metagRoot

F494431

General Info

Members	Datasets	Scaffolds	Average Seq Length
1505	539	1406	294

Family's Representative Sequence

Representative Sequence	3300005439\|Ga0070711_100088187\|Ga0070711_1000881873
Length	337
Sequence	VRTGNRGTTNPFGDRQPTRIDRAKFAQLKDGAMPEADQEGQRYASAQPQATPGFYLKGSHQLDWGMKNRLARVFDPASGRTVMLAVDHGYFQGPTTGLERIDLSIVPLLPSCDALFCTRGILRSVIPAQCQKPMVLRASGGPSILREELSDEQIAMDMDDAVRLNAAGVGIQVFIGGEHETRSVHNMTRLVDAGLRTGVPVMGITAVGKTMVRDAKYFRLACRIIAELGAQYVKTYFVEDGFETVTASCPVPIVMAGGKKLAELEALTMAYNAVQQGAAGVDMGRNIFQSEAPQAMIAAVAAVVHKNMKPKEALDLFNSLKRRAASVSEVVRTANTA

Samples

	Sample ID	Description	Type	Environment
1	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
4	2547132181	Kosakonia sacchari SP1	Isolate	Stem
5	2547132416	Enterobacter sp. MR1	Isolate	Rhizoplane
6	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
7	2561511199	Enterobacter sp. R4-368	Isolate	Nodule
8	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
9	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
10	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
11	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
12	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
13	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
14	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
15	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
16	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
17	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
18	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
19	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
20	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
21	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
22	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
23	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
24	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
25	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
26	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
27	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
28	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
29	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
30	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
31	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
32	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
33	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
34	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
35	2602042047	Enterobacter sp. NFIX59	Isolate	Rhizoplane
36	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
37	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
38	2602042066	Enterobacter sp. NFIX45	Isolate	Rhizoplane
39	2602042067	Enterobacter sp. NFIX58	Isolate	Rhizoplane
40	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
41	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
42	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
43	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
44	2602042109	Klebsiella aerogenes NFIX39	Isolate	Rhizoplane
45	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
46	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
47	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
48	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
49	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
50	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
51	2609459761	Enterobacter sp. NFR05	Isolate	Rhizoplane
52	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
53	2643221575	Microbacterium sp. Root61	Isolate	Unclassified
54	2667528172	Enterobacteriaceae bacterium NFIX31	Isolate	Rhizoplane
55	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
56	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
57	2681812866	Enterobacter asburiae NFIX55	Isolate	Rhizoplane
58	2681812869	Enterobacter ludwigii NFPP41	Isolate	Rhizoplane
59	2711768156	Atlantibacter hermannii DDE1	Isolate	Unclassified
60	2751185917	Enterobacter sp. HK169	Isolate	Unclassified
61	2765235842	Enterobacter ludwigii AA4	Isolate	Unclassified
62	2775506706	Enterobacter asburiae 1216	Isolate	Unclassified
63	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
64	2791355010	Kosakonia pseudosacchari NN143	Isolate	Unclassified
65	2791355275	Enterobacter sp. Sa187	Isolate	Unclassified
66	2811995292	Kosakonia oryzae Ola 51	Isolate	Unclassified
67	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
68	2821118458	Enterobacter asburiae 609	Isolate	Unclassified
69	2823373977	Enterobacter ludwigii NCR3	Isolate	Rhizosphere
70	2844425489	Enterobacter cloacae SBP-8	Isolate	Rhizosphere
71	2846540461	Photorhabdus luminescens HIM3	Isolate	Rhizosphere
72	2856741275	Microbispora triticiradicis NEAU-HRDPA2-9	Isolate	Unclassified
73	2858868258	Micromonospora sp. MH33	Isolate	Unclassified
74	2887443736	Ruania rhizosphaerae LNNU 22110	Isolate	Rhizosphere
75	2891395885	Microbispora catharanthi CR1-09	Isolate	Unclassified
76	2891554331	Microbispora sp. CL1-1	Isolate	Unclassified
77	2891562705	Microbispora tritici MT50	Isolate	Unclassified
78	2902582711	Micromonospora sp. AP08	Isolate	Unclassified
79	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
80	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
81	2923634449	Enterobacter kobei SLBN-76	Isolate	Rhizosphere
82	2927833300	Enterobacter sp. SLBN-59	Isolate	Rhizosphere
83	2937539931	Pantoea sp. LS15	Isolate	Unclassified
84	2939568625	Lelliottia sp. 489	Isolate	Rhizosphere
85	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
86	2939642701	Lelliottia nimipressuralis 2756	Isolate	Rhizosphere
87	2945874760	Phytobacter diazotrophicus UAEU22	Isolate	Rhizosphere
88	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
89	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
90	2974310843	Enterobacter sp. SORGH_AS 287	Isolate	Unclassified
91	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
92	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
93	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
94	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
95	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
96	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
97	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
98	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
99	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
100	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
101	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
102	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
103	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
104	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
105	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
106	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
107	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
108	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
109	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
110	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
111	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
112	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
113	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
114	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
115	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
116	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
117	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
118	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
119	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
120	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
121	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
122	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
123	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
124	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
125	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
126	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
127	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
128	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
129	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
130	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
131	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
132	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
133	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
134	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
135	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
136	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
137	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
138	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
139	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
140	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
141	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
142	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
143	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
144	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
145	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
146	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
147	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
148	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
149	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
150	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
151	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
152	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
153	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
154	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
155	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
156	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
157	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
158	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
159	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
160	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
161	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
162	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
163	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
164	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
165	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
166	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
167	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
168	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
169	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
170	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
171	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
172	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
173	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
174	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
175	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
176	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
177	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
178	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
179	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
180	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
181	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
182	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
183	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
184	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
185	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
186	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
187	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
188	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
189	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
190	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
191	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
192	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
193	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
194	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
195	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
196	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
197	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
198	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
199	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
200	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
201	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
202	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
203	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
204	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
205	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
206	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
207	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
208	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
209	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
210	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
211	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
212	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
213	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
214	3300015679	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08	Metagenome	Unclassified
215	3300015680	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03	Metagenome	Rhizosphere
216	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
217	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
218	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
219	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
220	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
221	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
222	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
223	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
224	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
225	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
226	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
281	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
283	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
284	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
286	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
287	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
288	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
289	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
290	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
291	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
292	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
293	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
294	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
295	3300031018	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
296	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
297	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
298	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
299	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
300	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
301	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
302	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
303	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
304	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
305	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
306	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
307	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
308	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
309	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
310	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
311	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
312	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
313	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
314	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
315	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
316	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
317	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
318	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
319	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
320	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
321	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
322	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
323	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
324	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
325	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
326	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
327	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
328	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
329	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
330	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
331	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
332	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
333	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
334	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
335	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
336	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
337	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
338	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
339	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
340	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
341	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
342	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
343	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
344	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
345	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
346	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
347	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
348	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
349	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
350	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
351	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
352	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
353	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
354	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
355	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
356	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
357	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
358	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
359	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
360	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
361	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
362	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
363	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
364	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
365	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
366	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
367	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
368	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
369	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
370	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
371	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
372	3300044669	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E	Metagenome	Unclassified
373	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
374	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
375	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
376	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
377	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
378	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
379	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
380	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
381	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
382	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
383	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
384	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
385	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
386	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
387	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
388	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
389	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
390	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
391	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
392	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
393	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
394	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
395	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
396	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
397	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
398	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
399	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
400	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
401	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
402	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
403	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
404	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
405	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
406	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
407	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
408	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
409	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
410	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
411	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
412	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
413	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
414	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
415	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
416	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
417	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
418	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
419	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
420	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
421	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
422	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
423	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
424	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
425	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
426	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
427	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
428	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
429	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
430	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
431	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
432	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
433	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
434	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
435	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
436	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
437	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
438	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
439	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
440	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
441	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
442	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
443	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
444	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
445	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
446	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
447	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
448	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
449	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
450	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
451	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
452	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
453	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
454	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
455	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
456	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
457	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
458	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
459	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
460	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
461	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
462	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
463	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
464	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
465	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
466	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
467	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
468	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
469	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
470	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
471	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
472	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
473	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
474	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
475	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
476	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
477	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
478	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
479	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
480	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
481	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
482	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
483	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
484	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
485	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
486	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
487	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
488	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
489	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
490	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
491	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
492	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
493	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
494	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
495	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
496	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
497	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
498	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
499	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
500	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
501	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
502	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
503	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
504	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
505	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
506	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
507	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
508	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
509	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
510	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
511	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
512	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
513	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
514	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
515	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
516	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
517	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
518	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
519	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
520	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
521	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
522	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
523	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
524	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
525	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
526	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
527	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
528	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
529	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
530	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
531	8004182704	Microbacterium paraoxydans ku-mp	Isolate	Unclassified
532	8018221730	Enterobacter sp. CM29	Isolate	Unclassified
533	8018405270	Enterobacter sp. 198	Isolate	Rhizosphere
534	8054844752	Dryocola boscaweniae H18W14	Isolate	Rhizosphere
535	8054849141	Dryocola clanedunensis H11S18	Isolate	Rhizosphere
536	8055087960	Silvania hatchlandensis H19S6	Isolate	Rhizosphere
537	8055092621	Silvania confinis H4N4	Isolate	Rhizosphere
538	8055097453	Leclercia tamurae H6W5	Isolate	Rhizosphere
539	8057304971	Scandinavium manionii H17S15	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.89
Metatranscriptomes	0.53
Isolates	6.58

Biome Distribution

Category	Percentage (%)
Aerial Root	0.13
Bulb	0
Endosphere	2.19
Nodule	0.8
Rhizoplane	8.57
Rhizosphere	80.73
Stem	0.07
Stem Tuber	0
Unclassified	7.51

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	RicEn_C4876	2010549000	Bacteria	1666
2	SwRhRL2b_contig_457441	2162886007	Bacteria	3674
3	SwRhRL2b_contig_527301	2162886007	Bacteria	3056
4	JGI25151J46595_10008823	3300003187	Bacteria	4819
5	JGI25153J46596_10001127	3300003215	Bacteria	16187
6	rootH2_10011647	3300003320	Bacteria	8041
7	rootH2_10015631	3300003320	Bacteria	9106
8	Ga0058692_1000148	3300003856	Bacteria	44843
9	Ga0065704_10000295	3300005289	Bacteria	68917
10	Ga0065704_10001559	3300005289	Bacteria	9917
11	Ga0065704_10002256	3300005289	Bacteria	9581
12	Ga0070658_10036578	3300005327	Bacteria	3957
13	Ga0070658_10095920	3300005327	Bacteria	2448
14	Ga0070683_100021642	3300005329	Bacteria	5740
15	Ga0070683_100164991	3300005329	Bacteria	2101
16	Ga0070683_100168838	3300005329	Bacteria	2076
17	Ga0070683_100213801	3300005329	Bacteria	1832
18	Ga0070690_100008196	3300005330	Bacteria	6011
19	Ga0068869_100114770	3300005334	Bacteria	2053
20	Ga0068869_100213635	3300005334	Bacteria	1526
21	Ga0070680_100003260	3300005336	Bacteria	12091
22	Ga0070680_100164920	3300005336	Bacteria	1863
23	Ga0068868_100065957	3300005338	Bacteria	2877
24	Ga0068868_100172222	3300005338	Bacteria	1792
25	Ga0070660_100118589	3300005339	Bacteria	2110
26	Ga0070689_100016116	3300005340	Bacteria	5466
27	Ga0070691_10083800	3300005341	Bacteria	1565
28	Ga0070687_100183712	3300005343	Bacteria	1254
29	Ga0070687_100238590	3300005343	Bacteria	1123
30	Ga0070661_100069598	3300005344	Bacteria	2588
31	Ga0070661_100070306	3300005344	Bacteria	2574
32	Ga0070668_100216824	3300005347	Bacteria	1576
33	Ga0070669_100167309	3300005353	Bacteria	1712
34	Ga0070671_100003039	3300005355	Bacteria	13057
35	Ga0070671_100005305	3300005355	Bacteria	10280
36	Ga0070671_100270612	3300005355	Bacteria	1444
37	Ga0070673_100193047	3300005364	Bacteria	1750
38	Ga0070673_100370087	3300005364	Bacteria	1276
39	Ga0070688_100009045	3300005365	Bacteria	5431
40	Ga0070688_100059685	3300005365	Bacteria	2406
41	Ga0070688_100111135	3300005365	Bacteria	1823
42	Ga0070659_100043369	3300005366	Bacteria	3518
43	Ga0070709_10000898	3300005434	Bacteria	16586
44	Ga0070714_100002822	3300005435	Bacteria	12817
45	Ga0070714_100081767	3300005435	Bacteria	2813
46	Ga0070714_100157685	3300005435	Bacteria	2050
47	Ga0070714_100170249	3300005435	Bacteria	1976
48	Ga0070713_100003141	3300005436	Bacteria	10874
49	Ga0070713_100023455	3300005436	Bacteria	4788
50	Ga0070713_100064381	3300005436	Bacteria	3077
51	Ga0070713_100066801	3300005436	Bacteria	3025
52	Ga0070713_100094372	3300005436	Bacteria	2579
53	Ga0070713_100095860	3300005436	Bacteria	2560
54	Ga0070713_100201465	3300005436	Bacteria	1798
55	Ga0070713_100235858	3300005436	Bacteria	1664
56	Ga0070713_100295766	3300005436	Bacteria	1489
57	Ga0070713_100385810	3300005436	Bacteria	1306
58	Ga0070710_10000649	3300005437	Bacteria	16588
59	Ga0070710_10002366	3300005437	Bacteria	8924
60	Ga0070710_10010061	3300005437	Bacteria	4638
61	Ga0070710_10050565	3300005437	Bacteria	2331
62	Ga0070710_10077345	3300005437	Bacteria	1933
63	Ga0070710_10081400	3300005437	Bacteria	1891
64	Ga0070701_10064971	3300005438	Bacteria	1935
65	Ga0070701_10185736	3300005438	Bacteria	1220
66	Ga0070711_100001246	3300005439	Bacteria	13779
67	Ga0070711_100008207	3300005439	Bacteria	6386
68	Ga0070711_100024738	3300005439	Unclassified	3922
69	Ga0070711_100057844	3300005439	Bacteria	2686
70	Ga0070711_100088187	3300005439	Bacteria	2229
71	Ga0070711_100470428	3300005439	Bacteria	1031
72	Ga0070705_100032926	3300005440	Bacteria	2884
73	Ga0070705_100034231	3300005440	Bacteria	2838
74	Ga0070705_100034341	3300005440	Bacteria	2834
75	Ga0070700_100048319	3300005441	Bacteria	2637
76	Ga0070694_100015175	3300005444	Bacteria	4832
77	Ga0070694_100071867	3300005444	Bacteria	2386
78	Ga0070708_100004192	3300005445	Bacteria	11330
79	Ga0070708_100008914	3300005445	Bacteria	8076
80	Ga0070708_100010968	3300005445	Bacteria	7363
81	Ga0070708_100018447	3300005445	Bacteria	5841
82	Ga0070708_100023693	3300005445	Bacteria	5223
83	Ga0070708_100351417	3300005445	Bacteria	1389
84	Ga0070678_100122975	3300005456	Bacteria	2049
85	Ga0070678_100342015	3300005456	Bacteria	1284
86	Ga0070662_100299640	3300005457	Bacteria	1306
87	Ga0070681_10005405	3300005458	Bacteria	12337
88	Ga0070681_10357368	3300005458	Bacteria	1371
89	Ga0070685_10009401	3300005466	Bacteria	5050
90	Ga0070685_10139435	3300005466	Bacteria	1525
91	Ga0070685_10154737	3300005466	Bacteria	1456
92	Ga0070706_100012610	3300005467	Bacteria	7823
93	Ga0070706_100284741	3300005467	Unclassified	1542
94	Ga0070706_100511929	3300005467	Bacteria	1116
95	Ga0070707_100001159	3300005468	Bacteria	25925
96	Ga0070707_100017280	3300005468	Bacteria	6781
97	Ga0070707_100020644	3300005468	Bacteria	6217
98	Ga0070707_100040320	3300005468	Unclassified	4468
99	Ga0070707_100100093	3300005468	Bacteria	2808
100	Ga0070707_100511613	3300005468	Bacteria	1162
101	Ga0070707_100731871	3300005468	Bacteria	952
102	Ga0070698_100028860	3300005471	Bacteria	5759
103	Ga0070698_100064489	3300005471	Bacteria	3690
104	Ga0070698_100097446	3300005471	Bacteria	2916
105	Ga0070698_100157269	3300005471	Unclassified	2218
106	Ga0070699_100003695	3300005518	Bacteria	13534
107	Ga0070699_100005111	3300005518	Bacteria	11539
108	Ga0070699_100041564	3300005518	Bacteria	3980
109	Ga0070699_100100802	3300005518	Bacteria	2531
110	Ga0070699_100103828	3300005518	Bacteria	2492
111	Ga0070699_100130659	3300005518	Bacteria	2214
112	Ga0070699_100193748	3300005518	Bacteria	1806
113	Ga0070679_100004247	3300005530	Bacteria	13224
114	Ga0070679_100115569	3300005530	Bacteria	2669
115	Ga0070684_100005531	3300005535	Bacteria	9694
116	Ga0070684_100017815	3300005535	Bacteria	5837
117	Ga0070684_100113923	3300005535	Bacteria	2427
118	Ga0070684_100148696	3300005535	Bacteria	2121
119	Ga0070684_100297896	3300005535	Bacteria	1479
120	Ga0070697_100019523	3300005536	Bacteria	5355
121	Ga0070697_100027236	3300005536	Bacteria	4571
122	Ga0070697_100152078	3300005536	Bacteria	1951
123	Ga0070686_100185137	3300005544	Bacteria	1482
124	Ga0070686_100273019	3300005544	Bacteria	1244
125	Ga0070686_100382608	3300005544	Bacteria	1066
126	Ga0070696_100012057	3300005546	Bacteria	5791
127	Ga0070696_100044841	3300005546	Bacteria	3062
128	Ga0070696_100110055	3300005546	Bacteria	1983
129	Ga0070665_100000241	3300005548	Bacteria	90760
130	Ga0070665_100018019	3300005548	Bacteria	7088
131	Ga0070704_100036319	3300005549	Bacteria	3357
132	Ga0070704_100171653	3300005549	Bacteria	1725
133	Ga0070704_100300551	3300005549	Bacteria	1337
134	Ga0068855_100489368	3300005563	Bacteria	1338
135	Ga0068855_100519040	3300005563	Bacteria	1292
136	Ga0070664_100126800	3300005564	Bacteria	2240
137	Ga0068857_100002076	3300005577	Bacteria	16270
138	Ga0068857_100042033	3300005577	Bacteria	4053
139	Ga0068857_100079277	3300005577	Bacteria	2932
140	Ga0068857_100133497	3300005577	Bacteria	2240
141	Ga0068854_100120178	3300005578	Bacteria	1993
142	Ga0068856_100011336	3300005614	Bacteria	8649
143	Ga0068856_100135041	3300005614	Bacteria	2472
144	Ga0068856_100184922	3300005614	Bacteria	2097
145	Ga0068856_100216661	3300005614	Bacteria	1930
146	Ga0068856_100531570	3300005614	Bacteria	1197
147	Ga0070702_100072973	3300005615	Bacteria	2032
148	Ga0068852_100017745	3300005616	Bacteria	5591
149	Ga0068852_100126561	3300005616	Bacteria	2347
150	Ga0068859_100008381	3300005617	Bacteria	10477
151	Ga0068864_100401583	3300005618	Bacteria	1302
152	Ga0068866_10054071	3300005718	Bacteria	2056
153	Ga0068866_10122826	3300005718	Bacteria	1466
154	Ga0068861_100112185	3300005719	Bacteria	2186
155	Ga0068861_100276392	3300005719	Bacteria	1444
156	Ga0068870_10082645	3300005840	Bacteria	1779
157	Ga0068858_100151607	3300005842	Unclassified	2180
158	Ga0068858_100396033	3300005842	Bacteria	1326
159	Ga0068860_100375660	3300005843	Bacteria	1402
160	Ga0068860_100505752	3300005843	Bacteria	1207
161	Ga0068862_100116846	3300005844	Bacteria	2347
162	Ga0081455_10009483	3300005937	Bacteria	10007
163	Ga0081455_10085744	3300005937	Bacteria	2567
164	Ga0081455_10086232	3300005937	Bacteria	2558
165	Ga0081538_10005284	3300005981	Bacteria	11652
166	Ga0081538_10029795	3300005981	Bacteria	3720
167	Ga0081540_1000619	3300005983	Bacteria	33751
168	Ga0081540_1017654	3300005983	Bacteria	4408
169	Ga0081540_1018071	3300005983	Bacteria	4339
170	Ga0081540_1046703	3300005983	Bacteria	2183
171	Ga0081540_1050486	3300005983	Bacteria	2065
172	Ga0081539_10016732	3300005985	Bacteria	5208
173	Ga0070717_10001468	3300006028	Bacteria	16299
174	Ga0070717_10025618	3300006028	Bacteria	4694
175	Ga0070717_10028626	3300006028	Unclassified	4461
176	Ga0070717_10044439	3300006028	Bacteria	3627
177	Ga0070717_10050303	3300006028	Bacteria	3424
178	Ga0070717_10050850	3300006028	Bacteria	3408
179	Ga0070717_10141518	3300006028	Bacteria	2075
180	Ga0070717_10158906	3300006028	Bacteria	1960
181	Ga0070717_10219842	3300006028	Bacteria	1669
182	Ga0070717_10323431	3300006028	Bacteria	1374
183	Ga0070717_10334905	3300006028	Bacteria	1350
184	Ga0075365_10022916	3300006038	Bacteria	3920
185	Ga0075364_10006907	3300006051	Bacteria	6700
186	Ga0075364_10029463	3300006051	Bacteria	3520
187	Ga0075432_10034965	3300006058	Bacteria	1746
188	Ga0070715_10001376	3300006163	Bacteria	7015
189	Ga0070715_10001972	3300006163	Bacteria	6189
190	Ga0070715_10016872	3300006163	Bacteria	2753
191	Ga0070715_10023333	3300006163	Bacteria	2423
192	Ga0070715_10072500	3300006163	Bacteria	1542
193	Ga0070716_100010453	3300006173	Bacteria	4653
194	Ga0070716_100016022	3300006173	Bacteria	3863
195	Ga0070716_100021001	3300006173	Bacteria	3435
196	Ga0070716_100161966	3300006173	Bacteria	1451
197	Ga0070716_100252552	3300006173	Bacteria	1202
198	Ga0070712_100002429	3300006175	Bacteria	11479
199	Ga0070712_100043845	3300006175	Bacteria	3081
200	Ga0070712_100056376	3300006175	Bacteria	2756
201	Ga0070712_100114043	3300006175	Bacteria	2022
202	Ga0070712_100121185	3300006175	Bacteria	1968
203	Ga0070712_100135658	3300006175	Bacteria	1871
204	Ga0070712_100165020	3300006175	Bacteria	1713
205	Ga0070712_100220758	3300006175	Bacteria	1500
206	Ga0070712_100261116	3300006175	Bacteria	1388
207	Ga0075362_10082562	3300006177	Bacteria	1483
208	Ga0075367_10058918	3300006178	Bacteria	2285
209	Ga0075367_10119436	3300006178	Bacteria	1623
210	Ga0075366_10055650	3300006195	Bacteria	2349
211	Ga0097621_100037588	3300006237	Bacteria	3881
212	Ga0097621_100173771	3300006237	Bacteria	1858
213	Ga0068871_100214255	3300006358	Bacteria	1667
214	Ga0075428_100007510	3300006844	Bacteria	12083
215	Ga0075428_100105880	3300006844	Bacteria	3066
216	Ga0075428_100277587	3300006844	Bacteria	1803
217	Ga0075428_100362249	3300006844	Bacteria	1555
218	Ga0075430_100107926	3300006846	Bacteria	2322
219	Ga0075430_100263897	3300006846	Bacteria	1426
220	Ga0075431_100028921	3300006847	Bacteria	5699
221	Ga0075431_100395251	3300006847	Bacteria	1384
222	Ga0075431_100431602	3300006847	Bacteria	1315
223	Ga0075433_10024440	3300006852	Bacteria	5099
224	Ga0075433_10094679	3300006852	Bacteria	2643
225	Ga0075433_10285358	3300006852	Archaea	1462
226	Ga0075434_100010403	3300006871	Bacteria	8721
227	Ga0075434_100019632	3300006871	Bacteria	6541
228	Ga0075434_100019983	3300006871	Bacteria	6487
229	Ga0075434_100072950	3300006871	Bacteria	3425
230	Ga0075434_100102372	3300006871	Bacteria	2871
231	Ga0075434_100230939	3300006871	Bacteria	1869
232	Ga0075434_100321975	3300006871	Bacteria	1567
233	Ga0075429_100018750	3300006880	Bacteria	5992
234	Ga0075429_100148614	3300006880	Bacteria	2051
235	Ga0075429_100281418	3300006880	Bacteria	1457
236	Ga0068865_100067241	3300006881	Bacteria	2531
237	Ga0068865_100071219	3300006881	Bacteria	2465
238	Ga0075436_100004521	3300006914	Bacteria	9543
239	Ga0075436_100009894	3300006914	Bacteria	6521
240	Ga0075436_100023308	3300006914	Bacteria	4251
241	Ga0075436_100319244	3300006914	Bacteria	1116
242	Ga0097620_100008381	3300006931	Bacteria	10477
243	Ga0079104_1000967	3300006946	Bacteria	22513
244	Ga0079104_1001132	3300006946	Bacteria	19423
245	Ga0079104_1002316	3300006946	Bacteria	10488
246	Ga0079104_1012039	3300006946	Bacteria	2744
247	Ga0075435_100007015	3300007076	Bacteria	7994
248	Ga0075435_100178186	3300007076	Bacteria	1796
249	Ga0075435_100235847	3300007076	Bacteria	1555
250	Ga0075435_100383380	3300007076	Bacteria	1208
251	Ga0099795_10126253	3300007788	Bacteria	1028
252	Ga0105251_10000696	3300009011	Bacteria	31004
253	Ga0105251_10005130	3300009011	Bacteria	8659
254	Ga0105251_10009921	3300009011	Bacteria	5574
255	Ga0105251_10011473	3300009011	Bacteria	5061
256	Ga0105251_10018360	3300009011	Bacteria	3721
257	Ga0105251_10018610	3300009011	Bacteria	3687
258	Ga0105251_10022835	3300009011	Bacteria	3239
259	Ga0105251_10069033	3300009011	Bacteria	1648
260	Ga0105244_10000153	3300009036	Bacteria	72636
261	Ga0105244_10001213	3300009036	Bacteria	21129
262	Ga0105244_10004024	3300009036	Bacteria	10267
263	Ga0105244_10010220	3300009036	Bacteria	5701
264	Ga0105244_10024031	3300009036	Bacteria	3331
265	Ga0105244_10172425	3300009036	Bacteria	1029
266	Ga0105250_10000148	3300009092	Bacteria	61880
267	Ga0105250_10001720	3300009092	Bacteria	11550
268	Ga0105250_10002795	3300009092	Bacteria	8561
269	Ga0105240_10364620	3300009093	Bacteria	1635
270	Ga0105240_10776687	3300009093	Bacteria	1039
271	Ga0111539_10006696	3300009094	Bacteria	14837
272	Ga0111539_10021993	3300009094	Bacteria	7838
273	Ga0111539_10126842	3300009094	Bacteria	2989
274	Ga0111539_10359909	3300009094	Bacteria	1694
275	Ga0111539_10461502	3300009094	Bacteria	1479
276	Ga0105245_10010094	3300009098	Bacteria	8226
277	Ga0105245_10047939	3300009098	Bacteria	3821
278	Ga0105247_10104684	3300009101	Bacteria	1813
279	Ga0114129_10117287	3300009147	Bacteria	3668
280	Ga0114129_10204176	3300009147	Bacteria	2675
281	Ga0114129_10814828	3300009147	Bacteria	1190
282	Ga0114129_10891292	3300009147	Bacteria	1128
283	Ga0105243_10003041	3300009148	Bacteria	13824
284	Ga0105243_10038175	3300009148	Bacteria	3739
285	Ga0105243_10083838	3300009148	Bacteria	2608
286	Ga0105243_10318808	3300009148	Bacteria	1415
287	Ga0105243_10422940	3300009148	Bacteria	1243
288	Ga0105241_10012343	3300009174	Bacteria	6265
289	Ga0105242_10022023	3300009176	Bacteria	5008
290	Ga0105248_10043640	3300009177	Bacteria	5028
291	Ga0105248_10448329	3300009177	Bacteria	1454
292	Ga0105237_10096605	3300009545	Bacteria	2945
293	Ga0105237_10102184	3300009545	Bacteria	2858
294	Ga0105237_10281938	3300009545	Bacteria	1664
295	Ga0105237_10408178	3300009545	Bacteria	1363
296	Ga0105238_10027827	3300009551	Bacteria	5761
297	Ga0105238_10046429	3300009551	Bacteria	4384
298	Ga0105238_10225870	3300009551	Bacteria	1849
299	Ga0105238_10327496	3300009551	Unclassified	1518
300	Ga0105238_10467602	3300009551	Bacteria	1259
301	Ga0099796_10029314	3300010159	Bacteria	1775
302	Ga0099796_10048096	3300010159	Bacteria	1469
303	Ga0105239_10537850	3300010375	Bacteria	1330
304	Ga0105239_10909844	3300010375	Bacteria	1010
305	Ga0105246_10010692	3300011119	Bacteria	5684
306	Ga0105246_10064479	3300011119	Bacteria	2559
307	Ga0157373_10026864	3300013100	Bacteria	4155
308	Ga0157373_10125147	3300013100	Bacteria	1808
309	Ga0157371_10124214	3300013102	Bacteria	1836
310	Ga0157371_10153903	3300013102	Bacteria	1640
311	Ga0157371_10262460	3300013102	Bacteria	1245
312	Ga0157371_10350196	3300013102	Bacteria	1075
313	Ga0157370_10003857	3300013104	Bacteria	17484
314	Ga0157369_10213946	3300013105	Bacteria	2020
315	Ga0157374_10028404	3300013296	Bacteria	5053
316	Ga0157374_10203001	3300013296	Bacteria	1941
317	Ga0157374_10337629	3300013296	Bacteria	1495
318	Ga0157374_10476080	3300013296	Bacteria	1252
319	Ga0157378_10001441	3300013297	Bacteria	21440
320	Ga0157378_10406067	3300013297	Bacteria	1343
321	Ga0163162_10100464	3300013306	Bacteria	2984
322	Ga0163162_10136689	3300013306	Bacteria	2562
323	Ga0157375_10088135	3300013308	Bacteria	3158
324	Ga0163163_10010901	3300014325	Bacteria	8209
325	Ga0163163_10039261	3300014325	Bacteria	4620
326	Ga0163163_10267317	3300014325	Bacteria	1761
327	Ga0163163_10450340	3300014325	Bacteria	1347
328	Ga0157380_10140845	3300014326	Bacteria	2072
329	Ga0157380_10242254	3300014326	Bacteria	1627
330	Ga0157377_10002806	3300014745	Bacteria	7768
331	Ga0157379_10002408	3300014968	Bacteria	15631
332	Ga0157376_10313998	3300014969	Bacteria	1488
333	Ga0182006_1000013	3300015261	Bacteria	363224
334	Ga0183366_1002	3300015679	Bacteria	791639
335	Ga0183370_1002	3300015680	Bacteria	791639
336	Ga0183369_1002	3300015685	Bacteria	791621
337	Ga0183368_1005	3300015687	Bacteria	791621
338	Ga0163161_10072025	3300017792	Bacteria	2530
339	Ga0206356_11756935	3300020070	Bacteria	3002
340	Ga0213876_10000013	3300021384	Bacteria	342052
341	Ga0213876_10087727	3300021384	Bacteria	1647
342	Ga0213875_10000124	3300021388	Bacteria	86711
343	Ga0213875_10010220	3300021388	Bacteria	4710
344	Ga0213875_10010252	3300021388	Bacteria	4701
345	Ga0224572_1014976	3300024225	Bacteria	1483
346	Ga0228598_1008177	3300024227	Bacteria	2118
347	Ga0209025_1000180	3300025294	Bacteria	157372
348	Ga0209758_1001018	3300025297	Bacteria	37092
349	Ga0207656_10106254	3300025321	Bacteria	1292
350	Ga0207696_1000183	3300025711	Bacteria	97885
351	Ga0207696_1000748	3300025711	Bacteria	21685
352	Ga0207696_1003827	3300025711	Bacteria	6693
353	Ga0207696_1004017	3300025711	Bacteria	6458
354	Ga0207655_1000050	3300025728	Bacteria	294923
355	Ga0207655_1000065	3300025728	Bacteria	252767
356	Ga0207655_1000318	3300025728	Bacteria	71503
357	Ga0207655_1005664	3300025728	Bacteria	8446
358	Ga0207655_1019560	3300025728	Bacteria	3530
359	Ga0207655_1021241	3300025728	Bacteria	3301
360	Ga0207655_1038355	3300025728	Bacteria	2095
361	Ga0207713_1000019	3300025735	Bacteria	361225
362	Ga0207713_1000076	3300025735	Bacteria	178268
363	Ga0207713_1000258	3300025735	Bacteria	65365
364	Ga0207713_1002075	3300025735	Bacteria	14979
365	Ga0207713_1002269	3300025735	Bacteria	14179
366	Ga0207713_1007641	3300025735	Bacteria	6331
367	Ga0207713_1084737	3300025735	Bacteria	1130
368	Ga0207692_10000502	3300025898	Bacteria	13794
369	Ga0207692_10007604	3300025898	Bacteria	4445
370	Ga0207692_10010117	3300025898	Bacteria	3963
371	Ga0207692_10108757	3300025898	Bacteria	1534
372	Ga0207692_10171296	3300025898	Bacteria	1258
373	Ga0207688_10012125	3300025901	Bacteria	4690
374	Ga0207685_10033520	3300025905	Bacteria	1857
375	Ga0207685_10098684	3300025905	Bacteria	1244
376	Ga0207699_10000902	3300025906	Bacteria	14193
377	Ga0207699_10010790	3300025906	Bacteria	4597
378	Ga0207699_10082312	3300025906	Bacteria	1999
379	Ga0207645_10122307	3300025907	Bacteria	1690
380	Ga0207643_10009043	3300025908	Bacteria	5350
381	Ga0207643_10139745	3300025908	Bacteria	1446
382	Ga0207705_10108018	3300025909	Bacteria	2053
383	Ga0207684_10001101	3300025910	Bacteria	30211
384	Ga0207684_10001612	3300025910	Bacteria	23951
385	Ga0207684_10005051	3300025910	Bacteria	12296
386	Ga0207684_10007123	3300025910	Bacteria	10106
387	Ga0207684_10009747	3300025910	Bacteria	8471
388	Ga0207684_10013490	3300025910	Bacteria	7068
389	Ga0207684_10031145	3300025910	Bacteria	4540
390	Ga0207684_10059149	3300025910	Bacteria	3253
391	Ga0207684_10251000	3300025910	Bacteria	1526
392	Ga0207654_10057400	3300025911	Bacteria	2262
393	Ga0207707_10125956	3300025912	Bacteria	2240
394	Ga0207671_10323444	3300025914	Bacteria	1221
395	Ga0207693_10001513	3300025915	Bacteria	20519
396	Ga0207693_10003605	3300025915	Bacteria	13222
397	Ga0207693_10004702	3300025915	Bacteria	11487
398	Ga0207693_10009082	3300025915	Bacteria	8115
399	Ga0207693_10019055	3300025915	Bacteria	5462
400	Ga0207693_10047643	3300025915	Bacteria	3367
401	Ga0207693_10048226	3300025915	Bacteria	3344
402	Ga0207693_10050231	3300025915	Bacteria	3275
403	Ga0207693_10261333	3300025915	Bacteria	1357
404	Ga0207663_10041232	3300025916	Bacteria	2812
405	Ga0207663_10054004	3300025916	Bacteria	2513
406	Ga0207663_10102474	3300025916	Bacteria	1926
407	Ga0207663_10139590	3300025916	Bacteria	1686
408	Ga0207663_10279631	3300025916	Bacteria	1239
409	Ga0207660_10351290	3300025917	Bacteria	1182
410	Ga0207662_10019071	3300025918	Bacteria	3899
411	Ga0207662_10087248	3300025918	Bacteria	1914
412	Ga0207662_10361851	3300025918	Bacteria	976
413	Ga0207657_10003526	3300025919	Bacteria	16712
414	Ga0207657_10008018	3300025919	Bacteria	10770
415	Ga0207652_10035443	3300025921	Bacteria	4211
416	Ga0207652_10046710	3300025921	Bacteria	3696
417	Ga0207652_10145398	3300025921	Bacteria	2122
418	Ga0207652_10349824	3300025921	Bacteria	1334
419	Ga0207646_10000161	3300025922	Bacteria	91153
420	Ga0207646_10022346	3300025922	Bacteria	5829
421	Ga0207646_10039292	3300025922	Bacteria	4259
422	Ga0207646_10106061	3300025922	Bacteria	2520
423	Ga0207646_10226392	3300025922	Bacteria	1689
424	Ga0207681_10095778	3300025923	Bacteria	2130
425	Ga0207694_10041321	3300025924	Bacteria	3553
426	Ga0207694_10147405	3300025924	Bacteria	1895
427	Ga0207687_10019622	3300025927	Bacteria	4480
428	Ga0207687_10234109	3300025927	Bacteria	1452
429	Ga0207700_10002927	3300025928	Bacteria	9850
430	Ga0207700_10011297	3300025928	Bacteria	5687
431	Ga0207700_10019788	3300025928	Bacteria	4554
432	Ga0207700_10022371	3300025928	Bacteria	4338
433	Ga0207700_10056678	3300025928	Bacteria	2951
434	Ga0207700_10067368	3300025928	Bacteria	2740
435	Ga0207700_10071460	3300025928	Bacteria	2672
436	Ga0207700_10081483	3300025928	Bacteria	2527
437	Ga0207700_10083103	3300025928	Bacteria	2506
438	Ga0207700_10260997	3300025928	Bacteria	1483
439	Ga0207700_10455773	3300025928	Bacteria	1128
440	Ga0207664_10000678	3300025929	Bacteria	23434
441	Ga0207664_10002010	3300025929	Bacteria	13399
442	Ga0207664_10010813	3300025929	Bacteria	6460
443	Ga0207664_10039113	3300025929	Bacteria	3681
444	Ga0207664_10057654	3300025929	Bacteria	3088
445	Ga0207664_10081279	3300025929	Bacteria	2636
446	Ga0207664_10095697	3300025929	Bacteria	2443
447	Ga0207664_10106656	3300025929	Bacteria	2323
448	Ga0207664_10119246	3300025929	Bacteria	2206
449	Ga0207664_10189832	3300025929	Bacteria	1768
450	Ga0207664_10341415	3300025929	Bacteria	1324
451	Ga0207664_10499388	3300025929	Bacteria	1089
452	Ga0207644_10004600	3300025931	Bacteria	8975
453	Ga0207644_10112048	3300025931	Bacteria	2064
454	Ga0207644_10254071	3300025931	Bacteria	1403
455	Ga0207644_10337150	3300025931	Bacteria	1222
456	Ga0207690_10084718	3300025932	Bacteria	2223
457	Ga0207706_10203155	3300025933	Bacteria	1738
458	Ga0207706_10398567	3300025933	Bacteria	1193
459	Ga0207709_10001887	3300025935	Bacteria	13849
460	Ga0207709_10086746	3300025935	Bacteria	2033
461	Ga0207670_10021502	3300025936	Bacteria	3981
462	Ga0207670_10108889	3300025936	Bacteria	1993
463	Ga0207669_10154303	3300025937	Bacteria	1613
464	Ga0207704_10175266	3300025938	Bacteria	1543
465	Ga0207665_10001445	3300025939	Bacteria	15981
466	Ga0207665_10001749	3300025939	Bacteria	14579
467	Ga0207665_10022313	3300025939	Bacteria	4164
468	Ga0207665_10280739	3300025939	Bacteria	1239
469	Ga0207691_10402899	3300025940	Bacteria	1167
470	Ga0207711_10002895	3300025941	Bacteria	15035
471	Ga0207711_10109629	3300025941	Bacteria	2453
472	Ga0207711_10360981	3300025941	Bacteria	1346
473	Ga0207689_10005002	3300025942	Bacteria	11937
474	Ga0207661_10082322	3300025944	Bacteria	2661
475	Ga0207661_10274593	3300025944	Bacteria	1505
476	Ga0207679_10004671	3300025945	Bacteria	8533
477	Ga0207679_10157957	3300025945	Bacteria	1853
478	Ga0207679_10178294	3300025945	Bacteria	1755
479	Ga0207667_10312678	3300025949	Bacteria	1604
480	Ga0207668_10060892	3300025972	Bacteria	2652
481	Ga0207668_10314624	3300025972	Bacteria	1297
482	Ga0207677_10033723	3300026023	Bacteria	3306
483	Ga0207703_10063847	3300026035	Bacteria	3021
484	Ga0207678_10005972	3300026067	Bacteria	10841
485	Ga0207678_10176474	3300026067	Bacteria	1824
486	Ga0207678_10661349	3300026067	Bacteria	918
487	Ga0207708_10048224	3300026075	Bacteria	3242
488	Ga0207702_10022952	3300026078	Bacteria	5176
489	Ga0207702_10056519	3300026078	Bacteria	3332
490	Ga0207702_10149336	3300026078	Bacteria	2124
491	Ga0207641_10092715	3300026088	Bacteria	2646
492	Ga0207648_10079363	3300026089	Bacteria	2863
493	Ga0207676_10344391	3300026095	Bacteria	1376
494	Ga0207674_10000913	3300026116	Bacteria	38470
495	Ga0207674_10008747	3300026116	Bacteria	11656
496	Ga0207674_10053223	3300026116	Bacteria	4126
497	Ga0207674_10053463	3300026116	Bacteria	4116
498	Ga0207675_100013612	3300026118	Bacteria	7593
499	Ga0207675_100177695	3300026118	Bacteria	2037
500	Ga0207675_100402741	3300026118	Bacteria	1349
501	Ga0207683_10012591	3300026121	Bacteria	7216
502	Ga0207698_10110017	3300026142	Bacteria	2307
503	Ga0209281_1000025	3300027111	Bacteria	488275
504	Ga0209281_1000060	3300027111	Bacteria	295683
505	Ga0209281_1000283	3300027111	Bacteria	95533
506	Ga0209281_1000818	3300027111	Bacteria	28143
507	Ga0209281_1001344	3300027111	Bacteria	15343
508	Ga0209281_1001705	3300027111	Bacteria	11393
509	Ga0209281_1004375	3300027111	Bacteria	4245
510	Ga0209371_1000013	3300027312	Bacteria	691516
511	Ga0209371_1000101	3300027312	Bacteria	153288
512	Ga0209371_1000876	3300027312	Bacteria	24091
513	Ga0209371_1001044	3300027312	Bacteria	20815
514	Ga0209371_1002764	3300027312	Bacteria	9395
515	Ga0207428_10020684	3300027907	Bacteria	5583
516	Ga0207428_10129900	3300027907	Bacteria	1928
517	Ga0207428_10219489	3300027907	Bacteria	1426
518	Ga0207428_10232497	3300027907	Bacteria	1379
519	Ga0265357_1001124	3300028023	Bacteria	1866
520	Ga0268266_10000041	3300028379	Bacteria	322311
521	Ga0268266_10058709	3300028379	Bacteria	3313
522	Ga0265337_1000447	3300028556	Bacteria	21961
523	Ga0265337_1006329	3300028556	Bacteria	4582
524	Ga0265337_1011664	3300028556	Bacteria	3018
525	Ga0265337_1019844	3300028556	Bacteria	2113
526	Ga0265326_10030280	3300028558	Bacteria	1541
527	Ga0265319_1000005	3300028563	Bacteria	249025
528	Ga0265334_10006089	3300028573	Bacteria	5230
529	Ga0265334_10019422	3300028573	Bacteria	2796
530	Ga0265334_10029208	3300028573	Bacteria	2211
531	Ga0265318_10014455	3300028577	Bacteria	3313
532	Ga0265318_10032899	3300028577	Bacteria	2004
533	Ga0265318_10051783	3300028577	Bacteria	1541
534	Ga0265323_10003972	3300028653	Bacteria	6416
535	Ga0265323_10010786	3300028653	Bacteria	3700
536	Ga0265323_10022345	3300028653	Bacteria	2417
537	Ga0265322_10037581	3300028654	Bacteria	1379
538	Ga0265338_10001840	3300028800	Bacteria	33293
539	Ga0265338_10002835	3300028800	Bacteria	25308
540	Ga0265338_10008621	3300028800	Bacteria	12331
541	Ga0265338_10037367	3300028800	Bacteria	4623
542	Ga0265338_10040471	3300028800	Bacteria	4377
543	Ga0265338_10048050	3300028800	Bacteria	3887
544	Ga0265338_10053536	3300028800	Bacteria	3609
545	Ga0265338_10059947	3300028800	Bacteria	3349
546	Ga0265338_10075109	3300028800	Bacteria	2870
547	Ga0265338_10093821	3300028800	Bacteria	2471
548	Ga0265338_10136652	3300028800	Bacteria	1926
549	Ga0265324_10001347	3300029957	Bacteria	14365
550	Ga0265324_10009957	3300029957	Bacteria	3692
551	Ga0268256_1000014	3300030500	Bacteria	691435
552	Ga0268256_1000029	3300030500	Bacteria	430123
553	Ga0268256_1000736	3300030500	Bacteria	24091
554	Ga0268256_1000897	3300030500	Bacteria	20535
555	Ga0268256_1002470	3300030500	Bacteria	9395
556	Ga0268256_1013041	3300030500	Bacteria	2540
557	Ga0265773_1000711	3300031018	Bacteria	1496
558	Ga0265330_10000325	3300031235	Bacteria	34254
559	Ga0265330_10002259	3300031235	Bacteria	10606
560	Ga0265330_10003208	3300031235	Bacteria	8621
561	Ga0265330_10003517	3300031235	Bacteria	8162
562	Ga0265330_10003710	3300031235	Bacteria	7909
563	Ga0265330_10019762	3300031235	Bacteria	3081
564	Ga0265330_10038832	3300031235	Bacteria	2116
565	Ga0265330_10062490	3300031235	Bacteria	1619
566	Ga0265332_10092272	3300031238	Bacteria	1280
567	Ga0265320_10007405	3300031240	Bacteria	6816
568	Ga0265325_10014714	3300031241	Bacteria	4414
569	Ga0265325_10020477	3300031241	Bacteria	3646
570	Ga0265325_10020557	3300031241	Bacteria	3639
571	Ga0265325_10072044	3300031241	Bacteria	1733
572	Ga0265329_10000055	3300031242	Bacteria	49177
573	Ga0265329_10000290	3300031242	Bacteria	26463
574	Ga0265329_10029561	3300031242	Bacteria	1790
575	Ga0265340_10068581	3300031247	Bacteria	1684
576	Ga0265339_10000059	3300031249	Bacteria	98287
577	Ga0265339_10002225	3300031249	Bacteria	14055
578	Ga0265339_10009276	3300031249	Bacteria	6199
579	Ga0265339_10010108	3300031249	Bacteria	5880
580	Ga0265339_10078044	3300031249	Bacteria	1754
581	Ga0265331_10015784	3300031250	Bacteria	3979
582	Ga0265327_10009533	3300031251	Bacteria	6988
583	Ga0265316_10000165	3300031344	Bacteria	74838
584	Ga0265316_10000320	3300031344	Bacteria	53356
585	Ga0265316_10000594	3300031344	Bacteria	40421
586	Ga0265316_10000776	3300031344	Bacteria	35252
587	Ga0265316_10002453	3300031344	Bacteria	19244
588	Ga0265316_10018934	3300031344	Bacteria	5908
589	Ga0265316_10034545	3300031344	Bacteria	4106
590	Ga0265316_10047102	3300031344	Bacteria	3412
591	Ga0265316_10147067	3300031344	Bacteria	1767
592	Ga0265313_10001520	3300031595	Bacteria	21599
593	Ga0265313_10030891	3300031595	Bacteria	2752
594	Ga0265313_10044351	3300031595	Unclassified	2171
595	Ga0265313_10055984	3300031595	Bacteria	1866
596	Ga0307508_10340554	3300031616	Bacteria	1091
597	Ga0316575_10000048	3300031665	Bacteria	30259
598	Ga0316575_10002350	3300031665	Bacteria	6336
599	Ga0316575_10019130	3300031665	Bacteria	2615
600	Ga0316575_10031196	3300031665	Bacteria	2086
601	Ga0316575_10076884	3300031665	Bacteria	1344
602	Ga0316579_10011415	3300031691	Bacteria	3776
603	Ga0316579_10023222	3300031691	Bacteria	2781
604	Ga0316579_10065613	3300031691	Bacteria	1713
605	Ga0265314_10004314	3300031711	Bacteria	13271
606	Ga0265314_10006774	3300031711	Bacteria	10051
607	Ga0265314_10019209	3300031711	Bacteria	5299
608	Ga0265314_10026020	3300031711	Bacteria	4403
609	Ga0265314_10037960	3300031711	Unclassified	3485
610	Ga0265314_10059290	3300031711	Bacteria	2619
611	Ga0265314_10254753	3300031711	Bacteria	1006
612	Ga0265342_10000121	3300031712	Bacteria	87591
613	Ga0265342_10001251	3300031712	Bacteria	23993
614	Ga0265342_10005473	3300031712	Bacteria	9667
615	Ga0265342_10005764	3300031712	Bacteria	9366
616	Ga0265342_10013174	3300031712	Bacteria	5560
617	Ga0265342_10032417	3300031712	Bacteria	3222
618	Ga0265342_10125931	3300031712	Bacteria	1438
619	Ga0316576_10039969	3300031727	Bacteria	3369
620	Ga0316578_10005669	3300031728	Bacteria	6078
621	Ga0316578_10188063	3300031728	Bacteria	1244
622	Ga0316577_10015118	3300031733	Bacteria	4244
623	Ga0316577_10267362	3300031733	Unclassified	967
624	Ga0307415_100112697	3300032126	Bacteria	2022
625	Ga0307415_100531716	3300032126	Bacteria	1034
626	Ga0316583_10000396	3300032133	Bacteria	12679
627	Ga0316585_10021756	3300032137	Bacteria	1970
628	Ga0316593_10000125	3300032168	Bacteria	10426
629	Ga0316593_10045001	3300032168	Bacteria	1478
630	Ga0316596_1020515	3300033541	Bacteria	1680
631	Ga0316596_1037408	3300033541	Bacteria	1270
632	Ga0316596_1060750	3300033541	Bacteria	1008
633	Ga0373959_0004714	3300034820	Bacteria	2212
634	Ga0373938_0012219	3300034957	Bacteria	1608
635	Ga0373926_0000081	3300035083	Bacteria	18249
636	Ga0373926_0020013	3300035083	Bacteria	2310
637	Ga0373926_0023354	3300035083	Bacteria	2147
638	Ga0373926_0023730	3300035083	Bacteria	2131
639	Ga0373926_0061285	3300035083	Bacteria	1372
640	Ga0373928_0009416	3300035084	Bacteria	1907
641	Ga0373934_0008083	3300035086	Bacteria	3918
642	Ga0373944_0000424	3300035089	Bacteria	9670
643	Ga0373944_0008621	3300035089	Bacteria	2753
644	Ga0373952_0012407	3300035092	Bacteria	1676
645	Ga0373923_0003296	3300035111	Bacteria	5150
646	Ga0373923_0035038	3300035111	Bacteria	2041
647	Ga0373923_0038027	3300035111	Bacteria	1970
648	Ga0373923_0186585	3300035111	Bacteria	954
649	Ga0373936_0000169	3300035113	Bacteria	21812
650	Ga0373936_0004296	3300035113	Bacteria	5384
651	Ga0373936_0022129	3300035113	Bacteria	2476
652	Ga0373936_0118349	3300035113	Bacteria	1130
653	Ga0373939_0037166	3300035114	Bacteria	1445
654	Ga0373939_0079486	3300035114	Bacteria	1086
655	Ga0373945_0000510	3300035116	Bacteria	11054
656	Ga0373945_0005792	3300035116	Bacteria	3965
657	Ga0373945_0006791	3300035116	Bacteria	3697
658	Ga0373945_0035270	3300035116	Bacteria	1787
659	Ga0373945_0035622	3300035116	Bacteria	1779
660	Ga0373953_0000044	3300035117	Bacteria	32505
661	Ga0373953_0011891	3300035117	Bacteria	3067
662	Ga0373954_0008518	3300035118	Bacteria	4503
663	Ga0373954_0076023	3300035118	Bacteria	1600
664	Ga0373956_0002560	3300035119	Bacteria	7390
665	Ga0373956_0004751	3300035119	Bacteria	5436
666	Ga0373956_0015419	3300035119	Bacteria	3199
667	Ga0373956_0028512	3300035119	Bacteria	2430
668	Ga0373957_0000107	3300035120	Bacteria	20022
669	Ga0373957_0029518	3300035120	Bacteria	2003
670	Ga0373957_0036172	3300035120	Bacteria	1838
671	Ga0373957_0060389	3300035120	Bacteria	1467
672	Ga0373960_0009843	3300035121	Bacteria	2324
673	Ga0373943_0000102	3300035170	Bacteria	31578
674	Ga0373943_0001153	3300035170	Bacteria	11799
675	Ga0373943_0007922	3300035170	Bacteria	4768
676	Ga0373943_0024879	3300035170	Bacteria	2795
677	Ga0373943_0028860	3300035170	Bacteria	2618
678	Ga0373946_0000662	3300035171	Bacteria	11546
679	Ga0373946_0015583	3300035171	Bacteria	2885
680	Ga0373946_0023405	3300035171	Bacteria	2413
681	Ga0373946_0052972	3300035171	Bacteria	1703
682	Ga0373946_0120549	3300035171	Bacteria	1197
683	Ga0373946_0130310	3300035171	Bacteria	1156
684	Ga0373955_0000014	3300035172	Bacteria	72349
685	Ga0373955_0001311	3300035172	Bacteria	10552
686	Ga0373955_0016839	3300035172	Bacteria	3604
687	Ga0373955_0035122	3300035172	Bacteria	2653
688	Ga0373955_0107397	3300035172	Bacteria	1610
689	Ga0373955_0130170	3300035172	Bacteria	1468
690	Ga0373942_0016581	3300035207	Bacteria	1808
691	Ga0373942_0035572	3300035207	Bacteria	1337
692	Ga0373961_0002306	3300035241	Bacteria	4986
693	Ga0373961_0026793	3300035241	Bacteria	1578
694	Ga0316574_0000978	3300035398	Bacteria	12825
695	Ga0316574_0004589	3300035398	Bacteria	7258
696	Ga0316574_0036070	3300035398	Bacteria	3026
697	Ga0316574_0039469	3300035398	Bacteria	2903
698	Ga0316574_0296277	3300035398	Bacteria	1029
699	Ga0373924_0000783	3300035410	Bacteria	9890
700	Ga0373924_0011693	3300035410	Bacteria	3264
701	Ga0373924_0016448	3300035410	Bacteria	2823
702	Ga0373924_0063146	3300035410	Bacteria	1553
703	Ga0373924_0145417	3300035410	Bacteria	1035
704	Ga0373931_0020045	3300035691	Bacteria	3343
705	Ga0373931_0024657	3300035691	Bacteria	3049
706	Ga0373931_0049224	3300035691	Bacteria	2237
707	Ga0373931_0050979	3300035691	Bacteria	2203
708	Ga0373935_0000066	3300035692	Bacteria	44441
709	Ga0373935_0003401	3300035692	Bacteria	9240
710	Ga0373935_0003437	3300035692	Bacteria	9204
711	Ga0373935_0003809	3300035692	Bacteria	8799
712	Ga0373935_0004966	3300035692	Bacteria	7824
713	Ga0373935_0036269	3300035692	Bacteria	3082
714	Ga0373927_0003194	3300035695	Bacteria	11808
715	Ga0373927_0005773	3300035695	Bacteria	8495
716	Ga0373927_0015668	3300035695	Bacteria	5006
717	Ga0373927_0016417	3300035695	Bacteria	4882
718	Ga0373927_0026337	3300035695	Bacteria	3800
719	Ga0373927_0049728	3300035695	Bacteria	2711
720	Ga0373927_0121717	3300035695	Bacteria	1703
721	Ga0373927_0133689	3300035695	Bacteria	1621
722	Ga0373927_0134775	3300035695	Bacteria	1614
723	Ga0373933_0000021	3300035724	Bacteria	96820
724	Ga0373933_0001274	3300035724	Bacteria	14859
725	Ga0373933_0041307	3300035724	Bacteria	2722
726	Ga0373933_0053486	3300035724	Bacteria	2418
727	Ga0373947_0000025	3300035725	Bacteria	84309
728	Ga0373947_0002831	3300035725	Bacteria	10354
729	Ga0373947_0002970	3300035725	Bacteria	10120
730	Ga0373947_0014558	3300035725	Bacteria	4512
731	Ga0373947_0026366	3300035725	Bacteria	3396
732	Ga0373947_0129737	3300035725	Bacteria	1608
733	Ga0373947_0229848	3300035725	Bacteria	1221
734	Ga0373947_0376345	3300035725	Bacteria	955
735	Ga0373937_0000032	3300036401	Bacteria	120148
736	Ga0373937_0016638	3300036401	Bacteria	6534
737	Ga0373937_0021858	3300036401	Bacteria	5744
738	Ga0373937_0027910	3300036401	Bacteria	5106
739	Ga0373937_0103170	3300036401	Bacteria	2648
740	Ga0373937_0148063	3300036401	Bacteria	2198
741	Ga0373937_0183951	3300036401	Bacteria	1963
742	Ga0373937_0193898	3300036401	Bacteria	1909
743	Ga0373937_0286986	3300036401	Bacteria	1555
744	Ga0373937_0392020	3300036401	Bacteria	1317
745	Ga0373937_0576963	3300036401	Bacteria	1068
746	Ga0372808_002633	3300036459	Bacteria	2099
747	Ga0316582_0001315	3300036647	Bacteria	10750
748	Ga0316582_0017550	3300036647	Bacteria	4144
749	Ga0316582_0029751	3300036647	Bacteria	3321
750	Ga0316582_0054831	3300036647	Bacteria	2539
751	Ga0316582_0079180	3300036647	Bacteria	2142
752	Ga0316582_0084025	3300036647	Bacteria	2084
753	Ga0316582_0090920	3300036647	Bacteria	2009
754	Ga0316582_0160304	3300036647	Bacteria	1524
755	Ga0316582_0397671	3300036647	Bacteria	949
756	Ga0316584_0024320	3300036712	Bacteria	4432
757	Ga0316584_0115122	3300036712	Bacteria	2011
758	Ga0373925_0001514	3300037068	Bacteria	19868
759	Ga0373925_0002640	3300037068	Bacteria	14221
760	Ga0373925_0003785	3300037068	Bacteria	11635
761	Ga0373925_0004656	3300037068	Bacteria	10355
762	Ga0373925_0015757	3300037068	Bacteria	5469
763	Ga0373925_0022111	3300037068	Bacteria	4636
764	Ga0373925_0067043	3300037068	Bacteria	2706
765	Ga0373925_0141881	3300037068	Bacteria	1881
766	Ga0373925_0201073	3300037068	Bacteria	1584
767	Ga0373925_0300685	3300037068	Bacteria	1295
768	Ga0373925_0302229	3300037068	Bacteria	1292
769	Ga0373925_0515810	3300037068	Bacteria	982
770	Ga0395899_0068874	3300037312	Bacteria	2593
771	Ga0395899_0304722	3300037312	Bacteria	1077
772	Ga0395900_0003352	3300037418	Bacteria	17307
773	Ga0395900_0037812	3300037418	Bacteria	4975
774	Ga0395900_0182218	3300037418	Bacteria	2134
775	Ga0395900_0411320	3300037418	Bacteria	1315
776	Ga0395898_0003228	3300037466	Bacteria	18329
777	Ga0395898_0008836	3300037466	Bacteria	10616
778	Ga0395898_0104024	3300037466	Bacteria	2723
779	Ga0395898_0516760	3300037466	Bacteria	1135
780	Ga0395905_0060164	3300037471	Bacteria	3552
781	Ga0436364_0454602	3300037853	Bacteria	2400
782	Ga0436364_0486446	3300037853	Bacteria	1944
783	Ga0436364_0690088	3300037853	Bacteria	1735
784	Ga0436364_1045514	3300037853	Bacteria	7555
785	Ga0436364_1171513	3300037853	Bacteria	122046
786	Ga0436364_1530016	3300037853	Bacteria	29546
787	Ga0436364_1546898	3300037853	Bacteria	867
788	Ga0395901_0011031	3300038443	Bacteria	9153
789	Ga0395901_0013249	3300038443	Bacteria	8372
790	Ga0395901_0059955	3300038443	Bacteria	3959
791	Ga0395901_0151391	3300038443	Bacteria	2438
792	Ga0395901_0261713	3300038443	Bacteria	1800
793	Ga0395901_0265644	3300038443	Bacteria	1785
794	Ga0395901_0297139	3300038443	Bacteria	1675
795	Ga0395901_0411575	3300038443	Bacteria	1388
796	Ga0400490_04430	3300038726	Unclassified	1056
797	Ga0400489_96005	3300039093	Bacteria	1278
798	Ga0436365_0471682	3300039437	Bacteria	352256
799	Ga0436365_0560405	3300039437	Bacteria	1138
800	Ga0436365_1097793	3300039437	Bacteria	3102
801	Ga0436365_1187437	3300039437	Bacteria	1656
802	Ga0436365_1419208	3300039437	Bacteria	2579
803	Ga0436365_1883742	3300039437	Bacteria	2809
804	Ga0436360_0751380	3300039438	Bacteria	10442
805	Ga0436361_1094564	3300039447	Bacteria	2414
806	Ga0436363_0515446	3300039450	Bacteria	1368
807	Ga0436363_1483820	3300039450	Bacteria	1775
808	Ga0439438_010104	3300041405	Bacteria	3009
809	Ga0439453_0014355	3300041408	Bacteria	1357
810	Ga0451802_1288203	3300041460	Bacteria	887
811	Ga0451853_0276144	3300041512	Bacteria	2611
812	Ga0439452_000011	3300042010	Bacteria	428451
813	Ga0439452_000191	3300042010	Bacteria	45233
814	Ga0439452_001085	3300042010	Bacteria	11986
815	Ga0450923_004735	3300042125	Bacteria	2152
816	Ga0451577_0000040	3300042876	Bacteria	346755
817	Ga0451577_0013370	3300042876	Bacteria	7685
818	Ga0451577_0039649	3300042876	Bacteria	4232
819	Ga0451577_0263284	3300042876	Unclassified	1561
820	Ga0451577_0581882	3300042876	Bacteria	1016
821	Ga0466981_0000001	3300044669	Bacteria	367980
822	Ga0466961_0059566	3300044693	Bacteria	2428
823	Ga0466961_0145398	3300044693	Bacteria	1483
824	Ga0466963_0001796	3300044694	Bacteria	11675
825	Ga0466963_0014075	3300044694	Bacteria	4928
826	Ga0466963_0043490	3300044694	Bacteria	2954
827	Ga0466963_0058419	3300044694	Bacteria	2571
828	Ga0466963_0067214	3300044694	Bacteria	2405
829	Ga0466963_0083874	3300044694	Bacteria	2161
830	Ga0466963_0317011	3300044694	Bacteria	1097
831	Ga0453684_0000179	3300044712	Bacteria	280195
832	Ga0453684_0053387	3300044712	Bacteria	5276
833	Ga0453684_0101140	3300044712	Bacteria	3527
834	Ga0453684_0350885	3300044712	Bacteria	1664
835	Ga0453684_0373459	3300044712	Bacteria	1603
836	Ga0466971_0129629	3300044719	Bacteria	1170
837	Ga0466957_0008496	3300044842	Bacteria	5843
838	Ga0466957_0033136	3300044842	Bacteria	3098
839	Ga0466957_0121330	3300044842	Bacteria	1666
840	Ga0466957_0198652	3300044842	Bacteria	1316
841	Ga0466957_0277606	3300044842	Bacteria	1120
842	Ga0466960_0024690	3300044901	Bacteria	2714
843	Ga0466959_0234517	3300045049	Bacteria	1269
844	Ga0451576_0052721	3300045051	Bacteria	4262
845	Ga0451576_0411436	3300045051	Bacteria	1418
846	Ga0466958_0002957	3300045836	Bacteria	8700
847	Ga0466958_0015785	3300045836	Bacteria	4338
848	Ga0466958_0068583	3300045836	Bacteria	2168
849	Ga0466958_0075297	3300045836	Bacteria	2070
850	Ga0466958_0268291	3300045836	Bacteria	1093
851	Ga0466967_0002751	3300045976	Bacteria	11125
852	Ga0466967_0004399	3300045976	Bacteria	9491
853	Ga0466967_0024343	3300045976	Bacteria	4976
854	Ga0466967_0081489	3300045976	Bacteria	2923
855	Ga0466967_0444178	3300045976	Bacteria	1267
856	Ga0495592_0000079	3300046454	Bacteria	85581
857	Ga0495592_0033827	3300046454	Bacteria	3855
858	Ga0495592_0041985	3300046454	Bacteria	3426
859	Ga0495592_0058786	3300046454	Bacteria	2834
860	Ga0495592_0094583	3300046454	Bacteria	2138
861	Ga0495592_0176509	3300046454	Bacteria	1458
862	Ga0495603_0005012	3300046455	Bacteria	7921
863	Ga0495603_0062367	3300046455	Bacteria	2201
864	Ga0495591_000202	3300046458	Bacteria	61048
865	Ga0495591_005725	3300046458	Bacteria	5670
866	Ga0495629_0000003	3300046459	Bacteria	529162
867	Ga0495629_0001585	3300046459	Bacteria	17884
868	Ga0495629_0010491	3300046459	Bacteria	6739
869	Ga0495629_0055843	3300046459	Bacteria	2762
870	Ga0495629_0153119	3300046459	Bacteria	1602
871	Ga0495629_0163647	3300046459	Bacteria	1545
872	Ga0495641_0031320	3300046461	Bacteria	2542
873	Ga0495641_0039996	3300046461	Bacteria	2183
874	Ga0495641_0065571	3300046461	Bacteria	1634
875	Ga0495651_0000010	3300046462	Bacteria	148763
876	Ga0495651_0006589	3300046462	Bacteria	8866
877	Ga0495651_0030038	3300046462	Bacteria	4237
878	Ga0495651_0044417	3300046462	Bacteria	3444
879	Ga0495651_0046869	3300046462	Bacteria	3344
880	Ga0495651_0054432	3300046462	Bacteria	3077
881	Ga0495651_0141411	3300046462	Bacteria	1745
882	Ga0495651_0225422	3300046462	Bacteria	1294
883	Ga0495653_0000601	3300046463	Bacteria	27606
884	Ga0495653_0003054	3300046463	Bacteria	13434
885	Ga0495653_0004864	3300046463	Bacteria	10898
886	Ga0495653_0016804	3300046463	Bacteria	5954
887	Ga0495653_0018932	3300046463	Bacteria	5587
888	Ga0495653_0026556	3300046463	Bacteria	4641
889	Ga0495653_0028799	3300046463	Bacteria	4440
890	Ga0495653_0037589	3300046463	Bacteria	3802
891	Ga0495653_0042812	3300046463	Bacteria	3523
892	Ga0495650_0000040	3300046471	Bacteria	366254
893	Ga0495580_0010328	3300046472	Bacteria	7278
894	Ga0495580_0033626	3300046472	Bacteria	3693
895	Ga0495580_0060900	3300046472	Bacteria	2651
896	Ga0495580_0125138	3300046472	Bacteria	1784
897	Ga0495580_0244577	3300046472	Bacteria	1229
898	Ga0495580_0447572	3300046472	Bacteria	867
899	Ga0495582_0009567	3300046473	Bacteria	5337
900	Ga0495582_0010683	3300046473	Bacteria	5050
901	Ga0495582_0012003	3300046473	Bacteria	4772
902	Ga0495639_0000498	3300046475	Bacteria	18549
903	Ga0495639_0002485	3300046475	Bacteria	8042
904	Ga0495639_0035932	3300046475	Bacteria	2218
905	Ga0495639_0047833	3300046475	Bacteria	1939
906	Ga0495662_0001205	3300046476	Bacteria	12769
907	Ga0495662_0004269	3300046476	Bacteria	7187
908	Ga0495662_0022636	3300046476	Bacteria	3034
909	Ga0495662_0061985	3300046476	Bacteria	1807
910	Ga0495664_0000600	3300046477	Bacteria	18276
911	Ga0495664_0001749	3300046477	Bacteria	11547
912	Ga0495664_0018516	3300046477	Bacteria	3992
913	Ga0495664_0024267	3300046477	Bacteria	3523
914	Ga0495664_0058694	3300046477	Bacteria	2289
915	Ga0495664_0108057	3300046477	Bacteria	1678
916	Ga0495585_0197604	3300046492	Bacteria	1026
917	Ga0495594_0026465	3300046499	Bacteria	3121
918	Ga0495594_0033289	3300046499	Bacteria	2801
919	Ga0495583_0011685	3300046506	Bacteria	5028
920	Ga0495608_0000037	3300046511	Bacteria	125064
921	Ga0495608_0005687	3300046511	Bacteria	8899
922	Ga0495608_0022677	3300046511	Bacteria	4306
923	Ga0495608_0022744	3300046511	Bacteria	4299
924	Ga0495608_0047001	3300046511	Bacteria	2870
925	Ga0495608_0051877	3300046511	Bacteria	2717
926	Ga0495608_0069105	3300046511	Bacteria	2308
927	Ga0495608_0079929	3300046511	Bacteria	2126
928	Ga0495608_0120985	3300046511	Bacteria	1679
929	Ga0495618_0003129	3300046514	Bacteria	10407
930	Ga0495618_0017003	3300046514	Bacteria	4457
931	Ga0495618_0042192	3300046514	Bacteria	2875
932	Ga0495618_0068672	3300046514	Bacteria	2254
933	Ga0495618_0081193	3300046514	Bacteria	2070
934	Ga0495618_0092147	3300046514	Bacteria	1937
935	Ga0495618_0181913	3300046514	Bacteria	1335
936	Ga0495628_0000227	3300046516	Bacteria	49431
937	Ga0495628_0131565	3300046516	Bacteria	1913
938	Ga0495630_0006270	3300046517	Bacteria	8444
939	Ga0495630_0006647	3300046517	Bacteria	8240
940	Ga0495630_0045136	3300046517	Bacteria	3292
941	Ga0495630_0205292	3300046517	Bacteria	1504
942	Ga0495630_0306572	3300046517	Bacteria	1213
943	Ga0495630_0510993	3300046517	Bacteria	921
944	Ga0495666_0000097	3300046526	Bacteria	36070
945	Ga0495666_0082709	3300046526	Bacteria	1518
946	Ga0495666_0134664	3300046526	Bacteria	1153
947	Ga0495666_0177618	3300046526	Bacteria	984
948	Ga0495652_0000180	3300046529	Bacteria	71646
949	Ga0495652_0003471	3300046529	Bacteria	15544
950	Ga0495652_0008373	3300046529	Bacteria	9444
951	Ga0495652_0039277	3300046529	Bacteria	4093
952	Ga0495652_0045086	3300046529	Bacteria	3794
953	Ga0495652_0056220	3300046529	Bacteria	3343
954	Ga0495652_0097574	3300046529	Bacteria	2390
955	Ga0495652_0127501	3300046529	Bacteria	2019
956	Ga0495652_0218548	3300046529	Bacteria	1433
957	Ga0495652_0276533	3300046529	Bacteria	1231
958	Ga0495654_0019199	3300046530	Bacteria	3576
959	Ga0495665_0003325	3300046531	Bacteria	8716
960	Ga0495665_0007768	3300046531	Bacteria	5804
961	Ga0495665_0008002	3300046531	Bacteria	5734
962	Ga0495665_0072185	3300046531	Bacteria	1818
963	Ga0495640_0003109	3300046533	Bacteria	13396
964	Ga0495640_0031847	3300046533	Bacteria	3761
965	Ga0495640_0049504	3300046533	Bacteria	2897
966	Ga0495640_0086368	3300046533	Bacteria	2077
967	Ga0495640_0141397	3300046533	Bacteria	1551
968	Ga0495640_0153400	3300046533	Bacteria	1479
969	Ga0495640_0237663	3300046533	Bacteria	1144
970	Ga0495586_0001396	3300046535	Bacteria	13380
971	Ga0495586_0007508	3300046535	Bacteria	5820
972	Ga0495586_0024059	3300046535	Bacteria	3253
973	Ga0495586_0069338	3300046535	Bacteria	1924
974	Ga0495586_0116934	3300046535	Unclassified	1487
975	Ga0495586_0278368	3300046535	Bacteria	957
976	Ga0495587_0000024	3300046536	Bacteria	148753
977	Ga0495587_0004103	3300046536	Bacteria	9638
978	Ga0495587_0019162	3300046536	Bacteria	4238
979	Ga0495587_0019778	3300046536	Bacteria	4162
980	Ga0495587_0043253	3300046536	Bacteria	2682
981	Ga0495587_0084942	3300046536	Bacteria	1833
982	Ga0495587_0131300	3300046536	Bacteria	1431
983	Ga0495587_0145330	3300046536	Bacteria	1352
984	Ga0495597_0001264	3300046542	Bacteria	18647
985	Ga0495645_0033928	3300046543	Bacteria	3723
986	Ga0495645_0046328	3300046543	Bacteria	3169
987	Ga0495645_0083976	3300046543	Bacteria	2281
988	Ga0495622_0009559	3300046557	Bacteria	4488
989	Ga0495667_0000024	3300046559	Bacteria	168313
990	Ga0495667_0002447	3300046559	Bacteria	12399
991	Ga0495667_0033606	3300046559	Bacteria	3432
992	Ga0495667_0051732	3300046559	Bacteria	2709
993	Ga0495667_0063541	3300046559	Bacteria	2416
994	Ga0495667_0084299	3300046559	Bacteria	2063
995	Ga0495667_0089424	3300046559	Unclassified	1996
996	Ga0495667_0143313	3300046559	Bacteria	1539
997	Ga0495634_0008957	3300046642	Bacteria	7410
998	Ga0495634_0012202	3300046642	Bacteria	6229
999	Ga0495634_0020786	3300046642	Bacteria	4650
1000	Ga0495634_0093356	3300046642	Bacteria	1951
1001	Ga0495625_0013065	3300046660	Bacteria	6691
1002	Ga0495635_0000698	3300046663	Bacteria	21638
1003	Ga0495635_0002396	3300046663	Bacteria	12771
1004	Ga0495635_0013834	3300046663	Bacteria	5643
1005	Ga0495635_0021399	3300046663	Bacteria	4506
1006	Ga0495635_0074276	3300046663	Bacteria	2329
1007	Ga0495635_0076822	3300046663	Bacteria	2288
1008	Ga0495635_0097058	3300046663	Bacteria	2014
1009	Ga0495635_0179074	3300046663	Bacteria	1441
1010	Ga0495659_0055340	3300046664	Bacteria	1454
1011	Ga0495588_0015114	3300046674	Bacteria	3709
1012	Ga0495657_0000121	3300046675	Bacteria	69526
1013	Ga0495657_0023553	3300046675	Bacteria	4397
1014	Ga0495657_0046568	3300046675	Bacteria	2935
1015	Ga0495657_0047431	3300046675	Bacteria	2904
1016	Ga0495657_0067872	3300046675	Bacteria	2339
1017	Ga0495657_0073246	3300046675	Bacteria	2231
1018	Ga0495657_0104569	3300046675	Bacteria	1800
1019	Ga0495599_0000362	3300046678	Bacteria	26767
1020	Ga0495599_0001065	3300046678	Bacteria	15433
1021	Ga0495599_0010778	3300046678	Bacteria	5601
1022	Ga0495599_0012754	3300046678	Bacteria	5185
1023	Ga0495599_0196179	3300046678	Bacteria	1241
1024	Ga0495623_0003314	3300046679	Bacteria	10644
1025	Ga0495623_0006380	3300046679	Bacteria	7670
1026	Ga0495623_0034632	3300046679	Bacteria	3238
1027	Ga0495623_0074400	3300046679	Bacteria	2111
1028	Ga0495623_0120032	3300046679	Bacteria	1583
1029	Ga0495646_0010081	3300046680	Bacteria	6009
1030	Ga0495646_0012744	3300046680	Bacteria	5343
1031	Ga0495646_0024899	3300046680	Bacteria	3765
1032	Ga0495646_0028472	3300046680	Bacteria	3498
1033	Ga0495646_0036135	3300046680	Bacteria	3062
1034	Ga0495646_0064067	3300046680	Bacteria	2180
1035	Ga0495646_0072968	3300046680	Bacteria	2017
1036	Ga0495646_0180657	3300046680	Bacteria	1158
1037	Ga0495647_0041429	3300046681	Bacteria	1754
1038	Ga0495647_0067250	3300046681	Bacteria	1427
1039	Ga0495658_0003636	3300046683	Bacteria	7633
1040	Ga0495658_0015577	3300046683	Bacteria	3901
1041	Ga0495613_0019496	3300046689	Bacteria	5055
1042	Ga0495613_0028170	3300046689	Bacteria	4178
1043	Ga0495613_0056812	3300046689	Bacteria	2874
1044	Ga0495624_0014423	3300046690	Bacteria	5362
1045	Ga0495624_0051331	3300046690	Bacteria	2610
1046	Ga0495624_0069662	3300046690	Bacteria	2190
1047	Ga0495649_0000130	3300046694	Bacteria	66169
1048	Ga0495649_0006193	3300046694	Bacteria	7470
1049	Ga0495649_0073332	3300046694	Unclassified	1834
1050	Ga0495600_0000659	3300046809	Bacteria	17938
1051	Ga0495600_0004325	3300046809	Bacteria	8494
1052	Ga0495600_0008867	3300046809	Bacteria	6196
1053	Ga0495600_0017185	3300046809	Bacteria	4598
1054	Ga0495600_0023984	3300046809	Bacteria	3927
1055	Ga0495600_0194164	3300046809	Bacteria	1305
1056	Ga0495600_0199986	3300046809	Bacteria	1283
1057	Ga0495600_0213374	3300046809	Bacteria	1236
1058	Ga0495600_0301168	3300046809	Bacteria	1011
1059	Ga0495581_0003599	3300047315	Bacteria	8916
1060	Ga0495581_0005385	3300047315	Bacteria	7403
1061	Ga0495581_0008719	3300047315	Bacteria	5873
1062	Ga0495581_0073274	3300047315	Bacteria	1981
1063	Ga0495581_0162501	3300047315	Bacteria	1305
1064	Ga0495581_0307514	3300047315	Bacteria	926
1065	Ga0495604_0000024	3300047317	Bacteria	148542
1066	Ga0495604_0005116	3300047317	Bacteria	10380
1067	Ga0495604_0012952	3300047317	Bacteria	6646
1068	Ga0495604_0015781	3300047317	Bacteria	6028
1069	Ga0495604_0046618	3300047317	Bacteria	3379
1070	Ga0495604_0060485	3300047317	Bacteria	2901
1071	Ga0495604_0097244	3300047317	Bacteria	2171
1072	Ga0495604_0163518	3300047317	Bacteria	1571
1073	Ga0495604_0232682	3300047317	Bacteria	1263
1074	Ga0495674_0002024	3300047319	Bacteria	19933
1075	Ga0495674_0004086	3300047319	Bacteria	14114
1076	Ga0495674_0008437	3300047319	Bacteria	9816
1077	Ga0495674_0008562	3300047319	Bacteria	9735
1078	Ga0495674_0022932	3300047319	Bacteria	5751
1079	Ga0495674_0066867	3300047319	Bacteria	3116
1080	Ga0495674_0081812	3300047319	Bacteria	2769
1081	Ga0495674_0194576	3300047319	Bacteria	1684
1082	Ga0495672_0000051	3300047320	Bacteria	237883
1083	Ga0495672_0073481	3300047320	Bacteria	1928
1084	Ga0495676_0002235	3300047321	Bacteria	17178
1085	Ga0495676_0006632	3300047321	Bacteria	10673
1086	Ga0495676_0060043	3300047321	Bacteria	2982
1087	Ga0495676_0115690	3300047321	Bacteria	1960
1088	Ga0495680_0000005	3300047322	Bacteria	168308
1089	Ga0495680_0003108	3300047322	Bacteria	16531
1090	Ga0495680_0007728	3300047322	Bacteria	9820
1091	Ga0495680_0007834	3300047322	Bacteria	9752
1092	Ga0495680_0010255	3300047322	Bacteria	8360
1093	Ga0495680_0021094	3300047322	Bacteria	5459
1094	Ga0495680_0021170	3300047322	Bacteria	5450
1095	Ga0495680_0029410	3300047322	Bacteria	4499
1096	Ga0495680_0073977	3300047322	Bacteria	2588
1097	Ga0495680_0088309	3300047322	Bacteria	2330
1098	Ga0495680_0103389	3300047322	Bacteria	2120
1099	Ga0495680_0107090	3300047322	Bacteria	2076
1100	Ga0495675_0001438	3300047444	Bacteria	14415
1101	Ga0495675_0005970	3300047444	Bacteria	7445
1102	Ga0495675_0017982	3300047444	Bacteria	4482
1103	Ga0495675_0024612	3300047444	Bacteria	3839
1104	Ga0495675_0118547	3300047444	Bacteria	1649
1105	Ga0495673_0000055	3300047469	Bacteria	247894
1106	Ga0495673_0081752	3300047469	Unclassified	1337
1107	Ga0495681_0061767	3300047470	Bacteria	1725
1108	Ga0495684_0001943	3300047471	Bacteria	16581
1109	Ga0495684_0002838	3300047471	Bacteria	13650
1110	Ga0495684_0007401	3300047471	Bacteria	8507
1111	Ga0495684_0008935	3300047471	Bacteria	7739
1112	Ga0495684_0011491	3300047471	Bacteria	6840
1113	Ga0495684_0050037	3300047471	Bacteria	3191
1114	Ga0495684_0135724	3300047471	Bacteria	1846
1115	Ga0495684_0348131	3300047471	Bacteria	1052
1116	Ga0495593_0018467	3300047673	Bacteria	3917
1117	Ga0495593_0034795	3300047673	Bacteria	2738
1118	Ga0495593_0144347	3300047673	Bacteria	1205
1119	Ga0495602_0000198	3300048088	Bacteria	56006
1120	Ga0495602_0029203	3300048088	Bacteria	5259
1121	Ga0495602_0041349	3300048088	Bacteria	4212
1122	Ga0495602_0058204	3300048088	Bacteria	3385
1123	Ga0495602_0126224	3300048088	Bacteria	2049
1124	Ga0495602_0143874	3300048088	Bacteria	1884
1125	Ga0495602_0200141	3300048088	Bacteria	1525
1126	Ga0495602_0218018	3300048088	Bacteria	1442
1127	Ga0495602_0304830	3300048088	Bacteria	1164
1128	Ga0495614_0012741	3300048089	Bacteria	3689
1129	Ga0495614_0039150	3300048089	Bacteria	2034
1130	Ga0496100_0037263	3300048903	Bacteria	3073
1131	Ga0496100_0133114	3300048903	Bacteria	1753
1132	Ga0496100_0389318	3300048903	Bacteria	1060
1133	Ga0496100_0457108	3300048903	Bacteria	979
1134	Ga0496101_0003301	3300048904	Bacteria	10039
1135	Ga0496101_0005337	3300048904	Bacteria	8188
1136	Ga0496101_0044676	3300048904	Bacteria	3170
1137	Ga0496101_0058507	3300048904	Bacteria	2791
1138	Ga0496101_0228214	3300048904	Bacteria	1447
1139	Ga0496102_0050544	3300048905	Bacteria	3785
1140	Ga0496102_0138415	3300048905	Bacteria	2281
1141	Ga0496102_0180215	3300048905	Bacteria	1990
1142	Ga0496102_0194637	3300048905	Bacteria	1911
1143	Ga0496102_0545449	3300048905	Bacteria	1082
1144	Ga0496103_0007127	3300048906	Bacteria	6672
1145	Ga0496104_0000142	3300048907	Bacteria	66482
1146	Ga0496104_0001194	3300048907	Bacteria	22354
1147	Ga0496104_0003348	3300048907	Bacteria	13840
1148	Ga0496104_0006860	3300048907	Bacteria	10038
1149	Ga0496104_0016626	3300048907	Bacteria	6686
1150	Ga0496104_0022297	3300048907	Bacteria	5816
1151	Ga0496104_0337543	3300048907	Bacteria	1420
1152	Ga0496105_0002102	3300048908	Bacteria	14413
1153	Ga0496105_0019782	3300048908	Bacteria	5432
1154	Ga0496105_0020513	3300048908	Bacteria	5341
1155	Ga0496105_0029059	3300048908	Bacteria	4524
1156	Ga0496105_0061613	3300048908	Bacteria	3096
1157	Ga0496106_0025932	3300048909	Bacteria	4360
1158	Ga0496106_0026132	3300048909	Bacteria	4344
1159	Ga0496106_0113297	3300048909	Bacteria	2114
1160	Ga0496106_0313477	3300048909	Bacteria	1259
1161	Ga0496107_0006945	3300048910	Bacteria	7802
1162	Ga0496107_0013149	3300048910	Bacteria	5783
1163	Ga0496107_0021209	3300048910	Bacteria	4592
1164	Ga0496107_0039875	3300048910	Bacteria	3370
1165	Ga0496107_0211681	3300048910	Bacteria	1441
1166	Ga0496108_0003022	3300048911	Bacteria	13525
1167	Ga0496108_0012378	3300048911	Bacteria	6943
1168	Ga0496108_0017814	3300048911	Bacteria	5810
1169	Ga0496108_0046267	3300048911	Bacteria	3635
1170	Ga0496108_0124734	3300048911	Bacteria	2210
1171	Ga0496109_0002157	3300048912	Bacteria	16358
1172	Ga0496109_0035028	3300048912	Bacteria	4526
1173	Ga0496109_0040197	3300048912	Bacteria	4235
1174	Ga0496109_0085882	3300048912	Bacteria	2906
1175	Ga0496109_0125376	3300048912	Bacteria	2394
1176	Ga0496109_0262867	3300048912	Bacteria	1625
1177	Ga0496109_0519119	3300048912	Bacteria	1124
1178	Ga0496110_0000935	3300048913	Bacteria	20529
1179	Ga0496110_0018818	3300048913	Bacteria	5800
1180	Ga0496110_0021299	3300048913	Bacteria	5486
1181	Ga0496110_0032571	3300048913	Bacteria	4503
1182	Ga0496110_0101971	3300048913	Bacteria	2573
1183	Ga0496110_0190309	3300048913	Bacteria	1863
1184	Ga0496111_0019470	3300048914	Bacteria	4714
1185	Ga0496111_0102977	3300048914	Bacteria	2099
1186	Ga0496111_0173083	3300048914	Bacteria	1604
1187	Ga0496111_0185691	3300048914	Bacteria	1546
1188	Ga0496111_0261783	3300048914	Bacteria	1283
1189	Ga0496111_0265457	3300048914	Bacteria	1273
1190	Ga0496112_0000183	3300048915	Bacteria	40211
1191	Ga0496112_0022543	3300048915	Bacteria	6001
1192	Ga0496112_0029249	3300048915	Bacteria	5327
1193	Ga0496112_0071174	3300048915	Bacteria	3437
1194	Ga0496112_0093208	3300048915	Bacteria	2982
1195	Ga0496112_0102494	3300048915	Bacteria	2832
1196	Ga0496112_0191334	3300048915	Bacteria	2008
1197	Ga0496113_0003554	3300048916	Bacteria	9353
1198	Ga0496113_0055458	3300048916	Bacteria	2971
1199	Ga0496113_0085485	3300048916	Bacteria	2423
1200	Ga0496113_0265470	3300048916	Bacteria	1371
1201	Ga0496114_0000058	3300048917	Bacteria	94552
1202	Ga0496114_0061949	3300048917	Bacteria	3130
1203	Ga0496114_0188324	3300048917	Bacteria	1804
1204	Ga0496115_0011367	3300048918	Bacteria	6671
1205	Ga0496115_0016550	3300048918	Bacteria	5618
1206	Ga0496115_0073872	3300048918	Bacteria	2768
1207	Ga0496115_0091891	3300048918	Bacteria	2481
1208	Ga0496116_0001554	3300048919	Bacteria	25390
1209	Ga0496116_0017049	3300048919	Bacteria	5657
1210	Ga0496116_0022687	3300048919	Bacteria	4697
1211	Ga0496117_0000267	3300048920	Bacteria	98737
1212	Ga0496117_0001864	3300048920	Bacteria	28453
1213	Ga0496117_0011678	3300048920	Bacteria	7840
1214	Ga0496117_0018619	3300048920	Bacteria	5741
1215	Ga0496117_0091292	3300048920	Bacteria	1959
1216	Ga0496117_0103220	3300048920	Bacteria	1797
1217	Ga0496118_0000238	3300048921	Bacteria	96987
1218	Ga0496118_0004021	3300048921	Bacteria	17882
1219	Ga0496118_0034109	3300048921	Bacteria	4160
1220	Ga0496118_0084003	3300048921	Bacteria	2223
1221	Ga0496118_0190175	3300048921	Bacteria	1228
1222	Ga0496118_0218870	3300048921	Bacteria	1110
1223	Ga0496119_0000438	3300048922	Bacteria	57088
1224	Ga0496119_0005383	3300048922	Bacteria	12301
1225	Ga0496119_0016375	3300048922	Bacteria	5644
1226	Ga0496119_0054374	3300048922	Bacteria	2437
1227	Ga0496119_0064575	3300048922	Bacteria	2173
1228	Ga0496120_0005047	3300048923	Bacteria	10701
1229	Ga0496120_0005098	3300048923	Bacteria	10625
1230	Ga0496120_0006515	3300048923	Bacteria	8946
1231	Ga0496121_0002164	3300048924	Bacteria	30753
1232	Ga0496121_0003719	3300048924	Bacteria	21394
1233	Ga0496121_0015662	3300048924	Bacteria	7911
1234	Ga0496121_0031965	3300048924	Bacteria	4796
1235	Ga0496121_0039378	3300048924	Bacteria	4167
1236	Ga0496121_0057989	3300048924	Unclassified	3205
1237	Ga0496122_0000016	3300048925	Bacteria	443353
1238	Ga0496122_0000704	3300048925	Bacteria	66052
1239	Ga0496122_0001356	3300048925	Bacteria	39932
1240	Ga0496122_0002447	3300048925	Bacteria	26292
1241	Ga0496122_0098094	3300048925	Bacteria	1969
1242	Ga0496122_0147195	3300048925	Bacteria	1461
1243	Ga0496122_0226105	3300048925	Bacteria	1068
1244	Ga0496122_0235335	3300048925	Bacteria	1037
1245	Ga0496123_0000017	3300048926	Bacteria	415261
1246	Ga0496123_0000195	3300048926	Bacteria	123066
1247	Ga0496123_0001123	3300048926	Bacteria	39932
1248	Ga0496123_0002091	3300048926	Bacteria	25686
1249	Ga0496123_0003100	3300048926	Bacteria	19077
1250	Ga0496123_0029613	3300048926	Bacteria	4024
1251	Ga0496123_0179226	3300048926	Bacteria	1108
1252	Ga0496124_0000618	3300048927	Bacteria	59667
1253	Ga0496124_0001752	3300048927	Bacteria	30334
1254	Ga0496124_0040713	3300048927	Bacteria	4017
1255	Ga0496124_0053564	3300048927	Bacteria	3418
1256	Ga0496124_0056316	3300048927	Bacteria	3316
1257	Ga0496124_0192553	3300048927	Bacteria	1558
1258	Ga0496124_0310535	3300048927	Bacteria	1134
1259	Ga0496125_0004453	3300048928	Bacteria	16170
1260	Ga0496125_0023482	3300048928	Bacteria	5691
1261	Ga0496125_0045777	3300048928	Bacteria	3677
1262	Ga0496125_0066900	3300048928	Bacteria	2835
1263	Ga0496125_0221914	3300048928	Bacteria	1217
1264	Ga0496126_0000626	3300048929	Bacteria	66242
1265	Ga0496126_0007432	3300048929	Bacteria	12016
1266	Ga0496126_0007502	3300048929	Bacteria	11947
1267	Ga0496126_0028335	3300048929	Bacteria	5339
1268	Ga0495682_0006258	3300049460	Bacteria	4838
1269	Ga0501031_0006323	3300049568	Bacteria	7721
1270	Ga0501032_0003419	3300049569	Bacteria	12156
1271	Ga0501033_0009921	3300049570	Bacteria	7311
1272	Ga0501033_0042041	3300049570	Bacteria	3408
1273	Ga0501034_0326217	3300049571	Bacteria	1467
1274	Ga0501034_0366121	3300049571	Bacteria	1368
1275	Ga0501036_0036875	3300049572	Bacteria	4136
1276	Ga0501036_0205022	3300049572	Bacteria	1658
1277	Ga0501037_0005593	3300049573	Bacteria	9160
1278	Ga0501038_0084839	3300049574	Bacteria	2664
1279	Ga0501039_0004648	3300049575	Bacteria	10376
1280	Ga0501042_0107014	3300049578	Bacteria	2013
1281	Ga0501042_0138305	3300049578	Bacteria	1755
1282	Ga0501043_0006514	3300049579	Bacteria	9368
1283	Ga0501046_0014564	3300049580	Bacteria	6628
1284	Ga0501046_0204109	3300049580	Bacteria	1470
1285	Ga0501047_0011482	3300049581	Bacteria	8384
1286	Ga0501047_0082428	3300049581	Bacteria	3091
1287	Ga0501047_0098526	3300049581	Bacteria	2802
1288	Ga0501048_0007757	3300049582	Bacteria	8135
1289	Ga0501067_0011209	3300049583	Bacteria	4961
1290	Ga0501067_0016063	3300049583	Bacteria	4140
1291	Ga0501067_0043519	3300049583	Bacteria	2494
1292	Ga0501068_0010669	3300049584	Bacteria	5167
1293	Ga0501068_0211508	3300049584	Bacteria	1231
1294	Ga0501069_0008834	3300049585	Bacteria	5309
1295	Ga0501069_0056764	3300049585	Bacteria	2182
1296	Ga0501069_0264248	3300049585	Bacteria	1005
1297	Ga0501070_0019216	3300049586	Bacteria	5730
1298	Ga0501070_0191814	3300049586	Bacteria	1679
1299	Ga0501071_0037999	3300049587	Bacteria	3439
1300	Ga0501072_0179894	3300049588	Bacteria	1687
1301	Ga0501073_0010725	3300049589	Bacteria	6710
1302	Ga0501074_0009792	3300049590	Bacteria	6960
1303	Ga0501074_0348242	3300049590	Bacteria	1051
1304	Ga0501074_0423241	3300049590	Bacteria	944
1305	Ga0501075_0053730	3300049591	Bacteria	3030
1306	Ga0501076_0022017	3300049592	Bacteria	4896
1307	Ga0501076_0056479	3300049592	Bacteria	3116
1308	Ga0501077_0057505	3300049593	Bacteria	2469
1309	Ga0501077_0111021	3300049593	Bacteria	1738
1310	Ga0501079_0025812	3300049741	Bacteria	4506
1311	Ga0501079_0029184	3300049741	Bacteria	4234
1312	Ga0501080_0035035	3300049742	Bacteria	4686
1313	Ga0501083_0005774	3300049744	Bacteria	8761
1314	Ga0501035_0010409	3300049822	Bacteria	8621
1315	Ga0501035_0349971	3300049822	Bacteria	1236
1316	Ga0501044_0000458	3300049823	Bacteria	49695
1317	Ga0501044_0024054	3300049823	Bacteria	6471
1318	Ga0501045_0011145	3300049824	Bacteria	6300
1319	Ga0501045_0077820	3300049824	Bacteria	2445
1320	nmdc:mga00v17_37591_c1	3300050491	Bacteria	2892
1321	nmdc:mga00v17_55182_c1	3300050491	Bacteria	2426
1322	nmdc:mga00v17_6287_c1	3300050491	Bacteria	6297
1323	nmdc:mga0yw44_189843_c1	3300050492	Bacteria	1355
1324	nmdc:mga0yw44_41337_c1	3300050492	Bacteria	2744
1325	nmdc:mga0yw44_62836_c1	3300050492	Bacteria	2282
1326	nmdc:mga0k408_83959_c1	3300050493	Bacteria	1868
1327	nmdc:mga06z11_70549_c1	3300050494	Bacteria	1847
1328	nmdc:mga07m45_57477_c1	3300050496	Bacteria	2200
1329	nmdc:mga05p37_259348_c1	3300050507	Bacteria	2081
1330	nmdc:mga05p37_965654_c1	3300050507	Bacteria	910
1331	nmdc:mga09592_148083_c1	3300050508	Bacteria	2025
1332	nmdc:mga09592_160385_c1	3300050508	Bacteria	1943
1333	nmdc:mga09592_38376_c1	3300050508	Bacteria	4020
1334	nmdc:mga09592_462396_c1	3300050508	Bacteria	1094
1335	nmdc:mga0qj67_186743_c1	3300050509	Bacteria	1684
1336	nmdc:mga0qj67_487696_c1	3300050509	Bacteria	991
1337	nmdc:mga0qj67_60510_c1	3300050509	Bacteria	3006
1338	nmdc:mga0qj67_7308_c1	3300050509	Bacteria	8164
1339	nmdc:mga0qj67_74130_c1	3300050509	Bacteria	2720
1340	nmdc:mga06r32_105930_c1	3300050510	Bacteria	2763
1341	nmdc:mga06r32_201639_c1	3300050510	Bacteria	1977
1342	nmdc:mga06r32_36239_c1	3300050510	Bacteria	4659
1343	nmdc:mga08y16_150661_c1	3300050511	Bacteria	2418
1344	nmdc:mga08y16_34782_c1	3300050511	Bacteria	5293
1345	nmdc:mga08y16_439005_c1	3300050511	Bacteria	1333
1346	nmdc:mga0n895_120411_c1	3300050512	Bacteria	2646
1347	nmdc:mga0n895_12622_c1	3300050512	Bacteria	7583
1348	nmdc:mga0n895_2379_c1	3300050512	Bacteria	14666
1349	nmdc:mga0n895_338196_c1	3300050512	Bacteria	1525
1350	nmdc:mga0n895_340810_c1	3300050512	Bacteria	1518
1351	nmdc:mga0n895_67230_c1	3300050512	Bacteria	3549
1352	nmdc:mga0n895_79016_c1	3300050512	Bacteria	1622
1353	nmdc:mga0rr50_211460_c1	3300050513	Bacteria	1598
1354	nmdc:mga0rr50_26188_c1	3300050513	Bacteria	4065
1355	nmdc:mga0rr50_61298_c1	3300050513	Bacteria	2833
1356	nmdc:mga0rr50_61869_c1	3300050513	Bacteria	2822
1357	nmdc:mga08x19_105878_c1	3300050514	Bacteria	1871
1358	nmdc:mga08x19_143221_c1	3300050514	Bacteria	1615
1359	nmdc:mga08x19_150147_c1	3300050514	Bacteria	1577
1360	nmdc:mga08x19_17976_c1	3300050514	Bacteria	4330
1361	nmdc:mga08x19_5254_c1	3300050514	Bacteria	7663
1362	nmdc:mga0a205_487338_c1	3300050515	Bacteria	1091
1363	nmdc:mga0a205_87562_c1	3300050515	Bacteria	3009
1364	Ga0495601_0001015	3300053077	Bacteria	15352
1365	Ga0495601_0001616	3300053077	Bacteria	12412
1366	Ga0495601_0048678	3300053077	Bacteria	2670
1367	Ga0495601_0053458	3300053077	Bacteria	2553
1368	Ga0495601_0073155	3300053077	Bacteria	2190
1369	Ga0495601_0193408	3300053077	Bacteria	1329
1370	Ga0495601_0217724	3300053077	Bacteria	1247
1371	Ga0495612_0000970	3300053078	Bacteria	11804
1372	Ga0495612_0028656	3300053078	Bacteria	2242
1373	Ga0495612_0061099	3300053078	Bacteria	1560
1374	Ga0495612_0077534	3300053078	Bacteria	1393
1375	Ga0495655_0062176	3300053083	Bacteria	1022
1376	Ga0495595_0002897	3300053084	Bacteria	6762
1377	Ga0495595_0006960	3300053084	Bacteria	4616
1378	Ga0495595_0008245	3300053084	Bacteria	4279
1379	Ga0495595_0014543	3300053084	Bacteria	3342
1380	Ga0495595_0019585	3300053084	Bacteria	2937
1381	Ga0495619_0001492	3300053085	Bacteria	15422
1382	Ga0495619_0003980	3300053085	Bacteria	9474
1383	Ga0495619_0004020	3300053085	Bacteria	9418
1384	Ga0495619_0041661	3300053085	Bacteria	3004
1385	Ga0495619_0050506	3300053085	Bacteria	2745
1386	Ga0495619_0096929	3300053085	Bacteria	2003
1387	Ga0495619_0114550	3300053085	Bacteria	1845
1388	Ga0495619_0136887	3300053085	Bacteria	1685
1389	Ga0500566_0026303	3300053094	Bacteria	3406
1390	Ga0500556_0000930	3300053104	Bacteria	15923
1391	Ga0500562_008872	3300053108	Bacteria	2540
1392	Ga0500597_064852	3300053120	Bacteria	1573
1393	Ga0500568_0000061	3300053139	Bacteria	107322
1394	Ga0500568_0000197	3300053139	Bacteria	52712
1395	Ga0500568_0032871	3300053139	Bacteria	2131
1396	Ga0500588_0001254	3300053146	Bacteria	4732
1397	Ga0500616_0011835	3300053153	Bacteria	5131
1398	Ga0500616_0057788	3300053153	Bacteria	2021
1399	Ga0500622_0006578	3300053156	Bacteria	6711
1400	Ga0500622_0018536	3300053156	Unclassified	3700
1401	Ga0501084_0048259	3300054114	Bacteria	3564
1402	Ga0501084_0122701	3300054114	Bacteria	2185
1403	Ga0501082_0121380	3300060353	Bacteria	2265
1404	Ga0466962_0002966	3300061719	Bacteria	8095
1405	Ga0530510_0089770	3300061734	Bacteria	2241
1406	Ga0530510_0190890	3300061734	Bacteria	1521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300035695	Ga0373927_0134775	Ga0373927_0134775_21_803	240
2	3300046462	Ga0495651_0141411	Ga0495651_0141411_951_1733	240
3	3300046472	Ga0495580_0447572	Ga0495580_0447572_45_770	240
4	3300050507	nmdc:mga05p37_965654_c1	nmdc:mga05p37_965654_c1_156_884	240
5	3300042876	Ga0451577_0581882	Ga0451577_0581882_243_971	241
6	3300046526	Ga0495666_0177618	Ga0495666_0177618_20_796	241
7	3300046529	Ga0495652_0008373	Ga0495652_0008373_5608_6384	241
8	3300047315	Ga0495581_0162501	Ga0495581_0162501_148_924	241
9	3300047317	Ga0495604_0232682	Ga0495604_0232682_44_817	241
10	3300049585	Ga0501069_0264248	Ga0501069_0264248_242_982	242
11	3300036712	Ga0316584_0115122	Ga0316584_0115122_1240_1974	243
12	3300037418	Ga0395900_0411320	Ga0395900_0411320_394_1140	243
13	3300038443	Ga0395901_0297139	Ga0395901_0297139_356_1102	243
14	3300038443	Ga0395901_0411575	Ga0395901_0411575_33_767	243
15	3300041460	Ga0451802_1288203	Ga0451802_1288203_138_869	243
16	3300048914	Ga0496111_0261783	Ga0496111_0261783_503_1246	243
17	3300048925	Ga0496122_0147195	Ga0496122_0147195_21_752	243
18	3300050512	nmdc:mga0n895_2379_c1	nmdc:mga0n895_2379_c1_41_832	245
19	3300050515	nmdc:mga0a205_487338_c1	nmdc:mga0a205_487338_c1_205_996	245
20	3300005471	Ga0070698_100064489	Ga0070698_1000644893	254
21	3300035121	Ga0373960_0009843	Ga0373960_0009843_22_798	254
22	3300046517	Ga0495630_0510993	Ga0495630_0510993_35_814	254
23	3300048088	Ga0495602_0304830	Ga0495602_0304830_372_1151	254
24	3300050514	nmdc:mga08x19_150147_c1	nmdc:mga08x19_150147_c1_728_1519	254
25	3300044842	Ga0466957_0198652	Ga0466957_0198652_26_802	257
26	3300046526	Ga0495666_0134664	Ga0495666_0134664_85_864	257
27	3300046535	Ga0495586_0278368	Ga0495586_0278368_88_867	257
28	3300053083	Ga0495655_0062176	Ga0495655_0062176_17_793	257
29	3300035172	Ga0373955_0130170	Ga0373955_0130170_49_873	258
30	3300046463	Ga0495653_0026556	Ga0495653_0026556_3729_4553	258
31	3300046809	Ga0495600_0199986	Ga0495600_0199986_426_1250	258
32	3300005445	Ga0070708_100351417	Ga0070708_1003514172	259
33	3300005468	Ga0070707_100731871	Ga0070707_1007318711	259
34	3300005518	Ga0070699_100103828	Ga0070699_1001038282	259
35	3300049590	Ga0501074_0423241	Ga0501074_0423241_19_804	259
36	3300025910	Ga0207684_10059149	Ga0207684_100591493	260
37	3300039450	Ga0436363_0515446	Ga0436363_0515446_101_886	260
38	3300046663	Ga0495635_0076822	Ga0495635_0076822_30_848	260
39	3300048905	Ga0496102_0545449	Ga0496102_0545449_29_823	260
40	3300048925	Ga0496122_0226105	Ga0496122_0226105_254_1036	260
41	3300050512	nmdc:mga0n895_79016_c1	nmdc:mga0n895_79016_c1_784_1581	260
42	3300037853	Ga0436364_1546898	Ga0436364_1546898_39_848	261
43	3300037068	Ga0373925_0003785	Ga0373925_0003785_4379_5293	270
44	3300035120	Ga0373957_0029518	Ga0373957_0029518_944_1774	271
45	3300020070	Ga0206356_11756935	Ga0206356_117569352	273
46	3300025915	Ga0207693_10261333	Ga0207693_102613332	274
47	3300036401	Ga0373937_0183951	Ga0373937_0183951_551_1459	276
48	3300044712	Ga0453684_0350885	Ga0453684_0350885_13_861	276
49	3300035086	Ga0373934_0008083	Ga0373934_0008083_1514_2410	277
50	3300035119	Ga0373956_0028512	Ga0373956_0028512_223_1119	277
51	3300035172	Ga0373955_0035122	Ga0373955_0035122_1534_2430	277
52	3300035724	Ga0373933_0053486	Ga0373933_0053486_652_1548	277
53	3300036401	Ga0373937_0027910	Ga0373937_0027910_1331_2227	277
54	3300044694	Ga0466963_0317011	Ga0466963_0317011_242_1078	277
55	3300046454	Ga0495592_0058786	Ga0495592_0058786_362_1258	277
56	3300046462	Ga0495651_0030038	Ga0495651_0030038_3147_4043	277
57	3300046463	Ga0495653_0042812	Ga0495653_0042812_510_1406	277
58	3300046477	Ga0495664_0018516	Ga0495664_0018516_1635_2531	277
59	3300046511	Ga0495608_0005687	Ga0495608_0005687_4042_4938	277
60	3300046517	Ga0495630_0205292	Ga0495630_0205292_370_1266	277
61	3300046529	Ga0495652_0127501	Ga0495652_0127501_871_1767	277
62	3300046533	Ga0495640_0049504	Ga0495640_0049504_190_1086	277
63	3300046535	Ga0495586_0116934	Ga0495586_0116934_13_849	277
64	3300046536	Ga0495587_0019778	Ga0495587_0019778_2730_3626	277
65	3300046543	Ga0495645_0046328	Ga0495645_0046328_1764_2660	277
66	3300046559	Ga0495667_0033606	Ga0495667_0033606_1873_2769	277
67	3300046663	Ga0495635_0013834	Ga0495635_0013834_618_1514	277
68	3300046675	Ga0495657_0023553	Ga0495657_0023553_416_1312	277
69	3300046679	Ga0495623_0120032	Ga0495623_0120032_580_1476	277
70	3300046680	Ga0495646_0036135	Ga0495646_0036135_250_1146	277
71	3300046809	Ga0495600_0008867	Ga0495600_0008867_565_1461	277
72	3300047317	Ga0495604_0015781	Ga0495604_0015781_4059_4955	277
73	3300047319	Ga0495674_0008562	Ga0495674_0008562_8200_9096	277
74	3300047322	Ga0495680_0021094	Ga0495680_0021094_2865_3761	277
75	3300047444	Ga0495675_0005970	Ga0495675_0005970_372_1268	277
76	3300047471	Ga0495684_0008935	Ga0495684_0008935_567_1463	277
77	3300048088	Ga0495602_0126224	Ga0495602_0126224_853_1755	277
78	3300053085	Ga0495619_0096929	Ga0495619_0096929_306_1202	277
79	3300006028	Ga0070717_10334905	Ga0070717_103349051	278
80	iso_pu_bacteria	2891562705	2891569181	278
81	3300025910	Ga0207684_10001101	Ga0207684_100011014	279
82	3300048088	Ga0495602_0200141	Ga0495602_0200141_598_1506	279
83	3300003187	JGI25151J46595_10008823	JGI25151J46595_100088235	280
84	3300006871	Ga0075434_100010403	Ga0075434_1000104037	280
85	3300006914	Ga0075436_100009894	Ga0075436_1000098943	280
86	3300025294	Ga0209025_1000180	Ga0209025_1000180116	280
87	3300035117	Ga0373953_0000044	Ga0373953_0000044_11439_12341	280
88	3300035119	Ga0373956_0004751	Ga0373956_0004751_511_1413	280
89	3300035120	Ga0373957_0000107	Ga0373957_0000107_4428_5330	280
90	3300035172	Ga0373955_0000014	Ga0373955_0000014_39936_40838	280
91	3300035410	Ga0373924_0000783	Ga0373924_0000783_4902_5804	280
92	3300035724	Ga0373933_0000021	Ga0373933_0000021_13632_14534	280
93	3300036401	Ga0373937_0000032	Ga0373937_0000032_82514_83416	280
94	3300046454	Ga0495592_0000079	Ga0495592_0000079_65338_66240	280
95	3300046462	Ga0495651_0000010	Ga0495651_0000010_65338_66240	280
96	3300046463	Ga0495653_0000601	Ga0495653_0000601_3155_4057	280
97	3300046511	Ga0495608_0000037	Ga0495608_0000037_47936_48838	280
98	3300046516	Ga0495628_0000227	Ga0495628_0000227_41432_42334	280
99	3300046529	Ga0495652_0000180	Ga0495652_0000180_51307_52209	280
100	3300046536	Ga0495587_0000024	Ga0495587_0000024_82513_83415	280
101	3300046559	Ga0495667_0000024	Ga0495667_0000024_102072_102974	280
102	3300046675	Ga0495657_0000121	Ga0495657_0000121_65326_66228	280
103	3300046678	Ga0495599_0000362	Ga0495599_0000362_23518_24420	280
104	3300046679	Ga0495623_0003314	Ga0495623_0003314_2218_3120	280
105	3300046680	Ga0495646_0010081	Ga0495646_0010081_4785_5687	280
106	3300046809	Ga0495600_0000659	Ga0495600_0000659_14669_15571	280
107	3300047317	Ga0495604_0000024	Ga0495604_0000024_82330_83232	280
108	3300047322	Ga0495680_0000005	Ga0495680_0000005_65314_66216	280
109	3300047444	Ga0495675_0001438	Ga0495675_0001438_12346_13248	280
110	3300048088	Ga0495602_0000198	Ga0495602_0000198_36733_37635	280
111	3300050513	nmdc:mga0rr50_26188_c1	nmdc:mga0rr50_26188_c1_1473_2369	280
112	3300050514	nmdc:mga08x19_17976_c1	nmdc:mga08x19_17976_c1_1262_2158	280
113	3300053084	Ga0495595_0008245	Ga0495595_0008245_285_1187	280
114	3300005518	Ga0070699_100193748	Ga0070699_1001937482	281
115	3300005435	Ga0070714_100002822	Ga0070714_10000282213	282
116	3300006175	Ga0070712_100121185	Ga0070712_1001211852	282
117	3300025929	Ga0207664_10010813	Ga0207664_100108132	282
118	3300005434	Ga0070709_10000898	Ga0070709_1000089817	284
119	3300005436	Ga0070713_100003141	Ga0070713_1000031412	284
120	3300005437	Ga0070710_10000649	Ga0070710_100006499	284
121	3300005439	Ga0070711_100001246	Ga0070711_10000124610	284
122	3300005445	Ga0070708_100023693	Ga0070708_1000236932	284
123	3300005471	Ga0070698_100097446	Ga0070698_1000974461	284
124	3300006028	Ga0070717_10050850	Ga0070717_100508502	284
125	3300006163	Ga0070715_10023333	Ga0070715_100233332	284
126	3300006173	Ga0070716_100021001	Ga0070716_1000210013	284
127	3300006175	Ga0070712_100114043	Ga0070712_1001140432	284
128	3300007788	Ga0099795_10126253	Ga0099795_101262532	284
129	3300010159	Ga0099796_10048096	Ga0099796_100480962	284
130	3300025898	Ga0207692_10000502	Ga0207692_100005024	284
131	3300025905	Ga0207685_10098684	Ga0207685_100986842	284
132	3300025906	Ga0207699_10000902	Ga0207699_100009029	284
133	3300025915	Ga0207693_10009082	Ga0207693_100090823	284
134	3300025928	Ga0207700_10022371	Ga0207700_100223712	284
135	3300025929	Ga0207664_10000678	Ga0207664_1000067815	284
136	3300025939	Ga0207665_10001749	Ga0207665_100017497	284
137	3300036459	Ga0372808_002633	Ga0372808_002633_310_1278	284
138	3300005329	Ga0070683_100213801	Ga0070683_1002138012	285
139	3300013105	Ga0157369_10213946	Ga0157369_102139463	285
140	3300025944	Ga0207661_10274593	Ga0207661_102745932	285
141	3300005439	Ga0070711_100024738	Ga0070711_1000247384	286
142	3300006175	Ga0070712_100261116	Ga0070712_1002611162	286
143	3300035398	Ga0316574_0296277	Ga0316574_0296277_49_921	286
144	3300036647	Ga0316582_0029751	Ga0316582_0029751_256_1131	286
145	3300028800	Ga0265338_10037367	Ga0265338_100373674	287
146	3300031241	Ga0265325_10014714	Ga0265325_100147142	287
147	3300031249	Ga0265339_10002225	Ga0265339_100022251	287
148	3300031595	Ga0265313_10001520	Ga0265313_1000152016	287
149	3300049588	Ga0501072_0179894	Ga0501072_0179894_409_1275	287
150	iso_pu_bacteria	2846540461	2846540745	287
151	3300005436	Ga0070713_100066801	Ga0070713_1000668012	288
152	3300005719	Ga0068861_100276392	Ga0068861_1002763922	288
153	3300021388	Ga0213875_10010220	Ga0213875_100102204	288
154	3300025910	Ga0207684_10009747	Ga0207684_100097475	288
155	3300025928	Ga0207700_10067368	Ga0207700_100673682	288
156	3300035207	Ga0373942_0035572	Ga0373942_0035572_159_1028	288
157	3300035691	Ga0373931_0050979	Ga0373931_0050979_1089_1958	288
158	3300037853	Ga0436364_1530016	Ga0436364_1530016_18292_19167	288
159	3300053153	Ga0500616_0011835	Ga0500616_0011835_1813_2691	288
160	iso_pu_bacteria	2856741275	2856742212	288
161	iso_pu_bacteria	2858868258	2858868936	288
162	iso_pu_bacteria	2902582711	2902582783	288
163	3300005327	Ga0070658_10095920	Ga0070658_100959202	289
164	3300005329	Ga0070683_100021642	Ga0070683_1000216424	289
165	3300005334	Ga0068869_100114770	Ga0068869_1001147702	289
166	3300005338	Ga0068868_100065957	Ga0068868_1000659572	289
167	3300005343	Ga0070687_100183712	Ga0070687_1001837122	289
168	3300005344	Ga0070661_100069598	Ga0070661_1000695981	289
169	3300005353	Ga0070669_100167309	Ga0070669_1001673092	289
170	3300005364	Ga0070673_100370087	Ga0070673_1003700871	289
171	3300005436	Ga0070713_100064381	Ga0070713_1000643813	289
172	3300005437	Ga0070710_10010061	Ga0070710_100100613	289
173	3300005439	Ga0070711_100008207	Ga0070711_1000082075	289
174	3300005440	Ga0070705_100032926	Ga0070705_1000329262	289
175	3300005440	Ga0070705_100034341	Ga0070705_1000343414	289
176	3300005444	Ga0070694_100071867	Ga0070694_1000718672	289
177	3300005445	Ga0070708_100018447	Ga0070708_1000184473	289
178	3300005456	Ga0070678_100122975	Ga0070678_1001229752	289
179	3300005466	Ga0070685_10139435	Ga0070685_101394352	289
180	3300005468	Ga0070707_100511613	Ga0070707_1005116132	289
181	3300005535	Ga0070684_100297896	Ga0070684_1002978962	289
182	3300005544	Ga0070686_100185137	Ga0070686_1001851371	289
183	3300005546	Ga0070696_100012057	Ga0070696_1000120572	289
184	3300005546	Ga0070696_100044841	Ga0070696_1000448412	289
185	3300005549	Ga0070704_100036319	Ga0070704_1000363192	289
186	3300005549	Ga0070704_100171653	Ga0070704_1001716532	289
187	3300005577	Ga0068857_100133497	Ga0068857_1001334972	289
188	3300005578	Ga0068854_100120178	Ga0068854_1001201782	289
189	3300005614	Ga0068856_100011336	Ga0068856_1000113368	289
190	3300005618	Ga0068864_100401583	Ga0068864_1004015832	289
191	3300005718	Ga0068866_10122826	Ga0068866_101228262	289
192	3300005840	Ga0068870_10082645	Ga0068870_100826452	289
193	3300005842	Ga0068858_100396033	Ga0068858_1003960332	289
194	3300005843	Ga0068860_100375660	Ga0068860_1003756602	289
195	3300005983	Ga0081540_1000619	Ga0081540_100061917	289
196	3300005983	Ga0081540_1050486	Ga0081540_10504862	289
197	3300006028	Ga0070717_10141518	Ga0070717_101415182	289
198	3300006163	Ga0070715_10001376	Ga0070715_100013767	289
199	3300006163	Ga0070715_10016872	Ga0070715_100168722	289
200	3300006173	Ga0070716_100010453	Ga0070716_1000104533	289
201	3300006175	Ga0070712_100056376	Ga0070712_1000563762	289
202	3300006237	Ga0097621_100173771	Ga0097621_1001737712	289
203	3300009011	Ga0105251_10069033	Ga0105251_100690332	289
204	3300009148	Ga0105243_10038175	Ga0105243_100381752	289
205	3300009148	Ga0105243_10083838	Ga0105243_100838381	289
206	3300009176	Ga0105242_10022023	Ga0105242_100220233	289
207	3300009545	Ga0105237_10102184	Ga0105237_101021842	289
208	3300013100	Ga0157373_10026864	Ga0157373_100268642	289
209	3300013102	Ga0157371_10153903	Ga0157371_101539032	289
210	3300013296	Ga0157374_10203001	Ga0157374_102030012	289
211	3300013306	Ga0163162_10100464	Ga0163162_101004643	289
212	3300014325	Ga0163163_10450340	Ga0163163_104503401	289
213	3300014326	Ga0157380_10140845	Ga0157380_101408452	289
214	3300017792	Ga0163161_10072025	Ga0163161_100720252	289
215	3300025898	Ga0207692_10007604	Ga0207692_100076043	289
216	3300025898	Ga0207692_10171296	Ga0207692_101712962	289
217	3300025901	Ga0207688_10012125	Ga0207688_100121252	289
218	3300025906	Ga0207699_10010790	Ga0207699_100107905	289
219	3300025906	Ga0207699_10082312	Ga0207699_100823122	289
220	3300025908	Ga0207643_10009043	Ga0207643_100090433	289
221	3300025910	Ga0207684_10005051	Ga0207684_100050518	289
222	3300025910	Ga0207684_10031145	Ga0207684_100311452	289
223	3300025910	Ga0207684_10251000	Ga0207684_102510002	289
224	3300025914	Ga0207671_10323444	Ga0207671_103234442	289
225	3300025915	Ga0207693_10004702	Ga0207693_100047028	289
226	3300025915	Ga0207693_10047643	Ga0207693_100476432	289
227	3300025916	Ga0207663_10054004	Ga0207663_100540043	289
228	3300025916	Ga0207663_10139590	Ga0207663_101395902	289
229	3300025918	Ga0207662_10019071	Ga0207662_100190711	289
230	3300025919	Ga0207657_10003526	Ga0207657_100035268	289
231	3300025921	Ga0207652_10349824	Ga0207652_103498242	289
232	3300025923	Ga0207681_10095778	Ga0207681_100957782	289
233	3300025928	Ga0207700_10011297	Ga0207700_100112975	289
234	3300025928	Ga0207700_10455773	Ga0207700_104557731	289
235	3300025929	Ga0207664_10002010	Ga0207664_1000201012	289
236	3300025929	Ga0207664_10039113	Ga0207664_100391132	289
237	3300025929	Ga0207664_10189832	Ga0207664_101898322	289
238	3300025929	Ga0207664_10499388	Ga0207664_104993882	289
239	3300025931	Ga0207644_10254071	Ga0207644_102540712	289
240	3300025939	Ga0207665_10001445	Ga0207665_100014452	289
241	3300025939	Ga0207665_10022313	Ga0207665_100223133	289
242	3300025942	Ga0207689_10005002	Ga0207689_100050029	289
243	3300026067	Ga0207678_10005972	Ga0207678_100059723	289
244	3300026078	Ga0207702_10022952	Ga0207702_100229522	289
245	3300026078	Ga0207702_10149336	Ga0207702_101493362	289
246	3300026089	Ga0207648_10079363	Ga0207648_100793633	289
247	3300026095	Ga0207676_10344391	Ga0207676_103443912	289
248	3300026116	Ga0207674_10008747	Ga0207674_100087479	289
249	3300026118	Ga0207675_100013612	Ga0207675_1000136126	289
250	3300026121	Ga0207683_10012591	Ga0207683_100125913	289
251	3300034820	Ga0373959_0004714	Ga0373959_0004714_960_1841	289
252	3300035083	Ga0373926_0023730	Ga0373926_0023730_227_1111	289
253	3300035084	Ga0373928_0009416	Ga0373928_0009416_877_1758	289
254	3300035089	Ga0373944_0008621	Ga0373944_0008621_333_1217	289
255	3300035111	Ga0373923_0003296	Ga0373923_0003296_3771_4655	289
256	3300035113	Ga0373936_0004296	Ga0373936_0004296_2804_3688	289
257	3300035114	Ga0373939_0079486	Ga0373939_0079486_150_1031	289
258	3300035116	Ga0373945_0005792	Ga0373945_0005792_360_1244	289
259	3300035119	Ga0373956_0002560	Ga0373956_0002560_2505_3389	289
260	3300035170	Ga0373943_0007922	Ga0373943_0007922_3423_4307	289
261	3300035171	Ga0373946_0052972	Ga0373946_0052972_707_1591	289
262	3300035172	Ga0373955_0016839	Ga0373955_0016839_1222_2106	289
263	3300035207	Ga0373942_0016581	Ga0373942_0016581_335_1216	289
264	3300035410	Ga0373924_0063146	Ga0373924_0063146_352_1227	289
265	3300035410	Ga0373924_0145417	Ga0373924_0145417_64_948	289
266	3300035691	Ga0373931_0024657	Ga0373931_0024657_453_1346	289
267	3300035692	Ga0373935_0003809	Ga0373935_0003809_4026_4910	289
268	3300035695	Ga0373927_0005773	Ga0373927_0005773_6854_7738	289
269	3300035725	Ga0373947_0014558	Ga0373947_0014558_3282_4166	289
270	3300037068	Ga0373925_0015757	Ga0373925_0015757_474_1358	289
271	3300037068	Ga0373925_0302229	Ga0373925_0302229_273_1169	289
272	3300037853	Ga0436364_0486446	Ga0436364_0486446_340_1224	289
273	3300039437	Ga0436365_1187437	Ga0436365_1187437_357_1241	289
274	3300045051	Ga0451576_0052721	Ga0451576_0052721_2771_3652	289
275	3300046455	Ga0495603_0005012	Ga0495603_0005012_493_1377	289
276	3300046459	Ga0495629_0010491	Ga0495629_0010491_3200_4084	289
277	3300046461	Ga0495641_0065571	Ga0495641_0065571_703_1587	289
278	3300046462	Ga0495651_0046869	Ga0495651_0046869_1336_2220	289
279	3300046472	Ga0495580_0010328	Ga0495580_0010328_2527_3411	289
280	3300046473	Ga0495582_0009567	Ga0495582_0009567_3721_4605	289
281	3300046475	Ga0495639_0002485	Ga0495639_0002485_107_991	289
282	3300046476	Ga0495662_0004269	Ga0495662_0004269_2723_3607	289
283	3300046477	Ga0495664_0024267	Ga0495664_0024267_91_975	289
284	3300046477	Ga0495664_0108057	Ga0495664_0108057_707_1591	289
285	3300046499	Ga0495594_0033289	Ga0495594_0033289_1782_2666	289
286	3300046511	Ga0495608_0022744	Ga0495608_0022744_3295_4179	289
287	3300046514	Ga0495618_0092147	Ga0495618_0092147_707_1591	289
288	3300046529	Ga0495652_0218548	Ga0495652_0218548_334_1218	289
289	3300046529	Ga0495652_0276533	Ga0495652_0276533_183_1067	289
290	3300046531	Ga0495665_0003325	Ga0495665_0003325_4410_5294	289
291	3300046535	Ga0495586_0007508	Ga0495586_0007508_4569_5453	289
292	3300046536	Ga0495587_0043253	Ga0495587_0043253_1325_2209	289
293	3300046642	Ga0495634_0093356	Ga0495634_0093356_574_1458	289
294	3300046663	Ga0495635_0021399	Ga0495635_0021399_1101_1985	289
295	3300046663	Ga0495635_0179074	Ga0495635_0179074_378_1262	289
296	3300046675	Ga0495657_0067872	Ga0495657_0067872_1416_2300	289
297	3300046675	Ga0495657_0073246	Ga0495657_0073246_1300_2184	289
298	3300046678	Ga0495599_0196179	Ga0495599_0196179_23_907	289
299	3300046680	Ga0495646_0012744	Ga0495646_0012744_599_1483	289
300	3300046683	Ga0495658_0003636	Ga0495658_0003636_4118_5002	289
301	3300046689	Ga0495613_0028170	Ga0495613_0028170_495_1379	289
302	3300046690	Ga0495624_0014423	Ga0495624_0014423_400_1284	289
303	3300046809	Ga0495600_0023984	Ga0495600_0023984_2286_3170	289
304	3300047315	Ga0495581_0073274	Ga0495581_0073274_391_1275	289
305	3300047317	Ga0495604_0012952	Ga0495604_0012952_1797_2681	289
306	3300047319	Ga0495674_0194576	Ga0495674_0194576_489_1373	289
307	3300047321	Ga0495676_0115690	Ga0495676_0115690_48_932	289
308	3300047444	Ga0495675_0017982	Ga0495675_0017982_2866_3750	289
309	3300047471	Ga0495684_0348131	Ga0495684_0348131_48_932	289
310	3300048089	Ga0495614_0012741	Ga0495614_0012741_2442_3326	289
311	3300048904	Ga0496101_0044676	Ga0496101_0044676_1350_2231	289
312	3300048906	Ga0496103_0007127	Ga0496103_0007127_2352_3233	289
313	3300048907	Ga0496104_0001194	Ga0496104_0001194_3586_4485	289
314	3300048908	Ga0496105_0002102	Ga0496105_0002102_10718_11617	289
315	3300048908	Ga0496105_0019782	Ga0496105_0019782_1849_2730	289
316	3300048910	Ga0496107_0013149	Ga0496107_0013149_4337_5218	289
317	3300048911	Ga0496108_0012378	Ga0496108_0012378_5573_6472	289
318	3300048912	Ga0496109_0035028	Ga0496109_0035028_996_1895	289
319	3300048913	Ga0496110_0190309	Ga0496110_0190309_691_1572	289
320	3300048915	Ga0496112_0000183	Ga0496112_0000183_6537_7436	289
321	3300048916	Ga0496113_0085485	Ga0496113_0085485_733_1632	289
322	3300048916	Ga0496113_0265470	Ga0496113_0265470_198_1079	289
323	3300048917	Ga0496114_0188324	Ga0496114_0188324_789_1670	289
324	3300048918	Ga0496115_0011367	Ga0496115_0011367_3801_4700	289
325	3300053077	Ga0495601_0193408	Ga0495601_0193408_230_1114	289
326	3300053084	Ga0495595_0014543	Ga0495595_0014543_2211_3095	289
327	3300053085	Ga0495619_0041661	Ga0495619_0041661_125_1009	289
328	iso_pu_bacteria	2887443736	2887447747	289
329	iso_pu_bacteria	2891395885	2891400933	289
330	iso_pu_bacteria	2891554331	2891558633	289
331	3300003215	JGI25153J46596_10001127	JGI25153J46596_100011274	290
332	3300005329	Ga0070683_100164991	Ga0070683_1001649913	290
333	3300005336	Ga0070680_100003260	Ga0070680_10000326011	290
334	3300005339	Ga0070660_100118589	Ga0070660_1001185892	290
335	3300005340	Ga0070689_100016116	Ga0070689_1000161162	290
336	3300005343	Ga0070687_100238590	Ga0070687_1002385901	290
337	3300005355	Ga0070671_100005305	Ga0070671_1000053056	290
338	3300005365	Ga0070688_100009045	Ga0070688_1000090453	290
339	3300005435	Ga0070714_100081767	Ga0070714_1000817673	290
340	3300005436	Ga0070713_100023455	Ga0070713_1000234553	290
341	3300005436	Ga0070713_100094372	Ga0070713_1000943722	290
342	3300005436	Ga0070713_100235858	Ga0070713_1002358582	290
343	3300005437	Ga0070710_10002366	Ga0070710_100023667	290
344	3300005438	Ga0070701_10185736	Ga0070701_101857361	290
345	3300005439	Ga0070711_100470428	Ga0070711_1004704281	290
346	3300005456	Ga0070678_100342015	Ga0070678_1003420151	290
347	3300005457	Ga0070662_100299640	Ga0070662_1002996402	290
348	3300005458	Ga0070681_10005405	Ga0070681_100054055	290
349	3300005458	Ga0070681_10357368	Ga0070681_103573681	290
350	3300005467	Ga0070706_100511929	Ga0070706_1005119291	290
351	3300005518	Ga0070699_100003695	Ga0070699_1000036956	290
352	3300005530	Ga0070679_100004247	Ga0070679_1000042475	290
353	3300005535	Ga0070684_100113923	Ga0070684_1001139233	290
354	3300005544	Ga0070686_100382608	Ga0070686_1003826081	290
355	3300005546	Ga0070696_100110055	Ga0070696_1001100551	290
356	3300005563	Ga0068855_100489368	Ga0068855_1004893681	290
357	3300005563	Ga0068855_100519040	Ga0068855_1005190402	290
358	3300005564	Ga0070664_100126800	Ga0070664_1001268002	290
359	3300005614	Ga0068856_100184922	Ga0068856_1001849221	290
360	3300005718	Ga0068866_10054071	Ga0068866_100540712	290
361	3300005843	Ga0068860_100505752	Ga0068860_1005057521	290
362	3300005937	Ga0081455_10009483	Ga0081455_100094834	290
363	3300005937	Ga0081455_10085744	Ga0081455_100857443	290
364	3300005937	Ga0081455_10086232	Ga0081455_100862322	290
365	3300005981	Ga0081538_10005284	Ga0081538_100052848	290
366	3300005981	Ga0081538_10029795	Ga0081538_100297952	290
367	3300005983	Ga0081540_1018071	Ga0081540_10180712	290
368	3300005983	Ga0081540_1046703	Ga0081540_10467033	290
369	3300005985	Ga0081539_10016732	Ga0081539_100167323	290
370	3300006028	Ga0070717_10025618	Ga0070717_100256184	290
371	3300006028	Ga0070717_10050303	Ga0070717_100503032	290
372	3300006028	Ga0070717_10158906	Ga0070717_101589062	290
373	3300006038	Ga0075365_10022916	Ga0075365_100229163	290
374	3300006163	Ga0070715_10001972	Ga0070715_100019723	290
375	3300006163	Ga0070715_10072500	Ga0070715_100725002	290
376	3300006173	Ga0070716_100016022	Ga0070716_1000160224	290
377	3300006173	Ga0070716_100161966	Ga0070716_1001619662	290
378	3300006175	Ga0070712_100043845	Ga0070712_1000438452	290
379	3300006177	Ga0075362_10082562	Ga0075362_100825622	290
380	3300006178	Ga0075367_10058918	Ga0075367_100589182	290
381	3300006178	Ga0075367_10119436	Ga0075367_101194361	290
382	3300006195	Ga0075366_10055650	Ga0075366_100556503	290
383	3300006358	Ga0068871_100214255	Ga0068871_1002142552	290
384	3300006846	Ga0075430_100107926	Ga0075430_1001079261	290
385	3300006847	Ga0075431_100028921	Ga0075431_1000289213	290
386	3300006847	Ga0075431_100395251	Ga0075431_1003952511	290
387	3300006847	Ga0075431_100431602	Ga0075431_1004316022	290
388	3300006871	Ga0075434_100019983	Ga0075434_1000199836	290
389	3300006871	Ga0075434_100072950	Ga0075434_1000729501	290
390	3300006871	Ga0075434_100230939	Ga0075434_1002309392	290
391	3300006871	Ga0075434_100321975	Ga0075434_1003219752	290
392	3300006880	Ga0075429_100018750	Ga0075429_1000187503	290
393	3300006880	Ga0075429_100148614	Ga0075429_1001486141	290
394	3300006880	Ga0075429_100281418	Ga0075429_1002814181	290
395	3300006881	Ga0068865_100067241	Ga0068865_1000672413	290
396	3300006914	Ga0075436_100319244	Ga0075436_1003192441	290
397	3300007076	Ga0075435_100007015	Ga0075435_1000070155	290
398	3300007076	Ga0075435_100178186	Ga0075435_1001781862	290
399	3300009093	Ga0105240_10364620	Ga0105240_103646202	290
400	3300009093	Ga0105240_10776687	Ga0105240_107766872	290
401	3300009094	Ga0111539_10006696	Ga0111539_1000669614	290
402	3300009094	Ga0111539_10126842	Ga0111539_101268423	290
403	3300009094	Ga0111539_10461502	Ga0111539_104615022	290
404	3300009101	Ga0105247_10104684	Ga0105247_101046842	290
405	3300009147	Ga0114129_10117287	Ga0114129_101172873	290
406	3300009147	Ga0114129_10814828	Ga0114129_108148281	290
407	3300009148	Ga0105243_10422940	Ga0105243_104229402	290
408	3300009545	Ga0105237_10096605	Ga0105237_100966052	290
409	3300009551	Ga0105238_10027827	Ga0105238_100278273	290
410	3300009551	Ga0105238_10225870	Ga0105238_102258701	290
411	3300010159	Ga0099796_10029314	Ga0099796_100293141	290
412	3300011119	Ga0105246_10064479	Ga0105246_100644792	290
413	3300014325	Ga0163163_10039261	Ga0163163_100392613	290
414	3300021388	Ga0213875_10000124	Ga0213875_100001245	290
415	3300024225	Ga0224572_1014976	Ga0224572_10149761	290
416	3300024227	Ga0228598_1008177	Ga0228598_10081772	290
417	3300025297	Ga0209758_1001018	Ga0209758_100101814	290
418	3300025898	Ga0207692_10010117	Ga0207692_100101175	290
419	3300025898	Ga0207692_10108757	Ga0207692_101087571	290
420	3300025905	Ga0207685_10033520	Ga0207685_100335202	290
421	3300025908	Ga0207643_10139745	Ga0207643_101397451	290
422	3300025910	Ga0207684_10013490	Ga0207684_100134905	290
423	3300025915	Ga0207693_10019055	Ga0207693_100190555	290
424	3300025915	Ga0207693_10050231	Ga0207693_100502313	290
425	3300025916	Ga0207663_10102474	Ga0207663_101024742	290
426	3300025918	Ga0207662_10361851	Ga0207662_103618511	290
427	3300025919	Ga0207657_10008018	Ga0207657_100080182	290
428	3300025921	Ga0207652_10035443	Ga0207652_100354431	290
429	3300025921	Ga0207652_10145398	Ga0207652_101453983	290
430	3300025924	Ga0207694_10147405	Ga0207694_101474053	290
431	3300025928	Ga0207700_10002927	Ga0207700_100029274	290
432	3300025928	Ga0207700_10019788	Ga0207700_100197884	290
433	3300025928	Ga0207700_10071460	Ga0207700_100714602	290
434	3300025929	Ga0207664_10057654	Ga0207664_100576543	290
435	3300025929	Ga0207664_10341415	Ga0207664_103414152	290
436	3300025931	Ga0207644_10112048	Ga0207644_101120481	290
437	3300025931	Ga0207644_10337150	Ga0207644_103371502	290
438	3300025933	Ga0207706_10203155	Ga0207706_102031552	290
439	3300025933	Ga0207706_10398567	Ga0207706_103985671	290
440	3300025936	Ga0207670_10021502	Ga0207670_100215024	290
441	3300025941	Ga0207711_10002895	Ga0207711_100028954	290
442	3300025945	Ga0207679_10178294	Ga0207679_101782942	290
443	3300025949	Ga0207667_10312678	Ga0207667_103126782	290
444	3300025972	Ga0207668_10060892	Ga0207668_100608923	290
445	3300025972	Ga0207668_10314624	Ga0207668_103146241	290
446	3300026067	Ga0207678_10176474	Ga0207678_101764742	290
447	3300026067	Ga0207678_10661349	Ga0207678_106613491	290
448	3300026078	Ga0207702_10056519	Ga0207702_100565193	290
449	3300026118	Ga0207675_100402741	Ga0207675_1004027411	290
450	3300027907	Ga0207428_10020684	Ga0207428_100206843	290
451	3300027907	Ga0207428_10219489	Ga0207428_102194892	290
452	3300027907	Ga0207428_10232497	Ga0207428_102324972	290
453	3300031241	Ga0265325_10020557	Ga0265325_100205573	290
454	3300031247	Ga0265340_10068581	Ga0265340_100685812	290
455	3300031251	Ga0265327_10009533	Ga0265327_100095332	290
456	3300031344	Ga0265316_10002453	Ga0265316_100024537	290
457	3300031344	Ga0265316_10034545	Ga0265316_100345451	290
458	3300031344	Ga0265316_10147067	Ga0265316_101470673	290
459	3300031665	Ga0316575_10002350	Ga0316575_100023504	290
460	3300031665	Ga0316575_10019130	Ga0316575_100191302	290
461	3300031665	Ga0316575_10076884	Ga0316575_100768841	290
462	3300031711	Ga0265314_10019209	Ga0265314_100192093	290
463	3300031711	Ga0265314_10254753	Ga0265314_102547532	290
464	3300031728	Ga0316578_10005669	Ga0316578_100056697	290
465	3300034957	Ga0373938_0012219	Ga0373938_0012219_650_1528	290
466	3300035092	Ga0373952_0012407	Ga0373952_0012407_708_1586	290
467	3300035111	Ga0373923_0035038	Ga0373923_0035038_1010_1888	290
468	3300035111	Ga0373923_0038027	Ga0373923_0038027_131_1009	290
469	3300035113	Ga0373936_0118349	Ga0373936_0118349_156_1034	290
470	3300035114	Ga0373939_0037166	Ga0373939_0037166_101_994	290
471	3300035118	Ga0373954_0008518	Ga0373954_0008518_1913_2791	290
472	3300035118	Ga0373954_0076023	Ga0373954_0076023_577_1455	290
473	3300035119	Ga0373956_0015419	Ga0373956_0015419_211_1089	290
474	3300035120	Ga0373957_0060389	Ga0373957_0060389_340_1218	290
475	3300035170	Ga0373943_0028860	Ga0373943_0028860_43_921	290
476	3300035171	Ga0373946_0023405	Ga0373946_0023405_618_1496	290
477	3300035171	Ga0373946_0120549	Ga0373946_0120549_295_1173	290
478	3300035172	Ga0373955_0001311	Ga0373955_0001311_5468_6346	290
479	3300035241	Ga0373961_0026793	Ga0373961_0026793_124_1002	290
480	3300035398	Ga0316574_0000978	Ga0316574_0000978_5413_6288	290
481	3300035410	Ga0373924_0016448	Ga0373924_0016448_415_1353	290
482	3300035691	Ga0373931_0020045	Ga0373931_0020045_1783_2661	290
483	3300035691	Ga0373931_0049224	Ga0373931_0049224_668_1543	290
484	3300035695	Ga0373927_0015668	Ga0373927_0015668_3779_4654	290
485	3300035695	Ga0373927_0026337	Ga0373927_0026337_2299_3237	290
486	3300035695	Ga0373927_0121717	Ga0373927_0121717_242_1120	290
487	3300035695	Ga0373927_0133689	Ga0373927_0133689_419_1294	290
488	3300035724	Ga0373933_0001274	Ga0373933_0001274_7258_8196	290
489	3300035725	Ga0373947_0129737	Ga0373947_0129737_379_1254	290
490	3300035725	Ga0373947_0229848	Ga0373947_0229848_58_996	290
491	3300035725	Ga0373947_0376345	Ga0373947_0376345_45_923	290
492	3300036401	Ga0373937_0016638	Ga0373937_0016638_2594_3472	290
493	3300036401	Ga0373937_0021858	Ga0373937_0021858_321_1199	290
494	3300036401	Ga0373937_0148063	Ga0373937_0148063_560_1438	290
495	3300036401	Ga0373937_0392020	Ga0373937_0392020_378_1256	290
496	3300036712	Ga0316584_0024320	Ga0316584_0024320_875_1750	290
497	3300037068	Ga0373925_0022111	Ga0373925_0022111_2884_3795	290
498	3300037068	Ga0373925_0201073	Ga0373925_0201073_358_1233	290
499	3300037068	Ga0373925_0515810	Ga0373925_0515810_13_891	290
500	3300037853	Ga0436364_1171513	Ga0436364_1171513_86744_87619	290
501	3300038726	Ga0400490_04430	Ga0400490_04430_79_957	290
502	3300039437	Ga0436365_0560405	Ga0436365_0560405_170_1048	290
503	3300039447	Ga0436361_1094564	Ga0436361_1094564_1281_2159	290
504	3300041408	Ga0439453_0014355	Ga0439453_0014355_224_1102	290
505	3300042125	Ga0450923_004735	Ga0450923_004735_661_1539	290
506	3300044693	Ga0466961_0145398	Ga0466961_0145398_258_1136	290
507	3300044694	Ga0466963_0058419	Ga0466963_0058419_27_902	290
508	3300044719	Ga0466971_0129629	Ga0466971_0129629_149_1027	290
509	3300044842	Ga0466957_0121330	Ga0466957_0121330_220_1098	290
510	3300044842	Ga0466957_0277606	Ga0466957_0277606_155_1033	290
511	3300045049	Ga0466959_0234517	Ga0466959_0234517_259_1137	290
512	3300045836	Ga0466958_0268291	Ga0466958_0268291_122_1000	290
513	3300045976	Ga0466967_0024343	Ga0466967_0024343_2760_3635	290
514	3300045976	Ga0466967_0444178	Ga0466967_0444178_246_1121	290
515	3300046454	Ga0495592_0033827	Ga0495592_0033827_1391_2269	290
516	3300046454	Ga0495592_0041985	Ga0495592_0041985_2197_3072	290
517	3300046454	Ga0495592_0176509	Ga0495592_0176509_128_1066	290
518	3300046459	Ga0495629_0001585	Ga0495629_0001585_8162_9100	290
519	3300046459	Ga0495629_0153119	Ga0495629_0153119_676_1554	290
520	3300046462	Ga0495651_0006589	Ga0495651_0006589_167_1105	290
521	3300046462	Ga0495651_0054432	Ga0495651_0054432_1425_2303	290
522	3300046462	Ga0495651_0225422	Ga0495651_0225422_340_1218	290
523	3300046463	Ga0495653_0003054	Ga0495653_0003054_4348_5286	290
524	3300046472	Ga0495580_0125138	Ga0495580_0125138_317_1192	290
525	3300046476	Ga0495662_0022636	Ga0495662_0022636_716_1591	290
526	3300046492	Ga0495585_0197604	Ga0495585_0197604_92_970	290
527	3300046511	Ga0495608_0022677	Ga0495608_0022677_2063_2941	290
528	3300046511	Ga0495608_0069105	Ga0495608_0069105_1163_2101	290
529	3300046511	Ga0495608_0079929	Ga0495608_0079929_209_1087	290
530	3300046514	Ga0495618_0081193	Ga0495618_0081193_1144_2022	290
531	3300046516	Ga0495628_0131565	Ga0495628_0131565_258_1136	290
532	3300046529	Ga0495652_0003471	Ga0495652_0003471_7318_8196	290
533	3300046529	Ga0495652_0056220	Ga0495652_0056220_2028_2906	290
534	3300046529	Ga0495652_0097574	Ga0495652_0097574_210_1088	290
535	3300046531	Ga0495665_0072185	Ga0495665_0072185_423_1298	290
536	3300046533	Ga0495640_0141397	Ga0495640_0141397_489_1427	290
537	3300046533	Ga0495640_0153400	Ga0495640_0153400_395_1270	290
538	3300046535	Ga0495586_0024059	Ga0495586_0024059_292_1167	290
539	3300046536	Ga0495587_0004103	Ga0495587_0004103_8137_9075	290
540	3300046536	Ga0495587_0131300	Ga0495587_0131300_358_1236	290
541	3300046536	Ga0495587_0145330	Ga0495587_0145330_195_1073	290
542	3300046543	Ga0495645_0083976	Ga0495645_0083976_1255_2133	290
543	3300046559	Ga0495667_0002447	Ga0495667_0002447_10456_11394	290
544	3300046559	Ga0495667_0051732	Ga0495667_0051732_658_1536	290
545	3300046559	Ga0495667_0084299	Ga0495667_0084299_77_955	290
546	3300046642	Ga0495634_0020786	Ga0495634_0020786_1437_2375	290
547	3300046663	Ga0495635_0074276	Ga0495635_0074276_1280_2218	290
548	3300046663	Ga0495635_0097058	Ga0495635_0097058_52_930	290
549	3300046664	Ga0495659_0055340	Ga0495659_0055340_476_1351	290
550	3300046675	Ga0495657_0046568	Ga0495657_0046568_1688_2566	290
551	3300046678	Ga0495599_0010778	Ga0495599_0010778_35_973	290
552	3300046678	Ga0495599_0012754	Ga0495599_0012754_2216_3094	290
553	3300046679	Ga0495623_0006380	Ga0495623_0006380_437_1375	290
554	3300046679	Ga0495623_0034632	Ga0495623_0034632_1169_2047	290
555	3300046680	Ga0495646_0024899	Ga0495646_0024899_2327_3265	290
556	3300046680	Ga0495646_0028472	Ga0495646_0028472_1689_2567	290
557	3300046681	Ga0495647_0067250	Ga0495647_0067250_287_1162	290
558	3300046809	Ga0495600_0017185	Ga0495600_0017185_2647_3522	290
559	3300046809	Ga0495600_0301168	Ga0495600_0301168_38_976	290
560	3300047315	Ga0495581_0307514	Ga0495581_0307514_34_912	290
561	3300047317	Ga0495604_0005116	Ga0495604_0005116_1300_2238	290
562	3300047317	Ga0495604_0060485	Ga0495604_0060485_305_1183	290
563	3300047317	Ga0495604_0097244	Ga0495604_0097244_243_1121	290
564	3300047317	Ga0495604_0163518	Ga0495604_0163518_335_1213	290
565	3300047319	Ga0495674_0008437	Ga0495674_0008437_848_1786	290
566	3300047319	Ga0495674_0066867	Ga0495674_0066867_1643_2521	290
567	3300047322	Ga0495680_0007728	Ga0495680_0007728_8419_9357	290
568	3300047322	Ga0495680_0007834	Ga0495680_0007834_3072_3950	290
569	3300047322	Ga0495680_0021170	Ga0495680_0021170_712_1587	290
570	3300047322	Ga0495680_0103389	Ga0495680_0103389_1013_1891	290
571	3300047444	Ga0495675_0024612	Ga0495675_0024612_442_1380	290
572	3300047444	Ga0495675_0118547	Ga0495675_0118547_178_1056	290
573	3300047673	Ga0495593_0144347	Ga0495593_0144347_229_1107	290
574	3300048088	Ga0495602_0029203	Ga0495602_0029203_564_1502	290
575	3300048088	Ga0495602_0041349	Ga0495602_0041349_1230_2108	290
576	3300048088	Ga0495602_0058204	Ga0495602_0058204_1530_2408	290
577	3300048903	Ga0496100_0389318	Ga0496100_0389318_10_888	290
578	3300048903	Ga0496100_0457108	Ga0496100_0457108_59_937	290
579	3300048904	Ga0496101_0228214	Ga0496101_0228214_149_1027	290
580	3300048905	Ga0496102_0050544	Ga0496102_0050544_25_903	290
581	3300048905	Ga0496102_0180215	Ga0496102_0180215_278_1156	290
582	3300048905	Ga0496102_0194637	Ga0496102_0194637_67_945	290
583	3300048907	Ga0496104_0006860	Ga0496104_0006860_8402_9280	290
584	3300048907	Ga0496104_0022297	Ga0496104_0022297_4318_5196	290
585	3300048907	Ga0496104_0337543	Ga0496104_0337543_181_1056	290
586	3300048908	Ga0496105_0029059	Ga0496105_0029059_2844_3722	290
587	3300048909	Ga0496106_0113297	Ga0496106_0113297_316_1194	290
588	3300048909	Ga0496106_0313477	Ga0496106_0313477_221_1099	290
589	3300048910	Ga0496107_0021209	Ga0496107_0021209_2855_3733	290
590	3300048910	Ga0496107_0039875	Ga0496107_0039875_1654_2532	290
591	3300048911	Ga0496108_0017814	Ga0496108_0017814_2736_3614	290
592	3300048912	Ga0496109_0085882	Ga0496109_0085882_1751_2629	290
593	3300048913	Ga0496110_0032571	Ga0496110_0032571_676_1554	290
594	3300048914	Ga0496111_0102977	Ga0496111_0102977_59_937	290
595	3300048914	Ga0496111_0185691	Ga0496111_0185691_224_1102	290
596	3300048915	Ga0496112_0029249	Ga0496112_0029249_1315_2190	290
597	3300048915	Ga0496112_0102494	Ga0496112_0102494_122_1000	290
598	3300048915	Ga0496112_0191334	Ga0496112_0191334_99_977	290
599	3300048916	Ga0496113_0055458	Ga0496113_0055458_625_1503	290
600	3300048918	Ga0496115_0073872	Ga0496115_0073872_1006_1884	290
601	3300048918	Ga0496115_0091891	Ga0496115_0091891_1338_2216	290
602	3300049568	Ga0501031_0006323	Ga0501031_0006323_891_1769	290
603	3300049569	Ga0501032_0003419	Ga0501032_0003419_10804_11682	290
604	3300049570	Ga0501033_0009921	Ga0501033_0009921_348_1226	290
605	3300049571	Ga0501034_0326217	Ga0501034_0326217_315_1190	290
606	3300049571	Ga0501034_0366121	Ga0501034_0366121_276_1154	290
607	3300049572	Ga0501036_0036875	Ga0501036_0036875_476_1354	290
608	3300049573	Ga0501037_0005593	Ga0501037_0005593_7935_8813	290
609	3300049574	Ga0501038_0084839	Ga0501038_0084839_1452_2330	290
610	3300049575	Ga0501039_0004648	Ga0501039_0004648_5493_6371	290
611	3300049578	Ga0501042_0107014	Ga0501042_0107014_666_1544	290
612	3300049579	Ga0501043_0006514	Ga0501043_0006514_4943_5821	290
613	3300049580	Ga0501046_0014564	Ga0501046_0014564_5403_6281	290
614	3300049580	Ga0501046_0204109	Ga0501046_0204109_385_1284	290
615	3300049581	Ga0501047_0082428	Ga0501047_0082428_348_1226	290
616	3300049582	Ga0501048_0007757	Ga0501048_0007757_5384_6262	290
617	3300049583	Ga0501067_0016063	Ga0501067_0016063_2363_3241	290
618	3300049584	Ga0501068_0010669	Ga0501068_0010669_933_1811	290
619	3300049585	Ga0501069_0008834	Ga0501069_0008834_965_1843	290
620	3300049586	Ga0501070_0019216	Ga0501070_0019216_1386_2264	290
621	3300049586	Ga0501070_0191814	Ga0501070_0191814_145_1020	290
622	3300049587	Ga0501071_0037999	Ga0501071_0037999_1214_2092	290
623	3300049589	Ga0501073_0010725	Ga0501073_0010725_4954_5832	290
624	3300049590	Ga0501074_0009792	Ga0501074_0009792_5558_6436	290
625	3300049590	Ga0501074_0348242	Ga0501074_0348242_22_897	290
626	3300049592	Ga0501076_0022017	Ga0501076_0022017_324_1202	290
627	3300049741	Ga0501079_0025812	Ga0501079_0025812_1495_2373	290
628	3300049742	Ga0501080_0035035	Ga0501080_0035035_3274_4152	290
629	3300049744	Ga0501083_0005774	Ga0501083_0005774_2683_3561	290
630	3300049822	Ga0501035_0010409	Ga0501035_0010409_2487_3365	290
631	3300049822	Ga0501035_0349971	Ga0501035_0349971_73_948	290
632	3300049823	Ga0501044_0000458	Ga0501044_0000458_4090_4989	290
633	3300049823	Ga0501044_0024054	Ga0501044_0024054_348_1226	290
634	3300049824	Ga0501045_0077820	Ga0501045_0077820_545_1423	290
635	3300050492	nmdc:mga0yw44_189843_c1	nmdc:mga0yw44_189843_c1_10_888	290
636	3300050492	nmdc:mga0yw44_41337_c1	nmdc:mga0yw44_41337_c1_287_1162	290
637	3300050492	nmdc:mga0yw44_62836_c1	nmdc:mga0yw44_62836_c1_1357_2232	290
638	3300050493	nmdc:mga0k408_83959_c1	nmdc:mga0k408_83959_c1_472_1350	290
639	3300050494	nmdc:mga06z11_70549_c1	nmdc:mga06z11_70549_c1_896_1774	290
640	3300050496	nmdc:mga07m45_57477_c1	nmdc:mga07m45_57477_c1_927_1805	290
641	3300050508	nmdc:mga09592_148083_c1	nmdc:mga09592_148083_c1_169_1047	290
642	3300050508	nmdc:mga09592_160385_c1	nmdc:mga09592_160385_c1_774_1652	290
643	3300050508	nmdc:mga09592_462396_c1	nmdc:mga09592_462396_c1_34_909	290
644	3300050509	nmdc:mga0qj67_487696_c1	nmdc:mga0qj67_487696_c1_34_909	290
645	3300050509	nmdc:mga0qj67_60510_c1	nmdc:mga0qj67_60510_c1_446_1324	290
646	3300050509	nmdc:mga0qj67_7308_c1	nmdc:mga0qj67_7308_c1_5279_6157	290
647	3300050509	nmdc:mga0qj67_74130_c1	nmdc:mga0qj67_74130_c1_1604_2482	290
648	3300050510	nmdc:mga06r32_105930_c1	nmdc:mga06r32_105930_c1_915_1793	290
649	3300050510	nmdc:mga06r32_201639_c1	nmdc:mga06r32_201639_c1_241_1116	290
650	3300050511	nmdc:mga08y16_150661_c1	nmdc:mga08y16_150661_c1_34_912	290
651	3300050511	nmdc:mga08y16_439005_c1	nmdc:mga08y16_439005_c1_173_1051	290
652	3300050512	nmdc:mga0n895_12622_c1	nmdc:mga0n895_12622_c1_1108_1986	290
653	3300050512	nmdc:mga0n895_338196_c1	nmdc:mga0n895_338196_c1_400_1278	290
654	3300050512	nmdc:mga0n895_340810_c1	nmdc:mga0n895_340810_c1_152_1027	290
655	3300050513	nmdc:mga0rr50_211460_c1	nmdc:mga0rr50_211460_c1_239_1117	290
656	3300050513	nmdc:mga0rr50_61298_c1	nmdc:mga0rr50_61298_c1_1238_2116	290
657	3300050514	nmdc:mga08x19_105878_c1	nmdc:mga08x19_105878_c1_584_1462	290
658	3300050514	nmdc:mga08x19_5254_c1	nmdc:mga08x19_5254_c1_695_1570	290
659	3300053077	Ga0495601_0001616	Ga0495601_0001616_8248_9186	290
660	3300053077	Ga0495601_0073155	Ga0495601_0073155_1028_1903	290
661	3300053077	Ga0495601_0217724	Ga0495601_0217724_231_1109	290
662	3300053078	Ga0495612_0028656	Ga0495612_0028656_560_1438	290
663	3300053078	Ga0495612_0061099	Ga0495612_0061099_498_1436	290
664	3300053084	Ga0495595_0002897	Ga0495595_0002897_402_1340	290
665	3300053084	Ga0495595_0006960	Ga0495595_0006960_384_1262	290
666	3300053084	Ga0495595_0019585	Ga0495595_0019585_1466_2344	290
667	3300053085	Ga0495619_0003980	Ga0495619_0003980_8173_9111	290
668	3300053085	Ga0495619_0050506	Ga0495619_0050506_393_1271	290
669	3300053085	Ga0495619_0136887	Ga0495619_0136887_324_1202	290
670	3300053108	Ga0500562_008872	Ga0500562_008872_934_1812	290
671	3300053120	Ga0500597_064852	Ga0500597_064852_633_1511	290
672	3300053153	Ga0500616_0057788	Ga0500616_0057788_1009_1887	290
673	3300054114	Ga0501084_0122701	Ga0501084_0122701_334_1212	290
674	3300061734	Ga0530510_0190890	Ga0530510_0190890_291_1166	290
675	iso_pu_bacteria	2643221575	2643886214	290
676	iso_pu_bacteria	8004182704	8004183186	290
677	3300005336	Ga0070680_100164920	Ga0070680_1001649201	291
678	3300005341	Ga0070691_10083800	Ga0070691_100838001	291
679	3300005614	Ga0068856_100135041	Ga0068856_1001350412	291
680	3300005615	Ga0070702_100072973	Ga0070702_1000729732	291
681	3300006028	Ga0070717_10044439	Ga0070717_100444393	291
682	3300006028	Ga0070717_10323431	Ga0070717_103234311	291
683	3300006844	Ga0075428_100277587	Ga0075428_1002775872	291
684	3300009098	Ga0105245_10010094	Ga0105245_100100947	291
685	3300010375	Ga0105239_10537850	Ga0105239_105378502	291
686	3300013296	Ga0157374_10028404	Ga0157374_100284045	291
687	3300014325	Ga0163163_10010901	Ga0163163_100109018	291
688	3300014968	Ga0157379_10002408	Ga0157379_100024089	291
689	3300025927	Ga0207687_10019622	Ga0207687_100196223	291
690	3300026035	Ga0207703_10063847	Ga0207703_100638473	291
691	3300026088	Ga0207641_10092715	Ga0207641_100927152	291
692	3300031691	Ga0316579_10065613	Ga0316579_100656131	291
693	3300032168	Ga0316593_10045001	Ga0316593_100450011	291
694	3300033541	Ga0316596_1037408	Ga0316596_10374082	291
695	3300033541	Ga0316596_1060750	Ga0316596_10607501	291
696	3300036647	Ga0316582_0054831	Ga0316582_0054831_1646_2524	291
697	3300037068	Ga0373925_0300685	Ga0373925_0300685_343_1275	291
698	3300042876	Ga0451577_0013370	Ga0451577_0013370_532_1410	291
699	3300042876	Ga0451577_0263284	Ga0451577_0263284_378_1259	291
700	3300044694	Ga0466963_0067214	Ga0466963_0067214_83_991	291
701	3300044712	Ga0453684_0373459	Ga0453684_0373459_577_1551	291
702	3300044842	Ga0466957_0033136	Ga0466957_0033136_1244_2152	291
703	3300045836	Ga0466958_0075297	Ga0466958_0075297_262_1170	291
704	3300048907	Ga0496104_0003348	Ga0496104_0003348_4893_5855	291
705	3300048911	Ga0496108_0003022	Ga0496108_0003022_5291_6223	291
706	3300048912	Ga0496109_0519119	Ga0496109_0519119_35_967	291
707	3300048913	Ga0496110_0021299	Ga0496110_0021299_2972_3904	291
708	3300048914	Ga0496111_0173083	Ga0496111_0173083_54_986	291
709	3300049570	Ga0501033_0042041	Ga0501033_0042041_1904_2785	291
710	3300049581	Ga0501047_0011482	Ga0501047_0011482_5675_6556	291
711	3300050507	nmdc:mga05p37_259348_c1	nmdc:mga05p37_259348_c1_1094_1972	291
712	3300050508	nmdc:mga09592_38376_c1	nmdc:mga09592_38376_c1_238_1116	291
713	iso_pu_bacteria	2537561587	2537876997	291
714	iso_pu_bacteria	2547132181	2547696080	291
715	iso_pu_bacteria	2547132416	2548648207	291
716	iso_pu_bacteria	2554235234	2555258803	291
717	iso_pu_bacteria	2561511199	2562464540	291
718	iso_pu_bacteria	2599185169	2599410208	291
719	iso_pu_bacteria	2600255254	2601523420	291
720	iso_pu_bacteria	2600255255	2601528579	291
721	iso_pu_bacteria	2600255256	2601534339	291
722	iso_pu_bacteria	2600255257	2601538882	291
723	iso_pu_bacteria	2600255280	2601615412	291
724	iso_pu_bacteria	2600255281	2601619662	291
725	iso_pu_bacteria	2600255287	2601643923	291
726	iso_pu_bacteria	2600255288	2601648067	291
727	iso_pu_bacteria	2600255289	2601653464	291
728	iso_pu_bacteria	2600255290	2601658415	291
729	iso_pu_bacteria	2600255291	2601663748	291
730	iso_pu_bacteria	2600255298	2601696371	291
731	iso_pu_bacteria	2600255299	2601701380	291
732	iso_pu_bacteria	2600255300	2601706119	291
733	iso_pu_bacteria	2600255301	2601711704	291
734	iso_pu_bacteria	2600255302	2601716722	291
735	iso_pu_bacteria	2600255303	2601721395	291
736	iso_pu_bacteria	2600255304	2601727128	291
737	iso_pu_bacteria	2600255305	2601731668	291
738	iso_pu_bacteria	2600255306	2601736680	291
739	iso_pu_bacteria	2600255307	2601740354	291
740	iso_pu_bacteria	2600255309	2601751291	291
741	iso_pu_bacteria	2600255310	2601757231	291
742	iso_pu_bacteria	2600255311	2601762168	291
743	iso_pu_bacteria	2600255392	2602018849	291
744	iso_pu_bacteria	2602042046	2603639580	291
745	iso_pu_bacteria	2602042047	2603644238	291
746	iso_pu_bacteria	2602042052	2603661136	291
747	iso_pu_bacteria	2602042053	2603666411	291
748	iso_pu_bacteria	2602042066	2603701240	291
749	iso_pu_bacteria	2602042067	2603704840	291
750	iso_pu_bacteria	2602042103	2603839065	291
751	iso_pu_bacteria	2602042104	2603843675	291
752	iso_pu_bacteria	2602042105	2603849221	291
753	iso_pu_bacteria	2602042106	2603854292	291
754	iso_pu_bacteria	2602042109	2603865621	291
755	iso_pu_bacteria	2602042110	2603872347	291
756	iso_pu_bacteria	2602042111	2603877223	291
757	iso_pu_bacteria	2603880178	2606049528	291
758	iso_pu_bacteria	2603880184	2606070843	291
759	iso_pu_bacteria	2603880202	2606147211	291
760	iso_pu_bacteria	2603880211	2606176937	291
761	iso_pu_bacteria	2609459761	2609911504	291
762	iso_pu_bacteria	2636415599	2637223246	291
763	iso_pu_bacteria	2667528172	2671104640	291
764	iso_pu_bacteria	2671180115	2671586949	291
765	iso_pu_bacteria	2675903046	2676408579	291
766	iso_pu_bacteria	2681812866	2681998009	291
767	iso_pu_bacteria	2681812869	2682008118	291
768	iso_pu_bacteria	2711768156	2712470936	291
769	iso_pu_bacteria	2751185917	2753857642	291
770	iso_pu_bacteria	2765235842	2765590745	291
771	iso_pu_bacteria	2775506706	2775540301	291
772	iso_pu_bacteria	2775507074	2777019553	291
773	iso_pu_bacteria	2791355010	2792312665	291
774	iso_pu_bacteria	2791355275	2793403962	291
775	iso_pu_bacteria	2811995292	2813726869	291
776	iso_pu_bacteria	2814123068	2814694239	291
777	iso_pu_bacteria	2821118458	2821120631	291
778	iso_pu_bacteria	2823373977	2823376507	291
779	iso_pu_bacteria	2844425489	2844429134	291
780	iso_pu_bacteria	2904513164	2904517146	291
781	iso_pu_bacteria	2919108558	2919110682	291
782	iso_pu_bacteria	2923634449	2923636635	291
783	iso_pu_bacteria	2927833300	2927836887	291
784	iso_pu_bacteria	2937539931	2937544020	291
785	iso_pu_bacteria	2939568625	2939572320	291
786	iso_pu_bacteria	2939607340	2939610465	291
787	iso_pu_bacteria	2939642701	2939645525	291
788	iso_pu_bacteria	2945874760	2945875934	291
789	iso_pu_bacteria	2969079654	2969080264	291
790	iso_pu_bacteria	2971820967	2971821635	291
791	iso_pu_bacteria	2974310843	2974315026	291
792	iso_pu_bacteria	2984559226	2984562717	291
793	iso_pu_bacteria	2984595703	2984600776	291
794	iso_pu_bacteria	8018221730	8018223030	291
795	iso_pu_bacteria	8018405270	8018406984	291
796	iso_pu_bacteria	8054844752	8054848165	291
797	iso_pu_bacteria	8054849141	8054853582	291
798	iso_pu_bacteria	8055087960	8055089625	291
799	iso_pu_bacteria	8055092621	8055095889	291
800	iso_pu_bacteria	8055097453	8055101644	291
801	iso_pu_bacteria	8057304971	8057308353	291
802	3300005437	Ga0070710_10050565	Ga0070710_100505651	292
803	3300005468	Ga0070707_100020644	Ga0070707_1000206443	292
804	3300005719	Ga0068861_100112185	Ga0068861_1001121855	292
805	3300006844	Ga0075428_100007510	Ga0075428_1000075109	292
806	3300009545	Ga0105237_10408178	Ga0105237_104081781	292
807	3300025922	Ga0207646_10039292	Ga0207646_100392923	292
808	3300026118	Ga0207675_100177695	Ga0207675_1001776951	292
809	3300028023	Ga0265357_1001124	Ga0265357_10011242	292
810	3300028573	Ga0265334_10029208	Ga0265334_100292082	292
811	3300028577	Ga0265318_10014455	Ga0265318_100144553	292
812	3300028577	Ga0265318_10032899	Ga0265318_100328992	292
813	3300029957	Ga0265324_10009957	Ga0265324_100099572	292
814	3300031018	Ga0265773_1000711	Ga0265773_10007111	292
815	3300031238	Ga0265332_10092272	Ga0265332_100922722	292
816	3300031240	Ga0265320_10007405	Ga0265320_100074053	292
817	3300031242	Ga0265329_10029561	Ga0265329_100295611	292
818	3300031595	Ga0265313_10030891	Ga0265313_100308913	292
819	3300031616	Ga0307508_10340554	Ga0307508_103405541	292
820	3300031665	Ga0316575_10000048	Ga0316575_1000004817	292
821	3300031665	Ga0316575_10031196	Ga0316575_100311963	292
822	3300031691	Ga0316579_10011415	Ga0316579_100114155	292
823	3300031691	Ga0316579_10023222	Ga0316579_100232221	292
824	3300031711	Ga0265314_10026020	Ga0265314_100260203	292
825	3300031733	Ga0316577_10015118	Ga0316577_100151185	292
826	3300032133	Ga0316583_10000396	Ga0316583_100003963	292
827	3300032137	Ga0316585_10021756	Ga0316585_100217562	292
828	3300032168	Ga0316593_10000125	Ga0316593_100001252	292
829	3300035083	Ga0373926_0020013	Ga0373926_0020013_1184_2068	292
830	3300035170	Ga0373943_0024879	Ga0373943_0024879_1229_2113	292
831	3300035241	Ga0373961_0002306	Ga0373961_0002306_20_901	292
832	3300035398	Ga0316574_0004589	Ga0316574_0004589_531_1547	292
833	3300035398	Ga0316574_0036070	Ga0316574_0036070_876_1757	292
834	3300035692	Ga0373935_0003401	Ga0373935_0003401_4847_5728	292
835	3300036647	Ga0316582_0001315	Ga0316582_0001315_5863_6879	292
836	3300036647	Ga0316582_0017550	Ga0316582_0017550_73_954	292
837	3300036647	Ga0316582_0084025	Ga0316582_0084025_432_1313	292
838	3300037068	Ga0373925_0067043	Ga0373925_0067043_1411_2295	292
839	3300037312	Ga0395899_0068874	Ga0395899_0068874_151_1032	292
840	3300037418	Ga0395900_0003352	Ga0395900_0003352_6509_7390	292
841	3300037418	Ga0395900_0037812	Ga0395900_0037812_3250_4131	292
842	3300037466	Ga0395898_0008836	Ga0395898_0008836_4400_5281	292
843	3300037466	Ga0395898_0104024	Ga0395898_0104024_1284_2165	292
844	3300038443	Ga0395901_0059955	Ga0395901_0059955_1402_2283	292
845	3300038443	Ga0395901_0261713	Ga0395901_0261713_865_1746	292
846	3300038443	Ga0395901_0265644	Ga0395901_0265644_476_1357	292
847	3300042876	Ga0451577_0000040	Ga0451577_0000040_327378_328268	292
848	3300044712	Ga0453684_0000179	Ga0453684_0000179_18462_19352	292
849	3300046461	Ga0495641_0031320	Ga0495641_0031320_174_1058	292
850	3300046463	Ga0495653_0016804	Ga0495653_0016804_4511_5395	292
851	3300046472	Ga0495580_0060900	Ga0495580_0060900_583_1467	292
852	3300046473	Ga0495582_0010683	Ga0495582_0010683_771_1655	292
853	3300046475	Ga0495639_0035932	Ga0495639_0035932_160_1044	292
854	3300046499	Ga0495594_0026465	Ga0495594_0026465_720_1604	292
855	3300046511	Ga0495608_0051877	Ga0495608_0051877_1214_2098	292
856	3300046514	Ga0495618_0181913	Ga0495618_0181913_231_1115	292
857	3300046517	Ga0495630_0045136	Ga0495630_0045136_84_968	292
858	3300046531	Ga0495665_0008002	Ga0495665_0008002_4046_4930	292
859	3300046559	Ga0495667_0063541	Ga0495667_0063541_228_1112	292
860	3300046660	Ga0495625_0013065	Ga0495625_0013065_1028_1909	292
861	3300046680	Ga0495646_0064067	Ga0495646_0064067_302_1186	292
862	3300046683	Ga0495658_0015577	Ga0495658_0015577_2457_3341	292
863	3300046690	Ga0495624_0051331	Ga0495624_0051331_381_1265	292
864	3300046694	Ga0495649_0073332	Ga0495649_0073332_636_1517	292
865	3300047315	Ga0495581_0005385	Ga0495581_0005385_3139_4023	292
866	3300047319	Ga0495674_0022932	Ga0495674_0022932_2831_3715	292
867	3300047321	Ga0495676_0060043	Ga0495676_0060043_2040_2924	292
868	3300047322	Ga0495680_0010255	Ga0495680_0010255_2167_3051	292
869	3300047469	Ga0495673_0081752	Ga0495673_0081752_327_1208	292
870	3300047471	Ga0495684_0050037	Ga0495684_0050037_961_1899	292
871	3300047673	Ga0495593_0018467	Ga0495593_0018467_383_1267	292
872	3300048089	Ga0495614_0039150	Ga0495614_0039150_552_1436	292
873	3300048908	Ga0496105_0061613	Ga0496105_0061613_116_997	292
874	3300048917	Ga0496114_0000058	Ga0496114_0000058_43058_43939	292
875	3300049460	Ga0495682_0006258	Ga0495682_0006258_3536_4417	292
876	3300053077	Ga0495601_0053458	Ga0495601_0053458_1381_2319	292
877	3300053085	Ga0495619_0004020	Ga0495619_0004020_7208_8092	292
878	3300053139	Ga0500568_0000061	Ga0500568_0000061_99972_100856	292
879	3300005329	Ga0070683_100168838	Ga0070683_1001688382	293
880	3300005364	Ga0070673_100193047	Ga0070673_1001930472	293
881	3300005365	Ga0070688_100111135	Ga0070688_1001111351	293
882	3300005435	Ga0070714_100157685	Ga0070714_1001576853	293
883	3300005435	Ga0070714_100170249	Ga0070714_1001702492	293
884	3300005436	Ga0070713_100095860	Ga0070713_1000958602	293
885	3300005436	Ga0070713_100201465	Ga0070713_1002014652	293
886	3300005436	Ga0070713_100295766	Ga0070713_1002957662	293
887	3300005436	Ga0070713_100385810	Ga0070713_1003858102	293
888	3300005437	Ga0070710_10077345	Ga0070710_100773451	293
889	3300005437	Ga0070710_10081400	Ga0070710_100814002	293
890	3300005438	Ga0070701_10064971	Ga0070701_100649712	293
891	3300005439	Ga0070711_100088187	Ga0070711_1000881873	293
892	3300005440	Ga0070705_100034231	Ga0070705_1000342313	293
893	3300005441	Ga0070700_100048319	Ga0070700_1000483192	293
894	3300005445	Ga0070708_100008914	Ga0070708_1000089145	293
895	3300005445	Ga0070708_100010968	Ga0070708_1000109687	293
896	3300005466	Ga0070685_10154737	Ga0070685_101547372	293
897	3300005467	Ga0070706_100012610	Ga0070706_1000126104	293
898	3300005468	Ga0070707_100001159	Ga0070707_1000011599	293
899	3300005468	Ga0070707_100017280	Ga0070707_1000172807	293
900	3300005468	Ga0070707_100100093	Ga0070707_1001000932	293
901	3300005471	Ga0070698_100028860	Ga0070698_1000288606	293
902	3300005518	Ga0070699_100041564	Ga0070699_1000415643	293
903	3300005535	Ga0070684_100148696	Ga0070684_1001486963	293
904	3300005536	Ga0070697_100027236	Ga0070697_1000272362	293
905	3300005536	Ga0070697_100152078	Ga0070697_1001520782	293
906	3300005577	Ga0068857_100042033	Ga0068857_1000420333	293
907	3300005614	Ga0068856_100216661	Ga0068856_1002166613	293
908	3300005616	Ga0068852_100126561	Ga0068852_1001265613	293
909	3300005844	Ga0068862_100116846	Ga0068862_1001168462	293
910	3300005983	Ga0081540_1017654	Ga0081540_10176545	293
911	3300006028	Ga0070717_10001468	Ga0070717_100014685	293
912	3300006028	Ga0070717_10219842	Ga0070717_102198422	293
913	3300006173	Ga0070716_100252552	Ga0070716_1002525522	293
914	3300006175	Ga0070712_100002429	Ga0070712_1000024298	293
915	3300006175	Ga0070712_100165020	Ga0070712_1001650201	293
916	3300006175	Ga0070712_100220758	Ga0070712_1002207582	293
917	3300007076	Ga0075435_100235847	Ga0075435_1002358472	293
918	3300009551	Ga0105238_10467602	Ga0105238_104676022	293
919	3300014969	Ga0157376_10313998	Ga0157376_103139982	293
920	3300021388	Ga0213875_10010252	Ga0213875_100102523	293
921	3300025910	Ga0207684_10001612	Ga0207684_1000161221	293
922	3300025915	Ga0207693_10001513	Ga0207693_100015136	293
923	3300025915	Ga0207693_10003605	Ga0207693_1000360512	293
924	3300025915	Ga0207693_10048226	Ga0207693_100482262	293
925	3300025916	Ga0207663_10279631	Ga0207663_102796312	293
926	3300025922	Ga0207646_10000161	Ga0207646_1000016175	293
927	3300025922	Ga0207646_10106061	Ga0207646_101060612	293
928	3300025922	Ga0207646_10226392	Ga0207646_102263921	293
929	3300025927	Ga0207687_10234109	Ga0207687_102341092	293
930	3300025928	Ga0207700_10056678	Ga0207700_100566782	293
931	3300025928	Ga0207700_10081483	Ga0207700_100814831	293
932	3300025928	Ga0207700_10083103	Ga0207700_100831032	293
933	3300025928	Ga0207700_10260997	Ga0207700_102609971	293
934	3300025929	Ga0207664_10081279	Ga0207664_100812793	293
935	3300025929	Ga0207664_10095697	Ga0207664_100956972	293
936	3300025929	Ga0207664_10106656	Ga0207664_101066562	293
937	3300025929	Ga0207664_10119246	Ga0207664_101192462	293
938	3300025939	Ga0207665_10280739	Ga0207665_102807392	293
939	3300025944	Ga0207661_10082322	Ga0207661_100823222	293
940	3300025945	Ga0207679_10004671	Ga0207679_100046713	293
941	3300026075	Ga0207708_10048224	Ga0207708_100482243	293
942	3300026116	Ga0207674_10053463	Ga0207674_100534633	293
943	3300026142	Ga0207698_10110017	Ga0207698_101100173	293
944	3300028573	Ga0265334_10006089	Ga0265334_100060892	293
945	3300028653	Ga0265323_10003972	Ga0265323_100039722	293
946	3300028653	Ga0265323_10022345	Ga0265323_100223452	293
947	3300028800	Ga0265338_10001840	Ga0265338_100018404	293
948	3300028800	Ga0265338_10048050	Ga0265338_100480502	293
949	3300028800	Ga0265338_10093821	Ga0265338_100938212	293
950	3300031235	Ga0265330_10000325	Ga0265330_1000032511	293
951	3300031235	Ga0265330_10003208	Ga0265330_100032084	293
952	3300031235	Ga0265330_10003517	Ga0265330_100035175	293
953	3300031235	Ga0265330_10003710	Ga0265330_100037107	293
954	3300031242	Ga0265329_10000290	Ga0265329_100002906	293
955	3300031344	Ga0265316_10000320	Ga0265316_1000032014	293
956	3300031344	Ga0265316_10000594	Ga0265316_100005949	293
957	3300031344	Ga0265316_10000776	Ga0265316_100007762	293
958	3300031344	Ga0265316_10018934	Ga0265316_100189345	293
959	3300031712	Ga0265342_10001251	Ga0265342_1000125114	293
960	3300031712	Ga0265342_10013174	Ga0265342_100131743	293
961	3300031712	Ga0265342_10032417	Ga0265342_100324171	293
962	3300035083	Ga0373926_0000081	Ga0373926_0000081_7415_8299	293
963	3300035083	Ga0373926_0023354	Ga0373926_0023354_985_1902	293
964	3300035089	Ga0373944_0000424	Ga0373944_0000424_6952_7884	293
965	3300035111	Ga0373923_0186585	Ga0373923_0186585_25_942	293
966	3300035113	Ga0373936_0000169	Ga0373936_0000169_11403_12335	293
967	3300035113	Ga0373936_0022129	Ga0373936_0022129_921_1838	293
968	3300035116	Ga0373945_0000510	Ga0373945_0000510_5184_6116	293
969	3300035116	Ga0373945_0006791	Ga0373945_0006791_2431_3348	293
970	3300035116	Ga0373945_0035270	Ga0373945_0035270_680_1582	293
971	3300035117	Ga0373953_0011891	Ga0373953_0011891_2006_2923	293
972	3300035120	Ga0373957_0036172	Ga0373957_0036172_681_1598	293
973	3300035170	Ga0373943_0000102	Ga0373943_0000102_26968_27885	293
974	3300035170	Ga0373943_0001153	Ga0373943_0001153_5349_6281	293
975	3300035171	Ga0373946_0000662	Ga0373946_0000662_7960_8892	293
976	3300035171	Ga0373946_0015583	Ga0373946_0015583_319_1236	293
977	3300035172	Ga0373955_0107397	Ga0373955_0107397_366_1283	293
978	3300035398	Ga0316574_0039469	Ga0316574_0039469_1798_2682	293
979	3300035410	Ga0373924_0011693	Ga0373924_0011693_1528_2445	293
980	3300035692	Ga0373935_0000066	Ga0373935_0000066_5279_6163	293
981	3300035692	Ga0373935_0003437	Ga0373935_0003437_5618_6550	293
982	3300035692	Ga0373935_0004966	Ga0373935_0004966_3186_4103	293
983	3300035692	Ga0373935_0036269	Ga0373935_0036269_1499_2383	293
984	3300035695	Ga0373927_0003194	Ga0373927_0003194_8309_9226	293
985	3300035695	Ga0373927_0016417	Ga0373927_0016417_190_1107	293
986	3300035724	Ga0373933_0041307	Ga0373933_0041307_1296_2225	293
987	3300035725	Ga0373947_0000025	Ga0373947_0000025_12992_13876	293
988	3300035725	Ga0373947_0002831	Ga0373947_0002831_6768_7700	293
989	3300035725	Ga0373947_0002970	Ga0373947_0002970_2323_3240	293
990	3300035725	Ga0373947_0026366	Ga0373947_0026366_677_1594	293
991	3300036401	Ga0373937_0103170	Ga0373937_0103170_766_1695	293
992	3300036401	Ga0373937_0193898	Ga0373937_0193898_53_985	293
993	3300036401	Ga0373937_0576963	Ga0373937_0576963_86_1003	293
994	3300036647	Ga0316582_0160304	Ga0316582_0160304_75_959	293
995	3300036647	Ga0316582_0397671	Ga0316582_0397671_25_909	293
996	3300037068	Ga0373925_0001514	Ga0373925_0001514_15230_16147	293
997	3300037068	Ga0373925_0002640	Ga0373925_0002640_928_1860	293
998	3300037068	Ga0373925_0141881	Ga0373925_0141881_503_1387	293
999	3300037853	Ga0436364_1045514	Ga0436364_1045514_3385_4344	293
1000	3300039437	Ga0436365_1097793	Ga0436365_1097793_268_1164	293
1001	3300039450	Ga0436363_1483820	Ga0436363_1483820_861_1757	293
1002	3300044712	Ga0453684_0101140	Ga0453684_0101140_901_1851	293
1003	3300044901	Ga0466960_0024690	Ga0466960_0024690_1674_2567	293
1004	3300045836	Ga0466958_0015785	Ga0466958_0015785_2291_3175	293
1005	3300045836	Ga0466958_0068583	Ga0466958_0068583_472_1356	293
1006	3300045976	Ga0466967_0004399	Ga0466967_0004399_749_1681	293
1007	3300045976	Ga0466967_0081489	Ga0466967_0081489_1083_1967	293
1008	3300046454	Ga0495592_0094583	Ga0495592_0094583_330_1247	293
1009	3300046459	Ga0495629_0055843	Ga0495629_0055843_782_1699	293
1010	3300046459	Ga0495629_0163647	Ga0495629_0163647_479_1411	293
1011	3300046461	Ga0495641_0039996	Ga0495641_0039996_900_1817	293
1012	3300046462	Ga0495651_0044417	Ga0495651_0044417_2344_3276	293
1013	3300046463	Ga0495653_0018932	Ga0495653_0018932_1737_2669	293
1014	3300046463	Ga0495653_0028799	Ga0495653_0028799_1642_2559	293
1015	3300046463	Ga0495653_0037589	Ga0495653_0037589_2543_3460	293
1016	3300046472	Ga0495580_0033626	Ga0495580_0033626_2414_3331	293
1017	3300046472	Ga0495580_0244577	Ga0495580_0244577_27_911	293
1018	3300046473	Ga0495582_0012003	Ga0495582_0012003_3356_4288	293
1019	3300046475	Ga0495639_0047833	Ga0495639_0047833_378_1295	293
1020	3300046476	Ga0495662_0001205	Ga0495662_0001205_8488_9405	293
1021	3300046476	Ga0495662_0061985	Ga0495662_0061985_153_1085	293
1022	3300046477	Ga0495664_0000600	Ga0495664_0000600_7953_8870	293
1023	3300046477	Ga0495664_0001749	Ga0495664_0001749_5126_6058	293
1024	3300046477	Ga0495664_0058694	Ga0495664_0058694_777_1694	293
1025	3300046511	Ga0495608_0047001	Ga0495608_0047001_1145_2062	293
1026	3300046514	Ga0495618_0003129	Ga0495618_0003129_1515_2432	293
1027	3300046514	Ga0495618_0017003	Ga0495618_0017003_1600_2532	293
1028	3300046514	Ga0495618_0042192	Ga0495618_0042192_591_1508	293
1029	3300046517	Ga0495630_0006270	Ga0495630_0006270_4213_5130	293
1030	3300046517	Ga0495630_0006647	Ga0495630_0006647_5323_6240	293
1031	3300046517	Ga0495630_0306572	Ga0495630_0306572_276_1193	293
1032	3300046526	Ga0495666_0082709	Ga0495666_0082709_365_1282	293
1033	3300046529	Ga0495652_0039277	Ga0495652_0039277_41_958	293
1034	3300046529	Ga0495652_0045086	Ga0495652_0045086_247_1164	293
1035	3300046531	Ga0495665_0007768	Ga0495665_0007768_1388_2305	293
1036	3300046533	Ga0495640_0003109	Ga0495640_0003109_3257_4174	293
1037	3300046533	Ga0495640_0031847	Ga0495640_0031847_206_1123	293
1038	3300046535	Ga0495586_0069338	Ga0495586_0069338_501_1418	293
1039	3300046536	Ga0495587_0019162	Ga0495587_0019162_2936_3853	293
1040	3300046536	Ga0495587_0084942	Ga0495587_0084942_752_1681	293
1041	3300046543	Ga0495645_0033928	Ga0495645_0033928_2190_3107	293
1042	3300046642	Ga0495634_0008957	Ga0495634_0008957_1235_2152	293
1043	3300046642	Ga0495634_0012202	Ga0495634_0012202_634_1566	293
1044	3300046663	Ga0495635_0000698	Ga0495635_0000698_9292_10224	293
1045	3300046675	Ga0495657_0047431	Ga0495657_0047431_1378_2328	293
1046	3300046675	Ga0495657_0104569	Ga0495657_0104569_215_1144	293
1047	3300046678	Ga0495599_0001065	Ga0495599_0001065_2349_3266	293
1048	3300046679	Ga0495623_0074400	Ga0495623_0074400_1064_1981	293
1049	3300046680	Ga0495646_0072968	Ga0495646_0072968_1009_1926	293
1050	3300046680	Ga0495646_0180657	Ga0495646_0180657_200_1132	293
1051	3300046681	Ga0495647_0041429	Ga0495647_0041429_541_1458	293
1052	3300046689	Ga0495613_0019496	Ga0495613_0019496_3022_3939	293
1053	3300046690	Ga0495624_0069662	Ga0495624_0069662_469_1401	293
1054	3300046809	Ga0495600_0194164	Ga0495600_0194164_187_1104	293
1055	3300046809	Ga0495600_0213374	Ga0495600_0213374_112_1029	293
1056	3300047315	Ga0495581_0003599	Ga0495581_0003599_2887_3804	293
1057	3300047317	Ga0495604_0046618	Ga0495604_0046618_795_1712	293
1058	3300047319	Ga0495674_0002024	Ga0495674_0002024_6640_7572	293
1059	3300047319	Ga0495674_0004086	Ga0495674_0004086_4306_5223	293
1060	3300047319	Ga0495674_0081812	Ga0495674_0081812_339_1256	293
1061	3300047321	Ga0495676_0006632	Ga0495676_0006632_6779_7711	293
1062	3300047322	Ga0495680_0029410	Ga0495680_0029410_763_1695	293
1063	3300047322	Ga0495680_0073977	Ga0495680_0073977_955_1884	293
1064	3300047322	Ga0495680_0107090	Ga0495680_0107090_521_1438	293
1065	3300047471	Ga0495684_0001943	Ga0495684_0001943_10381_11313	293
1066	3300047471	Ga0495684_0007401	Ga0495684_0007401_3748_4665	293
1067	3300047471	Ga0495684_0011491	Ga0495684_0011491_2604_3521	293
1068	3300047471	Ga0495684_0135724	Ga0495684_0135724_615_1532	293
1069	3300047673	Ga0495593_0034795	Ga0495593_0034795_920_1837	293
1070	3300048088	Ga0495602_0143874	Ga0495602_0143874_224_1153	293
1071	3300048088	Ga0495602_0218018	Ga0495602_0218018_302_1219	293
1072	3300048904	Ga0496101_0003301	Ga0496101_0003301_8094_8981	293
1073	3300048905	Ga0496102_0138415	Ga0496102_0138415_618_1505	293
1074	3300048907	Ga0496104_0016626	Ga0496104_0016626_90_977	293
1075	3300048908	Ga0496105_0020513	Ga0496105_0020513_4373_5260	293
1076	3300048909	Ga0496106_0025932	Ga0496106_0025932_2333_3220	293
1077	3300048910	Ga0496107_0211681	Ga0496107_0211681_115_1002	293
1078	3300048911	Ga0496108_0046267	Ga0496108_0046267_2632_3519	293
1079	3300048911	Ga0496108_0124734	Ga0496108_0124734_1187_2074	293
1080	3300048912	Ga0496109_0002157	Ga0496109_0002157_12502_13404	293
1081	3300048912	Ga0496109_0040197	Ga0496109_0040197_2450_3337	293
1082	3300048912	Ga0496109_0262867	Ga0496109_0262867_57_944	293
1083	3300048913	Ga0496110_0000935	Ga0496110_0000935_12207_13094	293
1084	3300048913	Ga0496110_0018818	Ga0496110_0018818_93_980	293
1085	3300048914	Ga0496111_0019470	Ga0496111_0019470_1577_2464	293
1086	3300048914	Ga0496111_0265457	Ga0496111_0265457_276_1163	293
1087	3300048915	Ga0496112_0022543	Ga0496112_0022543_415_1302	293
1088	3300048915	Ga0496112_0071174	Ga0496112_0071174_100_987	293
1089	3300048916	Ga0496113_0003554	Ga0496113_0003554_8067_8954	293
1090	3300048918	Ga0496115_0016550	Ga0496115_0016550_2092_2979	293
1091	3300048927	Ga0496124_0001752	Ga0496124_0001752_24202_25083	293
1092	3300048928	Ga0496125_0221914	Ga0496125_0221914_173_1054	293
1093	3300048929	Ga0496126_0000626	Ga0496126_0000626_24835_25716	293
1094	3300049572	Ga0501036_0205022	Ga0501036_0205022_575_1462	293
1095	3300049578	Ga0501042_0138305	Ga0501042_0138305_553_1440	293
1096	3300049583	Ga0501067_0043519	Ga0501067_0043519_328_1215	293
1097	3300049591	Ga0501075_0053730	Ga0501075_0053730_1025_1912	293
1098	3300049592	Ga0501076_0056479	Ga0501076_0056479_1322_2209	293
1099	3300049593	Ga0501077_0057505	Ga0501077_0057505_446_1333	293
1100	3300049593	Ga0501077_0111021	Ga0501077_0111021_708_1628	293
1101	3300049741	Ga0501079_0029184	Ga0501079_0029184_1843_2730	293
1102	3300049824	Ga0501045_0011145	Ga0501045_0011145_189_1076	293
1103	3300053077	Ga0495601_0001015	Ga0495601_0001015_7605_8522	293
1104	3300053077	Ga0495601_0048678	Ga0495601_0048678_674_1591	293
1105	3300053078	Ga0495612_0000970	Ga0495612_0000970_9781_10698	293
1106	3300053078	Ga0495612_0077534	Ga0495612_0077534_63_980	293
1107	3300053085	Ga0495619_0001492	Ga0495619_0001492_2682_3599	293
1108	3300054114	Ga0501084_0048259	Ga0501084_0048259_1856_2743	293
1109	3300060353	Ga0501082_0121380	Ga0501082_0121380_618_1505	293
1110	3300061734	Ga0530510_0089770	Ga0530510_0089770_841_1728	293
1111	3300005327	Ga0070658_10036578	Ga0070658_100365784	294
1112	3300005330	Ga0070690_100008196	Ga0070690_1000081966	294
1113	3300005334	Ga0068869_100213635	Ga0068869_1002136352	294
1114	3300005338	Ga0068868_100172222	Ga0068868_1001722222	294
1115	3300005344	Ga0070661_100070306	Ga0070661_1000703062	294
1116	3300005355	Ga0070671_100003039	Ga0070671_1000030396	294
1117	3300005355	Ga0070671_100270612	Ga0070671_1002706122	294
1118	3300005365	Ga0070688_100059685	Ga0070688_1000596853	294
1119	3300005466	Ga0070685_10009401	Ga0070685_100094012	294
1120	3300005518	Ga0070699_100100802	Ga0070699_1001008022	294
1121	3300005518	Ga0070699_100130659	Ga0070699_1001306591	294
1122	3300005530	Ga0070679_100115569	Ga0070679_1001155691	294
1123	3300005535	Ga0070684_100005531	Ga0070684_1000055317	294
1124	3300005535	Ga0070684_100017815	Ga0070684_1000178153	294
1125	3300005549	Ga0070704_100300551	Ga0070704_1003005511	294
1126	3300005577	Ga0068857_100079277	Ga0068857_1000792772	294
1127	3300005614	Ga0068856_100531570	Ga0068856_1005315702	294
1128	3300005616	Ga0068852_100017745	Ga0068852_1000177453	294
1129	3300006175	Ga0070712_100135658	Ga0070712_1001356582	294
1130	3300006237	Ga0097621_100037588	Ga0097621_1000375883	294
1131	3300006844	Ga0075428_100105880	Ga0075428_1001058803	294
1132	3300006844	Ga0075428_100362249	Ga0075428_1003622491	294
1133	3300006852	Ga0075433_10024440	Ga0075433_100244404	294
1134	3300006852	Ga0075433_10094679	Ga0075433_100946792	294
1135	3300006871	Ga0075434_100019632	Ga0075434_1000196325	294
1136	3300006871	Ga0075434_100102372	Ga0075434_1001023722	294
1137	3300006881	Ga0068865_100071219	Ga0068865_1000712192	294
1138	3300006914	Ga0075436_100023308	Ga0075436_1000233082	294
1139	3300006946	Ga0079104_1012039	Ga0079104_10120394	294
1140	3300009094	Ga0111539_10021993	Ga0111539_100219935	294
1141	3300009098	Ga0105245_10047939	Ga0105245_100479393	294
1142	3300009147	Ga0114129_10204176	Ga0114129_102041763	294
1143	3300009147	Ga0114129_10891292	Ga0114129_108912922	294
1144	3300009174	Ga0105241_10012343	Ga0105241_100123433	294
1145	3300009177	Ga0105248_10043640	Ga0105248_100436402	294
1146	3300009545	Ga0105237_10281938	Ga0105237_102819382	294
1147	3300009551	Ga0105238_10046429	Ga0105238_100464292	294
1148	3300011119	Ga0105246_10010692	Ga0105246_100106924	294
1149	3300013102	Ga0157371_10124214	Ga0157371_101242143	294
1150	3300013102	Ga0157371_10350196	Ga0157371_103501962	294
1151	3300013296	Ga0157374_10476080	Ga0157374_104760802	294
1152	3300013297	Ga0157378_10406067	Ga0157378_104060672	294
1153	3300013306	Ga0163162_10136689	Ga0163162_101366892	294
1154	3300013308	Ga0157375_10088135	Ga0157375_100881352	294
1155	3300014326	Ga0157380_10242254	Ga0157380_102422542	294
1156	3300014745	Ga0157377_10002806	Ga0157377_100028067	294
1157	3300015261	Ga0182006_1000013	Ga0182006_100001333	294
1158	3300025909	Ga0207705_10108018	Ga0207705_101080182	294
1159	3300025911	Ga0207654_10057400	Ga0207654_100574002	294
1160	3300025917	Ga0207660_10351290	Ga0207660_103512902	294
1161	3300025918	Ga0207662_10087248	Ga0207662_100872482	294
1162	3300025921	Ga0207652_10046710	Ga0207652_100467102	294
1163	3300025924	Ga0207694_10041321	Ga0207694_100413213	294
1164	3300025931	Ga0207644_10004600	Ga0207644_100046006	294
1165	3300025936	Ga0207670_10108889	Ga0207670_101088892	294
1166	3300025938	Ga0207704_10175266	Ga0207704_101752662	294
1167	3300025941	Ga0207711_10109629	Ga0207711_101096291	294
1168	3300025945	Ga0207679_10157957	Ga0207679_101579571	294
1169	3300026023	Ga0207677_10033723	Ga0207677_100337232	294
1170	3300026116	Ga0207674_10053223	Ga0207674_100532235	294
1171	3300027111	Ga0209281_1004375	Ga0209281_10043755	294
1172	3300027907	Ga0207428_10129900	Ga0207428_101299002	294
1173	3300028556	Ga0265337_1019844	Ga0265337_10198442	294
1174	3300028558	Ga0265326_10030280	Ga0265326_100302801	294
1175	3300028563	Ga0265319_1000005	Ga0265319_1000005235	294
1176	3300028573	Ga0265334_10019422	Ga0265334_100194224	294
1177	3300028577	Ga0265318_10051783	Ga0265318_100517832	294
1178	3300028800	Ga0265338_10002835	Ga0265338_100028359	294
1179	3300028800	Ga0265338_10053536	Ga0265338_100535362	294
1180	3300028800	Ga0265338_10059947	Ga0265338_100599472	294
1181	3300028800	Ga0265338_10075109	Ga0265338_100751092	294
1182	3300029957	Ga0265324_10001347	Ga0265324_100013479	294
1183	3300031235	Ga0265330_10038832	Ga0265330_100388322	294
1184	3300031235	Ga0265330_10062490	Ga0265330_100624901	294
1185	3300031241	Ga0265325_10020477	Ga0265325_100204772	294
1186	3300031249	Ga0265339_10000059	Ga0265339_1000005932	294
1187	3300031249	Ga0265339_10010108	Ga0265339_100101085	294
1188	3300031595	Ga0265313_10055984	Ga0265313_100559843	294
1189	3300031711	Ga0265314_10059290	Ga0265314_100592902	294
1190	3300031712	Ga0265342_10125931	Ga0265342_101259311	294
1191	3300032126	Ga0307415_100112697	Ga0307415_1001126971	294
1192	3300032126	Ga0307415_100531716	Ga0307415_1005317161	294
1193	3300033541	Ga0316596_1020515	Ga0316596_10205152	294
1194	3300036647	Ga0316582_0090920	Ga0316582_0090920_867_1754	294
1195	3300037312	Ga0395899_0304722	Ga0395899_0304722_43_930	294
1196	3300037418	Ga0395900_0182218	Ga0395900_0182218_372_1259	294
1197	3300037466	Ga0395898_0003228	Ga0395898_0003228_9230_10123	294
1198	3300037466	Ga0395898_0516760	Ga0395898_0516760_136_1023	294
1199	3300037471	Ga0395905_0060164	Ga0395905_0060164_972_1859	294
1200	3300038443	Ga0395901_0011031	Ga0395901_0011031_5722_6615	294
1201	3300038443	Ga0395901_0013249	Ga0395901_0013249_740_1627	294
1202	3300038443	Ga0395901_0151391	Ga0395901_0151391_741_1628	294
1203	3300039437	Ga0436365_1883742	Ga0436365_1883742_1248_2135	294
1204	3300039438	Ga0436360_0751380	Ga0436360_0751380_726_1613	294
1205	3300044693	Ga0466961_0059566	Ga0466961_0059566_72_959	294
1206	3300044694	Ga0466963_0001796	Ga0466963_0001796_5530_6423	294
1207	3300044694	Ga0466963_0014075	Ga0466963_0014075_413_1300	294
1208	3300044694	Ga0466963_0043490	Ga0466963_0043490_171_1058	294
1209	3300044694	Ga0466963_0083874	Ga0466963_0083874_990_1919	294
1210	3300044842	Ga0466957_0008496	Ga0466957_0008496_3253_4140	294
1211	3300045051	Ga0451576_0411436	Ga0451576_0411436_265_1179	294
1212	3300045836	Ga0466958_0002957	Ga0466958_0002957_4550_5443	294
1213	3300045976	Ga0466967_0002751	Ga0466967_0002751_4348_5241	294
1214	3300046506	Ga0495583_0011685	Ga0495583_0011685_1382_2278	294
1215	3300046511	Ga0495608_0120985	Ga0495608_0120985_557_1450	294
1216	3300046533	Ga0495640_0237663	Ga0495640_0237663_234_1127	294
1217	3300046559	Ga0495667_0143313	Ga0495667_0143313_375_1268	294
1218	3300047320	Ga0495672_0073481	Ga0495672_0073481_216_1109	294
1219	3300047322	Ga0495680_0088309	Ga0495680_0088309_1275_2168	294
1220	3300048903	Ga0496100_0037263	Ga0496100_0037263_331_1218	294
1221	3300048903	Ga0496100_0133114	Ga0496100_0133114_794_1690	294
1222	3300048904	Ga0496101_0005337	Ga0496101_0005337_5001_5888	294
1223	3300048904	Ga0496101_0058507	Ga0496101_0058507_1290_2186	294
1224	3300048909	Ga0496106_0026132	Ga0496106_0026132_2688_3575	294
1225	3300048910	Ga0496107_0006945	Ga0496107_0006945_1629_2516	294
1226	3300048912	Ga0496109_0125376	Ga0496109_0125376_725_1621	294
1227	3300048913	Ga0496110_0101971	Ga0496110_0101971_1102_1998	294
1228	3300048915	Ga0496112_0093208	Ga0496112_0093208_602_1501	294
1229	3300048917	Ga0496114_0061949	Ga0496114_0061949_1633_2529	294
1230	3300048924	Ga0496121_0031965	Ga0496121_0031965_3844_4728	294
1231	3300048925	Ga0496122_0098094	Ga0496122_0098094_841_1731	294
1232	3300048928	Ga0496125_0023482	Ga0496125_0023482_1261_2151	294
1233	3300049581	Ga0501047_0098526	Ga0501047_0098526_1161_2054	294
1234	3300049583	Ga0501067_0011209	Ga0501067_0011209_1412_2317	294
1235	3300049584	Ga0501068_0211508	Ga0501068_0211508_264_1151	294
1236	3300049585	Ga0501069_0056764	Ga0501069_0056764_492_1397	294
1237	3300050511	nmdc:mga08y16_34782_c1	nmdc:mga08y16_34782_c1_4020_4907	294
1238	3300050512	nmdc:mga0n895_120411_c1	nmdc:mga0n895_120411_c1_344_1240	294
1239	3300050512	nmdc:mga0n895_67230_c1	nmdc:mga0n895_67230_c1_551_1438	294
1240	3300050513	nmdc:mga0rr50_61869_c1	nmdc:mga0rr50_61869_c1_536_1432	294
1241	3300050514	nmdc:mga08x19_143221_c1	nmdc:mga08x19_143221_c1_126_1022	294
1242	3300050515	nmdc:mga0a205_87562_c1	nmdc:mga0a205_87562_c1_1928_2815	294
1243	3300053139	Ga0500568_0032871	Ga0500568_0032871_393_1286	294
1244	3300053146	Ga0500588_0001254	Ga0500588_0001254_2955_3848	294
1245	3300053156	Ga0500622_0006578	Ga0500622_0006578_4031_4924	294
1246	3300053156	Ga0500622_0018536	Ga0500622_0018536_2079_2972	294
1247	3300061719	Ga0466962_0002966	Ga0466962_0002966_4013_4900	294
1248	2010549000	RicEn_C4876	RicEn_86990	295
1249	2162886007	SwRhRL2b_contig_457441	SwRhRL2b_0425.00004270	295
1250	2162886007	SwRhRL2b_contig_527301	SwRhRL2b_0922.00005130	295
1251	3300003320	rootH2_10011647	rootH2_100116477	295
1252	3300003320	rootH2_10015631	rootH2_100156315	295
1253	3300003856	Ga0058692_1000148	Ga0058692_100014846	295
1254	3300005289	Ga0065704_10000295	Ga0065704_1000029527	295
1255	3300005289	Ga0065704_10001559	Ga0065704_100015594	295
1256	3300005289	Ga0065704_10002256	Ga0065704_100022568	295
1257	3300005347	Ga0070668_100216824	Ga0070668_1002168242	295
1258	3300005366	Ga0070659_100043369	Ga0070659_1000433693	295
1259	3300005439	Ga0070711_100057844	Ga0070711_1000578443	295
1260	3300005444	Ga0070694_100015175	Ga0070694_1000151753	295
1261	3300005445	Ga0070708_100004192	Ga0070708_1000041927	295
1262	3300005467	Ga0070706_100284741	Ga0070706_1002847412	295
1263	3300005468	Ga0070707_100040320	Ga0070707_1000403202	295
1264	3300005471	Ga0070698_100157269	Ga0070698_1001572692	295
1265	3300005518	Ga0070699_100005111	Ga0070699_1000051112	295
1266	3300005536	Ga0070697_100019523	Ga0070697_1000195232	295
1267	3300005544	Ga0070686_100273019	Ga0070686_1002730191	295
1268	3300005548	Ga0070665_100000241	Ga0070665_10000024138	295
1269	3300005548	Ga0070665_100018019	Ga0070665_1000180193	295
1270	3300005577	Ga0068857_100002076	Ga0068857_1000020768	295
1271	3300005617	Ga0068859_100008381	Ga0068859_1000083812	295
1272	3300005842	Ga0068858_100151607	Ga0068858_1001516073	295
1273	3300006028	Ga0070717_10028626	Ga0070717_100286263	295
1274	3300006051	Ga0075364_10006907	Ga0075364_100069075	295
1275	3300006051	Ga0075364_10029463	Ga0075364_100294633	295
1276	3300006058	Ga0075432_10034965	Ga0075432_100349652	295
1277	3300006846	Ga0075430_100263897	Ga0075430_1002638972	295
1278	3300006852	Ga0075433_10285358	Ga0075433_102853582	295
1279	3300006914	Ga0075436_100004521	Ga0075436_10000452110	295
1280	3300006931	Ga0097620_100008381	Ga0097620_10000838111	295
1281	3300006946	Ga0079104_1000967	Ga0079104_10009674	295
1282	3300006946	Ga0079104_1001132	Ga0079104_10011326	295
1283	3300006946	Ga0079104_1002316	Ga0079104_10023165	295
1284	3300007076	Ga0075435_100383380	Ga0075435_1003833802	295
1285	3300009011	Ga0105251_10000696	Ga0105251_1000069629	295
1286	3300009011	Ga0105251_10005130	Ga0105251_1000513010	295
1287	3300009011	Ga0105251_10009921	Ga0105251_100099213	295
1288	3300009011	Ga0105251_10011473	Ga0105251_100114736	295
1289	3300009011	Ga0105251_10018360	Ga0105251_100183601	295
1290	3300009011	Ga0105251_10018610	Ga0105251_100186102	295
1291	3300009011	Ga0105251_10022835	Ga0105251_100228354	295
1292	3300009036	Ga0105244_10000153	Ga0105244_1000015327	295
1293	3300009036	Ga0105244_10001213	Ga0105244_100012138	295
1294	3300009036	Ga0105244_10004024	Ga0105244_100040248	295
1295	3300009036	Ga0105244_10010220	Ga0105244_100102205	295
1296	3300009036	Ga0105244_10024031	Ga0105244_100240314	295
1297	3300009036	Ga0105244_10172425	Ga0105244_101724252	295
1298	3300009092	Ga0105250_10000148	Ga0105250_1000014830	295
1299	3300009092	Ga0105250_10001720	Ga0105250_100017208	295
1300	3300009092	Ga0105250_10002795	Ga0105250_100027957	295
1301	3300009094	Ga0111539_10359909	Ga0111539_103599092	295
1302	3300009148	Ga0105243_10003041	Ga0105243_1000304110	295
1303	3300009148	Ga0105243_10318808	Ga0105243_103188082	295
1304	3300009177	Ga0105248_10448329	Ga0105248_104483292	295
1305	3300009551	Ga0105238_10327496	Ga0105238_103274962	295
1306	3300010375	Ga0105239_10909844	Ga0105239_109098441	295
1307	3300013100	Ga0157373_10125147	Ga0157373_101251472	295
1308	3300013102	Ga0157371_10262460	Ga0157371_102624602	295
1309	3300013104	Ga0157370_10003857	Ga0157370_100038576	295
1310	3300013296	Ga0157374_10337629	Ga0157374_103376292	295
1311	3300013297	Ga0157378_10001441	Ga0157378_1000144111	295
1312	3300014325	Ga0163163_10267317	Ga0163163_102673172	295
1313	3300015679	Ga0183366_1002	Ga0183366_1002588	295
1314	3300015680	Ga0183370_1002	Ga0183370_1002588	295
1315	3300015685	Ga0183369_1002	Ga0183369_1002588	295
1316	3300015687	Ga0183368_1005	Ga0183368_1005588	295
1317	3300021384	Ga0213876_10000013	Ga0213876_10000013163	295
1318	3300021384	Ga0213876_10087727	Ga0213876_100877272	295
1319	3300025321	Ga0207656_10106254	Ga0207656_101062541	295
1320	3300025711	Ga0207696_1000183	Ga0207696_100018330	295
1321	3300025711	Ga0207696_1000748	Ga0207696_100074817	295
1322	3300025711	Ga0207696_1003827	Ga0207696_10038274	295
1323	3300025711	Ga0207696_1004017	Ga0207696_10040172	295
1324	3300025728	Ga0207655_1000050	Ga0207655_10000507	295
1325	3300025728	Ga0207655_1000065	Ga0207655_1000065192	295
1326	3300025728	Ga0207655_1000318	Ga0207655_100031837	295
1327	3300025728	Ga0207655_1005664	Ga0207655_10056643	295
1328	3300025728	Ga0207655_1019560	Ga0207655_10195602	295
1329	3300025728	Ga0207655_1021241	Ga0207655_10212414	295
1330	3300025728	Ga0207655_1038355	Ga0207655_10383552	295
1331	3300025735	Ga0207713_1000019	Ga0207713_1000019185	295
1332	3300025735	Ga0207713_1000076	Ga0207713_100007629	295
1333	3300025735	Ga0207713_1000258	Ga0207713_100025834	295
1334	3300025735	Ga0207713_1002075	Ga0207713_10020759	295
1335	3300025735	Ga0207713_1002269	Ga0207713_10022696	295
1336	3300025735	Ga0207713_1007641	Ga0207713_10076412	295
1337	3300025735	Ga0207713_1084737	Ga0207713_10847372	295
1338	3300025907	Ga0207645_10122307	Ga0207645_101223072	295
1339	3300025910	Ga0207684_10007123	Ga0207684_100071233	295
1340	3300025912	Ga0207707_10125956	Ga0207707_101259562	295
1341	3300025916	Ga0207663_10041232	Ga0207663_100412322	295
1342	3300025922	Ga0207646_10022346	Ga0207646_100223465	295
1343	3300025932	Ga0207690_10084718	Ga0207690_100847182	295
1344	3300025935	Ga0207709_10001887	Ga0207709_100018872	295
1345	3300025935	Ga0207709_10086746	Ga0207709_100867462	295
1346	3300025937	Ga0207669_10154303	Ga0207669_101543032	295
1347	3300025940	Ga0207691_10402899	Ga0207691_104028991	295
1348	3300025941	Ga0207711_10360981	Ga0207711_103609812	295
1349	3300026116	Ga0207674_10000913	Ga0207674_100009138	295
1350	3300027111	Ga0209281_1000025	Ga0209281_1000025186	295
1351	3300027111	Ga0209281_1000060	Ga0209281_1000060256	295
1352	3300027111	Ga0209281_1000283	Ga0209281_100028342	295
1353	3300027111	Ga0209281_1000818	Ga0209281_10008189	295
1354	3300027111	Ga0209281_1001344	Ga0209281_10013447	295
1355	3300027111	Ga0209281_1001705	Ga0209281_10017054	295
1356	3300027312	Ga0209371_1000013	Ga0209371_1000013497	295
1357	3300027312	Ga0209371_1000101	Ga0209371_100010135	295
1358	3300027312	Ga0209371_1000876	Ga0209371_100087612	295
1359	3300027312	Ga0209371_1001044	Ga0209371_100104417	295
1360	3300027312	Ga0209371_1002764	Ga0209371_10027647	295
1361	3300028379	Ga0268266_10000041	Ga0268266_10000041277	295
1362	3300028379	Ga0268266_10058709	Ga0268266_100587092	295
1363	3300028556	Ga0265337_1000447	Ga0265337_10004474	295
1364	3300028556	Ga0265337_1006329	Ga0265337_10063295	295
1365	3300028556	Ga0265337_1011664	Ga0265337_10116643	295
1366	3300028653	Ga0265323_10010786	Ga0265323_100107862	295
1367	3300028654	Ga0265322_10037581	Ga0265322_100375811	295
1368	3300028800	Ga0265338_10008621	Ga0265338_100086213	295
1369	3300028800	Ga0265338_10040471	Ga0265338_100404714	295
1370	3300028800	Ga0265338_10136652	Ga0265338_101366521	295
1371	3300030500	Ga0268256_1000014	Ga0268256_1000014181	295
1372	3300030500	Ga0268256_1000029	Ga0268256_1000029439	295
1373	3300030500	Ga0268256_1000736	Ga0268256_100073610	295
1374	3300030500	Ga0268256_1000897	Ga0268256_100089717	295
1375	3300030500	Ga0268256_1002470	Ga0268256_10024707	295
1376	3300030500	Ga0268256_1013041	Ga0268256_10130413	295
1377	3300031235	Ga0265330_10002259	Ga0265330_100022592	295
1378	3300031235	Ga0265330_10019762	Ga0265330_100197623	295
1379	3300031241	Ga0265325_10072044	Ga0265325_100720442	295
1380	3300031242	Ga0265329_10000055	Ga0265329_1000005514	295
1381	3300031249	Ga0265339_10009276	Ga0265339_100092762	295
1382	3300031249	Ga0265339_10078044	Ga0265339_100780442	295
1383	3300031250	Ga0265331_10015784	Ga0265331_100157842	295
1384	3300031344	Ga0265316_10000165	Ga0265316_100001654	295
1385	3300031344	Ga0265316_10047102	Ga0265316_100471024	295
1386	3300031595	Ga0265313_10044351	Ga0265313_100443512	295
1387	3300031711	Ga0265314_10004314	Ga0265314_100043147	295
1388	3300031711	Ga0265314_10006774	Ga0265314_1000677411	295
1389	3300031711	Ga0265314_10037960	Ga0265314_100379602	295
1390	3300031712	Ga0265342_10000121	Ga0265342_1000012160	295
1391	3300031712	Ga0265342_10005473	Ga0265342_100054733	295
1392	3300031712	Ga0265342_10005764	Ga0265342_100057648	295
1393	3300031727	Ga0316576_10039969	Ga0316576_100399693	295
1394	3300031728	Ga0316578_10188063	Ga0316578_101880631	295
1395	3300031733	Ga0316577_10267362	Ga0316577_102673621	295
1396	3300035083	Ga0373926_0061285	Ga0373926_0061285_285_1175	295
1397	3300035116	Ga0373945_0035622	Ga0373945_0035622_440_1330	295
1398	3300035171	Ga0373946_0130310	Ga0373946_0130310_46_936	295
1399	3300035695	Ga0373927_0049728	Ga0373927_0049728_870_1760	295
1400	3300036401	Ga0373937_0286986	Ga0373937_0286986_490_1392	295
1401	3300036647	Ga0316582_0079180	Ga0316582_0079180_869_1759	295
1402	3300037068	Ga0373925_0004656	Ga0373925_0004656_5517_6407	295
1403	3300037853	Ga0436364_0454602	Ga0436364_0454602_92_1015	295
1404	3300037853	Ga0436364_0690088	Ga0436364_0690088_808_1707	295
1405	3300039093	Ga0400489_96005	Ga0400489_96005_183_1082	295
1406	3300039437	Ga0436365_0471682	Ga0436365_0471682_169292_170179	295
1407	3300039437	Ga0436365_1419208	Ga0436365_1419208_567_1466	295
1408	3300041405	Ga0439438_010104	Ga0439438_010104_1913_2800	295
1409	3300041512	Ga0451853_0276144	Ga0451853_0276144_768_1655	295
1410	3300042010	Ga0439452_000011	Ga0439452_000011_193196_194083	295
1411	3300042010	Ga0439452_000191	Ga0439452_000191_12632_13519	295
1412	3300042010	Ga0439452_001085	Ga0439452_001085_50_937	295
1413	3300042876	Ga0451577_0039649	Ga0451577_0039649_3312_4208	295
1414	3300044669	Ga0466981_0000001	Ga0466981_0000001_291916_292803	295
1415	3300044712	Ga0453684_0053387	Ga0453684_0053387_1431_2327	295
1416	3300046455	Ga0495603_0062367	Ga0495603_0062367_90_980	295
1417	3300046458	Ga0495591_000202	Ga0495591_000202_22237_23124	295
1418	3300046458	Ga0495591_005725	Ga0495591_005725_4744_5631	295
1419	3300046459	Ga0495629_0000003	Ga0495629_0000003_350048_350938	295
1420	3300046463	Ga0495653_0004864	Ga0495653_0004864_4565_5455	295
1421	3300046471	Ga0495650_0000040	Ga0495650_0000040_195282_196169	295
1422	3300046475	Ga0495639_0000498	Ga0495639_0000498_4385_5275	295
1423	3300046514	Ga0495618_0068672	Ga0495618_0068672_1040_1930	295
1424	3300046526	Ga0495666_0000097	Ga0495666_0000097_29971_30861	295
1425	3300046530	Ga0495654_0019199	Ga0495654_0019199_2591_3481	295
1426	3300046533	Ga0495640_0086368	Ga0495640_0086368_380_1270	295
1427	3300046535	Ga0495586_0001396	Ga0495586_0001396_7712_8602	295
1428	3300046542	Ga0495597_0001264	Ga0495597_0001264_6839_7729	295
1429	3300046557	Ga0495622_0009559	Ga0495622_0009559_2384_3274	295
1430	3300046559	Ga0495667_0089424	Ga0495667_0089424_297_1208	295
1431	3300046663	Ga0495635_0002396	Ga0495635_0002396_5948_6838	295
1432	3300046674	Ga0495588_0015114	Ga0495588_0015114_2632_3522	295
1433	3300046689	Ga0495613_0056812	Ga0495613_0056812_207_1097	295
1434	3300046694	Ga0495649_0000130	Ga0495649_0000130_50706_51593	295
1435	3300046694	Ga0495649_0006193	Ga0495649_0006193_4872_5759	295
1436	3300046809	Ga0495600_0004325	Ga0495600_0004325_205_1095	295
1437	3300047315	Ga0495581_0008719	Ga0495581_0008719_694_1584	295
1438	3300047320	Ga0495672_0000051	Ga0495672_0000051_229360_230250	295
1439	3300047321	Ga0495676_0002235	Ga0495676_0002235_11641_12531	295
1440	3300047322	Ga0495680_0003108	Ga0495680_0003108_6717_7607	295
1441	3300047469	Ga0495673_0000055	Ga0495673_0000055_49345_50244	295
1442	3300047470	Ga0495681_0061767	Ga0495681_0061767_346_1236	295
1443	3300047471	Ga0495684_0002838	Ga0495684_0002838_6206_7096	295
1444	3300048907	Ga0496104_0000142	Ga0496104_0000142_37694_38581	295
1445	3300048919	Ga0496116_0001554	Ga0496116_0001554_20768_21655	295
1446	3300048919	Ga0496116_0017049	Ga0496116_0017049_468_1355	295
1447	3300048919	Ga0496116_0022687	Ga0496116_0022687_1322_2209	295
1448	3300048920	Ga0496117_0000267	Ga0496117_0000267_30509_31396	295
1449	3300048920	Ga0496117_0001864	Ga0496117_0001864_27074_27961	295
1450	3300048920	Ga0496117_0011678	Ga0496117_0011678_3569_4456	295
1451	3300048920	Ga0496117_0018619	Ga0496117_0018619_2203_3090	295
1452	3300048920	Ga0496117_0091292	Ga0496117_0091292_561_1448	295
1453	3300048920	Ga0496117_0103220	Ga0496117_0103220_492_1379	295
1454	3300048921	Ga0496118_0000238	Ga0496118_0000238_22723_23610	295
1455	3300048921	Ga0496118_0004021	Ga0496118_0004021_3899_4786	295
1456	3300048921	Ga0496118_0034109	Ga0496118_0034109_2861_3748	295
1457	3300048921	Ga0496118_0084003	Ga0496118_0084003_924_1811	295
1458	3300048921	Ga0496118_0190175	Ga0496118_0190175_276_1163	295
1459	3300048921	Ga0496118_0218870	Ga0496118_0218870_11_976	295
1460	3300048922	Ga0496119_0000438	Ga0496119_0000438_4628_5515	295
1461	3300048922	Ga0496119_0005383	Ga0496119_0005383_11370_12257	295
1462	3300048922	Ga0496119_0016375	Ga0496119_0016375_4416_5303	295
1463	3300048922	Ga0496119_0054374	Ga0496119_0054374_30_917	295
1464	3300048922	Ga0496119_0064575	Ga0496119_0064575_732_1625	295
1465	3300048923	Ga0496120_0005047	Ga0496120_0005047_8750_9643	295
1466	3300048923	Ga0496120_0005098	Ga0496120_0005098_6136_7023	295
1467	3300048923	Ga0496120_0006515	Ga0496120_0006515_7493_8380	295
1468	3300048924	Ga0496121_0002164	Ga0496121_0002164_17594_18481	295
1469	3300048924	Ga0496121_0003719	Ga0496121_0003719_17812_18699	295
1470	3300048924	Ga0496121_0015662	Ga0496121_0015662_5790_6677	295
1471	3300048924	Ga0496121_0039378	Ga0496121_0039378_375_1262	295
1472	3300048924	Ga0496121_0057989	Ga0496121_0057989_441_1358	295
1473	3300048925	Ga0496122_0000016	Ga0496122_0000016_372838_373725	295
1474	3300048925	Ga0496122_0000704	Ga0496122_0000704_64640_65527	295
1475	3300048925	Ga0496122_0001356	Ga0496122_0001356_569_1456	295
1476	3300048925	Ga0496122_0002447	Ga0496122_0002447_1023_1910	295
1477	3300048925	Ga0496122_0235335	Ga0496122_0235335_74_961	295
1478	3300048926	Ga0496123_0000017	Ga0496123_0000017_115753_116640	295
1479	3300048926	Ga0496123_0000195	Ga0496123_0000195_67459_68346	295
1480	3300048926	Ga0496123_0001123	Ga0496123_0001123_569_1456	295
1481	3300048926	Ga0496123_0002091	Ga0496123_0002091_9562_10449	295
1482	3300048926	Ga0496123_0003100	Ga0496123_0003100_12533_13420	295
1483	3300048926	Ga0496123_0029613	Ga0496123_0029613_74_961	295
1484	3300048926	Ga0496123_0179226	Ga0496123_0179226_148_1035	295
1485	3300048927	Ga0496124_0000618	Ga0496124_0000618_31100_31987	295
1486	3300048927	Ga0496124_0040713	Ga0496124_0040713_3084_3971	295
1487	3300048927	Ga0496124_0053564	Ga0496124_0053564_499_1386	295
1488	3300048927	Ga0496124_0056316	Ga0496124_0056316_1855_2742	295
1489	3300048927	Ga0496124_0192553	Ga0496124_0192553_618_1505	295
1490	3300048927	Ga0496124_0310535	Ga0496124_0310535_221_1108	295
1491	3300048928	Ga0496125_0004453	Ga0496125_0004453_12379_13266	295
1492	3300048928	Ga0496125_0045777	Ga0496125_0045777_671_1558	295
1493	3300048928	Ga0496125_0066900	Ga0496125_0066900_75_962	295
1494	3300048929	Ga0496126_0007432	Ga0496126_0007432_3741_4628	295
1495	3300048929	Ga0496126_0007502	Ga0496126_0007502_3611_4498	295
1496	3300048929	Ga0496126_0028335	Ga0496126_0028335_2504_3391	295
1497	3300050491	nmdc:mga00v17_37591_c1	nmdc:mga00v17_37591_c1_1484_2374	295
1498	3300050491	nmdc:mga00v17_55182_c1	nmdc:mga00v17_55182_c1_805_1692	295
1499	3300050491	nmdc:mga00v17_6287_c1	nmdc:mga00v17_6287_c1_4665_5552	295
1500	3300050509	nmdc:mga0qj67_186743_c1	nmdc:mga0qj67_186743_c1_128_1018	295
1501	3300050510	nmdc:mga06r32_36239_c1	nmdc:mga06r32_36239_c1_595_1485	295
1502	3300053085	Ga0495619_0114550	Ga0495619_0114550_17_907	295
1503	3300053094	Ga0500566_0026303	Ga0500566_0026303_2444_3334	295
1504	3300053104	Ga0500556_0000930	Ga0500556_0000930_13508_14407	295
1505	3300053139	Ga0500568_0000197	Ga0500568_0000197_6245_7132	295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01791

DeoC

DeoC/LacD family aldolase

81

290

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3gkf-assembly1.cif.gz_L	crystal structure of e. coli lsrf	0.9602	10	289
4p2v-assembly1.cif.gz_F	structure of the ai-2 processing enzyme lsrf in complex with the product of the lsrg reaction p-hpd	0.954	10	288
3gkf-assembly1.cif.gz_L	crystal structure of e. coli lsrf	0.9534	10	289
4p2v-assembly1.cif.gz_F	structure of the ai-2 processing enzyme lsrf in complex with the product of the lsrg reaction p-hpd	0.9474	10	288
3glc-assembly1.cif.gz_D	crystal structure of e. coli lsrf in complex with ribose-5-phosphate	0.9466	10	288

ID	Description	Score	Start	End	Superfamily
3glcA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9465	10	288	3.20.20.70
3glcA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9399	10	288	3.20.20.70
2qjgK00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9099	32	285	3.20.20.70
2qjgK00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8675	32	285	3.20.20.70
1ok6A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8544	35	277	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A7C5LU95-F1-model_v4	3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase LsrF	1.004	218	291	GO:0016829
AF-A0A2X1MXM6-F1-model_v4	Putative aldolase (EC 4.1.2.-)	1.001	221	288	GO:0016829
AF-A0A774S9L1-F1-model_v4	3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase LsrF	0.9995	188	290	GO:0016829
AF-A0A382NSN0-F1-model_v4	3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase LsrF	0.9989	196	288	GO:0016829
AF-A0A4V6J1X8-F1-model_v4	Uncharacterized aldolase lsrF (EC 4.1.2.-)	0.9989	215	295	GO:0016829

Feature Viewer

pLDDT	pTM	Quality
88.22	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F494431

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01791

DeoC

DeoC/LacD family aldolase

81

290

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map