676_1000868 3300025292 Bacteria 38801
594 Ga0209025_1000103 3300025294 Bacteria 228054
595 Ga0209025_1000312 3300025294 Bacteria 107913
596 Ga0209025_1001649 3300025294 Bacteria 27534
597 Ga0209025_1003125 3300025294 Bacteria 16198
598 Ga0209025_1010118 3300025294 Bacteria 6440
599 Ga0209025_1010290 3300025294 Bacteria 6356
600 Ga0209564_1001251 3300025295 Bacteria 28255
601 Ga0209564_1001414 3300025295 Bacteria 24743
602 Ga0209564_1002566 3300025295 Bacteria 13966
603 Ga0209758_1000028 3300025297 Bacteria 530102
604 Ga0209758_1001416 3300025297 Bacteria 28400
605 Ga0209758_1006824 3300025297 Bacteria 8001
606 Ga0209050_1000008 3300025298 Bacteria 1144179
607 Ga0209050_1003807 3300025298 Bacteria 10766
608 Ga0209050_1009162 3300025298 Bacteria 5119
609 Ga0209050_1019093 3300025298 Bacteria 2625
610 Ga0209256_1000003 3300025299 Bacteria 1661127
611 Ga0209256_1002403 3300025299 Bacteria 15370
612 Ga0209256_1025630 3300025299 Bacteria 1713
613 Ga0207426_1000091 3300025302 Bacteria 280561
614 Ga0207426_1000158 3300025302 Bacteria 177323
615 Ga0207426_1001126 3300025302 Bacteria 24341
616 Ga0207426_1008325 3300025302 Bacteria 4207
617 Ga0209051_1000005 3300025303 Bacteria 1142353
618 Ga0209051_1000658 3300025303 Bacteria 39012
619 Ga0209051_1001207 3300025303 Bacteria 23322
620 Ga0209051_1001419 3300025303 Bacteria 20568
621 Ga0209051_1016656 3300025303 Bacteria 3312
622 Ga0209257_1000048 3300025304 Bacteria 455536
623 Ga0209257_1000707 3300025304 Bacteria 51654
624 Ga0209257_1001241 3300025304 Bacteria 31534
625 Ga0209257_1008540 3300025304 Bacteria 5784
626 Ga0207697_10000570 3300025315 Bacteria 20951
627 Ga0207697_10014393 3300025315 Bacteria 3281
628 Ga0207697_10023252 3300025315 Bacteria 2537
629 Ga0207697_10027523 3300025315 Bacteria 2324
630 Ga0207656_10020101 3300025321 Bacteria 2650
631 Ga0207656_10020303 3300025321 Bacteria 2639
632 Ga0207682_10000037 3300025893 Bacteria 54103
633 Ga0207682_10000481 3300025893 Bacteria 18483
634 Ga0207682_10006639 3300025893 Bacteria 4650
635 Ga0207682_10016635 3300025893 Bacteria 2870
636 Ga0207642_10023585 3300025899 Bacteria 2460
637 Ga0207642_10032752 3300025899 Bacteria 2192
638 Ga0207710_10012401 3300025900 Bacteria 3587
639 Ga0207688_10003561 3300025901 Bacteria 8498
640 Ga0207688_10006372 3300025901 Bacteria 6427
641 Ga0207688_10029382 3300025901 Bacteria 3026
642 Ga0207688_10079501 3300025901 Bacteria 1870
643 Ga0207688_10089488 3300025901 Bacteria 1766
644 Ga0207680_10004793 3300025903 Bacteria 6439
645 Ga0207680_10005170 3300025903 Bacteria 6226
646 Ga0207680_10023025 3300025903 Bacteria 3396
647 Ga0207680_10027578 3300025903 Bacteria 3165
648 Ga0207680_10042523 3300025903 Bacteria 2658
649 Ga0207680_10048311 3300025903 Bacteria 2527
650 Ga0207680_10050192 3300025903 Bacteria 2488
651 Ga0207680_10068584 3300025903 Bacteria 2188
652 Ga0207699_10009808 3300025906 Bacteria 4785
653 Ga0207645_10000187 3300025907 Bacteria 49829
654 Ga0207645_10000549 3300025907 Bacteria 31247
655 Ga0207645_10004878 3300025907 Bacteria 9838
656 Ga0207645_10007994 3300025907 Bacteria 7420
657 Ga0207645_10020182 3300025907 Bacteria 4364
658 Ga0207645_10042134 3300025907 Bacteria 2921
659 Ga0207645_10047598 3300025907 Bacteria 2738
660 Ga0207645_10056454 3300025907 Bacteria 2507
661 Ga0207645_10057329 3300025907 Bacteria 2487
662 Ga0207645_10076894 3300025907 Bacteria 2138
663 Ga0207645_10110178 3300025907 Bacteria 1782
664 Ga0207643_10000184 3300025908 Bacteria 43056
665 Ga0207643_10010895 3300025908 Bacteria 4904
666 Ga0207643_10083963 3300025908 Bacteria 1848
667 Ga0207705_10039251 3300025909 Bacteria 3392
668 Ga0207705_10040679 3300025909 Bacteria 3335
669 Ga0207684_10028541 3300025910 Bacteria 4754
670 Ga0207707_10004954 3300025912 Bacteria 11704
671 Ga0207707_10028501 3300025912 Bacteria 4880
672 Ga0207707_10072231 3300025912 Bacteria 3008
673 Ga0207695_10004412 3300025913 Bacteria 19220
674 Ga0207695_10016786 3300025913 Bacteria 8548
675 Ga0207695_10050075 3300025913 Bacteria 4397
676 Ga0207695_10054043 3300025913 Bacteria 4197
677 Ga0207671_10029173 3300025914 Bacteria 4121
678 Ga0207671_10036072 3300025914 Bacteria 3667
679 Ga0207660_10063000 3300025917 Bacteria 2672
680 Ga0207660_10080220 3300025917 Bacteria 2396
681 Ga0207660_10127220 3300025917 Bacteria 1936
682 Ga0207662_10000381 3300025918 Bacteria 19870
683 Ga0207657_10000044 3300025919 Bacteria 116398
684 Ga0207657_10000102 3300025919 Bacteria 82096
685 Ga0207657_10002428 3300025919 Bacteria 20129
686 Ga0207657_10003776 3300025919 Bacteria 16099
687 Ga0207657_10072283 3300025919 Bacteria 2918
688 Ga0207657_10143172 3300025919 Bacteria 1952
689 Ga0207649_10001848 3300025920 Bacteria 12101
690 Ga0207649_10013503 3300025920 Bacteria 4559
691 Ga0207649_10035717 3300025920 Bacteria 2988
692 Ga0207646_10208405 3300025922 Bacteria 1765
693 Ga0207681_10008019 3300025923 Bacteria 6460
694 Ga0207681_10025579 3300025923 Bacteria 3798
695 Ga0207681_10044482 3300025923 Bacteria 2976
696 Ga0207681_10070544 3300025923 Bacteria 2433
697 Ga0207681_10082141 3300025923 Bacteria 2277
698 Ga0207681_10106217 3300025923 Bacteria 2034
699 Ga0207681_10205703 3300025923 Bacteria 1514
700 Ga0207694_10009366 3300025924 Bacteria 7386
701 Ga0207694_10046669 3300025924 Bacteria 3348
702 Ga0207694_10107911 3300025924 Bacteria 2212
703 Ga0207650_10002667 3300025925 Bacteria 12349
704 Ga0207650_10007698 3300025925 Bacteria 7339
705 Ga0207650_10017067 3300025925 Bacteria 5081
706 Ga0207650_10017955 3300025925 Bacteria 4958
707 Ga0207650_10026003 3300025925 Bacteria 4173
708 Ga0207650_10031866 3300025925 Bacteria 3810
709 Ga0207650_10064654 3300025925 Bacteria 2739
710 Ga0207650_10226187 3300025925 Bacteria 1507
711 Ga0207659_10001823 3300025926 Bacteria 12620
712 Ga0207659_10002543 3300025926 Bacteria 10856
713 Ga0207659_10003407 3300025926 Bacteria 9525
714 Ga0207659_10011571 3300025926 Bacteria 5578
715 Ga0207659_10044009 3300025926 Bacteria 3139
716 Ga0207659_10118906 3300025926 Bacteria 2022
717 Ga0207687_10151625 3300025927 Bacteria 1769
718 Ga0207700_10000209 3300025928 Bacteria 35041
719 Ga0207700_10014240 3300025928 Bacteria 5204
720 Ga0207700_10060735 3300025928 Bacteria 2863
721 Ga0207664_10002657 3300025929 Bacteria 11853
722 Ga0207664_10067400 3300025929 Bacteria 2872
723 Ga0207664_10069592 3300025929 Bacteria 2830
724 Ga0207644_10000896 3300025931 Bacteria 18852
725 Ga0207644_10002261 3300025931 Bacteria 12495
726 Ga0207644_10002955 3300025931 Bacteria 10951
727 Ga0207644_10009799 3300025931 Bacteria 6299
728 Ga0207644_10022344 3300025931 Bacteria 4321
729 Ga0207644_10079954 3300025931 Bacteria 2413
730 Ga0207644_10173715 3300025931 Bacteria 1684
731 Ga0207690_10000046 3300025932 Bacteria 116358
732 Ga0207690_10022360 3300025932 Bacteria 3932
733 Ga0207690_10068112 3300025932 Bacteria 2444
734 Ga0207690_10170693 3300025932 Bacteria 1629
735 Ga0207706_10000095 3300025933 Bacteria 92378
736 Ga0207706_10030582 3300025933 Bacteria 4802
737 Ga0207706_10039869 3300025933 Bacteria 4164
738 Ga0207706_10053025 3300025933 Bacteria 3580
739 Ga0207706_10054053 3300025933 Bacteria 3544
740 Ga0207706_10058430 3300025933 Bacteria 3397
741 Ga0207706_10082514 3300025933 Bacteria 2825
742 Ga0207706_10087646 3300025933 Bacteria 2737
743 Ga0207706_10087979 3300025933 Bacteria 2732
744 Ga0207686_10006148 3300025934 Bacteria 6450
745 Ga0207686_10009754 3300025934 Bacteria 5218
746 Ga0207686_10019101 3300025934 Bacteria 3892
747 Ga0207686_10134436 3300025934 Bacteria 1701
748 Ga0207709_10008886 3300025935 Bacteria 5546
749 Ga0207709_10015977 3300025935 Bacteria 4166
750 Ga0207709_10019778 3300025935 Bacteria 3790
751 Ga0207670_10004649 3300025936 Bacteria 7438
752 Ga0207670_10006415 3300025936 Bacteria 6522
753 Ga0207670_10069218 3300025936 Bacteria 2434
754 Ga0207669_10055128 3300025937 Bacteria 2405
755 Ga0207704_10001029 3300025938 Bacteria 12386
756 Ga0207704_10003578 3300025938 Bacteria 7057
757 Ga0207704_10004265 3300025938 Bacteria 6533
758 Ga0207704_10054456 3300025938 Bacteria 2439
759 Ga0207704_10061652 3300025938 Bacteria 2328
760 Ga0207704_10067560 3300025938 Bacteria 2249
761 Ga0207665_10005952 3300025939 Bacteria 8114
762 Ga0207665_10009720 3300025939 Bacteria 6313
763 Ga0207691_10000024 3300025940 Bacteria 132111
764 Ga0207691_10000105 3300025940 Bacteria 74790
765 Ga0207691_10000699 3300025940 Bacteria 33182
766 Ga0207691_10002234 3300025940 Bacteria 18960
767 Ga0207691_10007608 3300025940 Bacteria 10426
768 Ga0207691_10007936 3300025940 Bacteria 10213
769 Ga0207691_10013535 3300025940 Bacteria 7802
770 Ga0207691_10018938 3300025940 Bacteria 6521
771 Ga0207691_10020043 3300025940 Bacteria 6326
772 Ga0207691_10036527 3300025940 Bacteria 4553
773 Ga0207691_10040328 3300025940 Bacteria 4314
774 Ga0207691_10067648 3300025940 Bacteria 3230
775 Ga0207691_10135538 3300025940 Bacteria 2172
776 Ga0207711_10017928 3300025941 Bacteria 5883
777 Ga0207711_10026589 3300025941 Bacteria 4855
778 Ga0207711_10031694 3300025941 Bacteria 4464
779 Ga0207711_10032000 3300025941 Bacteria 4445
780 Ga0207711_10032218 3300025941 Bacteria 4431
781 Ga0207711_10040913 3300025941 Bacteria 3944
782 Ga0207711_10042809 3300025941 Bacteria 3859
783 Ga0207689_10000280 3300025942 Bacteria 46392
784 Ga0207689_10008871 3300025942 Bacteria 8727
785 Ga0207689_10009536 3300025942 Bacteria 8377
786 Ga0207689_10019933 3300025942 Bacteria 5648
787 Ga0207689_10042498 3300025942 Bacteria 3759
788 Ga0207689_10053209 3300025942 Bacteria 3336
789 Ga0207689_10061855 3300025942 Bacteria 3079
790 Ga0207689_10069059 3300025942 Bacteria 2903
791 Ga0207689_10070772 3300025942 Bacteria 2865
792 Ga0207689_10094298 3300025942 Bacteria 2458
793 Ga0207661_10011026 3300025944 Bacteria 6533
794 Ga0207661_10062606 3300025944 Bacteria 3010
795 Ga0207661_10083028 3300025944 Bacteria 2650
796 Ga0207679_10003260 3300025945 Bacteria 10024
797 Ga0207679_10005044 3300025945 Bacteria 8254
798 Ga0207679_10006792 3300025945 Bacteria 7252
799 Ga0207679_10020528 3300025945 Bacteria 4459
800 Ga0207679_10045330 3300025945 Bacteria 3179
801 Ga0207679_10060643 3300025945 Bacteria 2812
802 Ga0207667_10000233 3300025949 Bacteria 77272
803 Ga0207667_10004665 3300025949 Bacteria 16788
804 Ga0207667_10009195 3300025949 Bacteria 11673
805 Ga0207667_10059600 3300025949 Bacteria 3997
806 Ga0207667_10073160 3300025949 Bacteria 3561
807 Ga0207667_10080159 3300025949 Bacteria 3382
808 Ga0207667_10122226 3300025949 Bacteria 2683
809 Ga0207651_10005217 3300025960 Bacteria 6639
810 Ga0207651_10009785 3300025960 Bacteria 5272
811 Ga0207651_10016687 3300025960 Bacteria 4311
812 Ga0207651_10025618 3300025960 Bacteria 3669
813 Ga0207651_10040178 3300025960 Bacteria 3092
814 Ga0207651_10063916 3300025960 Bacteria 2573
815 Ga0207651_10075833 3300025960 Bacteria 2401
816 Ga0207712_10018035 3300025961 Bacteria 4592
817 Ga0207712_10030739 3300025961 Bacteria 3612
818 Ga0207712_10060447 3300025961 Bacteria 2686
819 Ga0207712_10104576 3300025961 Bacteria 2111
820 Ga0207712_10198561 3300025961 Bacteria 1589
821 Ga0207668_10004902 3300025972 Bacteria 7872
822 Ga0207668_10009416 3300025972 Bacteria 5854
823 Ga0207668_10013512 3300025972 Bacteria 5031
824 Ga0207668_10042806 3300025972 Bacteria 3069
825 Ga0207668_10110882 3300025972 Bacteria 2058
826 Ga0207668_10111395 3300025972 Bacteria 2054
827 Ga0207668_10126201 3300025972 Bacteria 1946
828 Ga0207640_10074435 3300025981 Bacteria 2299
829 Ga0207658_10001872 3300025986 Bacteria 15746
830 Ga0207658_10002398 3300025986 Bacteria 13742
831 Ga0207658_10003703 3300025986 Bacteria 10771
832 Ga0207658_10016389 3300025986 Bacteria 5097
833 Ga0207658_10025059 3300025986 Bacteria 4175
834 Ga0207658_10059486 3300025986 Bacteria 2847
835 Ga0207658_10243707 3300025986 Bacteria 1524
836 Ga0207677_10003378 3300026023 Bacteria 8450
837 Ga0207677_10012818 3300026023 Bacteria 4837
838 Ga0207677_10016469 3300026023 Bacteria 4382
839 Ga0207677_10073542 3300026023 Bacteria 2421
840 Ga0207677_10133458 3300026023 Bacteria 1889
841 Ga0207703_10002556 3300026035 Bacteria 15720
842 Ga0207703_10006522 3300026035 Bacteria 9310
843 Ga0207703_10007174 3300026035 Bacteria 8864
844 Ga0207703_10010786 3300026035 Bacteria 7129
845 Ga0207703_10011356 3300026035 Bacteria 6930
846 Ga0207703_10027160 3300026035 Bacteria 4507
847 Ga0207703_10081322 3300026035 Bacteria 2700
848 Ga0207703_10082279 3300026035 Bacteria 2686
849 Ga0207703_10137291 3300026035 Bacteria 2118
850 Ga0207639_10002255 3300026041 Bacteria 12960
851 Ga0207639_10132527 3300026041 Bacteria 2065
852 Ga0207678_10000286 3300026067 Bacteria 45712
853 Ga0207678_10002265 3300026067 Bacteria 17417
854 Ga0207678_10004850 3300026067 Bacteria 12084
855 Ga0207678_10005487 3300026067 Bacteria 11335
856 Ga0207678_10042830 3300026067 Bacteria 3920
857 Ga0207678_10049530 3300026067 Bacteria 3630
858 Ga0207678_10054220 3300026067 Bacteria 3453
859 Ga0207708_10005067 3300026075 Bacteria 9717
860 Ga0207708_10016854 3300026075 Bacteria 5501
861 Ga0207708_10053137 3300026075 Bacteria 3086
862 Ga0207708_10071542 3300026075 Bacteria 2657
863 Ga0207702_10002061 3300026078 Bacteria 19456
864 Ga0207702_10032002 3300026078 Bacteria 4387
865 Ga0207702_10033667 3300026078 Bacteria 4281
866 Ga0207702_10049691 3300026078 Bacteria 3539
867 Ga0207641_10011927 3300026088 Bacteria 7131
868 Ga0207641_10018825 3300026088 Bacteria 5663
869 Ga0207641_10023973 3300026088 Bacteria 5029
870 Ga0207641_10032159 3300026088 Bacteria 4355
871 Ga0207641_10034231 3300026088 Bacteria 4224
872 Ga0207641_10047709 3300026088 Bacteria 3612
873 Ga0207641_10074038 3300026088 Bacteria 2936
874 Ga0207641_10094025 3300026088 Bacteria 2628
875 Ga0207641_10169323 3300026088 Bacteria 1992
876 Ga0207641_10202211 3300026088 Bacteria 1832
877 Ga0207641_10255224 3300026088 Bacteria 1639
878 Ga0207648_10000319 3300026089 Bacteria 52621
879 Ga0207648_10000320 3300026089 Bacteria 52595
880 Ga0207648_10005620 3300026089 Bacteria 12601
881 Ga0207648_10006803 3300026089 Bacteria 11335
882 Ga0207648_10016468 3300026089 Bacteria 6752
883 Ga0207648_10018481 3300026089 Bacteria 6311
884 Ga0207648_10018704 3300026089 Bacteria 6266
885 Ga0207648_10035662 3300026089 Bacteria 4382
886 Ga0207648_10075768 3300026089 Bacteria 2932
887 Ga0207648_10132571 3300026089 Bacteria 2193
888 Ga0207676_10011495 3300026095 Bacteria 6331
889 Ga0207676_10013054 3300026095 Bacteria 5963
890 Ga0207676_10013290 3300026095 Bacteria 5914
891 Ga0207676_10014707 3300026095 Bacteria 5636
892 Ga0207676_10029112 3300026095 Bacteria 4132
893 Ga0207676_10085097 3300026095 Bacteria 2579
894 Ga0207676_10093934 3300026095 Bacteria 2470
895 Ga0207676_10162743 3300026095 Bacteria 1935
896 Ga0207676_10187202 3300026095 Bacteria 1818
897 Ga0207674_10000326 3300026116 Bacteria 60670
898 Ga0207674_10001568 3300026116 Bacteria 29439
899 Ga0207674_10002996 3300026116 Bacteria 20950
900 Ga0207674_10003123 3300026116 Bacteria 20429
901 Ga0207674_10022936 3300026116 Bacteria 6696
902 Ga0207674_10029867 3300026116 Bacteria 5735
903 Ga0207674_10030905 3300026116 Bacteria 5629
904 Ga0207674_10055612 3300026116 Bacteria 4022
905 Ga0207674_10117898 3300026116 Bacteria 2625
906 Ga0207675_100000538 3300026118 Bacteria 36903
907 Ga0207675_100000977 3300026118 Bacteria 28393
908 Ga0207675_100004711 3300026118 Bacteria 13130
909 Ga0207675_100006767 3300026118 Bacteria 10842
910 Ga0207675_100009583 3300026118 Bacteria 9059
911 Ga0207675_100012572 3300026118 Bacteria 7906
912 Ga0207675_100025952 3300026118 Bacteria 5453
913 Ga0207675_100034418 3300026118 Bacteria 4724
914 Ga0207675_100036832 3300026118 Bacteria 4563
915 Ga0207675_100080175 3300026118 Bacteria 3060
916 Ga0207675_100163980 3300026118 Bacteria 2121
917 Ga0207675_100176419 3300026118 Bacteria 2045
918 Ga0207675_100218140 3300026118 Bacteria 1837
919 Ga0207683_10000012 3300026121 Bacteria 134768
920 Ga0207683_10000189 3300026121 Bacteria 52818
921 Ga0207683_10001281 3300026121 Bacteria 22746
922 Ga0207683_10006699 3300026121 Bacteria 9854
923 Ga0207683_10012093 3300026121 Bacteria 7366
924 Ga0207683_10023822 3300026121 Bacteria 5266
925 Ga0207683_10066050 3300026121 Bacteria 3190
926 Ga0207683_10099612 3300026121 Bacteria 2594
927 Ga0207683_10100283 3300026121 Bacteria 2585
928 Ga0207683_10125895 3300026121 Bacteria 2303
929 Ga0207698_10005671 3300026142 Bacteria 7733
930 Ga0207698_10012586 3300026142 Bacteria 5543
931 Ga0207698_10038365 3300026142 Bacteria 3539
932 Ga0207698_10076080 3300026142 Bacteria 2685
933 Ga0207698_10162137 3300026142 Bacteria 1957
934 Ga0209389_1004459 3300027296 Bacteria 11670
935 Ga0209371_1000145 3300027312 Bacteria 116135
936 Ga0209981_1002185 3300027378 Bacteria 2490
937 Ga0209996_1004197 3300027395 Bacteria 1828
938 Ga0209179_1000079 3300027512 Bacteria 15586
939 Ga0209968_1000396 3300027526 Bacteria 7091
940 Ga0209999_1004658 3300027543 Bacteria 2460
941 Ga0209970_1000712 3300027614 Bacteria 5781
942 Ga0209971_1001455 3300027682 Bacteria 5882
943 Ga0209966_1000155 3300027695 Bacteria 28831
944 Ga0209974_10028031 3300027876 Bacteria 1864
945 Ga0207428_10000206 3300027907 Bacteria 82022
946 Ga0207428_10000781 3300027907 Bacteria 36098
947 Ga0207428_10004733 3300027907 Bacteria 12873
948 Ga0207428_10058536 3300027907 Bacteria 3057
949 Ga0207428_10087624 3300027907 Bacteria 2422
950 Ga0207428_10103124 3300027907 Bacteria 2202
951 Ga0268266_10014553 3300028379 Bacteria 6759
952 Ga0268266_10069243 3300028379 Bacteria 3057
953 Ga0268265_10002776 3300028380 Bacteria 12916
954 Ga0268265_10007574 3300028380 Bacteria 7326
955 Ga0268265_10008051 3300028380 Bacteria 7119
956 Ga0268265_10025215 3300028380 Bacteria 4217
957 Ga0268265_10048832 3300028380 Bacteria 3179
958 Ga0268265_10080832 3300028380 Bacteria 2564
959 Ga0268264_10008321 3300028381 Bacteria 8623
960 Ga0268264_10012087 3300028381 Bacteria 7107
961 Ga0268264_10025624 3300028381 Bacteria 4818
962 Ga0268264_10029108 3300028381 Bacteria 4523
963 Ga0268264_10035972 3300028381 Bacteria 4077
964 Ga0268264_10051083 3300028381 Bacteria 3444
965 Ga0268264_10054992 3300028381 Bacteria 3325
966 Ga0268264_10071659 3300028381 Bacteria 2937
967 Ga0268264_10080337 3300028381 Bacteria 2784
968 Ga0268264_10113692 3300028381 Bacteria 2375
969 Ga0268264_10173594 3300028381 Bacteria 1952
970 Ga0268264_10174429 3300028381 Bacteria 1947
971 Ga0307517_10009075 3300028786 Bacteria 14168
972 Ga0307515_10000049 3300028794 Bacteria 278611
973 Ga0307515_10028979 3300028794 Bacteria 9381
974 Ga0307515_10038957 3300028794 Bacteria 7579
975 Ga0307515_10040590 3300028794 Bacteria 7353
976 Ga0307515_10087372 3300028794 Bacteria 3958
977 Ga0307515_10116869 3300028794 Bacteria 3058
978 Ga0307515_10128687 3300028794 Bacteria 2806
979 Ga0268256_1000128 3300030500 Bacteria 108651
980 Ga0265330_10001082 3300031235 Bacteria 16406
981 Ga0265332_10004366 3300031238 Bacteria 6650
982 Ga0265332_10024712 3300031238 Bacteria 2641
983 Ga0265328_10007375 3300031239 Bacteria 4586
984 Ga0265329_10001186 3300031242 Bacteria 12780
985 Ga0265331_10000350 3300031250 Bacteria 48905
986 Ga0265327_10054342 3300031251 Bacteria 2073
987 Ga0307513_10000130 3300031456 Bacteria 106451
988 Ga0307513_10004164 3300031456 Bacteria 19364
989 Ga0307513_10017129 3300031456 Bacteria 8703
990 Ga0307513_10048959 3300031456 Bacteria 4581
991 Ga0307513_10078883 3300031456 Bacteria 3404
992 Ga0307513_10090900 3300031456 Bacteria 3112
993 Ga0307513_10159648 3300031456 Bacteria 2149
994 Ga0307509_10000092 3300031507 Bacteria 124019
995 Ga0307509_10002037 3300031507 Bacteria 33298
996 Ga0307509_10031330 3300031507 Bacteria 5872
997 Ga0307509_10067822 3300031507 Bacteria 3735
998 Ga0307408_100002928 3300031548 Bacteria 11829
999 Ga0307408_100008532 3300031548 Bacteria 6766
1000 Ga0307408_100028855 3300031548 Bacteria 3838
1001 Ga0307408_100032521 3300031548 Bacteria 3638
1002 Ga0307508_10001131 3300031616 Bacteria 30761
1003 Ga0307508_10003490 3300031616 Bacteria 15867
1004 Ga0307508_10183344 3300031616 Bacteria 1696
1005 Ga0307514_10098191 3300031649 Bacteria 2111
1006 Ga0265314_10007574 3300031711 Bacteria 9407
1007 Ga0265342_10059656 3300031712 Bacteria 2253
1008 Ga0307516_10000921 3300031730 Bacteria 40429
1009 Ga0307516_10084089 3300031730 Bacteria 3022
1010 Ga0307405_10001511 3300031731 Bacteria 9852
1011 Ga0307405_10002697 3300031731 Bacteria 7925
1012 Ga0307405_10003255 3300031731 Bacteria 7411
1013 Ga0307405_10010341 3300031731 Bacteria 4828
1014 Ga0307413_10025501 3300031824 Bacteria 3241
1015 Ga0307413_10028680 3300031824 Bacteria 3104
1016 Ga0307410_10000988 3300031852 Bacteria 12259
1017 Ga0307410_10001960 3300031852 Bacteria 9666
1018 Ga0307406_10003971 3300031901 Bacteria 8041
1019 Ga0307406_10027934 3300031901 Bacteria 3405
1020 Ga0307406_10034955 3300031901 Bacteria 3087
1021 Ga0307406_10040728 3300031901 Bacteria 2890
1022 Ga0307406_10046752 3300031901 Bacteria 2724
1023 Ga0307407_10001283 3300031903 Bacteria 8965
1024 Ga0307412_10001820 3300031911 Bacteria 11804
1025 Ga0307412_10135456 3300031911 Bacteria 1796
1026 Ga0307409_100000467 3300031995 Bacteria 17264
1027 Ga0307409_100002217 3300031995 Bacteria 10044
1028 Ga0307409_100004831 3300031995 Bacteria 7651
1029 Ga0307409_100071573 3300031995 Bacteria 2758
1030 Ga0307416_100007807 3300032002 Bacteria 6839
1031 Ga0307416_100009729 3300032002 Bacteria 6313
1032 Ga0307416_100015808 3300032002 Bacteria 5224
1033 Ga0307416_100019906 3300032002 Bacteria 4771
1034 Ga0307416_100071548 3300032002 Bacteria 2882
1035 Ga0307416_100080731 3300032002 Bacteria 2747
1036 Ga0307414_10124632 3300032004 Bacteria 1988
1037 Ga0307411_10012027 3300032005 Bacteria 4701
1038 Ga0307411_10070410 3300032005 Bacteria 2367
1039 Ga0307415_100007103 3300032126 Bacteria 6098
1040 Ga0307415_100009800 3300032126 Bacteria 5393
1041 Ga0307415_100026213 3300032126 Bacteria 3673
1042 Ga0307510_10001210 3300033180 Bacteria 27978
1043 Ga0307510_10022939 3300033180 Bacteria 7239
1044 Ga0373928_0003384 3300035084 Bacteria 3040
1045 Ga0373946_0014842 3300035171 Bacteria 2944
1046 Ga0373955_0063707 3300035172 Bacteria 2042
1047 Ga0373924_0008893 3300035410 Bacteria 3666
1048 Ga0373931_0018365 3300035691 Bacteria 3478
1049 Ga0373931_0078560 3300035691 Bacteria 1816
1050 Ga0373935_0008119 3300035692 Bacteria 6292
1051 Ga0373927_0040515 3300035695 Bacteria 3021
1052 Ga0373947_0016263 3300035725 Bacteria 4276
1053 Ga0373947_0082902 3300035725 Bacteria 1988
1054 Ga0373937_0007414 3300036401 Bacteria 9496
1055 Ga0373937_0011810 3300036401 Bacteria 7667
1056 Ga0373937_0068068 3300036401 Bacteria 3282
1057 Ga0373937_0116588 3300036401 Bacteria 2487
1058 Ga0373925_0011541 3300037068 Bacteria 6393
1059 Ga0373925_0031520 3300037068 Bacteria 3897
1060 Ga0373925_0039429 3300037068 Bacteria 3494
1061 Ga0395900_0045834 3300037418 Bacteria 4503
1062 Ga0395900_0058900 3300037418 Bacteria 3954
1063 Ga0395900_0268736 3300037418 Bacteria 1701
1064 Ga0395898_0047369 3300037466 Bacteria 4219
1065 Ga0395905_0000047 3300037471 Bacteria 237582
1066 Ga0395905_0000057 3300037471 Bacteria 203452
1067 Ga0395905_0000167 3300037471 Bacteria 107775
1068 Ga0395905_0001267 3300037471 Bacteria 31206
1069 Ga0395905_0020959 3300037471 Bacteria 6189
1070 Ga0395905_0024202 3300037471 Bacteria 5731
1071 Ga0395905_0037040 3300037471 Bacteria 4581
1072 Ga0395901_0112026 3300038443 Bacteria 2866
1073 Ga0436365_0960063 3300039437 Bacteria 4068
1074 Ga0436365_1841312 3300039437 Bacteria 9531
1075 Ga0436360_0938195 3300039438 Bacteria 1941
1076 Ga0436363_0008183 3300039450 Bacteria 2855
1077 Ga0436363_0510015 3300039450 Bacteria 4081
1078 Ga0439447_000273 3300041407 Bacteria 18219
1079 Ga0439453_0001473 3300041408 Bacteria 3036
1080 Ga0439443_000225 3300042003 Bacteria 4335
1081 Ga0439459_0013332 3300042438 Bacteria 1478
1082 Ga0439464_0004023 3300042439 Bacteria 3742
1083 Ga0451577_0003798 3300042876 Bacteria 16437
1084 Ga0451577_0005487 3300042876 Bacteria 12985
1085 Ga0451577_0006202 3300042876 Bacteria 11997
1086 Ga0451577_0054128 3300042876 Bacteria 3582
1087 Ga0451577_0060282 3300042876 Bacteria 3383
1088 Ga0451577_0130547 3300042876 Bacteria 2253
1089 Ga0466969_0004149 3300044656 Bacteria 7694
1090 Ga0466977_0009695 3300044666 Bacteria 5437
1091 Ga0453683_0066816 3300044673 Bacteria 2247
1092 Ga0466961_0019037 3300044693 Bacteria 4417
1093 Ga0453684_0074538 3300044712 Bacteria 4271
1094 Ga0453684_0136057 3300044712 Bacteria 2942
1095 Ga0453684_0368506 3300044712 Bacteria 1615
1096 Ga0466959_0007477 3300045049 Bacteria 7668
1097 Ga0451576_0002691 3300045051 Bacteria 25879
1098 Ga0451576_0013845 3300045051 Bacteria 9011
1099 Ga0451576_0078120 3300045051 Bacteria 3445
1100 Ga0451576_0115595 3300045051 Bacteria 2793
1101 Ga0451576_0173239 3300045051 Bacteria 2252
1102 Ga0495627_004628 3300046453 Bacteria 5707
1103 Ga0495592_0000413 3300046454 Bacteria 32677
1104 Ga0495592_0058453 3300046454 Bacteria 2844
1105 Ga0495592_0099604 3300046454 Bacteria 2073
1106 Ga0495603_0017236 3300046455 Bacteria 4372
1107 Ga0495629_0000020 3300046459 Bacteria 155818
1108 Ga0495629_0000042 3300046459 Bacteria 112605
1109 Ga0495629_0001082 3300046459 Bacteria 21638
1110 Ga0495629_0012741 3300046459 Bacteria 6087
1111 Ga0495629_0039444 3300046459 Bacteria 3324
1112 Ga0495638_0014812 3300046460 Bacteria 5258
1113 Ga0495638_0016411 3300046460 Bacteria 4960
1114 Ga0495651_0003918 3300046462 Bacteria 11381
1115 Ga0495651_0041791 3300046462 Bacteria 3561
1116 Ga0495653_0000321 3300046463 Bacteria 39085
1117 Ga0495653_0000388 3300046463 Bacteria 35251
1118 Ga0495653_0004554 3300046463 Bacteria 11203
1119 Ga0495650_0022112 3300046471 Bacteria 3056
1120 Ga0495580_0000022 3300046472 Bacteria 89749
1121 Ga0495580_0000355 3300046472 Bacteria 37382
1122 Ga0495580_0000357 3300046472 Bacteria 37302
1123 Ga0495580_0000527 3300046472 Bacteria 32321
1124 Ga0495580_0005233 3300046472 Bacteria 10781
1125 Ga0495580_0006761 3300046472 Bacteria 9299
1126 Ga0495580_0045155 3300046472 Bacteria 3130
1127 Ga0495580_0056957 3300046472 Bacteria 2751
1128 Ga0495582_0000803 3300046473 Bacteria 17428
1129 Ga0495582_0041840 3300046473 Bacteria 2524
1130 Ga0495582_0057192 3300046473 Bacteria 2150
1131 Ga0495605_0003499 3300046474 Bacteria 9338
1132 Ga0495605_0036748 3300046474 Bacteria 2467
1133 Ga0495662_0017399 3300046476 Bacteria 3479
1134 Ga0495664_0059308 3300046477 Bacteria 2277
1135 Ga0495594_0031581 3300046499 Bacteria 2872
1136 Ga0495594_0044741 3300046499 Bacteria 2429
1137 Ga0495583_0019594 3300046506 Bacteria 3527
1138 Ga0495583_0032370 3300046506 Bacteria 2524
1139 Ga0495606_0037544 3300046507 Bacteria 3289
1140 Ga0495608_0004039 3300046511 Bacteria 10532
1141 Ga0495618_0000764 3300046514 Bacteria 22494
1142 Ga0495618_0009666 3300046514 Bacteria 5822
1143 Ga0495620_0005754 3300046515 Bacteria 6888
1144 Ga0495620_0035360 3300046515 Bacteria 2247
1145 Ga0495628_0002401 3300046516 Bacteria 16892
1146 Ga0495628_0004370 3300046516 Bacteria 12536
1147 Ga0495628_0007611 3300046516 Bacteria 9360
1148 Ga0495628_0010826 3300046516 Bacteria 7722
1149 Ga0495628_0018544 3300046516 Bacteria 5761
1150 Ga0495628_0063419 3300046516 Bacteria 2895
1151 Ga0495628_0077324 3300046516 Bacteria 2589
1152 Ga0495630_0003094 3300046517 Bacteria 11541
1153 Ga0495630_0012684 3300046517 Bacteria 6124
1154 Ga0495630_0016330 3300046517 Bacteria 5423
1155 Ga0495630_0111536 3300046517 Bacteria 2071
1156 Ga0495632_0028648 3300046519 Bacteria 2905
1157 Ga0495648_0002871 3300046524 Bacteria 15523
1158 Ga0495648_0032508 3300046524 Bacteria 3421
1159 Ga0495648_0055057 3300046524 Bacteria 2399
1160 Ga0495666_0000243 3300046526 Bacteria 23496
1161 Ga0495652_0007905 3300046529 Bacteria 9763
1162 Ga0495654_0001492 3300046530 Bacteria 16011
1163 Ga0495654_0007291 3300046530 Bacteria 6192
1164 Ga0495654_0026124 3300046530 Bacteria 3005
1165 Ga0495665_0004168 3300046531 Bacteria 7796
1166 Ga0495665_0032218 3300046531 Bacteria 2803
1167 Ga0495640_0016325 3300046533 Bacteria 5557
1168 Ga0495587_0007176 3300046536 Bacteria 7232
1169 Ga0495597_0000109 3300046542 Bacteria 73193
1170 Ga0495645_0000691 3300046543 Bacteria 23175
1171 Ga0495645_0016092 3300046543 Bacteria 5333
1172 Ga0495645_0025940 3300046543 Bacteria 4255
1173 Ga0495645_0039588 3300046543 Bacteria 3438
1174 Ga0495645_0113845 3300046543 Bacteria 1912
1175 Ga0495622_0011113 3300046557 Bacteria 4155
1176 Ga0495656_0000073 3300046615 Bacteria 44754
1177 Ga0495656_0005404 3300046615 Bacteria 4409
1178 Ga0495668_0001832 3300046616 Bacteria 19226
1179 Ga0495634_0000449 3300046642 Bacteria 40909
1180 Ga0495611_0014066 3300046648 Bacteria 3414
1181 Ga0495625_0000336 3300046660 Bacteria 71606
1182 Ga0495625_0031340 3300046660 Bacteria 3957
1183 Ga0495635_0001225 3300046663 Bacteria 17164
1184 Ga0495635_0062897 3300046663 Bacteria 2548
1185 Ga0495661_0009270 3300046665 Bacteria 6761
1186 Ga0495588_0005333 3300046674 Bacteria 5717
1187 Ga0495588_0008426 3300046674 Bacteria 4732
1188 Ga0495588_0010894 3300046674 Bacteria 4250
1189 Ga0495657_0089713 3300046675 Bacteria 1974
1190 Ga0495599_0000731 3300046678 Bacteria 18528
1191 Ga0495599_0003001 3300046678 Bacteria 9830
1192 Ga0495599_0009689 3300046678 Bacteria 5894
1193 Ga0495623_0010970 3300046679 Bacteria 5863
1194 Ga0495623_0029621 3300046679 Bacteria 3522
1195 Ga0495623_0054742 3300046679 Bacteria 2516
1196 Ga0495646_0000273 3300046680 Bacteria 26278
1197 Ga0495646_0000495 3300046680 Bacteria 21056
1198 Ga0495646_0003800 3300046680 Bacteria 9442
1199 Ga0495647_0027804 3300046681 Bacteria 2081
1200 Ga0495658_0071811 3300046683 Bacteria 2012
1201 Ga0495613_0054111 3300046689 Bacteria 2951
1202 Ga0495624_0000216 3300046690 Bacteria 44450
1203 Ga0495624_0000591 3300046690 Bacteria 28234
1204 Ga0495624_0005260 3300046690 Bacteria 9344
1205 Ga0495624_0046993 3300046690 Bacteria 2743
1206 Ga0495671_0003854 3300046692 Bacteria 9116
1207 Ga0495600_0000574 3300046809 Bacteria 19018
1208 Ga0495600_0071242 3300046809 Bacteria 2271
1209 Ga0495581_0000200 3300047315 Bacteria 27892
1210 Ga0495581_0004525 3300047315 Bacteria 8034
1211 Ga0495604_0001161 3300047317 Bacteria 21748
1212 Ga0495604_0001825 3300047317 Bacteria 17340
1213 Ga0495604_0006351 3300047317 Bacteria 9372
1214 Ga0495674_0027772 3300047319 Bacteria 5167
1215 Ga0495674_0052470 3300047319 Bacteria 3588
1216 Ga0495674_0115719 3300047319 Bacteria 2269
1217 Ga0495674_0120152 3300047319 Bacteria 2220
1218 Ga0495674_0127841 3300047319 Bacteria 2142
1219 Ga0495672_0113394 3300047320 Bacteria 1452
1220 Ga0495676_0014537 3300047321 Bacteria 7042
1221 Ga0495676_0134445 3300047321 Bacteria 1781
1222 Ga0495680_0001617 3300047322 Bacteria 23953
1223 Ga0495683_0010201 3300047323 Bacteria 4974
1224 Ga0495687_001245 3300047443 Bacteria 24266
1225 Ga0495687_011843 3300047443 Bacteria 4658
1226 Ga0495687_016528 3300047443 Bacteria 3709
1227 Ga0495675_0031568 3300047444 Bacteria 3381
1228 Ga0495679_000022 3300047446 Bacteria 215296
1229 Ga0495679_000023 3300047446 Bacteria 209366
1230 Ga0495684_0015873 3300047471 Bacteria 5798
1231 Ga0495686_0002020 3300047472 Bacteria 20040
1232 Ga0495593_0005313 3300047673 Bacteria 7612
1233 Ga0495593_0010132 3300047673 Bacteria 5454
1234 Ga0495593_0042654 3300047673 Bacteria 2434
1235 Ga0495602_0022700 3300048088 Bacteria 6136
1236 Ga0495602_0081917 3300048088 Bacteria 2710
1237 Ga0495626_0013149 3300048091 Bacteria 4312
1238 Ga0496100_0005628 3300048903 Bacteria 6770
1239 Ga0496101_0001603 3300048904 Bacteria 13608
1240 Ga0496101_0001874 3300048904 Bacteria 12700
1241 Ga0496101_0001982 3300048904 Bacteria 12422
1242 Ga0496101_0015940 3300048904 Bacteria 5070
1243 Ga0496102_0000134 3300048905 Bacteria 101631
1244 Ga0496102_0001296 3300048905 Bacteria 22482
1245 Ga0496102_0019884 3300048905 Bacteria 5921
1246 Ga0496102_0034159 3300048905 Bacteria 4573
1247 Ga0496102_0097188 3300048905 Bacteria 2731
1248 Ga0496102_0150641 3300048905 Bacteria 2186
1249 Ga0496102_0202635 3300048905 Bacteria 1870
1250 Ga0496103_0008446 3300048906 Bacteria 6117
1251 Ga0496103_0018691 3300048906 Bacteria 4158
1252 Ga0496104_0015582 3300048907 Bacteria 6889
1253 Ga0496104_0019309 3300048907 Bacteria 6233
1254 Ga0496104_0028189 3300048907 Bacteria 5204
1255 Ga0496104_0031984 3300048907 Bacteria 4895
1256 Ga0496104_0147391 3300048907 Bacteria 2260
1257 Ga0496105_0001714 3300048908 Bacteria 15656
1258 Ga0496105_0001879 3300048908 Bacteria 15072
1259 Ga0496105_0012490 3300048908 Bacteria 6724
1260 Ga0496105_0043715 3300048908 Bacteria 3695
1261 Ga0496106_0014091 3300048909 Bacteria 5908
1262 Ga0496106_0016853 3300048909 Bacteria 5407
1263 Ga0496106_0021059 3300048909 Bacteria 4840
1264 Ga0496106_0035476 3300048909 Bacteria 3729
1265 Ga0496106_0139713 3300048909 Bacteria 1905
1266 Ga0496107_0034910 3300048910 Bacteria 3604
1267 Ga0496107_0049028 3300048910 Bacteria 3043
1268 Ga0496107_0100942 3300048910 Bacteria 2116
1269 Ga0496108_0000794 3300048911 Bacteria 24612
1270 Ga0496108_0003455 3300048911 Bacteria 12673
1271 Ga0496108_0031647 3300048911 Bacteria 4390
1272 Ga0496109_0004794 3300048912 Bacteria 11294
1273 Ga0496109_0043374 3300048912 Bacteria 4077
1274 Ga0496109_0119878 3300048912 Bacteria 2450
1275 Ga0496109_0123688 3300048912 Bacteria 2411
1276 Ga0496110_0000815 3300048913 Bacteria 21835
1277 Ga0496110_0012905 3300048913 Bacteria 6888
1278 Ga0496110_0034532 3300048913 Bacteria 4381
1279 Ga0496110_0082986 3300048913 Bacteria 2858
1280 Ga0496110_0238846 3300048913 Bacteria 1653
1281 Ga0496111_0015150 3300048914 Bacteria 5284
1282 Ga0496111_0037061 3300048914 Bacteria 3489
1283 Ga0496112_0028019 3300048915 Bacteria 5434
1284 Ga0496112_0050856 3300048915 Bacteria 4064
1285 Ga0496113_0076740 3300048916 Bacteria 2553
1286 Ga0496113_0128587 3300048916 Bacteria 1986
1287 Ga0496114_0022351 3300048917 Bacteria 5154
1288 Ga0496114_0102079 3300048917 Bacteria 2450
1289 Ga0496114_0107069 3300048917 Bacteria 2392
1290 Ga0496116_0000503 3300048919 Bacteria 53433
1291 Ga0496116_0038047 3300048919 Bacteria 3346
1292 Ga0496118_0001420 3300048921 Bacteria 36121
1293 Ga0496118_0032105 3300048921 Bacteria 4336
1294 Ga0496118_0042544 3300048921 Bacteria 3582
1295 Ga0496118_0043723 3300048921 Bacteria 3517
1296 Ga0496119_0015463 3300048922 Bacteria 5872
1297 Ga0496121_0006720 3300048924 Bacteria 14120
1298 Ga0496121_0013264 3300048924 Bacteria 8874
1299 Ga0496124_0066277 3300048927 Bacteria 3007
1300 Ga0496125_0005958 3300048928 Bacteria 13344
1301 Ga0496126_0000414 3300048929 Bacteria 86330
1302 Ga0496126_0112018 3300048929 Bacteria 2376
1303 Ga0501032_0001833 3300049569 Bacteria 16806
1304 Ga0501033_0008938 3300049570 Bacteria 7737
1305 Ga0501034_0000875 3300049571 Bacteria 44296
1306 Ga0501034_0008902 3300049571 Bacteria 10548
1307 Ga0501034_0064231 3300049571 Bacteria 3685
1308 Ga0501036_0023251 3300049572 Bacteria 5219
1309 Ga0501037_0005118 3300049573 Bacteria 9537
1310 Ga0501038_0001970 3300049574 Bacteria 18956
1311 Ga0501038_0050477 3300049574 Bacteria 3594
1312 Ga0501039_0001598 3300049575 Bacteria 16684
1313 Ga0501040_0009684 3300049576 Bacteria 6291
1314 Ga0501041_0003172 3300049577 Bacteria 9459
1315 Ga0501041_0014118 3300049577 Bacteria 4740
1316 Ga0501042_0013253 3300049578 Bacteria 5612
1317 Ga0501043_0000059 3300049579 Bacteria 101444
1318 Ga0501043_0000364 3300049579 Bacteria 40997
1319 Ga0501043_0028562 3300049579 Bacteria 4379
1320 Ga0501046_0000082 3300049580 Bacteria 101313
1321 Ga0501046_0000867 3300049580 Bacteria 29435
1322 Ga0501047_0000050 3300049581 Bacteria 155628
1323 Ga0501047_0002160 3300049581 Bacteria 18806
1324 Ga0501047_0025367 3300049581 Bacteria 5698
1325 Ga0501048_0007107 3300049582 Bacteria 8505
1326 Ga0501067_0001425 3300049583 Bacteria 12977
1327 Ga0501069_0003379 3300049585 Bacteria 8191
1328 Ga0501069_0011483 3300049585 Bacteria 4692
1329 Ga0501070_0001480 3300049586 Bacteria 21020
1330 Ga0501070_0001836 3300049586 Bacteria 18720
1331 Ga0501070_0117916 3300049586 Bacteria 2193
1332 Ga0501072_0013754 3300049588 Bacteria 6195
1333 Ga0501072_0126112 3300049588 Bacteria 2040
1334 Ga0501073_0000067 3300049589 Bacteria 64981
1335 Ga0501073_0000620 3300049589 Bacteria 25004
1336 Ga0501073_0010743 3300049589 Bacteria 6704
1337 Ga0501074_0000588 3300049590 Bacteria 22586
1338 Ga0501074_0021833 3300049590 Bacteria 4647
1339 Ga0501074_0055534 3300049590 Bacteria 2854
1340 Ga0501075_0039065 3300049591 Bacteria 3551
1341 Ga0501076_0070867 3300049592 Bacteria 2787
1342 Ga0501079_0009324 3300049741 Bacteria 7438
1343 Ga0501080_0001874 3300049742 Bacteria 18084
1344 Ga0501080_0031615 3300049742 Bacteria 4932
1345 Ga0501080_0034930 3300049742 Bacteria 4694
1346 Ga0501080_0050436 3300049742 Bacteria 3873
1347 Ga0501080_0075888 3300049742 Bacteria 3126
1348 Ga0501080_0173142 3300049742 Bacteria 1990
1349 Ga0501081_0004799 3300049743 Bacteria 8689
1350 Ga0501083_0000515 3300049744 Bacteria 24650
1351 Ga0501083_0006601 3300049744 Bacteria 8232
1352 Ga0501083_0010787 3300049744 Bacteria 6426
1353 Ga0501035_0006788 3300049822 Bacteria 10695
1354 Ga0501035_0056178 3300049822 Bacteria 3513
1355 Ga0501044_0009350 3300049823 Bacteria 10688
1356 Ga0501044_0039230 3300049823 Bacteria 4941
1357 Ga0501045_0005237 3300049824 Bacteria 8974
1358 Ga0501045_0011333 3300049824 Bacteria 6259
1359 Ga0501045_0057126 3300049824 Bacteria 2855
1360 nmdc:mga00v17_58158_c1 3300050491 Bacteria 2367
1361 nmdc:mga0yw44_36343_c1 3300050492 Bacteria 2902
1362 nmdc:mga0k408_19005_c1 3300050493 Bacteria 3836
1363 nmdc:mga0k408_7246_c1 3300050493 Bacteria 5928
1364 nmdc:mga0k408_9560_c1 3300050493 Bacteria 5231
1365 nmdc:mga07m45_12057_c1 3300050496 Bacteria 4559
1366 nmdc:mga07m45_16737_c1 3300050496 Bacteria 3928
1367 nmdc:mga07m45_75490_c1 3300050496 Bacteria 1921
1368 nmdc:mga0qj67_95097_c1 3300050509 Bacteria 2398
1369 nmdc:mga06r32_1173_c1 3300050510 Bacteria 23604
1370 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
1371 nmdc:mga08y16_215245_c1 3300050511 Bacteria 1989
1372 nmdc:mga08y16_2283_c1 3300050511 Bacteria 19654
1373 nmdc:mga08y16_24582_c1 3300050511 Bacteria 6357
1374 nmdc:mga08y16_58737_c1 3300050511 Bacteria 4019
1375 nmdc:mga0n895_108765_c1 3300050512 Bacteria 2787
1376 nmdc:mga0n895_131858_c1 3300050512 Bacteria 2524
1377 nmdc:mga0n895_43955_c1 3300050512 Bacteria 4356
1378 nmdc:mga0n895_95941_c1 3300050512 Bacteria 2970
1379 nmdc:mga0rr50_48425_c1 3300050513 Bacteria 3141
1380 nmdc:mga08x19_16319_c1 3300050514 Bacteria 4527
1381 nmdc:mga08x19_23730_c1 3300050514 Bacteria 3806
1382 nmdc:mga0a205_1477_c1 3300050515 Bacteria 15134
1383 nmdc:mga0a205_20144_c1 3300050515 Bacteria 6293
1384 nmdc:mga0a205_40982_c1 3300050515 Bacteria 4459
1385 Ga0495601_0008116 3300053077 Bacteria 6191
1386 Ga0495619_0044616 3300053085 Bacteria 2910
1387 Ga0500578_0109622 3300053086 Bacteria 1741
1388 Ga0500643_021945 3300053087 Bacteria 2063
1389 Ga0500644_0037720 3300053088 Bacteria 1582
1390 Ga0500646_0027016 3300053090 Bacteria 1559
1391 Ga0500651_0000040 3300053093 Bacteria 92649
1392 Ga0500651_0013116 3300053093 Bacteria 5039
1393 Ga0500566_0050220 3300053094 Bacteria 2389
1394 Ga0500641_0043206 3300053096 Bacteria 1829
1395 Ga0500562_004410 3300053108 Bacteria 3561
1396 Ga0500571_000030 3300053110 Bacteria 47663
1397 Ga0500572_011206 3300053111 Bacteria 2162
1398 Ga0500592_004646 3300053116 Bacteria 2183
1399 Ga0500593_000168 3300053117 Bacteria 26386
1400 Ga0500593_000252 3300053117 Bacteria 21954
1401 Ga0500595_001190 3300053119 Bacteria 14365
1402 Ga0500642_0002005 3300053130 Bacteria 5906
1403 Ga0500642_0038289 3300053130 Bacteria 2054
1404 Ga0500655_000797 3300053133 Bacteria 6194
1405 Ga0500559_0000017 3300053136 Bacteria 143646
1406 Ga0500564_035954 3300053138 Bacteria 2286
1407 Ga0500568_0003326 3300053139 Bacteria 9045
1408 Ga0500574_002682 3300053141 Bacteria 2984
1409 Ga0500574_003369 3300053141 Bacteria 2814
1410 Ga0500604_0001284 3300053151 Bacteria 7030
1411 Ga0500616_0003059 3300053153 Bacteria 13150
1412 Ga0500622_0002180 3300053156 Bacteria 14473
1413 Ga0500627_0005829 3300053158 Bacteria 4130
1414 Ga0500634_0009019 3300053161 Bacteria 5017
1415 Ga0500645_000151 3300053730 Bacteria 54244
1416 Ga0500645_000242 3300053730 Bacteria 40854
1417 Ga0500645_000333 3300053730 Bacteria 33591
1418 Ga0500645_000991 3300053730 Bacteria 16014
1419 Ga0500645_001359 3300053730 Bacteria 12598
1420 Ga0500645_009566 3300053730 Bacteria 3250
1421 Ga0501084_0110025 3300054114 Bacteria 2315
1422 Ga0500661_000506 3300055283 Bacteria 7251
1423 Ga0590075_018559 3300059424 Bacteria 1721
1424 Ga0501082_0001879 3300060353 Bacteria 18478
1425 Ga0530510_0003494 3300061734 Bacteria 10800

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0368506 Ga0453684_0368506_375_1601 408
2 iso_pu_bacteria 2928084124 2928090891 432
3 3300005334 Ga0068869_100069803 Ga0068869_1000698031 438
4 3300046679 Ga0495623_0029621 Ga0495623_0029621_1482_2822 438
5 3300035172 Ga0373955_0063707 Ga0373955_0063707_23_1348 440
6 3300049586 Ga0501070_0117916 Ga0501070_0117916_445_1779 444
7 3300053077 Ga0495601_0008116 Ga0495601_0008116_3706_5157 446
8 3300025228 Ga0209672_100041 Ga0209672_100041250 447
9 3300025229 Ga0209147_100226 Ga0209147_10022625 447
10 3300025242 Ga0209258_100309 Ga0209258_10030952 447
11 3300035171 Ga0373946_0014842 Ga0373946_0014842_203_1567 447
12 3300042876 Ga0451577_0006202 Ga0451577_0006202_1970_3409 448
13 3300013306 Ga0163162_10288563 Ga0163162_102885631 449
14 3300025942 Ga0207689_10070772 Ga0207689_100707722 449
15 3300005339 Ga0070660_100000040 Ga0070660_10000004044 450
16 3300005366 Ga0070659_100000335 Ga0070659_10000033529 450
17 3300005455 Ga0070663_100000273 Ga0070663_10000027322 450
18 3300005614 Ga0068856_100129036 Ga0068856_1001290362 450
19 3300005842 Ga0068858_100171609 Ga0068858_1001716091 450
20 3300009093 Ga0105240_10160746 Ga0105240_101607462 450
21 3300010375 Ga0105239_10040067 Ga0105239_100400673 450
22 3300025914 Ga0207671_10036072 Ga0207671_100360722 450
23 3300025919 Ga0207657_10000044 Ga0207657_1000004460 450
24 3300025924 Ga0207694_10046669 Ga0207694_100466692 450
25 3300025932 Ga0207690_10000046 Ga0207690_1000004660 450
26 3300025949 Ga0207667_10004665 Ga0207667_100046658 450
27 3300026035 Ga0207703_10137291 Ga0207703_101372911 450
28 3300026067 Ga0207678_10000286 Ga0207678_1000028613 450
29 3300053730 Ga0500645_000151 Ga0500645_000151_43549_45003 450
30 3300005364 Ga0070673_100046988 Ga0070673_1000469882 451
31 3300005618 Ga0068864_100061160 Ga0068864_1000611602 451
32 3300025925 Ga0207650_10064654 Ga0207650_100646542 451
33 3300025940 Ga0207691_10135538 Ga0207691_101355382 451
34 3300001989 JGI24739J22299_10002041 JGI24739J22299_100020415 452
35 3300005327 Ga0070658_10175530 Ga0070658_101755301 452
36 3300005547 Ga0070693_100001435 Ga0070693_1000014358 452
37 3300025909 Ga0207705_10040679 Ga0207705_100406792 452
38 3300001989 JGI24739J22299_10008446 JGI24739J22299_100084462 453
39 3300009093 Ga0105240_10009642 Ga0105240_1000964211 453
40 3300009545 Ga0105237_10014315 Ga0105237_100143155 453
41 3300025913 Ga0207695_10004412 Ga0207695_1000441212 453
42 3300007788 Ga0099795_10000016 Ga0099795_1000001622 454
43 3300010159 Ga0099796_10000003 Ga0099796_1000000337 454
44 3300027512 Ga0209179_1000079 Ga0209179_10000795 454
45 3300014969 Ga0157376_10122724 Ga0157376_101227242 455
46 3300026088 Ga0207641_10034231 Ga0207641_100342314 455
47 3300031548 Ga0307408_100032521 Ga0307408_1000325212 455
48 3300031731 Ga0307405_10010341 Ga0307405_100103412 455
49 3300031995 Ga0307409_100000467 Ga0307409_10000046714 455
50 3300032002 Ga0307416_100015808 Ga0307416_1000158084 455
51 3300032004 Ga0307414_10124632 Ga0307414_101246322 455
52 3300032126 Ga0307415_100009800 Ga0307415_1000098002 455
53 3300046474 Ga0495605_0003499 Ga0495605_0003499_2810_4216 455
54 3300047446 Ga0495679_000022 Ga0495679_000022_40218_41624 455
55 3300005367 Ga0070667_100027031 Ga0070667_1000270312 456
56 3300005548 Ga0070665_100024149 Ga0070665_1000241495 456
57 3300005841 Ga0068863_100017733 Ga0068863_1000177334 456
58 3300005842 Ga0068858_100094682 Ga0068858_1000946822 456
59 3300005843 Ga0068860_100066238 Ga0068860_1000662382 456
60 3300006237 Ga0097621_100009479 Ga0097621_1000094794 456
61 3300006358 Ga0068871_100004278 Ga0068871_1000042788 456
62 3300009098 Ga0105245_10151766 Ga0105245_101517662 456
63 3300009101 Ga0105247_10031204 Ga0105247_100312043 456
64 3300009177 Ga0105248_10018504 Ga0105248_100185042 456
65 3300013306 Ga0163162_10040591 Ga0163162_100405912 456
66 3300014325 Ga0163163_10001474 Ga0163163_1000147417 456
67 3300014968 Ga0157379_10000796 Ga0157379_1000079623 456
68 3300014969 Ga0157376_10004066 Ga0157376_1000406610 456
69 3300025903 Ga0207680_10048311 Ga0207680_100483112 456
70 3300025941 Ga0207711_10031694 Ga0207711_100316944 456
71 3300026035 Ga0207703_10081322 Ga0207703_100813222 456
72 3300028381 Ga0268264_10025624 Ga0268264_100256242 456
73 3300037418 Ga0395900_0268736 Ga0395900_0268736_299_1678 456
74 3300037471 Ga0395905_0037040 Ga0395905_0037040_888_2267 456
75 3300045051 Ga0451576_0002691 Ga0451576_0002691_14005_15423 456
76 3300048907 Ga0496104_0015582 Ga0496104_0015582_366_1799 456
77 3300048908 Ga0496105_0043715 Ga0496105_0043715_981_2414 456
78 3300048911 Ga0496108_0000794 Ga0496108_0000794_19890_21323 456
79 3300048912 Ga0496109_0004794 Ga0496109_0004794_9022_10455 456
80 3300048913 Ga0496110_0000815 Ga0496110_0000815_4457_5890 456
81 3300048914 Ga0496111_0015150 Ga0496111_0015150_435_1868 456
82 3300048917 Ga0496114_0102079 Ga0496114_0102079_361_1794 456
83 3300009176 Ga0105242_10012520 Ga0105242_100125203 457
84 3300028786 Ga0307517_10009075 Ga0307517_1000907511 458
85 3300031616 Ga0307508_10003490 Ga0307508_100034904 458
86 3300005338 Ga0068868_100112372 Ga0068868_1001123722 460
87 3300006173 Ga0070716_100005715 Ga0070716_1000057152 460
88 3300009551 Ga0105238_10095559 Ga0105238_100955591 460
89 3300025939 Ga0207665_10005952 Ga0207665_100059522 460
90 3300042876 Ga0451577_0005487 Ga0451577_0005487_6297_7736 460
91 3300013306 Ga0163162_10092092 Ga0163162_100920922 461
92 3300025228 Ga0209672_100015 Ga0209672_100015293 461
93 3300025229 Ga0209147_100016 Ga0209147_100016171 461
94 3300025242 Ga0209258_100026 Ga0209258_100026293 461
95 3300025272 Ga0209455_1000510 Ga0209455_10005109 461
96 3300028379 Ga0268266_10069243 Ga0268266_100692432 461
97 3300050491 nmdc:mga00v17_58158_c1 nmdc:mga00v17_58158_c1_384_1781 461
98 3300053096 Ga0500641_0043206 Ga0500641_0043206_132_1529 461
99 3300006844 Ga0075428_100145404 Ga0075428_1001454042 462
100 3300006852 Ga0075433_10033873 Ga0075433_100338734 462
101 3300009094 Ga0111539_10002831 Ga0111539_100028312 462
102 3300014969 Ga0157376_10124279 Ga0157376_101242792 462
103 3300025908 Ga0207643_10083963 Ga0207643_100839632 462
104 3300025936 Ga0207670_10004649 Ga0207670_100046494 462
105 3300025940 Ga0207691_10000699 Ga0207691_100006992 462
106 3300025942 Ga0207689_10053209 Ga0207689_100532093 462
107 3300026116 Ga0207674_10022936 Ga0207674_100229362 462
108 3300027907 Ga0207428_10004733 Ga0207428_100047332 462
109 3300050511 nmdc:mga08y16_24582_c1 nmdc:mga08y16_24582_c1_1699_3093 462
110 3300050515 nmdc:mga0a205_40982_c1 nmdc:mga0a205_40982_c1_2538_3935 462
111 3300005842 Ga0068858_100014101 Ga0068858_1000141016 464
112 3300007265 Ga0099794_10009254 Ga0099794_100092543 464
113 3300009176 Ga0105242_10021186 Ga0105242_100211864 464
114 3300009177 Ga0105248_10015742 Ga0105248_100157424 464
115 3300009551 Ga0105238_10045297 Ga0105238_100452975 464
116 3300025934 Ga0207686_10009754 Ga0207686_100097542 464
117 3300025961 Ga0207712_10198561 Ga0207712_101985611 464
118 3300026035 Ga0207703_10006522 Ga0207703_100065223 464
119 3300003856 Ga0058692_1002848 Ga0058692_10028483 465
120 3300025273 Ga0209673_1000102 Ga0209673_100010249 465
121 3300027312 Ga0209371_1000145 Ga0209371_100014542 465
122 3300030500 Ga0268256_1000128 Ga0268256_100012866 465
123 3300031616 Ga0307508_10001131 Ga0307508_100011316 465
124 3300035695 Ga0373927_0040515 Ga0373927_0040515_901_2334 465
125 3300046472 Ga0495580_0056957 Ga0495580_0056957_950_2383 465
126 3300046473 Ga0495582_0041840 Ga0495582_0041840_1065_2498 465
127 3300046499 Ga0495594_0031581 Ga0495594_0031581_803_2236 465
128 3300046531 Ga0495665_0004168 Ga0495665_0004168_1224_2657 465
129 3300046663 Ga0495635_0062897 Ga0495635_0062897_141_1574 465
130 3300046689 Ga0495613_0054111 Ga0495613_0054111_514_1947 465
131 3300047315 Ga0495581_0004525 Ga0495581_0004525_1590_3023 465
132 3300047471 Ga0495684_0015873 Ga0495684_0015873_4225_5658 465
133 3300053085 Ga0495619_0044616 Ga0495619_0044616_982_2415 465
134 3300002774 JGI25150J39212_1004092 JGI25150J39212_10040923 466
135 3300003187 JGI25151J46595_10021104 JGI25151J46595_100211042 466
136 3300005262 Ga0065165_1020613 Ga0065165_10206132 466
137 3300006177 Ga0075362_10003779 Ga0075362_100037793 466
138 3300025245 Ga0207425_1000606 Ga0207425_100060615 466
139 3300025263 Ga0209565_1000849 Ga0209565_100084910 466
140 3300025284 Ga0209130_1000014 Ga0209130_1000014398 466
141 3300025294 Ga0209025_1010118 Ga0209025_10101184 466
142 3300025294 Ga0209025_1010290 Ga0209025_10102904 466
143 3300025297 Ga0209758_1006824 Ga0209758_10068242 466
144 3300025298 Ga0209050_1003807 Ga0209050_10038078 466
145 3300025302 Ga0207426_1000091 Ga0207426_100009119 466
146 3300031548 Ga0307408_100002928 Ga0307408_1000029285 466
147 3300031901 Ga0307406_10003971 Ga0307406_100039716 466
148 3300044712 Ga0453684_0074538 Ga0453684_0074538_13_1419 466
149 3300053130 Ga0500642_0002005 Ga0500642_0002005_3542_4951 466
150 3300001991 JGI24743J22301_10005128 JGI24743J22301_100051282 467
151 3300002705 JGI25156J39149_1001101 JGI25156J39149_10011018 467
152 3300005518 Ga0070699_100039279 Ga0070699_1000392793 467
153 3300005841 Ga0068863_100022168 Ga0068863_1000221685 467
154 3300005841 Ga0068863_100043139 Ga0068863_1000431393 467
155 3300006175 Ga0070712_100043810 Ga0070712_1000438102 467
156 3300009093 Ga0105240_10037680 Ga0105240_100376802 467
157 3300009093 Ga0105240_10038466 Ga0105240_100384664 467
158 3300009176 Ga0105242_10064030 Ga0105242_100640302 467
159 3300009177 Ga0105248_10021964 Ga0105248_100219643 467
160 3300009177 Ga0105248_10097015 Ga0105248_100970153 467
161 3300009545 Ga0105237_10186713 Ga0105237_101867132 467
162 3300009553 Ga0105249_10111569 Ga0105249_101115692 467
163 3300013104 Ga0157370_10023152 Ga0157370_100231522 467
164 3300013105 Ga0157369_10010470 Ga0157369_100104705 467
165 3300014326 Ga0157380_10030469 Ga0157380_100304692 467
166 3300014968 Ga0157379_10145872 Ga0157379_101458722 467
167 3300025903 Ga0207680_10050192 Ga0207680_100501922 467
168 3300025910 Ga0207684_10028541 Ga0207684_100285413 467
169 3300025919 Ga0207657_10003776 Ga0207657_100037762 467
170 3300025949 Ga0207667_10059600 Ga0207667_100596003 467
171 3300025972 Ga0207668_10126201 Ga0207668_101262012 467
172 3300026041 Ga0207639_10132527 Ga0207639_101325271 467
173 3300026116 Ga0207674_10002996 Ga0207674_100029969 467
174 3300031995 Ga0307409_100071573 Ga0307409_1000715732 467
175 3300035691 Ga0373931_0078560 Ga0373931_0078560_401_1804 467
176 3300035725 Ga0373947_0082902 Ga0373947_0082902_523_1926 467
177 3300036401 Ga0373937_0068068 Ga0373937_0068068_1776_3182 467
178 3300037418 Ga0395900_0045834 Ga0395900_0045834_3060_4463 467
179 3300042438 Ga0439459_0013332 Ga0439459_0013332_55_1461 467
180 3300046459 Ga0495629_0000020 Ga0495629_0000020_85552_86958 467
181 3300046460 Ga0495638_0014812 Ga0495638_0014812_31_1434 467
182 3300046463 Ga0495653_0000388 Ga0495653_0000388_1254_2660 467
183 3300046472 Ga0495580_0000022 Ga0495580_0000022_37433_38839 467
184 3300046472 Ga0495580_0045155 Ga0495580_0045155_1207_2613 467
185 3300046515 Ga0495620_0035360 Ga0495620_0035360_825_2231 467
186 3300046516 Ga0495628_0010826 Ga0495628_0010826_1075_2481 467
187 3300046516 Ga0495628_0077324 Ga0495628_0077324_258_1664 467
188 3300046517 Ga0495630_0012684 Ga0495630_0012684_4520_5926 467
189 3300046517 Ga0495630_0016330 Ga0495630_0016330_3517_4923 467
190 3300046524 Ga0495648_0055057 Ga0495648_0055057_641_2047 467
191 3300046531 Ga0495665_0032218 Ga0495665_0032218_175_1581 467
192 3300046690 Ga0495624_0000591 Ga0495624_0000591_1663_3069 467
193 3300046690 Ga0495624_0046993 Ga0495624_0046993_533_1939 467
194 3300047319 Ga0495674_0120152 Ga0495674_0120152_211_1617 467
195 3300047319 Ga0495674_0127841 Ga0495674_0127841_213_1619 467
196 3300047320 Ga0495672_0113394 Ga0495672_0113394_21_1427 467
197 3300047321 Ga0495676_0134445 Ga0495676_0134445_18_1424 467
198 3300047443 Ga0495687_011843 Ga0495687_011843_2737_4143 467
199 3300047673 Ga0495593_0010132 Ga0495593_0010132_145_1551 467
200 3300047673 Ga0495593_0042654 Ga0495593_0042654_267_1673 467
201 3300048907 Ga0496104_0031984 Ga0496104_0031984_2996_4465 467
202 3300048913 Ga0496110_0082986 Ga0496110_0082986_1202_2671 467
203 3300048929 Ga0496126_0000414 Ga0496126_0000414_42076_43482 467
204 3300050496 nmdc:mga07m45_75490_c1 nmdc:mga07m45_75490_c1_404_1822 467
205 3300050509 nmdc:mga0qj67_95097_c1 nmdc:mga0qj67_95097_c1_274_1677 467
206 3300053158 Ga0500627_0005829 Ga0500627_0005829_2695_4098 467
207 3300003187 JGI25151J46595_10003002 JGI25151J46595_100030024 468
208 3300025294 Ga0209025_1000312 Ga0209025_100031211 468
209 3300005334 Ga0068869_100152623 Ga0068869_1001526232 469
210 3300005364 Ga0070673_100162192 Ga0070673_1001621921 469
211 3300005435 Ga0070714_100080266 Ga0070714_1000802662 469
212 3300005455 Ga0070663_100022567 Ga0070663_1000225672 469
213 3300005545 Ga0070695_100017622 Ga0070695_1000176222 469
214 3300005548 Ga0070665_100011350 Ga0070665_1000113502 469
215 3300005614 Ga0068856_100089464 Ga0068856_1000894642 469
216 3300006237 Ga0097621_100115702 Ga0097621_1001157022 469
217 3300006847 Ga0075431_100000979 Ga0075431_10000097923 469
218 3300006871 Ga0075434_100108789 Ga0075434_1001087892 469
219 3300017792 Ga0163161_10000166 Ga0163161_1000016637 469
220 3300021377 Ga0213874_10009787 Ga0213874_100097872 469
221 3300025901 Ga0207688_10006372 Ga0207688_100063722 469
222 3300025906 Ga0207699_10009808 Ga0207699_100098083 469
223 3300025907 Ga0207645_10004878 Ga0207645_100048787 469
224 3300025929 Ga0207664_10069592 Ga0207664_100695922 469
225 3300025936 Ga0207670_10069218 Ga0207670_100692182 469
226 3300025940 Ga0207691_10067648 Ga0207691_100676482 469
227 3300025961 Ga0207712_10060447 Ga0207712_100604472 469
228 3300026067 Ga0207678_10005487 Ga0207678_100054877 469
229 3300026118 Ga0207675_100176419 Ga0207675_1001764192 469
230 3300026121 Ga0207683_10006699 Ga0207683_100066992 469
231 3300026121 Ga0207683_10023822 Ga0207683_100238222 469
232 3300028794 Ga0307515_10087372 Ga0307515_100873723 469
233 3300046674 Ga0495588_0005333 Ga0495588_0005333_1157_2626 469
234 3300050510 nmdc:mga06r32_1173_c1 nmdc:mga06r32_1173_c1_16594_18021 469
235 3300050512 nmdc:mga0n895_108765_c1 nmdc:mga0n895_108765_c1_1224_2639 469
236 3300005341 Ga0070691_10028046 Ga0070691_100280462 470
237 3300005345 Ga0070692_10003099 Ga0070692_100030993 470
238 3300005438 Ga0070701_10017146 Ga0070701_100171461 470
239 3300005444 Ga0070694_100018184 Ga0070694_1000181842 470
240 3300005518 Ga0070699_100013187 Ga0070699_1000131874 470
241 3300005545 Ga0070695_100005263 Ga0070695_1000052632 470
242 3300005546 Ga0070696_100041062 Ga0070696_1000410622 470
243 3300005577 Ga0068857_100173147 Ga0068857_1001731472 470
244 3300005843 Ga0068860_100145030 Ga0068860_1001450302 470
245 3300005844 Ga0068862_100020347 Ga0068862_1000203472 470
246 3300006844 Ga0075428_100094800 Ga0075428_1000948002 470
247 3300006852 Ga0075433_10115124 Ga0075433_101151242 470
248 3300006871 Ga0075434_100026928 Ga0075434_1000269282 470
249 3300007076 Ga0075435_100029224 Ga0075435_1000292242 470
250 3300009094 Ga0111539_10001754 Ga0111539_1000175426 470
251 3300009094 Ga0111539_10166659 Ga0111539_101666592 470
252 3300009176 Ga0105242_10006175 Ga0105242_100061752 470
253 3300025917 Ga0207660_10063000 Ga0207660_100630002 470
254 3300025934 Ga0207686_10019101 Ga0207686_100191013 470
255 3300025942 Ga0207689_10009536 Ga0207689_100095363 470
256 3300026089 Ga0207648_10132571 Ga0207648_101325712 470
257 3300027907 Ga0207428_10000781 Ga0207428_100007814 470
258 3300027907 Ga0207428_10103124 Ga0207428_101031241 470
259 3300028380 Ga0268265_10007574 Ga0268265_100075741 470
260 3300042876 Ga0451577_0003798 Ga0451577_0003798_10040_11470 470
261 3300044673 Ga0453683_0066816 Ga0453683_0066816_34_1464 470
262 3300045051 Ga0451576_0078120 Ga0451576_0078120_100_1530 470
263 3300045051 Ga0451576_0173239 Ga0451576_0173239_93_1523 470
264 3300049588 Ga0501072_0126112 Ga0501072_0126112_416_1846 470
265 3300050511 nmdc:mga08y16_2283_c1 nmdc:mga08y16_2283_c1_18133_19563 470
266 3300050512 nmdc:mga0n895_43955_c1 nmdc:mga0n895_43955_c1_76_1506 470
267 3300050513 nmdc:mga0rr50_48425_c1 nmdc:mga0rr50_48425_c1_44_1474 470
268 3300050515 nmdc:mga0a205_1477_c1 nmdc:mga0a205_1477_c1_2957_4387 470
269 3300050515 nmdc:mga0a205_20144_c1 nmdc:mga0a205_20144_c1_4137_5567 470
270 3300005843 Ga0068860_100140727 Ga0068860_1001407272 471
271 3300025245 Ga0207425_1012831 Ga0207425_10128311 471
272 3300026118 Ga0207675_100163980 Ga0207675_1001639802 471
273 3300028794 Ga0307515_10000049 Ga0307515_1000004992 471
274 3300028794 Ga0307515_10028979 Ga0307515_100289796 471
275 3300031456 Ga0307513_10004164 Ga0307513_1000416410 471
276 3300045051 Ga0451576_0013845 Ga0451576_0013845_6408_7835 471
277 iso_pu_bacteria 2643221609 2644063026 471
278 iso_pu_bacteria 2738543013 2739247407 471
279 iso_pu_bacteria 2883291878 2883295115 471
280 iso_pu_bacteria 2883354860 2883356413 471
281 iso_pu_bacteria 2904541872 2904542007 471
282 iso_pu_bacteria 2929160207 2929167297 471
283 iso_pu_bacteria 2939631187 2939634826 471
284 3300005335 Ga0070666_10059851 Ga0070666_100598512 472
285 3300005549 Ga0070704_100024207 Ga0070704_1000242073 472
286 3300005578 Ga0068854_100161522 Ga0068854_1001615222 472
287 3300006195 Ga0075366_10033867 Ga0075366_100338672 472
288 3300006914 Ga0075436_100022431 Ga0075436_1000224312 472
289 3300014325 Ga0163163_10184052 Ga0163163_101840522 472
290 3300014968 Ga0157379_10021082 Ga0157379_100210824 472
291 3300025254 Ga0209148_1000599 Ga0209148_100059927 472
292 3300025272 Ga0209455_1000901 Ga0209455_100090111 472
293 3300025893 Ga0207682_10016635 Ga0207682_100166353 472
294 3300025907 Ga0207645_10047598 Ga0207645_100475982 472
295 3300025907 Ga0207645_10076894 Ga0207645_100768942 472
296 3300025925 Ga0207650_10226187 Ga0207650_102261871 472
297 3300025933 Ga0207706_10030582 Ga0207706_100305825 472
298 3300025940 Ga0207691_10007936 Ga0207691_100079362 472
299 3300025942 Ga0207689_10042498 Ga0207689_100424982 472
300 3300031456 Ga0307513_10017129 Ga0307513_100171299 472
301 3300031507 Ga0307509_10067822 Ga0307509_100678222 472
302 3300031901 Ga0307406_10034955 Ga0307406_100349553 472
303 3300035084 Ga0373928_0003384 Ga0373928_0003384_1338_2774 472
304 3300036401 Ga0373937_0116588 Ga0373937_0116588_251_1687 472
305 3300037471 Ga0395905_0001267 Ga0395905_0001267_17228_18646 472
306 3300041407 Ga0439447_000273 Ga0439447_000273_4258_5676 472
307 3300046681 Ga0495647_0027804 Ga0495647_0027804_280_1719 472
308 3300047443 Ga0495687_001245 Ga0495687_001245_15126_16565 472
309 3300048909 Ga0496106_0035476 Ga0496106_0035476_1411_2865 472
310 3300048909 Ga0496106_0139713 Ga0496106_0139713_462_1880 472
311 3300048913 Ga0496110_0238846 Ga0496110_0238846_14_1486 472
312 3300048916 Ga0496113_0128587 Ga0496113_0128587_453_1907 472
313 3300049742 Ga0501080_0173142 Ga0501080_0173142_297_1730 472
314 3300049744 Ga0501083_0010787 Ga0501083_0010787_2996_4429 472
315 3300050514 nmdc:mga08x19_23730_c1 nmdc:mga08x19_23730_c1_1145_2602 472
316 3300059424 Ga0590075_018559 Ga0590075_018559_144_1595 472
317 iso_pu_bacteria 2643221654 2644305170 472
318 iso_pu_bacteria 2721755763 2723876275 472
319 iso_pu_bacteria 2900634093 2900638559 472
320 3300003215 JGI25153J46596_10000066 JGI25153J46596_1000006689 473
321 3300005328 Ga0070676_10000358 Ga0070676_100003585 473
322 3300005329 Ga0070683_100058972 Ga0070683_1000589722 473
323 3300005333 Ga0070677_10000799 Ga0070677_100007996 473
324 3300005335 Ga0070666_10002683 Ga0070666_100026832 473
325 3300005338 Ga0068868_100001448 Ga0068868_1000014482 473
326 3300005344 Ga0070661_100001117 Ga0070661_10000111718 473
327 3300005344 Ga0070661_100032460 Ga0070661_1000324602 473
328 3300005347 Ga0070668_100001120 Ga0070668_1000011203 473
329 3300005347 Ga0070668_100017358 Ga0070668_1000173584 473
330 3300005347 Ga0070668_100036158 Ga0070668_1000361582 473
331 3300005354 Ga0070675_100000127 Ga0070675_10000012731 473
332 3300005355 Ga0070671_100000385 Ga0070671_1000003852 473
333 3300005356 Ga0070674_100000120 Ga0070674_10000012020 473
334 3300005364 Ga0070673_100000465 Ga0070673_10000046516 473
335 3300005366 Ga0070659_100033464 Ga0070659_1000334642 473
336 3300005367 Ga0070667_100001635 Ga0070667_10000163515 473
337 3300005367 Ga0070667_100010671 Ga0070667_1000106714 473
338 3300005435 Ga0070714_100001578 Ga0070714_1000015784 473
339 3300005456 Ga0070678_100000532 Ga0070678_10000053217 473
340 3300005458 Ga0070681_10008439 Ga0070681_100084392 473
341 3300005458 Ga0070681_10044648 Ga0070681_100446483 473
342 3300005459 Ga0068867_100027347 Ga0068867_1000273472 473
343 3300005530 Ga0070679_100008975 Ga0070679_1000089752 473
344 3300005530 Ga0070679_100078097 Ga0070679_1000780972 473
345 3300005539 Ga0068853_100016255 Ga0068853_1000162555 473
346 3300005539 Ga0068853_100036798 Ga0068853_1000367982 473
347 3300005543 Ga0070672_100014139 Ga0070672_1000141393 473
348 3300005548 Ga0070665_100018618 Ga0070665_1000186187 473
349 3300005563 Ga0068855_100021344 Ga0068855_1000213445 473
350 3300005564 Ga0070664_100016626 Ga0070664_1000166265 473
351 3300005577 Ga0068857_100009255 Ga0068857_1000092555 473
352 3300005616 Ga0068852_100000773 Ga0068852_1000007733 473
353 3300005616 Ga0068852_100008520 Ga0068852_1000085205 473
354 3300005616 Ga0068852_100170682 Ga0068852_1001706822 473
355 3300005834 Ga0068851_10003201 Ga0068851_100032012 473
356 3300005841 Ga0068863_100151284 Ga0068863_1001512842 473
357 3300005842 Ga0068858_100047879 Ga0068858_1000478792 473
358 3300005843 Ga0068860_100136516 Ga0068860_1001365162 473
359 3300005843 Ga0068860_100264045 Ga0068860_1002640452 473
360 3300005981 Ga0081538_10017023 Ga0081538_100170232 473
361 3300006237 Ga0097621_100007020 Ga0097621_1000070204 473
362 3300006358 Ga0068871_100025900 Ga0068871_1000259002 473
363 3300006881 Ga0068865_100013513 Ga0068865_1000135134 473
364 3300009177 Ga0105248_10074135 Ga0105248_100741352 473
365 3300009545 Ga0105237_10040777 Ga0105237_100407773 473
366 3300009551 Ga0105238_10002047 Ga0105238_1000204719 473
367 3300013104 Ga0157370_10030299 Ga0157370_100302995 473
368 3300013104 Ga0157370_10062897 Ga0157370_100628972 473
369 3300013297 Ga0157378_10010403 Ga0157378_100104033 473
370 3300013307 Ga0157372_10004036 Ga0157372_100040362 473
371 3300013308 Ga0157375_10000969 Ga0157375_1000096919 473
372 3300013308 Ga0157375_10183443 Ga0157375_101834432 473
373 3300025297 Ga0209758_1000028 Ga0209758_100002841 473
374 3300025298 Ga0209050_1019093 Ga0209050_10190932 473
375 3300025304 Ga0209257_1000707 Ga0209257_100070730 473
376 3300025315 Ga0207697_10027523 Ga0207697_100275232 473
377 3300025321 Ga0207656_10020303 Ga0207656_100203032 473
378 3300025893 Ga0207682_10006639 Ga0207682_100066392 473
379 3300025903 Ga0207680_10004793 Ga0207680_100047933 473
380 3300025907 Ga0207645_10000187 Ga0207645_1000018710 473
381 3300025907 Ga0207645_10110178 Ga0207645_101101782 473
382 3300025917 Ga0207660_10127220 Ga0207660_101272202 473
383 3300025923 Ga0207681_10082141 Ga0207681_100821412 473
384 3300025923 Ga0207681_10205703 Ga0207681_102057031 473
385 3300025925 Ga0207650_10017955 Ga0207650_100179553 473
386 3300025926 Ga0207659_10011571 Ga0207659_100115715 473
387 3300025932 Ga0207690_10022360 Ga0207690_100223602 473
388 3300025938 Ga0207704_10061652 Ga0207704_100616522 473
389 3300025938 Ga0207704_10067560 Ga0207704_100675602 473
390 3300025940 Ga0207691_10000024 Ga0207691_1000002420 473
391 3300025940 Ga0207691_10020043 Ga0207691_100200432 473
392 3300025941 Ga0207711_10032000 Ga0207711_100320004 473
393 3300025942 Ga0207689_10069059 Ga0207689_100690592 473
394 3300025944 Ga0207661_10011026 Ga0207661_100110264 473
395 3300025945 Ga0207679_10005044 Ga0207679_100050445 473
396 3300025949 Ga0207667_10080159 Ga0207667_100801592 473
397 3300025960 Ga0207651_10005217 Ga0207651_100052175 473
398 3300025972 Ga0207668_10004902 Ga0207668_100049025 473
399 3300025972 Ga0207668_10042806 Ga0207668_100428062 473
400 3300025986 Ga0207658_10001872 Ga0207658_1000187210 473
401 3300025986 Ga0207658_10002398 Ga0207658_100023985 473
402 3300026023 Ga0207677_10003378 Ga0207677_100033787 473
403 3300026078 Ga0207702_10002061 Ga0207702_1000206116 473
404 3300026088 Ga0207641_10202211 Ga0207641_102022112 473
405 3300026089 Ga0207648_10005620 Ga0207648_100056208 473
406 3300026095 Ga0207676_10093934 Ga0207676_100939342 473
407 3300026116 Ga0207674_10001568 Ga0207674_100015685 473
408 3300026118 Ga0207675_100034418 Ga0207675_1000344182 473
409 3300026118 Ga0207675_100080175 Ga0207675_1000801752 473
410 3300026121 Ga0207683_10000012 Ga0207683_1000001278 473
411 3300026142 Ga0207698_10038365 Ga0207698_100383653 473
412 3300027907 Ga0207428_10000206 Ga0207428_1000020616 473
413 3300028379 Ga0268266_10014553 Ga0268266_100145535 473
414 3300028380 Ga0268265_10008051 Ga0268265_100080512 473
415 3300028381 Ga0268264_10054992 Ga0268264_100549923 473
416 3300028381 Ga0268264_10080337 Ga0268264_100803371 473
417 3300031456 Ga0307513_10090900 Ga0307513_100909002 473
418 3300031616 Ga0307508_10183344 Ga0307508_101833442 473
419 3300031824 Ga0307413_10028680 Ga0307413_100286802 473
420 3300032002 Ga0307416_100080731 Ga0307416_1000807312 473
421 3300037068 Ga0373925_0039429 Ga0373925_0039429_1410_2852 473
422 3300042876 Ga0451577_0060282 Ga0451577_0060282_1260_2693 473
423 3300046543 Ga0495645_0039588 Ga0495645_0039588_875_2308 473
424 3300048915 Ga0496112_0028019 Ga0496112_0028019_471_1904 473
425 3300049569 Ga0501032_0001833 Ga0501032_0001833_9962_11392 473
426 3300049570 Ga0501033_0008938 Ga0501033_0008938_5109_6539 473
427 3300049571 Ga0501034_0008902 Ga0501034_0008902_5415_6845 473
428 3300049571 Ga0501034_0064231 Ga0501034_0064231_1399_2832 473
429 3300049573 Ga0501037_0005118 Ga0501037_0005118_3891_5321 473
430 3300049574 Ga0501038_0001970 Ga0501038_0001970_3747_5177 473
431 3300049575 Ga0501039_0001598 Ga0501039_0001598_1685_3115 473
432 3300049579 Ga0501043_0000364 Ga0501043_0000364_15709_17139 473
433 3300049579 Ga0501043_0028562 Ga0501043_0028562_2624_4051 473
434 3300049580 Ga0501046_0000867 Ga0501046_0000867_7221_8651 473
435 3300049583 Ga0501067_0001425 Ga0501067_0001425_7287_8720 473
436 3300049585 Ga0501069_0003379 Ga0501069_0003379_4338_5768 473
437 3300049586 Ga0501070_0001836 Ga0501070_0001836_10353_11783 473
438 3300049589 Ga0501073_0000620 Ga0501073_0000620_8797_10227 473
439 3300049589 Ga0501073_0010743 Ga0501073_0010743_4743_6176 473
440 3300049590 Ga0501074_0055534 Ga0501074_0055534_283_1716 473
441 3300049742 Ga0501080_0001874 Ga0501080_0001874_16614_18047 473
442 3300049742 Ga0501080_0031615 Ga0501080_0031615_1817_3247 473
443 3300049742 Ga0501080_0050436 Ga0501080_0050436_1291_2721 473
444 3300049742 Ga0501080_0075888 Ga0501080_0075888_769_2199 473
445 3300049744 Ga0501083_0006601 Ga0501083_0006601_2042_3472 473
446 3300049822 Ga0501035_0006788 Ga0501035_0006788_362_1792 473
447 3300049823 Ga0501044_0009350 Ga0501044_0009350_1910_3340 473
448 3300049823 Ga0501044_0039230 Ga0501044_0039230_2437_3867 473
449 3300050511 nmdc:mga08y16_16_c1 nmdc:mga08y16_16_c1_134319_135752 473
450 3300053088 Ga0500644_0037720 Ga0500644_0037720_45_1472 473
451 3300053090 Ga0500646_0027016 Ga0500646_0027016_28_1458 473
452 3300053119 Ga0500595_001190 Ga0500595_001190_5377_6807 473
453 3300053130 Ga0500642_0038289 Ga0500642_0038289_36_1466 473
454 3300053139 Ga0500568_0003326 Ga0500568_0003326_2409_3839 473
455 3300053151 Ga0500604_0001284 Ga0500604_0001284_4466_5896 473
456 3300053153 Ga0500616_0003059 Ga0500616_0003059_4364_5794 473
457 3300054114 Ga0501084_0110025 Ga0501084_0110025_468_1901 473
458 3300060353 Ga0501082_0001879 Ga0501082_0001879_362_1792 473
459 iso_pu_bacteria 2511231002 2511245432 473
460 3300005331 Ga0070670_100053796 Ga0070670_1000537962 474
461 3300005331 Ga0070670_100059058 Ga0070670_1000590582 474
462 3300005334 Ga0068869_100066870 Ga0068869_1000668702 474
463 3300005338 Ga0068868_100025255 Ga0068868_1000252552 474
464 3300005338 Ga0068868_100026903 Ga0068868_1000269032 474
465 3300005339 Ga0070660_100098154 Ga0070660_1000981541 474
466 3300005353 Ga0070669_100085187 Ga0070669_1000851871 474
467 3300005354 Ga0070675_100017061 Ga0070675_1000170614 474
468 3300005354 Ga0070675_100019717 Ga0070675_1000197174 474
469 3300005354 Ga0070675_100022840 Ga0070675_1000228402 474
470 3300005364 Ga0070673_100031470 Ga0070673_1000314704 474
471 3300005455 Ga0070663_100096148 Ga0070663_1000961482 474
472 3300005457 Ga0070662_100049536 Ga0070662_1000495362 474
473 3300005457 Ga0070662_100050759 Ga0070662_1000507592 474
474 3300005467 Ga0070706_100002711 Ga0070706_1000027117 474
475 3300005530 Ga0070679_100006925 Ga0070679_1000069253 474
476 3300005539 Ga0068853_100105584 Ga0068853_1001055842 474
477 3300005543 Ga0070672_100001354 Ga0070672_10000135411 474
478 3300005543 Ga0070672_100108193 Ga0070672_1001081932 474
479 3300005614 Ga0068856_100008625 Ga0068856_1000086252 474
480 3300005618 Ga0068864_100014096 Ga0068864_1000140966 474
481 3300005618 Ga0068864_100080655 Ga0068864_1000806552 474
482 3300005842 Ga0068858_100057702 Ga0068858_1000577022 474
483 3300005843 Ga0068860_100233584 Ga0068860_1002335842 474
484 3300006177 Ga0075362_10013671 Ga0075362_100136712 474
485 3300006195 Ga0075366_10014908 Ga0075366_100149084 474
486 3300006195 Ga0075366_10108350 Ga0075366_101083501 474
487 3300006237 Ga0097621_100009828 Ga0097621_1000098282 474
488 3300006237 Ga0097621_100083065 Ga0097621_1000830652 474
489 3300006353 Ga0075370_10001530 Ga0075370_100015305 474
490 3300006353 Ga0075370_10001898 Ga0075370_100018987 474
491 3300006353 Ga0075370_10003975 Ga0075370_100039755 474
492 3300006353 Ga0075370_10008606 Ga0075370_100086062 474
493 3300006358 Ga0068871_100015576 Ga0068871_1000155764 474
494 3300009098 Ga0105245_10033953 Ga0105245_100339534 474
495 3300009177 Ga0105248_10215930 Ga0105248_102159302 474
496 3300009551 Ga0105238_10025045 Ga0105238_100250455 474
497 3300013306 Ga0163162_10208109 Ga0163162_102081092 474
498 3300013308 Ga0157375_10051869 Ga0157375_100518692 474
499 3300014325 Ga0163163_10162891 Ga0163163_101628912 474
500 3300014745 Ga0157377_10017671 Ga0157377_100176712 474
501 3300014968 Ga0157379_10045091 Ga0157379_100450913 474
502 3300014968 Ga0157379_10053760 Ga0157379_100537602 474
503 3300014969 Ga0157376_10024013 Ga0157376_100240133 474
504 3300014969 Ga0157376_10039002 Ga0157376_100390024 474
505 3300025273 Ga0209673_1008187 Ga0209673_10081875 474
506 3300025321 Ga0207656_10020101 Ga0207656_100201012 474
507 3300025901 Ga0207688_10079501 Ga0207688_100795012 474
508 3300025907 Ga0207645_10007994 Ga0207645_100079945 474
509 3300025907 Ga0207645_10042134 Ga0207645_100421342 474
510 3300025912 Ga0207707_10072231 Ga0207707_100722311 474
511 3300025919 Ga0207657_10072283 Ga0207657_100722832 474
512 3300025920 Ga0207649_10001848 Ga0207649_100018487 474
513 3300025922 Ga0207646_10208405 Ga0207646_102084051 474
514 3300025923 Ga0207681_10106217 Ga0207681_101062172 474
515 3300025924 Ga0207694_10107911 Ga0207694_101079112 474
516 3300025925 Ga0207650_10026003 Ga0207650_100260032 474
517 3300025926 Ga0207659_10044009 Ga0207659_100440092 474
518 3300025931 Ga0207644_10173715 Ga0207644_101737151 474
519 3300025933 Ga0207706_10053025 Ga0207706_100530252 474
520 3300025933 Ga0207706_10054053 Ga0207706_100540532 474
521 3300025940 Ga0207691_10013535 Ga0207691_100135352 474
522 3300025941 Ga0207711_10040913 Ga0207711_100409132 474
523 3300025942 Ga0207689_10008871 Ga0207689_100088716 474
524 3300025944 Ga0207661_10062606 Ga0207661_100626062 474
525 3300025949 Ga0207667_10122226 Ga0207667_101222263 474
526 3300025960 Ga0207651_10075833 Ga0207651_100758331 474
527 3300025961 Ga0207712_10104576 Ga0207712_101045762 474
528 3300026023 Ga0207677_10012818 Ga0207677_100128183 474
529 3300026035 Ga0207703_10011356 Ga0207703_100113566 474
530 3300026067 Ga0207678_10042830 Ga0207678_100428302 474
531 3300026067 Ga0207678_10054220 Ga0207678_100542202 474
532 3300026088 Ga0207641_10047709 Ga0207641_100477092 474
533 3300026089 Ga0207648_10018481 Ga0207648_100184814 474
534 3300026116 Ga0207674_10029867 Ga0207674_100298672 474
535 3300026116 Ga0207674_10055612 Ga0207674_100556123 474
536 3300026118 Ga0207675_100000977 Ga0207675_1000009774 474
537 3300028381 Ga0268264_10113692 Ga0268264_101136922 474
538 3300028381 Ga0268264_10173594 Ga0268264_101735942 474
539 3300028794 Ga0307515_10038957 Ga0307515_100389573 474
540 3300028794 Ga0307515_10040590 Ga0307515_100405903 474
541 3300031238 Ga0265332_10024712 Ga0265332_100247122 474
542 3300031456 Ga0307513_10048959 Ga0307513_100489594 474
543 3300031456 Ga0307513_10159648 Ga0307513_101596482 474
544 3300031507 Ga0307509_10000092 Ga0307509_1000009254 474
545 3300031507 Ga0307509_10002037 Ga0307509_100020376 474
546 3300031507 Ga0307509_10031330 Ga0307509_100313302 474
547 3300031649 Ga0307514_10098191 Ga0307514_100981912 474
548 3300031730 Ga0307516_10000921 Ga0307516_1000092134 474
549 3300031730 Ga0307516_10084089 Ga0307516_100840892 474
550 3300033180 Ga0307510_10001210 Ga0307510_100012108 474
551 3300033180 Ga0307510_10022939 Ga0307510_100229395 474
552 3300035691 Ga0373931_0018365 Ga0373931_0018365_1254_2705 474
553 3300037471 Ga0395905_0000047 Ga0395905_0000047_121489_122940 474
554 3300037471 Ga0395905_0020959 Ga0395905_0020959_371_1822 474
555 3300039437 Ga0436365_1841312 Ga0436365_1841312_7763_9211 474
556 3300039450 Ga0436363_0008183 Ga0436363_0008183_95_1549 474
557 3300044656 Ga0466969_0004149 Ga0466969_0004149_1297_2748 474
558 3300044693 Ga0466961_0019037 Ga0466961_0019037_1027_2478 474
559 3300045049 Ga0466959_0007477 Ga0466959_0007477_2671_4122 474
560 3300046454 Ga0495592_0000413 Ga0495592_0000413_6338_7789 474
561 3300046519 Ga0495632_0028648 Ga0495632_0028648_985_2433 474
562 3300046615 Ga0495656_0005404 Ga0495656_0005404_184_1638 474
563 3300048909 Ga0496106_0021059 Ga0496106_0021059_232_1677 474
564 3300048915 Ga0496112_0050856 Ga0496112_0050856_1004_2455 474
565 3300050493 nmdc:mga0k408_9560_c1 nmdc:mga0k408_9560_c1_1540_2985 474
566 3300050496 nmdc:mga07m45_12057_c1 nmdc:mga07m45_12057_c1_1790_3235 474
567 3300050496 nmdc:mga07m45_16737_c1 nmdc:mga07m45_16737_c1_474_1919 474
568 3300053086 Ga0500578_0109622 Ga0500578_0109622_262_1713 474
569 3300053093 Ga0500651_0013116 Ga0500651_0013116_521_1966 474
570 3300053136 Ga0500559_0000017 Ga0500559_0000017_77036_78481 474
571 3300053156 Ga0500622_0002180 Ga0500622_0002180_7567_9012 474
572 3300053730 Ga0500645_001359 Ga0500645_001359_5007_6461 474
573 3300002704 JGI25155J39150_1000121 JGI25155J39150_100012122 475
574 3300002705 JGI25156J39149_1000100 JGI25156J39149_100010022 475
575 3300002738 JGI25154J39366_1000121 JGI25154J39366_100012121 475
576 3300002741 JGI25157J39369_1000130 JGI25157J39369_100013031 475
577 3300002987 JGI25159J45721_1000190 JGI25159J45721_100019019 475
578 3300002987 JGI25159J45721_1002388 JGI25159J45721_10023884 475
579 3300003187 JGI25151J46595_10009359 JGI25151J46595_100093592 475
580 3300003323 rootH1_10006056 rootH1_100060562 475
581 3300003354 JGI25160J50197_1000345 JGI25160J50197_100034522 475
582 3300003374 JGI25161J50226_1000007 JGI25161J50226_1000007202 475
583 3300003771 Ga0055526_1006082 Ga0055526_10060823 475
584 3300003771 Ga0055526_1006763 Ga0055526_10067633 475
585 3300003773 Ga0055537_1000183 Ga0055537_100018329 475
586 3300003773 Ga0055537_1000254 Ga0055537_100025420 475
587 3300003773 Ga0055537_1003881 Ga0055537_10038813 475
588 3300003775 Ga0055524_1000101 Ga0055524_100010119 475
589 3300003784 Ga0055534_1001577 Ga0055534_10015774 475
590 3300003791 Ga0055530_10001334 Ga0055530_100013345 475
591 3300003792 Ga0055540_1000099 Ga0055540_100009967 475
592 3300003794 Ga0055531_10002500 Ga0055531_100025009 475
593 3300003794 Ga0055531_10016598 Ga0055531_100165983 475
594 3300004625 Ga0055543_1001205 Ga0055543_10012053 475
595 3300005338 Ga0068868_100135695 Ga0068868_1001356952 475
596 3300005440 Ga0070705_100053755 Ga0070705_1000537552 475
597 3300005518 Ga0070699_100028079 Ga0070699_1000280792 475
598 3300006038 Ga0075365_10020559 Ga0075365_100205592 475
599 3300006058 Ga0075432_10031837 Ga0075432_100318371 475
600 3300006944 Ga0099823_1000262 Ga0099823_100026220 475
601 3300009176 Ga0105242_10022167 Ga0105242_100221673 475
602 3300012502 Ga0157347_1000437 Ga0157347_10004372 475
603 3300025206 Ga0209435_100008 Ga0209435_100008308 475
604 3300025246 Ga0209646_1000079 Ga0209646_100007931 475
605 3300025250 Ga0209026_1000067 Ga0209026_100006731 475
606 3300025256 Ga0209759_1000056 Ga0209759_100005631 475
607 3300025263 Ga0209565_1000041 Ga0209565_1000041119 475
608 3300025273 Ga0209673_1000012 Ga0209673_100001241 475
609 3300025273 Ga0209673_1003059 Ga0209673_10030597 475
610 3300025284 Ga0209130_1000184 Ga0209130_100018464 475
611 3300025291 Ga0209675_1000475 Ga0209675_10004754 475
612 3300025292 Ga0209676_1000013 Ga0209676_1000013353 475
613 3300025294 Ga0209025_1003125 Ga0209025_10031254 475
614 3300025295 Ga0209564_1001251 Ga0209564_100125111 475
615 3300025295 Ga0209564_1001414 Ga0209564_100141410 475
616 3300025298 Ga0209050_1000008 Ga0209050_1000008353 475
617 3300025298 Ga0209050_1009162 Ga0209050_10091624 475
618 3300025299 Ga0209256_1000003 Ga0209256_100000348 475
619 3300025299 Ga0209256_1002403 Ga0209256_10024038 475
620 3300025299 Ga0209256_1025630 Ga0209256_10256302 475
621 3300025302 Ga0207426_1008325 Ga0207426_10083252 475
622 3300025303 Ga0209051_1000005 Ga0209051_1000005353 475
623 3300025303 Ga0209051_1001419 Ga0209051_10014193 475
624 3300025304 Ga0209257_1000048 Ga0209257_1000048353 475
625 3300025304 Ga0209257_1001241 Ga0209257_10012415 475
626 3300027296 Ga0209389_1004459 Ga0209389_10044597 475
627 3300027614 Ga0209970_1000712 Ga0209970_10007125 475
628 3300028794 Ga0307515_10128687 Ga0307515_101286872 475
629 3300031456 Ga0307513_10000130 Ga0307513_1000013087 475
630 3300031456 Ga0307513_10078883 Ga0307513_100788833 475
631 3300039438 Ga0436360_0938195 Ga0436360_0938195_146_1597 475
632 3300044666 Ga0466977_0009695 Ga0466977_0009695_1005_2459 475
633 3300046530 Ga0495654_0001492 Ga0495654_0001492_7415_8869 475
634 3300046542 Ga0495597_0000109 Ga0495597_0000109_50934_52388 475
635 3300048928 Ga0496125_0005958 Ga0496125_0005958_959_2404 475
636 3300049579 Ga0501043_0000059 Ga0501043_0000059_16830_18284 475
637 3300049580 Ga0501046_0000082 Ga0501046_0000082_16721_18175 475
638 3300049581 Ga0501047_0000050 Ga0501047_0000050_83161_84615 475
639 3300049581 Ga0501047_0025367 Ga0501047_0025367_2085_3554 475
640 3300049582 Ga0501048_0007107 Ga0501048_0007107_3328_4782 475
641 3300049824 Ga0501045_0011333 Ga0501045_0011333_695_2149 475
642 3300050492 nmdc:mga0yw44_36343_c1 nmdc:mga0yw44_36343_c1_989_2494 475
643 3300050493 nmdc:mga0k408_19005_c1 nmdc:mga0k408_19005_c1_1788_3245 475
644 3300053094 Ga0500566_0050220 Ga0500566_0050220_254_1711 475
645 3300053117 Ga0500593_000168 Ga0500593_000168_10939_12399 475
646 3300053730 Ga0500645_000333 Ga0500645_000333_10113_11573 475
647 3300053730 Ga0500645_009566 Ga0500645_009566_49_1509 475
648 3300055283 Ga0500661_000506 Ga0500661_000506_5364_6821 475
649 iso_pu_bacteria 2548876994 2550695027 475
650 iso_pu_bacteria 2643221654 2644302557 475
651 iso_pu_bacteria 2818991436 2819544620 475
652 iso_pu_bacteria 2884811622 2884812502 475
653 iso_pu_bacteria 2884836552 2884839490 475
654 iso_pu_bacteria 2884852848 2884856700 475
655 iso_pu_bacteria 2894023352 2894027804 475
656 iso_pu_bacteria 2896154374 2896158046 475
657 iso_pu_bacteria 2945909444 2945913075 475
658 iso_pu_bacteria 2945984333 2945984638 475
659 3300005327 Ga0070658_10005585 Ga0070658_100055858 476
660 3300005329 Ga0070683_100059613 Ga0070683_1000596132 476
661 3300005339 Ga0070660_100007070 Ga0070660_1000070704 476
662 3300005366 Ga0070659_100047925 Ga0070659_1000479252 476
663 3300005434 Ga0070709_10020613 Ga0070709_100206133 476
664 3300005435 Ga0070714_100021635 Ga0070714_1000216353 476
665 3300005436 Ga0070713_100020020 Ga0070713_1000200202 476
666 3300005455 Ga0070663_100005582 Ga0070663_1000055823 476
667 3300005530 Ga0070679_100026267 Ga0070679_1000262673 476
668 3300005539 Ga0068853_100019352 Ga0068853_1000193522 476
669 3300005543 Ga0070672_100040912 Ga0070672_1000409122 476
670 3300005546 Ga0070696_100005886 Ga0070696_1000058863 476
671 3300005563 Ga0068855_100074485 Ga0068855_1000744852 476
672 3300005564 Ga0070664_100165039 Ga0070664_1001650392 476
673 3300005614 Ga0068856_100007848 Ga0068856_1000078482 476
674 3300005614 Ga0068856_100027812 Ga0068856_1000278122 476
675 3300005719 Ga0068861_100155056 Ga0068861_1001550562 476
676 3300005834 Ga0068851_10004806 Ga0068851_100048065 476
677 3300007788 Ga0099795_10009193 Ga0099795_100091933 476
678 3300009093 Ga0105240_10013339 Ga0105240_100133392 476
679 3300009551 Ga0105238_10038818 Ga0105238_100388182 476
680 3300010375 Ga0105239_10204709 Ga0105239_102047092 476
681 3300013100 Ga0157373_10038288 Ga0157373_100382882 476
682 3300013102 Ga0157371_10025257 Ga0157371_100252572 476
683 3300013104 Ga0157370_10004541 Ga0157370_100045413 476
684 3300013104 Ga0157370_10033170 Ga0157370_100331703 476
685 3300013104 Ga0157370_10079441 Ga0157370_100794412 476
686 3300013306 Ga0163162_10040756 Ga0163162_100407562 476
687 3300013307 Ga0157372_10035608 Ga0157372_100356086 476
688 3300013307 Ga0157372_10095039 Ga0157372_100950392 476
689 3300025901 Ga0207688_10029382 Ga0207688_100293821 476
690 3300025909 Ga0207705_10039251 Ga0207705_100392512 476
691 3300025912 Ga0207707_10028501 Ga0207707_100285012 476
692 3300025913 Ga0207695_10050075 Ga0207695_100500752 476
693 3300025919 Ga0207657_10000102 Ga0207657_1000010255 476
694 3300025920 Ga0207649_10035717 Ga0207649_100357172 476
695 3300025924 Ga0207694_10009366 Ga0207694_100093662 476
696 3300025929 Ga0207664_10002657 Ga0207664_100026574 476
697 3300025932 Ga0207690_10170693 Ga0207690_101706932 476
698 3300025933 Ga0207706_10087646 Ga0207706_100876462 476
699 3300025940 Ga0207691_10036527 Ga0207691_100365273 476
700 3300025945 Ga0207679_10045330 Ga0207679_100453302 476
701 3300025945 Ga0207679_10060643 Ga0207679_100606431 476
702 3300025949 Ga0207667_10009195 Ga0207667_100091953 476
703 3300026041 Ga0207639_10002255 Ga0207639_1000225512 476
704 3300026067 Ga0207678_10004850 Ga0207678_100048504 476
705 3300026078 Ga0207702_10032002 Ga0207702_100320022 476
706 3300026116 Ga0207674_10000326 Ga0207674_100003263 476
707 3300026118 Ga0207675_100218140 Ga0207675_1002181402 476
708 3300037466 Ga0395898_0047369 Ga0395898_0047369_88_1542 476
709 3300038443 Ga0395901_0112026 Ga0395901_0112026_697_2151 476
710 3300042876 Ga0451577_0130547 Ga0451577_0130547_445_1884 476
711 3300047472 Ga0495686_0002020 Ga0495686_0002020_3939_5396 476
712 iso_pu_bacteria 2928170801 2928172485 476
713 iso_pu_bacteria 8018845410 8018849687 476
714 iso_pu_bacteria 8021120328 8021120753 476
715 3300002737 JGI25162J39368_1000040 JGI25162J39368_1000040152 477
716 3300003214 JGI25165J46597_1000051 JGI25165J46597_100005147 477
717 3300003751 Ga0055538_1000025 Ga0055538_1000025186 477
718 3300003752 Ga0055539_1000032 Ga0055539_100003247 477
719 3300003756 Ga0055533_1000042 Ga0055533_1000042186 477
720 3300003759 Ga0055525_1000050 Ga0055525_1000050186 477
721 3300003841 Ga0055541_1000023 Ga0055541_1000023185 477
722 3300005293 Ga0065715_10023900 Ga0065715_100239002 477
723 3300005328 Ga0070676_10000148 Ga0070676_1000014818 477
724 3300005330 Ga0070690_100087458 Ga0070690_1000874582 477
725 3300005331 Ga0070670_100001361 Ga0070670_1000013612 477
726 3300005331 Ga0070670_100005248 Ga0070670_1000052487 477
727 3300005331 Ga0070670_100029684 Ga0070670_1000296844 477
728 3300005331 Ga0070670_100033630 Ga0070670_1000336301 477
729 3300005334 Ga0068869_100001654 Ga0068869_1000016543 477
730 3300005334 Ga0068869_100016511 Ga0068869_1000165114 477
731 3300005335 Ga0070666_10004155 Ga0070666_100041554 477
732 3300005338 Ga0068868_100001446 Ga0068868_1000014467 477
733 3300005338 Ga0068868_100027849 Ga0068868_1000278492 477
734 3300005338 Ga0068868_100120218 Ga0068868_1001202182 477
735 3300005345 Ga0070692_10023354 Ga0070692_100233542 477
736 3300005347 Ga0070668_100001207 Ga0070668_1000012072 477
737 3300005347 Ga0070668_100002539 Ga0070668_1000025396 477
738 3300005347 Ga0070668_100015868 Ga0070668_1000158685 477
739 3300005353 Ga0070669_100015487 Ga0070669_1000154873 477
740 3300005354 Ga0070675_100006009 Ga0070675_1000060094 477
741 3300005354 Ga0070675_100020291 Ga0070675_1000202913 477
742 3300005355 Ga0070671_100001859 Ga0070671_1000018597 477
743 3300005355 Ga0070671_100023725 Ga0070671_1000237253 477
744 3300005355 Ga0070671_100038568 Ga0070671_1000385684 477
745 3300005355 Ga0070671_100171910 Ga0070671_1001719102 477
746 3300005364 Ga0070673_100022841 Ga0070673_1000228412 477
747 3300005364 Ga0070673_100023139 Ga0070673_1000231392 477
748 3300005365 Ga0070688_100012229 Ga0070688_1000122292 477
749 3300005367 Ga0070667_100002817 Ga0070667_10000281710 477
750 3300005367 Ga0070667_100019721 Ga0070667_1000197212 477
751 3300005436 Ga0070713_100000030 Ga0070713_10000003077 477
752 3300005440 Ga0070705_100054282 Ga0070705_1000542821 477
753 3300005441 Ga0070700_100002594 Ga0070700_1000025946 477
754 3300005445 Ga0070708_100000315 Ga0070708_10000031522 477
755 3300005445 Ga0070708_100133133 Ga0070708_1001331332 477
756 3300005456 Ga0070678_100027467 Ga0070678_1000274671 477
757 3300005457 Ga0070662_100026933 Ga0070662_1000269332 477
758 3300005457 Ga0070662_100047869 Ga0070662_1000478692 477
759 3300005457 Ga0070662_100140215 Ga0070662_1001402152 477
760 3300005459 Ga0068867_100000611 Ga0068867_1000006118 477
761 3300005459 Ga0068867_100008312 Ga0068867_1000083122 477
762 3300005459 Ga0068867_100015611 Ga0068867_1000156113 477
763 3300005471 Ga0070698_100142866 Ga0070698_1001428662 477
764 3300005543 Ga0070672_100001593 Ga0070672_1000015934 477
765 3300005543 Ga0070672_100002173 Ga0070672_1000021738 477
766 3300005543 Ga0070672_100002527 Ga0070672_1000025274 477
767 3300005548 Ga0070665_100003546 Ga0070665_1000035463 477
768 3300005563 Ga0068855_100145450 Ga0068855_1001454502 477
769 3300005564 Ga0070664_100156731 Ga0070664_1001567312 477
770 3300005577 Ga0068857_100078530 Ga0068857_1000785302 477
771 3300005614 Ga0068856_100017226 Ga0068856_1000172265 477
772 3300005617 Ga0068859_100002372 Ga0068859_1000023724 477
773 3300005617 Ga0068859_100003577 Ga0068859_10000357716 477
774 3300005617 Ga0068859_100042632 Ga0068859_1000426322 477
775 3300005617 Ga0068859_100059241 Ga0068859_1000592412 477
776 3300005618 Ga0068864_100001575 Ga0068864_10000157510 477
777 3300005618 Ga0068864_100002069 Ga0068864_1000020692 477
778 3300005618 Ga0068864_100008157 Ga0068864_1000081575 477
779 3300005618 Ga0068864_100023397 Ga0068864_1000233972 477
780 3300005618 Ga0068864_100040760 Ga0068864_1000407603 477
781 3300005618 Ga0068864_100090975 Ga0068864_1000909752 477
782 3300005618 Ga0068864_100098419 Ga0068864_1000984192 477
783 3300005719 Ga0068861_100000301 Ga0068861_10000030111 477
784 3300005719 Ga0068861_100037108 Ga0068861_1000371083 477
785 3300005719 Ga0068861_100062179 Ga0068861_1000621792 477
786 3300005840 Ga0068870_10043673 Ga0068870_100436732 477
787 3300005841 Ga0068863_100003067 Ga0068863_1000030677 477
788 3300005841 Ga0068863_100025414 Ga0068863_1000254143 477
789 3300005841 Ga0068863_100269639 Ga0068863_1002696392 477
790 3300005842 Ga0068858_100006180 Ga0068858_1000061802 477
791 3300005842 Ga0068858_100007048 Ga0068858_10000704811 477
792 3300005842 Ga0068858_100021347 Ga0068858_1000213474 477
793 3300005843 Ga0068860_100012715 Ga0068860_1000127155 477
794 3300005843 Ga0068860_100028913 Ga0068860_1000289134 477
795 3300005843 Ga0068860_100092329 Ga0068860_1000923292 477
796 3300005844 Ga0068862_100041734 Ga0068862_1000417342 477
797 3300005844 Ga0068862_100056683 Ga0068862_1000566832 477
798 3300005844 Ga0068862_100061758 Ga0068862_1000617582 477
799 3300006237 Ga0097621_100034286 Ga0097621_1000342862 477
800 3300006237 Ga0097621_100131299 Ga0097621_1001312992 477
801 3300006358 Ga0068871_100010918 Ga0068871_1000109183 477
802 3300006358 Ga0068871_100020682 Ga0068871_1000206822 477
803 3300006358 Ga0068871_100078028 Ga0068871_1000780282 477
804 3300006871 Ga0075434_100217527 Ga0075434_1002175272 477
805 3300006881 Ga0068865_100029143 Ga0068865_1000291433 477
806 3300006931 Ga0097620_100002372 Ga0097620_10000237215 477
807 3300006931 Ga0097620_100003577 Ga0097620_10000357716 477
808 3300006931 Ga0097620_100042633 Ga0097620_1000426332 477
809 3300006931 Ga0097620_100059240 Ga0097620_1000592402 477
810 3300009094 Ga0111539_10115047 Ga0111539_101150472 477
811 3300009098 Ga0105245_10029258 Ga0105245_100292582 477
812 3300009101 Ga0105247_10032359 Ga0105247_100323593 477
813 3300009148 Ga0105243_10035079 Ga0105243_100350793 477
814 3300009177 Ga0105248_10002044 Ga0105248_100020443 477
815 3300009177 Ga0105248_10009798 Ga0105248_100097985 477
816 3300009177 Ga0105248_10020721 Ga0105248_100207211 477
817 3300009177 Ga0105248_10166548 Ga0105248_101665482 477
818 3300009553 Ga0105249_10049391 Ga0105249_100493912 477
819 3300013308 Ga0157375_10010250 Ga0157375_100102502 477
820 3300013308 Ga0157375_10054701 Ga0157375_100547012 477
821 3300013308 Ga0157375_10054813 Ga0157375_100548132 477
822 3300013308 Ga0157375_10066889 Ga0157375_100668893 477
823 3300014325 Ga0163163_10017467 Ga0163163_100174674 477
824 3300014325 Ga0163163_10115197 Ga0163163_101151972 477
825 3300014326 Ga0157380_10032014 Ga0157380_100320142 477
826 3300014497 Ga0182008_10049376 Ga0182008_100493762 477
827 3300014968 Ga0157379_10007870 Ga0157379_100078704 477
828 3300014968 Ga0157379_10020780 Ga0157379_100207803 477
829 3300014969 Ga0157376_10094119 Ga0157376_100941192 477
830 3300015261 Ga0182006_1007864 Ga0182006_10078643 477
831 3300017792 Ga0163161_10021996 Ga0163161_100219964 477
832 3300025224 Ga0209784_100010 Ga0209784_100010564 477
833 3300025225 Ga0209566_100008 Ga0209566_100008564 477
834 3300025226 Ga0209674_100019 Ga0209674_100019564 477
835 3300025230 Ga0209563_100021 Ga0209563_100021564 477
836 3300025231 Ga0207427_102072 Ga0207427_1020725 477
837 3300025233 Ga0209437_100019 Ga0209437_100019564 477
838 3300025253 Ga0209677_100011 Ga0209677_100011564 477
839 3300025261 Ga0209233_1000025 Ga0209233_1000025564 477
840 3300025315 Ga0207697_10014393 Ga0207697_100143932 477
841 3300025315 Ga0207697_10023252 Ga0207697_100232522 477
842 3300025900 Ga0207710_10012401 Ga0207710_100124013 477
843 3300025901 Ga0207688_10089488 Ga0207688_100894882 477
844 3300025903 Ga0207680_10005170 Ga0207680_100051702 477
845 3300025903 Ga0207680_10023025 Ga0207680_100230252 477
846 3300025907 Ga0207645_10000549 Ga0207645_1000054917 477
847 3300025907 Ga0207645_10056454 Ga0207645_100564542 477
848 3300025908 Ga0207643_10010895 Ga0207643_100108952 477
849 3300025917 Ga0207660_10080220 Ga0207660_100802202 477
850 3300025923 Ga0207681_10008019 Ga0207681_100080195 477
851 3300025923 Ga0207681_10025579 Ga0207681_100255794 477
852 3300025925 Ga0207650_10007698 Ga0207650_100076986 477
853 3300025926 Ga0207659_10001823 Ga0207659_100018234 477
854 3300025926 Ga0207659_10002543 Ga0207659_100025439 477
855 3300025928 Ga0207700_10000209 Ga0207700_1000020915 477
856 3300025931 Ga0207644_10002955 Ga0207644_100029557 477
857 3300025933 Ga0207706_10039869 Ga0207706_100398692 477
858 3300025933 Ga0207706_10082514 Ga0207706_100825143 477
859 3300025935 Ga0207709_10019778 Ga0207709_100197782 477
860 3300025937 Ga0207669_10055128 Ga0207669_100551282 477
861 3300025938 Ga0207704_10001029 Ga0207704_100010292 477
862 3300025938 Ga0207704_10003578 Ga0207704_100035783 477
863 3300025938 Ga0207704_10054456 Ga0207704_100544562 477
864 3300025940 Ga0207691_10000105 Ga0207691_1000010555 477
865 3300025940 Ga0207691_10018938 Ga0207691_100189382 477
866 3300025940 Ga0207691_10040328 Ga0207691_100403283 477
867 3300025941 Ga0207711_10032218 Ga0207711_100322182 477
868 3300025942 Ga0207689_10000280 Ga0207689_100002804 477
869 3300025942 Ga0207689_10061855 Ga0207689_100618552 477
870 3300025942 Ga0207689_10094298 Ga0207689_100942982 477
871 3300025960 Ga0207651_10009785 Ga0207651_100097855 477
872 3300025960 Ga0207651_10040178 Ga0207651_100401782 477
873 3300025960 Ga0207651_10063916 Ga0207651_100639162 477
874 3300025961 Ga0207712_10018035 Ga0207712_100180352 477
875 3300025972 Ga0207668_10009416 Ga0207668_100094164 477
876 3300025972 Ga0207668_10013512 Ga0207668_100135124 477
877 3300025972 Ga0207668_10111395 Ga0207668_101113952 477
878 3300025986 Ga0207658_10003703 Ga0207658_100037032 477
879 3300025986 Ga0207658_10016389 Ga0207658_100163892 477
880 3300025986 Ga0207658_10243707 Ga0207658_102437071 477
881 3300026023 Ga0207677_10016469 Ga0207677_100164692 477
882 3300026035 Ga0207703_10002556 Ga0207703_100025562 477
883 3300026035 Ga0207703_10007174 Ga0207703_100071749 477
884 3300026035 Ga0207703_10010786 Ga0207703_100107864 477
885 3300026067 Ga0207678_10049530 Ga0207678_100495303 477
886 3300026075 Ga0207708_10053137 Ga0207708_100531372 477
887 3300026075 Ga0207708_10071542 Ga0207708_100715422 477
888 3300026078 Ga0207702_10049691 Ga0207702_100496913 477
889 3300026088 Ga0207641_10018825 Ga0207641_100188253 477
890 3300026088 Ga0207641_10023973 Ga0207641_100239735 477
891 3300026088 Ga0207641_10094025 Ga0207641_100940252 477
892 3300026088 Ga0207641_10169323 Ga0207641_101693232 477
893 3300026088 Ga0207641_10255224 Ga0207641_102552242 477
894 3300026089 Ga0207648_10000320 Ga0207648_1000032016 477
895 3300026089 Ga0207648_10006803 Ga0207648_100068035 477
896 3300026089 Ga0207648_10016468 Ga0207648_100164684 477
897 3300026089 Ga0207648_10035662 Ga0207648_100356622 477
898 3300026095 Ga0207676_10011495 Ga0207676_100114953 477
899 3300026095 Ga0207676_10013054 Ga0207676_100130543 477
900 3300026095 Ga0207676_10013290 Ga0207676_100132902 477
901 3300026095 Ga0207676_10029112 Ga0207676_100291123 477
902 3300026095 Ga0207676_10162743 Ga0207676_101627432 477
903 3300026095 Ga0207676_10187202 Ga0207676_101872022 477
904 3300026116 Ga0207674_10030905 Ga0207674_100309053 477
905 3300026118 Ga0207675_100009583 Ga0207675_1000095832 477
906 3300026118 Ga0207675_100012572 Ga0207675_1000125725 477
907 3300026118 Ga0207675_100036832 Ga0207675_1000368322 477
908 3300026121 Ga0207683_10001281 Ga0207683_1000128121 477
909 3300026121 Ga0207683_10012093 Ga0207683_100120936 477
910 3300026121 Ga0207683_10099612 Ga0207683_100996122 477
911 3300026121 Ga0207683_10125895 Ga0207683_101258952 477
912 3300026142 Ga0207698_10005671 Ga0207698_100056712 477
913 3300027907 Ga0207428_10058536 Ga0207428_100585362 477
914 3300027907 Ga0207428_10087624 Ga0207428_100876242 477
915 3300028380 Ga0268265_10025215 Ga0268265_100252153 477
916 3300028380 Ga0268265_10048832 Ga0268265_100488322 477
917 3300028381 Ga0268264_10008321 Ga0268264_100083216 477
918 3300028381 Ga0268264_10035972 Ga0268264_100359725 477
919 3300028381 Ga0268264_10071659 Ga0268264_100716592 477
920 3300031548 Ga0307408_100028855 Ga0307408_1000288552 477
921 3300031731 Ga0307405_10003255 Ga0307405_100032552 477
922 3300031852 Ga0307410_10001960 Ga0307410_100019602 477
923 3300031901 Ga0307406_10027934 Ga0307406_100279343 477
924 3300031901 Ga0307406_10040728 Ga0307406_100407282 477
925 3300031903 Ga0307407_10001283 Ga0307407_100012832 477
926 3300031911 Ga0307412_10001820 Ga0307412_100018203 477
927 3300031911 Ga0307412_10135456 Ga0307412_101354562 477
928 3300031995 Ga0307409_100004831 Ga0307409_1000048315 477
929 3300032002 Ga0307416_100007807 Ga0307416_1000078072 477
930 3300032002 Ga0307416_100019906 Ga0307416_1000199062 477
931 3300032005 Ga0307411_10012027 Ga0307411_100120273 477
932 3300032005 Ga0307411_10070410 Ga0307411_100704102 477
933 3300032126 Ga0307415_100007103 Ga0307415_1000071032 477
934 3300035692 Ga0373935_0008119 Ga0373935_0008119_2178_3638 477
935 3300035725 Ga0373947_0016263 Ga0373947_0016263_1674_3134 477
936 3300036401 Ga0373937_0007414 Ga0373937_0007414_1615_3075 477
937 3300037068 Ga0373925_0031520 Ga0373925_0031520_1924_3378 477
938 3300037471 Ga0395905_0000167 Ga0395905_0000167_99516_100979 477
939 3300042439 Ga0439464_0004023 Ga0439464_0004023_445_1881 477
940 3300046454 Ga0495592_0058453 Ga0495592_0058453_55_1515 477
941 3300046462 Ga0495651_0003918 Ga0495651_0003918_7498_8958 477
942 3300046463 Ga0495653_0004554 Ga0495653_0004554_5992_7452 477
943 3300046511 Ga0495608_0004039 Ga0495608_0004039_4803_6263 477
944 3300046514 Ga0495618_0009666 Ga0495618_0009666_1014_2474 477
945 3300046516 Ga0495628_0002401 Ga0495628_0002401_10414_11874 477
946 3300046516 Ga0495628_0004370 Ga0495628_0004370_5619_7079 477
947 3300046529 Ga0495652_0007905 Ga0495652_0007905_2619_4076 477
948 3300046543 Ga0495645_0016092 Ga0495645_0016092_2441_3901 477
949 3300046543 Ga0495645_0025940 Ga0495645_0025940_670_2130 477
950 3300046660 Ga0495625_0000336 Ga0495625_0000336_48250_49707 477
951 3300046675 Ga0495657_0089713 Ga0495657_0089713_288_1748 477
952 3300046678 Ga0495599_0000731 Ga0495599_0000731_15699_17159 477
953 3300046680 Ga0495646_0003800 Ga0495646_0003800_7600_9060 477
954 3300046683 Ga0495658_0071811 Ga0495658_0071811_359_1816 477
955 3300046809 Ga0495600_0000574 Ga0495600_0000574_12603_14063 477
956 3300047317 Ga0495604_0006351 Ga0495604_0006351_4510_5970 477
957 3300048088 Ga0495602_0081917 Ga0495602_0081917_1208_2668 477
958 3300048905 Ga0496102_0034159 Ga0496102_0034159_1434_2888 477
959 3300048907 Ga0496104_0028189 Ga0496104_0028189_410_1846 477
960 3300049581 Ga0501047_0002160 Ga0501047_0002160_4153_5610 477
961 3300049585 Ga0501069_0011483 Ga0501069_0011483_2819_4276 477
962 3300049586 Ga0501070_0001480 Ga0501070_0001480_7969_9426 477
963 3300049589 Ga0501073_0000067 Ga0501073_0000067_34698_36155 477
964 3300049590 Ga0501074_0000588 Ga0501074_0000588_10056_11513 477
965 3300049742 Ga0501080_0034930 Ga0501080_0034930_164_1621 477
966 3300049744 Ga0501083_0000515 Ga0501083_0000515_11548_13005 477
967 3300049822 Ga0501035_0056178 Ga0501035_0056178_1701_3158 477
968 3300050512 nmdc:mga0n895_131858_c1 nmdc:mga0n895_131858_c1_158_1618 477
969 3300053141 Ga0500574_002682 Ga0500574_002682_486_1946 477
970 iso_pu_bacteria 2513237150 2513952653 477
971 iso_pu_bacteria 2513237165 2514045193 477
972 iso_pu_bacteria 644736347 644750736 477
973 3300002244 JGI24742J22300_10004324 JGI24742J22300_100043242 478
974 3300005290 Ga0065712_10076177 Ga0065712_100761772 478
975 3300005328 Ga0070676_10043269 Ga0070676_100432692 478
976 3300005329 Ga0070683_100017202 Ga0070683_1000172022 478
977 3300005330 Ga0070690_100022632 Ga0070690_1000226322 478
978 3300005331 Ga0070670_100024381 Ga0070670_1000243813 478
979 3300005333 Ga0070677_10023498 Ga0070677_100234982 478
980 3300005340 Ga0070689_100005644 Ga0070689_1000056444 478
981 3300005343 Ga0070687_100000725 Ga0070687_1000007255 478
982 3300005344 Ga0070661_100013669 Ga0070661_1000136694 478
983 3300005345 Ga0070692_10018619 Ga0070692_100186192 478
984 3300005354 Ga0070675_100177231 Ga0070675_1001772312 478
985 3300005356 Ga0070674_100098106 Ga0070674_1000981062 478
986 3300005365 Ga0070688_100007940 Ga0070688_1000079402 478
987 3300005366 Ga0070659_100069679 Ga0070659_1000696792 478
988 3300005438 Ga0070701_10083976 Ga0070701_100839761 478
989 3300005457 Ga0070662_100057765 Ga0070662_1000577652 478
990 3300005466 Ga0070685_10023432 Ga0070685_100234322 478
991 3300005539 Ga0068853_100098240 Ga0068853_1000982402 478
992 3300005544 Ga0070686_100072944 Ga0070686_1000729442 478
993 3300005616 Ga0068852_100015228 Ga0068852_1000152282 478
994 3300005617 Ga0068859_100035283 Ga0068859_1000352833 478
995 3300005617 Ga0068859_100223378 Ga0068859_1002233782 478
996 3300005618 Ga0068864_100006417 Ga0068864_1000064172 478
997 3300005718 Ga0068866_10002154 Ga0068866_100021543 478
998 3300005719 Ga0068861_100020256 Ga0068861_1000202562 478
999 3300005834 Ga0068851_10004667 Ga0068851_100046673 478
1000 3300005840 Ga0068870_10001765 Ga0068870_100017656 478
1001 3300005841 Ga0068863_100148406 Ga0068863_1001484062 478
1002 3300005842 Ga0068858_100089727 Ga0068858_1000897273 478
1003 3300005843 Ga0068860_100041016 Ga0068860_1000410162 478
1004 3300006931 Ga0097620_100035282 Ga0097620_1000352823 478
1005 3300006931 Ga0097620_100223359 Ga0097620_1002233592 478
1006 3300009094 Ga0111539_10039561 Ga0111539_100395612 478
1007 3300009148 Ga0105243_10070583 Ga0105243_100705832 478
1008 3300009177 Ga0105248_10116645 Ga0105248_101166452 478
1009 3300009551 Ga0105238_10212985 Ga0105238_102129852 478
1010 3300009553 Ga0105249_10024270 Ga0105249_100242702 478
1011 3300013296 Ga0157374_10039253 Ga0157374_100392533 478
1012 3300013296 Ga0157374_10047421 Ga0157374_100474213 478
1013 3300013297 Ga0157378_10043470 Ga0157378_100434703 478
1014 3300013306 Ga0163162_10100788 Ga0163162_101007882 478
1015 3300013308 Ga0157375_10183362 Ga0157375_101833622 478
1016 3300014326 Ga0157380_10045371 Ga0157380_100453711 478
1017 3300014968 Ga0157379_10005362 Ga0157379_100053623 478
1018 3300014969 Ga0157376_10062505 Ga0157376_100625053 478
1019 3300017792 Ga0163161_10010292 Ga0163161_100102922 478
1020 3300025315 Ga0207697_10000570 Ga0207697_100005702 478
1021 3300025893 Ga0207682_10000037 Ga0207682_1000003739 478
1022 3300025899 Ga0207642_10032752 Ga0207642_100327522 478
1023 3300025908 Ga0207643_10000184 Ga0207643_100001846 478
1024 3300025913 Ga0207695_10054043 Ga0207695_100540434 478
1025 3300025918 Ga0207662_10000381 Ga0207662_100003812 478
1026 3300025919 Ga0207657_10143172 Ga0207657_101431721 478
1027 3300025923 Ga0207681_10070544 Ga0207681_100705442 478
1028 3300025925 Ga0207650_10002667 Ga0207650_100026674 478
1029 3300025925 Ga0207650_10031866 Ga0207650_100318663 478
1030 3300025926 Ga0207659_10003407 Ga0207659_100034075 478
1031 3300025931 Ga0207644_10009799 Ga0207644_100097993 478
1032 3300025934 Ga0207686_10006148 Ga0207686_100061483 478
1033 3300025936 Ga0207670_10006415 Ga0207670_100064156 478
1034 3300025938 Ga0207704_10004265 Ga0207704_100042655 478
1035 3300025940 Ga0207691_10002234 Ga0207691_100022347 478
1036 3300025941 Ga0207711_10042809 Ga0207711_100428093 478
1037 3300025942 Ga0207689_10019933 Ga0207689_100199333 478
1038 3300025945 Ga0207679_10006792 Ga0207679_100067925 478
1039 3300025960 Ga0207651_10025618 Ga0207651_100256182 478
1040 3300025972 Ga0207668_10110882 Ga0207668_101108822 478
1041 3300025986 Ga0207658_10059486 Ga0207658_100594862 478
1042 3300026023 Ga0207677_10073542 Ga0207677_100735422 478
1043 3300026035 Ga0207703_10027160 Ga0207703_100271603 478
1044 3300026075 Ga0207708_10005067 Ga0207708_100050677 478
1045 3300026088 Ga0207641_10074038 Ga0207641_100740382 478
1046 3300026095 Ga0207676_10014707 Ga0207676_100147075 478
1047 3300026116 Ga0207674_10003123 Ga0207674_1000312311 478
1048 3300026118 Ga0207675_100000538 Ga0207675_10000053827 478
1049 3300026142 Ga0207698_10076080 Ga0207698_100760802 478
1050 3300027378 Ga0209981_1002185 Ga0209981_10021854 478
1051 3300037418 Ga0395900_0058900 Ga0395900_0058900_366_1805 478
1052 3300037471 Ga0395905_0024202 Ga0395905_0024202_1685_3124 478
1053 3300042876 Ga0451577_0054128 Ga0451577_0054128_1435_2883 478
1054 3300044712 Ga0453684_0136057 Ga0453684_0136057_612_2060 478
1055 3300045051 Ga0451576_0115595 Ga0451576_0115595_754_2211 478
1056 3300048904 Ga0496101_0015940 Ga0496101_0015940_1146_2606 478
1057 3300048905 Ga0496102_0097188 Ga0496102_0097188_900_2360 478
1058 3300048908 Ga0496105_0012490 Ga0496105_0012490_2348_3808 478
1059 3300048909 Ga0496106_0014091 Ga0496106_0014091_2060_3520 478
1060 3300048910 Ga0496107_0034910 Ga0496107_0034910_879_2339 478
1061 3300048911 Ga0496108_0031647 Ga0496108_0031647_2420_3880 478
1062 3300048912 Ga0496109_0043374 Ga0496109_0043374_2128_3588 478
1063 3300048913 Ga0496110_0012905 Ga0496110_0012905_4232_5692 478
1064 3300048917 Ga0496114_0107069 Ga0496114_0107069_594_2054 478
1065 3300050511 nmdc:mga08y16_58737_c1 nmdc:mga08y16_58737_c1_2164_3624 478
1066 iso_pu_bacteria 2513237166 2514051201 478
1067 iso_pu_bacteria 2562617112 2563056455 478
1068 iso_pu_bacteria 2599185214 2599622547 478
1069 iso_pu_bacteria 2599185226 2599671026 478
1070 iso_pu_bacteria 2599185227 2599679937 478
1071 iso_pu_bacteria 2599185229 2599691953 478
1072 iso_pu_bacteria 2599185240 2599744459 478
1073 iso_pu_bacteria 2599185355 2600206496 478
1074 iso_pu_bacteria 2643221683 2644468913 478
1075 iso_pu_bacteria 2675903129 2676744664 478
1076 iso_pu_bacteria 2711768613 2713481537 478
1077 iso_pu_bacteria 2738541277 2738722136 478
1078 iso_pu_bacteria 2738541307 2738883058 478
1079 iso_pu_bacteria 2738543019 2739282500 478
1080 iso_pu_bacteria 2744054900 2746087591 478
1081 iso_pu_bacteria 2744054900 2746089086 478
1082 iso_pu_bacteria 2744054901 2746095953 478
1083 iso_pu_bacteria 2744054901 2746097218 478
1084 iso_pu_bacteria 2791355137 2792835200 478
1085 iso_pu_bacteria 2831265667 2831271413 478
1086 iso_pu_bacteria 2842324504 2842325548 478
1087 iso_pu_bacteria 2842348783 2842349827 478
1088 iso_pu_bacteria 2842454564 2842454936 478
1089 iso_pu_bacteria 2863421361 2863426175 478
1090 iso_pu_bacteria 2870068957 2870069764 478
1091 iso_pu_bacteria 2900634093 2900639910 478
1092 iso_pu_bacteria 2904541872 2904544283 478
1093 iso_pu_bacteria 2904564687 2904570857 478
1094 iso_pu_bacteria 2904571731 2904578021 478
1095 iso_pu_bacteria 2904615490 2904621078 478
1096 iso_pu_bacteria 2921643360 2921643460 478
1097 iso_pu_bacteria 2928070936 2928077572 478
1098 iso_pu_bacteria 2928157003 2928161704 478
1099 iso_pu_bacteria 2928163908 2928170727 478
1100 iso_pu_bacteria 2928170801 2928176712 478
1101 iso_pu_bacteria 2928536128 2928539346 478
1102 iso_pu_bacteria 2929160207 2929162145 478
1103 iso_pu_bacteria 2945909444 2945913450 478
1104 iso_pu_bacteria 2945984333 2945991157 478
1105 iso_pu_bacteria 2954767861 2954767932 478
1106 iso_pu_bacteria 2981990288 2981993131 478
1107 iso_pu_bacteria 641736154 642414755 478
1108 iso_pu_bacteria 642555113 642615464 478
1109 iso_pu_bacteria 8020938398 8020940783 478
1110 iso_pu_bacteria 8020945358 8020949034 478
1111 iso_pu_bacteria 8020953355 8020956353 478
1112 iso_pu_bacteria 8055266321 8055272939 478
1113 3300005336 Ga0070680_100003143 Ga0070680_1000031436 479
1114 3300005344 Ga0070661_100014791 Ga0070661_1000147913 479
1115 3300005345 Ga0070692_10006942 Ga0070692_100069424 479
1116 3300005354 Ga0070675_100061149 Ga0070675_1000611491 479
1117 3300005355 Ga0070671_100034527 Ga0070671_1000345272 479
1118 3300005355 Ga0070671_100037375 Ga0070671_1000373752 479
1119 3300005364 Ga0070673_100049389 Ga0070673_1000493892 479
1120 3300005366 Ga0070659_100003843 Ga0070659_1000038436 479
1121 3300005444 Ga0070694_100006213 Ga0070694_1000062134 479
1122 3300005455 Ga0070663_100026453 Ga0070663_1000264533 479
1123 3300005545 Ga0070695_100095895 Ga0070695_1000958951 479
1124 3300005546 Ga0070696_100124032 Ga0070696_1001240321 479
1125 3300005563 Ga0068855_100001125 Ga0068855_1000011254 479
1126 3300005564 Ga0070664_100001613 Ga0070664_1000016134 479
1127 3300005614 Ga0068856_100002166 Ga0068856_1000021662 479
1128 3300005616 Ga0068852_100005228 Ga0068852_1000052282 479
1129 3300005617 Ga0068859_100215824 Ga0068859_1002158241 479
1130 3300005834 Ga0068851_10058505 Ga0068851_100585051 479
1131 3300005843 Ga0068860_100022270 Ga0068860_1000222703 479
1132 3300005844 Ga0068862_100003581 Ga0068862_10000358116 479
1133 3300006195 Ga0075366_10012563 Ga0075366_100125634 479
1134 3300006844 Ga0075428_100008716 Ga0075428_1000087163 479
1135 3300006847 Ga0075431_100020085 Ga0075431_1000200855 479
1136 3300006931 Ga0097620_100215825 Ga0097620_1002158251 479
1137 3300009148 Ga0105243_10058069 Ga0105243_100580692 479
1138 3300013102 Ga0157371_10001585 Ga0157371_100015852 479
1139 3300013307 Ga0157372_10088187 Ga0157372_100881872 479
1140 3300025907 Ga0207645_10057329 Ga0207645_100573292 479
1141 3300025919 Ga0207657_10002428 Ga0207657_100024284 479
1142 3300025920 Ga0207649_10013503 Ga0207649_100135032 479
1143 3300025931 Ga0207644_10022344 Ga0207644_100223443 479
1144 3300025932 Ga0207690_10068112 Ga0207690_100681122 479
1145 3300025933 Ga0207706_10000095 Ga0207706_1000009568 479
1146 3300025945 Ga0207679_10003260 Ga0207679_100032606 479
1147 3300025949 Ga0207667_10000233 Ga0207667_1000023340 479
1148 3300025960 Ga0207651_10016687 Ga0207651_100166872 479
1149 3300025981 Ga0207640_10074435 Ga0207640_100744352 479
1150 3300026067 Ga0207678_10002265 Ga0207678_1000226515 479
1151 3300026078 Ga0207702_10033667 Ga0207702_100336672 479
1152 3300026142 Ga0207698_10162137 Ga0207698_101621371 479
1153 3300027395 Ga0209996_1004197 Ga0209996_10041971 479
1154 3300027526 Ga0209968_1000396 Ga0209968_10003965 479
1155 3300027543 Ga0209999_1004658 Ga0209999_10046581 479
1156 3300027682 Ga0209971_1001455 Ga0209971_10014553 479
1157 3300027695 Ga0209966_1000155 Ga0209966_100015514 479
1158 3300027876 Ga0209974_10028031 Ga0209974_100280312 479
1159 3300028380 Ga0268265_10080832 Ga0268265_100808321 479
1160 3300028381 Ga0268264_10029108 Ga0268264_100291083 479
1161 3300031235 Ga0265330_10001082 Ga0265330_1000108211 479
1162 3300031238 Ga0265332_10004366 Ga0265332_100043662 479
1163 3300031242 Ga0265329_10001186 Ga0265329_100011862 479
1164 3300031250 Ga0265331_10000350 Ga0265331_1000035016 479
1165 3300031711 Ga0265314_10007574 Ga0265314_100075743 479
1166 3300031712 Ga0265342_10059656 Ga0265342_100596562 479
1167 3300031731 Ga0307405_10001511 Ga0307405_100015113 479
1168 3300031824 Ga0307413_10025501 Ga0307413_100255012 479
1169 3300031852 Ga0307410_10000988 Ga0307410_100009887 479
1170 3300031901 Ga0307406_10046752 Ga0307406_100467522 479
1171 3300031995 Ga0307409_100002217 Ga0307409_1000022172 479
1172 3300032126 Ga0307415_100026213 Ga0307415_1000262132 479
1173 3300036401 Ga0373937_0011810 Ga0373937_0011810_1106_2569 479
1174 3300041408 Ga0439453_0001473 Ga0439453_0001473_1507_2955 479
1175 3300042003 Ga0439443_000225 Ga0439443_000225_817_2265 479
1176 3300046459 Ga0495629_0039444 Ga0495629_0039444_940_2403 479
1177 3300048905 Ga0496102_0019884 Ga0496102_0019884_2997_4457 479
1178 3300048905 Ga0496102_0202635 Ga0496102_0202635_118_1578 479
1179 3300048906 Ga0496103_0018691 Ga0496103_0018691_752_2212 479
1180 3300048921 Ga0496118_0043723 Ga0496118_0043723_884_2344 479
1181 3300049572 Ga0501036_0023251 Ga0501036_0023251_1900_3348 479
1182 3300049574 Ga0501038_0050477 Ga0501038_0050477_484_1932 479
1183 3300049576 Ga0501040_0009684 Ga0501040_0009684_3821_5269 479
1184 3300049577 Ga0501041_0003172 Ga0501041_0003172_3450_4898 479
1185 3300049577 Ga0501041_0014118 Ga0501041_0014118_3265_4713 479
1186 3300049578 Ga0501042_0013253 Ga0501042_0013253_1665_3113 479
1187 3300049588 Ga0501072_0013754 Ga0501072_0013754_2211_3659 479
1188 3300049590 Ga0501074_0021833 Ga0501074_0021833_3091_4542 479
1189 3300049591 Ga0501075_0039065 Ga0501075_0039065_1311_2759 479
1190 3300049592 Ga0501076_0070867 Ga0501076_0070867_721_2169 479
1191 3300049741 Ga0501079_0009324 Ga0501079_0009324_2022_3470 479
1192 3300049743 Ga0501081_0004799 Ga0501081_0004799_3849_5297 479
1193 3300049824 Ga0501045_0005237 Ga0501045_0005237_4242_5690 479
1194 3300049824 Ga0501045_0057126 Ga0501045_0057126_1269_2717 479
1195 3300050493 nmdc:mga0k408_7246_c1 nmdc:mga0k408_7246_c1_1757_3199 479
1196 3300061734 Ga0530510_0003494 Ga0530510_0003494_2650_4098 479
1197 iso_pu_bacteria 2885198086 2885200496 479
1198 iso_pu_bacteria 2885211737 2885214721 479
1199 3300003354 JGI25160J50197_1000031 JGI25160J50197_100003113 480
1200 3300003758 Ga0055532_1003245 Ga0055532_10032452 480
1201 3300003761 Ga0055535_1001815 Ga0055535_10018152 480
1202 3300003762 Ga0055542_1001741 Ga0055542_10017412 480
1203 3300003763 Ga0055529_1000475 Ga0055529_10004759 480
1204 3300005262 Ga0065165_1000075 Ga0065165_100007514 480
1205 3300005328 Ga0070676_10023184 Ga0070676_100231842 480
1206 3300005329 Ga0070683_100008040 Ga0070683_1000080408 480
1207 3300005331 Ga0070670_100059254 Ga0070670_1000592542 480
1208 3300005331 Ga0070670_100166491 Ga0070670_1001664912 480
1209 3300005347 Ga0070668_100008228 Ga0070668_1000082286 480
1210 3300005355 Ga0070671_100005362 Ga0070671_1000053627 480
1211 3300005355 Ga0070671_100033607 Ga0070671_1000336072 480
1212 3300005364 Ga0070673_100057489 Ga0070673_1000574891 480
1213 3300005458 Ga0070681_10001589 Ga0070681_1000158910 480
1214 3300005459 Ga0068867_100023683 Ga0068867_1000236832 480
1215 3300005543 Ga0070672_100069573 Ga0070672_1000695732 480
1216 3300005548 Ga0070665_100139011 Ga0070665_1001390112 480
1217 3300005564 Ga0070664_100001477 Ga0070664_1000014773 480
1218 3300005615 Ga0070702_100068989 Ga0070702_1000689891 480
1219 3300005616 Ga0068852_100001185 Ga0068852_1000011853 480
1220 3300005618 Ga0068864_100024363 Ga0068864_1000243632 480
1221 3300005841 Ga0068863_100175672 Ga0068863_1001756722 480
1222 3300005843 Ga0068860_100120259 Ga0068860_1001202591 480
1223 3300006237 Ga0097621_100001301 Ga0097621_10000130117 480
1224 3300006358 Ga0068871_100000155 Ga0068871_10000015529 480
1225 3300006881 Ga0068865_100055654 Ga0068865_1000556542 480
1226 3300007788 Ga0099795_10000213 Ga0099795_100002132 480
1227 3300009148 Ga0105243_10017029 Ga0105243_100170294 480
1228 3300009177 Ga0105248_10102047 Ga0105248_101020472 480
1229 3300013105 Ga0157369_10007892 Ga0157369_1000789211 480
1230 3300013297 Ga0157378_10018771 Ga0157378_100187713 480
1231 3300014326 Ga0157380_10095817 Ga0157380_100958172 480
1232 3300014968 Ga0157379_10091663 Ga0157379_100916632 480
1233 3300014969 Ga0157376_10067225 Ga0157376_100672252 480
1234 3300015683 Ga0183362_10002 Ga0183362_10002731 480
1235 3300017792 Ga0163161_10195994 Ga0163161_101959941 480
1236 3300025228 Ga0209672_100263 Ga0209672_10026310 480
1237 3300025229 Ga0209147_100313 Ga0209147_10031310 480
1238 3300025242 Ga0209258_100498 Ga0209258_10049810 480
1239 3300025254 Ga0209148_1000518 Ga0209148_100051810 480
1240 3300025256 Ga0209759_1000077 Ga0209759_100007793 480
1241 3300025256 Ga0209759_1001862 Ga0209759_10018624 480
1242 3300025272 Ga0209455_1000272 Ga0209455_10002729 480
1243 3300025302 Ga0207426_1000158 Ga0207426_1000158139 480
1244 3300025303 Ga0209051_1016656 Ga0209051_10166563 480
1245 3300025893 Ga0207682_10000481 Ga0207682_100004814 480
1246 3300025901 Ga0207688_10003561 Ga0207688_100035612 480
1247 3300025903 Ga0207680_10027578 Ga0207680_100275782 480
1248 3300025903 Ga0207680_10042523 Ga0207680_100425232 480
1249 3300025907 Ga0207645_10020182 Ga0207645_100201822 480
1250 3300025912 Ga0207707_10004954 Ga0207707_100049547 480
1251 3300025925 Ga0207650_10017067 Ga0207650_100170674 480
1252 3300025927 Ga0207687_10151625 Ga0207687_101516252 480
1253 3300025931 Ga0207644_10000896 Ga0207644_1000089618 480
1254 3300025931 Ga0207644_10002261 Ga0207644_100022619 480
1255 3300025933 Ga0207706_10087979 Ga0207706_100879792 480
1256 3300025935 Ga0207709_10008886 Ga0207709_100088862 480
1257 3300025940 Ga0207691_10007608 Ga0207691_100076085 480
1258 3300025941 Ga0207711_10017928 Ga0207711_100179282 480
1259 3300025941 Ga0207711_10026589 Ga0207711_100265893 480
1260 3300025944 Ga0207661_10083028 Ga0207661_100830282 480
1261 3300025945 Ga0207679_10020528 Ga0207679_100205285 480
1262 3300026023 Ga0207677_10133458 Ga0207677_101334582 480
1263 3300026075 Ga0207708_10016854 Ga0207708_100168542 480
1264 3300026088 Ga0207641_10011927 Ga0207641_100119277 480
1265 3300026088 Ga0207641_10032159 Ga0207641_100321591 480
1266 3300026089 Ga0207648_10018704 Ga0207648_100187042 480
1267 3300026089 Ga0207648_10075768 Ga0207648_100757682 480
1268 3300026095 Ga0207676_10085097 Ga0207676_100850971 480
1269 3300026118 Ga0207675_100006767 Ga0207675_1000067675 480
1270 3300026118 Ga0207675_100025952 Ga0207675_1000259524 480
1271 3300026121 Ga0207683_10000189 Ga0207683_1000018923 480
1272 3300026142 Ga0207698_10012586 Ga0207698_100125866 480
1273 3300028381 Ga0268264_10174429 Ga0268264_101744291 480
1274 3300031239 Ga0265328_10007375 Ga0265328_100073753 480
1275 3300031251 Ga0265327_10054342 Ga0265327_100543422 480
1276 3300031548 Ga0307408_100008532 Ga0307408_1000085323 480
1277 3300037471 Ga0395905_0000057 Ga0395905_0000057_95560_97017 480
1278 3300039437 Ga0436365_0960063 Ga0436365_0960063_2478_3944 480
1279 3300046455 Ga0495603_0017236 Ga0495603_0017236_390_1847 480
1280 3300046459 Ga0495629_0000042 Ga0495629_0000042_37581_39053 480
1281 3300046459 Ga0495629_0001082 Ga0495629_0001082_4668_6125 480
1282 3300046459 Ga0495629_0012741 Ga0495629_0012741_845_2302 480
1283 3300046463 Ga0495653_0000321 Ga0495653_0000321_27156_28628 480
1284 3300046471 Ga0495650_0022112 Ga0495650_0022112_456_1928 480
1285 3300046472 Ga0495580_0000355 Ga0495580_0000355_9091_10545 480
1286 3300046472 Ga0495580_0000357 Ga0495580_0000357_20442_21899 480
1287 3300046472 Ga0495580_0005233 Ga0495580_0005233_8334_9806 480
1288 3300046473 Ga0495582_0000803 Ga0495582_0000803_955_2412 480
1289 3300046473 Ga0495582_0057192 Ga0495582_0057192_471_1943 480
1290 3300046474 Ga0495605_0036748 Ga0495605_0036748_615_2072 480
1291 3300046476 Ga0495662_0017399 Ga0495662_0017399_541_1998 480
1292 3300046477 Ga0495664_0059308 Ga0495664_0059308_44_1501 480
1293 3300046499 Ga0495594_0044741 Ga0495594_0044741_128_1585 480
1294 3300046506 Ga0495583_0019594 Ga0495583_0019594_1271_2728 480
1295 3300046506 Ga0495583_0032370 Ga0495583_0032370_981_2453 480
1296 3300046507 Ga0495606_0037544 Ga0495606_0037544_147_1619 480
1297 3300046514 Ga0495618_0000764 Ga0495618_0000764_517_1974 480
1298 3300046515 Ga0495620_0005754 Ga0495620_0005754_1379_2851 480
1299 3300046516 Ga0495628_0007611 Ga0495628_0007611_2219_3676 480
1300 3300046516 Ga0495628_0018544 Ga0495628_0018544_1150_2604 480
1301 3300046516 Ga0495628_0063419 Ga0495628_0063419_1345_2817 480
1302 3300046517 Ga0495630_0003094 Ga0495630_0003094_4930_6387 480
1303 3300046517 Ga0495630_0111536 Ga0495630_0111536_383_1837 480
1304 3300046524 Ga0495648_0002871 Ga0495648_0002871_12509_13966 480
1305 3300046524 Ga0495648_0032508 Ga0495648_0032508_646_2103 480
1306 3300046526 Ga0495666_0000243 Ga0495666_0000243_1482_2939 480
1307 3300046533 Ga0495640_0016325 Ga0495640_0016325_3591_5048 480
1308 3300046536 Ga0495587_0007176 Ga0495587_0007176_659_2116 480
1309 3300046543 Ga0495645_0000691 Ga0495645_0000691_487_1944 480
1310 3300046557 Ga0495622_0011113 Ga0495622_0011113_424_1881 480
1311 3300046616 Ga0495668_0001832 Ga0495668_0001832_2733_4178 480
1312 3300046642 Ga0495634_0000449 Ga0495634_0000449_15274_16731 480
1313 3300046648 Ga0495611_0014066 Ga0495611_0014066_828_2285 480
1314 3300046660 Ga0495625_0031340 Ga0495625_0031340_718_2190 480
1315 3300046663 Ga0495635_0001225 Ga0495635_0001225_14567_16024 480
1316 3300046665 Ga0495661_0009270 Ga0495661_0009270_200_1672 480
1317 3300046678 Ga0495599_0003001 Ga0495599_0003001_8267_9724 480
1318 3300046678 Ga0495599_0009689 Ga0495599_0009689_3068_4522 480
1319 3300046679 Ga0495623_0010970 Ga0495623_0010970_1108_2562 480
1320 3300046679 Ga0495623_0054742 Ga0495623_0054742_490_1947 480
1321 3300046680 Ga0495646_0000273 Ga0495646_0000273_24812_26266 480
1322 3300046680 Ga0495646_0000495 Ga0495646_0000495_14542_15999 480
1323 3300046690 Ga0495624_0000216 Ga0495624_0000216_37581_39053 480
1324 3300046690 Ga0495624_0005260 Ga0495624_0005260_2661_4115 480
1325 3300046809 Ga0495600_0071242 Ga0495600_0071242_802_2259 480
1326 3300047315 Ga0495581_0000200 Ga0495581_0000200_8935_10392 480
1327 3300047317 Ga0495604_0001161 Ga0495604_0001161_15707_17161 480
1328 3300047317 Ga0495604_0001825 Ga0495604_0001825_632_2089 480
1329 3300047319 Ga0495674_0027772 Ga0495674_0027772_2148_3620 480
1330 3300047319 Ga0495674_0052470 Ga0495674_0052470_1013_2470 480
1331 3300047319 Ga0495674_0115719 Ga0495674_0115719_641_2098 480
1332 3300047321 Ga0495676_0014537 Ga0495676_0014537_550_2007 480
1333 3300047322 Ga0495680_0001617 Ga0495680_0001617_1444_2901 480
1334 3300047323 Ga0495683_0010201 Ga0495683_0010201_1321_2778 480
1335 3300047443 Ga0495687_016528 Ga0495687_016528_34_1491 480
1336 3300047444 Ga0495675_0031568 Ga0495675_0031568_1461_2915 480
1337 3300047446 Ga0495679_000023 Ga0495679_000023_77391_78863 480
1338 3300047673 Ga0495593_0005313 Ga0495593_0005313_1447_2904 480
1339 3300048088 Ga0495602_0022700 Ga0495602_0022700_589_2043 480
1340 3300048091 Ga0495626_0013149 Ga0495626_0013149_2399_3856 480
1341 3300048903 Ga0496100_0005628 Ga0496100_0005628_1202_2659 480
1342 3300048904 Ga0496101_0001603 Ga0496101_0001603_2745_4202 480
1343 3300048905 Ga0496102_0000134 Ga0496102_0000134_44571_46028 480
1344 3300048905 Ga0496102_0150641 Ga0496102_0150641_251_1711 480
1345 3300048906 Ga0496103_0008446 Ga0496103_0008446_930_2387 480
1346 3300048907 Ga0496104_0019309 Ga0496104_0019309_969_2423 480
1347 3300048908 Ga0496105_0001879 Ga0496105_0001879_2045_3499 480
1348 3300048910 Ga0496107_0100942 Ga0496107_0100942_19_1473 480
1349 3300048911 Ga0496108_0003455 Ga0496108_0003455_4326_5786 480
1350 3300048913 Ga0496110_0034532 Ga0496110_0034532_1140_2600 480
1351 3300048916 Ga0496113_0076740 Ga0496113_0076740_319_1767 480
1352 3300048919 Ga0496116_0000503 Ga0496116_0000503_17564_19006 480
1353 3300048919 Ga0496116_0038047 Ga0496116_0038047_843_2288 480
1354 3300048921 Ga0496118_0001420 Ga0496118_0001420_1261_2718 480
1355 3300048921 Ga0496118_0042544 Ga0496118_0042544_1020_2492 480
1356 3300048924 Ga0496121_0006720 Ga0496121_0006720_10554_12011 480
1357 3300049571 Ga0501034_0000875 Ga0501034_0000875_19917_21362 480
1358 3300050511 nmdc:mga08y16_215245_c1 nmdc:mga08y16_215245_c1_13_1515 480
1359 iso_pu_bacteria 2818991452 2819635891 480
1360 iso_pu_bacteria 8018845410 8018847106 480
1361 iso_pu_bacteria 8021120328 8021128100 480
1362 3300001979 JGI24740J21852_10013044 JGI24740J21852_100130443 482
1363 3300001989 JGI24739J22299_10005780 JGI24739J22299_100057805 482
1364 3300002773 JGI25152J39213_1000666 JGI25152J39213_100066610 482
1365 3300002987 JGI25159J45721_1002971 JGI25159J45721_10029712 482
1366 3300003187 JGI25151J46595_10001588 JGI25151J46595_100015887 482
1367 3300003187 JGI25151J46595_10003463 JGI25151J46595_100034638 482
1368 3300003215 JGI25153J46596_10000914 JGI25153J46596_1000091410 482
1369 3300003773 Ga0055537_1000640 Ga0055537_100064011 482
1370 3300003781 Ga0055536_1000680 Ga0055536_10006809 482
1371 3300003781 Ga0055536_1003212 Ga0055536_10032124 482
1372 3300003784 Ga0055534_1000579 Ga0055534_100057910 482
1373 3300003790 Ga0055528_1001018 Ga0055528_100101811 482
1374 3300003792 Ga0055540_1001144 Ga0055540_100114412 482
1375 3300003792 Ga0055540_1001339 Ga0055540_100133911 482
1376 3300005262 Ga0065165_1002503 Ga0065165_100250313 482
1377 3300005288 Ga0065714_10094400 Ga0065714_100944002 482
1378 3300005295 Ga0065707_10086095 Ga0065707_100860953 482
1379 3300005334 Ga0068869_100032567 Ga0068869_1000325672 482
1380 3300005355 Ga0070671_100031223 Ga0070671_1000312232 482
1381 3300005356 Ga0070674_100040651 Ga0070674_1000406513 482
1382 3300005366 Ga0070659_100126174 Ga0070659_1001261742 482
1383 3300005435 Ga0070714_100028074 Ga0070714_1000280742 482
1384 3300005436 Ga0070713_100007351 Ga0070713_1000073512 482
1385 3300005436 Ga0070713_100023150 Ga0070713_1000231503 482
1386 3300005437 Ga0070710_10004978 Ga0070710_100049785 482
1387 3300005439 Ga0070711_100019510 Ga0070711_1000195101 482
1388 3300005439 Ga0070711_100086840 Ga0070711_1000868402 482
1389 3300005456 Ga0070678_100032420 Ga0070678_1000324203 482
1390 3300005457 Ga0070662_100038412 Ga0070662_1000384123 482
1391 3300005548 Ga0070665_100082191 Ga0070665_1000821912 482
1392 3300005578 Ga0068854_100030465 Ga0068854_1000304652 482
1393 3300005718 Ga0068866_10018615 Ga0068866_100186152 482
1394 3300005842 Ga0068858_100103413 Ga0068858_1001034133 482
1395 3300005843 Ga0068860_100002318 Ga0068860_10000231811 482
1396 3300006028 Ga0070717_10017896 Ga0070717_100178965 482
1397 3300006173 Ga0070716_100027792 Ga0070716_1000277922 482
1398 3300006175 Ga0070712_100031422 Ga0070712_1000314222 482
1399 3300006871 Ga0075434_100089369 Ga0075434_1000893692 482
1400 3300009093 Ga0105240_10021359 Ga0105240_100213595 482
1401 3300009093 Ga0105240_10197498 Ga0105240_101974982 482
1402 3300009148 Ga0105243_10028276 Ga0105243_100282762 482
1403 3300009176 Ga0105242_10004677 Ga0105242_100046774 482
1404 3300009553 Ga0105249_10017612 Ga0105249_100176123 482
1405 3300012502 Ga0157347_1000526 Ga0157347_10005262 482
1406 3300013104 Ga0157370_10014786 Ga0157370_100147863 482
1407 3300013297 Ga0157378_10029728 Ga0157378_100297283 482
1408 3300013306 Ga0163162_10002191 Ga0163162_100021914 482
1409 3300014497 Ga0182008_10000044 Ga0182008_1000004437 482
1410 3300014497 Ga0182008_10003423 Ga0182008_100034232 482
1411 3300015262 Ga0182007_10003472 Ga0182007_100034728 482
1412 3300017792 Ga0163161_10000042 Ga0163161_10000042112 482
1413 3300025245 Ga0207425_1000926 Ga0207425_10009266 482
1414 3300025258 Ga0209129_1000776 Ga0209129_100077611 482
1415 3300025263 Ga0209565_1000504 Ga0209565_100050424 482
1416 3300025273 Ga0209673_1001382 Ga0209673_100138220 482
1417 3300025284 Ga0209130_1000888 Ga0209130_100088810 482
1418 3300025291 Ga0209675_1000615 Ga0209675_100061510 482
1419 3300025292 Ga0209676_1000240 Ga0209676_100024038 482
1420 3300025292 Ga0209676_1000868 Ga0209676_10008685 482
1421 3300025294 Ga0209025_1000103 Ga0209025_100010346 482
1422 3300025294 Ga0209025_1001649 Ga0209025_100164922 482
1423 3300025295 Ga0209564_1002566 Ga0209564_100256610 482
1424 3300025297 Ga0209758_1001416 Ga0209758_100141624 482
1425 3300025302 Ga0207426_1001126 Ga0207426_100112610 482
1426 3300025303 Ga0209051_1000658 Ga0209051_10006585 482
1427 3300025303 Ga0209051_1001207 Ga0209051_100120712 482
1428 3300025304 Ga0209257_1008540 Ga0209257_10085404 482
1429 3300025899 Ga0207642_10023585 Ga0207642_100235852 482
1430 3300025903 Ga0207680_10068584 Ga0207680_100685842 482
1431 3300025913 Ga0207695_10016786 Ga0207695_100167865 482
1432 3300025914 Ga0207671_10029173 Ga0207671_100291732 482
1433 3300025923 Ga0207681_10044482 Ga0207681_100444822 482
1434 3300025926 Ga0207659_10118906 Ga0207659_101189062 482
1435 3300025928 Ga0207700_10014240 Ga0207700_100142405 482
1436 3300025928 Ga0207700_10060735 Ga0207700_100607352 482
1437 3300025929 Ga0207664_10067400 Ga0207664_100674002 482
1438 3300025931 Ga0207644_10079954 Ga0207644_100799542 482
1439 3300025933 Ga0207706_10058430 Ga0207706_100584303 482
1440 3300025934 Ga0207686_10134436 Ga0207686_101344361 482
1441 3300025935 Ga0207709_10015977 Ga0207709_100159774 482
1442 3300025939 Ga0207665_10009720 Ga0207665_100097202 482
1443 3300025949 Ga0207667_10073160 Ga0207667_100731602 482
1444 3300025961 Ga0207712_10030739 Ga0207712_100307393 482
1445 3300025986 Ga0207658_10025059 Ga0207658_100250593 482
1446 3300026035 Ga0207703_10082279 Ga0207703_100822792 482
1447 3300026089 Ga0207648_10000319 Ga0207648_100003194 482
1448 3300026116 Ga0207674_10117898 Ga0207674_101178982 482
1449 3300026118 Ga0207675_100004711 Ga0207675_1000047115 482
1450 3300026121 Ga0207683_10066050 Ga0207683_100660502 482
1451 3300026121 Ga0207683_10100283 Ga0207683_101002832 482
1452 3300028380 Ga0268265_10002776 Ga0268265_100027762 482
1453 3300028381 Ga0268264_10012087 Ga0268264_100120876 482
1454 3300028381 Ga0268264_10051083 Ga0268264_100510834 482
1455 3300028794 Ga0307515_10116869 Ga0307515_101168692 482
1456 3300031731 Ga0307405_10002697 Ga0307405_100026976 482
1457 3300032002 Ga0307416_100009729 Ga0307416_1000097293 482
1458 3300032002 Ga0307416_100071548 Ga0307416_1000715482 482
1459 3300035410 Ga0373924_0008893 Ga0373924_0008893_2051_3520 482
1460 3300037068 Ga0373925_0011541 Ga0373925_0011541_2907_4370 482
1461 3300039450 Ga0436363_0510015 Ga0436363_0510015_527_2005 482
1462 3300046453 Ga0495627_004628 Ga0495627_004628_2099_3547 482
1463 3300046454 Ga0495592_0099604 Ga0495592_0099604_274_1743 482
1464 3300046460 Ga0495638_0016411 Ga0495638_0016411_2766_4214 482
1465 3300046462 Ga0495651_0041791 Ga0495651_0041791_229_1677 482
1466 3300046472 Ga0495580_0000527 Ga0495580_0000527_16884_18353 482
1467 3300046472 Ga0495580_0006761 Ga0495580_0006761_6211_7680 482
1468 3300046530 Ga0495654_0007291 Ga0495654_0007291_3050_4498 482
1469 3300046530 Ga0495654_0026124 Ga0495654_0026124_994_2442 482
1470 3300046543 Ga0495645_0113845 Ga0495645_0113845_288_1736 482
1471 3300046615 Ga0495656_0000073 Ga0495656_0000073_7337_8785 482
1472 3300046674 Ga0495588_0008426 Ga0495588_0008426_1841_3289 482
1473 3300046674 Ga0495588_0010894 Ga0495588_0010894_307_1755 482
1474 3300046692 Ga0495671_0003854 Ga0495671_0003854_7575_9023 482
1475 3300048904 Ga0496101_0001874 Ga0496101_0001874_3485_4933 482
1476 3300048904 Ga0496101_0001982 Ga0496101_0001982_10319_11767 482
1477 3300048905 Ga0496102_0001296 Ga0496102_0001296_3116_4564 482
1478 3300048907 Ga0496104_0147391 Ga0496104_0147391_545_2023 482
1479 3300048908 Ga0496105_0001714 Ga0496105_0001714_2882_4330 482
1480 3300048909 Ga0496106_0016853 Ga0496106_0016853_1068_2516 482
1481 3300048910 Ga0496107_0049028 Ga0496107_0049028_1280_2728 482
1482 3300048912 Ga0496109_0119878 Ga0496109_0119878_438_1886 482
1483 3300048912 Ga0496109_0123688 Ga0496109_0123688_840_2309 482
1484 3300048914 Ga0496111_0037061 Ga0496111_0037061_1320_2768 482
1485 3300048917 Ga0496114_0022351 Ga0496114_0022351_1562_3010 482
1486 3300048921 Ga0496118_0032105 Ga0496118_0032105_105_1553 482
1487 3300048922 Ga0496119_0015463 Ga0496119_0015463_2626_4074 482
1488 3300048924 Ga0496121_0013264 Ga0496121_0013264_293_1759 482
1489 3300048927 Ga0496124_0066277 Ga0496124_0066277_776_2224 482
1490 3300048929 Ga0496126_0112018 Ga0496126_0112018_474_1922 482
1491 3300050512 nmdc:mga0n895_95941_c1 nmdc:mga0n895_95941_c1_844_2322 482
1492 3300050514 nmdc:mga08x19_16319_c1 nmdc:mga08x19_16319_c1_2825_4303 482
1493 3300053087 Ga0500643_021945 Ga0500643_021945_285_1736 482
1494 3300053093 Ga0500651_0000040 Ga0500651_0000040_89636_91087 482
1495 3300053108 Ga0500562_004410 Ga0500562_004410_1360_2808 482
1496 3300053110 Ga0500571_000030 Ga0500571_000030_34760_36211 482
1497 3300053111 Ga0500572_011206 Ga0500572_011206_455_1903 482
1498 3300053116 Ga0500592_004646 Ga0500592_004646_580_2028 482
1499 3300053117 Ga0500593_000252 Ga0500593_000252_2451_3899 482
1500 3300053133 Ga0500655_000797 Ga0500655_000797_1333_2784 482
1501 3300053138 Ga0500564_035954 Ga0500564_035954_207_1658 482
1502 3300053141 Ga0500574_003369 Ga0500574_003369_1191_2642 482
1503 3300053161 Ga0500634_0009019 Ga0500634_0009019_2547_3995 482
1504 3300053730 Ga0500645_000242 Ga0500645_000242_25646_27094 482
1505 3300053730 Ga0500645_000991 Ga0500645_000991_5315_6763 482

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

7

451

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i3x-assembly2.cif.gz_C structure of phosphonoacetaldehyde dehydrogenase in complex with phosphonoacetate and cofactor nad+ 0.9732 12 482
4i3x-assembly2.cif.gz_C structure of phosphonoacetaldehyde dehydrogenase in complex with phosphonoacetate and cofactor nad+ 0.9632 12 482
1euh-assembly1.cif.gz_A apo form of a nadp dependent aldehyde dehydrogenase from streptococcus mutans 0.9524 11 482
2qe0-assembly1.cif.gz_C thioacylenzyme intermediate of gapn from s. mutans, new data integration and refinement. 0.9508 11 482
1qi1-assembly1.cif.gz_A ternary complex of an nadp dependent aldehyde dehydrogenase 0.9505 11 482
ID Description Score Start End Superfamily
4i3xF01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9752 11 261 3.40.605.10
af_Q55CJ9_31_264_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9616 29 259 3.40.605.10
af_A0A1D6MRK0_1_96_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9588 169 258 3.40.605.10
af_P76149_240_424_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9552 262 440 3.40.309.10
af_Q55CJ9_14_489_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9552 14 480 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A3D4QIP1-F1-model_v4 Phosphonoacetaldehyde dehydrogenase 0.9805 211 428 GO:0008911
AF-A0A3N8PFR1-F1-model_v4 Aldehyde dehydrogenase family protein 0.9772 155 369 GO:0008911
AF-A0A3C1B6M9-F1-model_v4 Phosphonoacetaldehyde dehydrogenase 0.9766 7 387 GO:0008911
AF-A0A853QX01-F1-model_v4 deleted 0.973 101 482
AF-A0A353DWU0-F1-model_v4 Phosphonoacetaldehyde dehydrogenase 0.9723 49 482 GO:0008911

Feature Viewer

pLDDT pTM Quality
89.98 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map