F494372

General Info

Members Datasets Scaffolds Average Seq Length
1497 517 1292 415

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1000002|JGI25155J39150_100000234
Length 442
Sequence MTTQTRFFARHAGVALAVTAMFYSSMTLAQAPAAKAAAPTKATVATPAAGGAVNLNQTVKIAWLDPLSGLMAAVGTNQLKGFQFLAEQFSKKNKAGVKFEIIGIDNKLSPQETTNALKSAIDQGARYVVQGNGSGPALAIMDALSKYNERNPGKEVVYLNYAAVDPDLTNSKCEYWHFRLDADTSMKMEALTAFMKEQPDIKKVYLINQNYSHGQQVAKFAKANLASKRPDIQIVGEDLHPLAQVRDFAPYIAKIKQSGADTVITGNWGSDLSLLVKAANEAGLNNVKFYTYYAGVTGTPTALGAGSAGRVYMVAYNHLNMGGEIQQIQAEYKKKFNDDFYTGAIFHAFTILTEAMAQTKSTEPAVVAKAMEGLRFKSFNGDVEMRKTDHQLQQGLYIDKWEKAGGKYPYDAENTGYTFVPVKYYEPYVASTPTSCQMKRPG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
9 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
10 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
11 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
12 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
13 2643221570 Acidovorax sp. Root568 Isolate Unclassified
14 2643221585 Pelomonas sp. Root662 Isolate Unclassified
15 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
16 2643221596 Acidovorax sp. Root70 Isolate Unclassified
17 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
18 2643221609 Acidovorax sp. Root217 Isolate Unclassified
19 2643221611 Acidovorax sp. Root219 Isolate Unclassified
20 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
21 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
22 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
23 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
24 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
25 2643221652 Acidovorax sp. Root402 Isolate Unclassified
26 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
27 2643221656 Pelomonas sp. Root405 Isolate Unclassified
28 2643221658 Variovorax sp. Root411 Isolate Unclassified
29 2643221660 Methylibium sp. Root1272 Isolate Unclassified
30 2643221672 Variovorax sp. Root434 Isolate Unclassified
31 2643221683 Variovorax sp. Root473 Isolate Unclassified
32 2643221717 Acidovorax sp. Root267 Isolate Unclassified
33 2721755523 Delftia sp. HK171 Isolate Unclassified
34 2738541277 Variovorax sp. GV051 Isolate Unclassified
35 2738541307 Variovorax sp. GV008 Isolate Unclassified
36 2738541337 Pelomonas sp. BT06 Isolate Unclassified
37 2738543012 Acidovorax sp. CF301 Isolate Unclassified
38 2738543013 Variovorax sp. BT01 Isolate Unclassified
39 2738543019 Variovorax sp. GV040 Isolate Unclassified
40 2816332133 Acidovorax radicis 2721A Isolate Unclassified
41 2818991446 Variovorax sp. 1180 Isolate Unclassified
42 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
43 2831864461 Roseateles noduli HZ7 Isolate Nodule
44 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
45 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
46 2842677519 Variovorax sp. R-72495 Isolate Unclassified
47 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
48 2842733646 Variovorax sp. R-72446 Isolate Unclassified
49 2842747753 Variovorax sp. R-72060 Isolate Unclassified
50 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
51 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
52 2885198086 Variovorax sp. 679 Isolate Unclassified
53 2885211737 Variovorax sp. 553 Isolate Unclassified
54 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
55 2899924645 Variovorax sp. 369 Isolate Unclassified
56 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
57 2904456579 Variovorax sp. 2002 Isolate Unclassified
58 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
59 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
60 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
61 2928037797 Variovorax sp. 1126 Isolate Unclassified
62 2928044640 Variovorax sp. 1128 Isolate Unclassified
63 2928051484 Variovorax sp. 1133 Isolate Unclassified
64 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
65 2928070936 Variovorax gossypii 1167 Isolate Unclassified
66 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
67 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
68 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
69 2929520902 Variovorax beijingensis 502 Isolate Unclassified
70 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
71 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
72 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
73 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
74 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
75 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
76 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
77 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
78 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
82 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
83 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
84 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
85 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
86 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
87 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
88 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
89 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
90 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
91 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
92 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
93 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
94 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
95 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
96 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
97 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
98 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
99 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
100 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
101 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
102 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
103 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
104 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
105 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
106 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
107 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
108 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
109 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
110 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
111 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
112 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
113 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
114 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
115 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
116 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
117 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
118 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
119 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
120 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
121 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
122 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
123 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
124 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
125 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
126 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
127 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
128 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
129 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
130 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
131 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
132 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
133 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
134 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
135 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
136 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
137 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
138 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
139 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
140 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
141 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
142 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
143 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
144 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
145 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
146 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
147 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
148 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
149 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
150 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
151 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
152 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
153 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
154 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
155 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
156 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
157 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
158 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
159 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
160 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
161 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
162 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
163 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
164 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
165 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
166 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
167 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
168 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
169 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
170 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
171 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
172 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
173 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
174 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
175 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
176 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
177 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
178 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
179 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
180 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
181 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
182 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
183 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
184 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
185 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
187 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
188 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
189 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
190 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
191 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
192 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
193 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
194 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
195 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
196 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
197 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
198 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
199 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
200 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
201 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
202 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
203 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
204 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
205 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
206 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
207 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
208 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
209 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
210 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
211 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
212 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
213 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
214 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
215 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
216 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
217 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
218 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
219 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
220 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
221 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
226 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
228 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
229 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
230 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
233 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
234 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
238 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
241 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
243 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
245 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
246 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
305 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
306 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
307 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
308 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
309 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
310 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
312 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
317 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
318 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
319 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
320 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
321 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
322 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
323 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
324 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
325 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
326 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
327 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
328 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
329 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
330 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
331 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
332 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
333 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
334 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
335 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
336 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
337 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
338 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
339 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
340 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
341 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
342 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
343 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
344 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
345 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
346 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
347 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
348 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
349 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
350 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
351 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
352 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
353 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
354 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
355 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
356 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
357 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
358 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
359 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
360 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
361 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
362 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
363 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
364 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
365 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
366 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
367 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
368 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
369 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
370 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
371 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
372 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
373 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
374 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
375 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
376 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
377 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
378 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
379 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
380 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
381 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
382 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
383 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
384 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
385 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
386 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
387 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
388 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
389 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
390 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
391 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
392 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
393 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
394 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
395 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
396 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
397 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
398 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
399 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
400 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
401 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
402 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
403 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
404 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
405 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
406 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
407 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
408 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
409 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
410 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
411 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
412 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
413 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
414 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
415 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
416 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
417 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
418 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
419 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
420 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
421 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
422 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
423 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
424 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
425 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
426 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
427 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
428 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
429 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
430 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
431 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
432 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
437 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
438 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
439 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
440 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
441 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
442 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
443 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
444 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
445 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
446 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
447 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
448 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
449 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
450 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
451 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
452 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
453 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
454 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
455 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
456 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
457 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
458 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
459 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
460 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
461 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
462 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
463 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
471 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
472 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
473 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
474 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
475 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
476 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
477 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
478 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
479 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
480 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
481 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
482 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
483 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
484 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
485 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
486 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
487 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
488 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
489 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
490 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
491 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
492 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
493 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
494 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
495 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
496 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
497 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
498 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
499 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
500 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
501 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
502 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
503 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
504 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
505 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
506 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
507 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
508 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
509 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
510 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
511 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
512 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
513 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
514 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
515 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
516 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 0.2
Isolates 8.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.45
Nodule 1.14
Rhizoplane 1.94
Rhizosphere 60.59
Stem 0
Stem Tuber 0
Unclassified 11.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10020775 3300001979 Bacteria 2284
2 JGI25155J39150_1000002 3300002704 Bacteria 292156
3 JGI25156J39149_1000003 3300002705 Bacteria 305434
4 JGI25156J39149_1000837 3300002705 Bacteria 15529
5 JGI25156J39149_1008895 3300002705 Bacteria 2486
6 JGI25156J39149_1012858 3300002705 Bacteria 1813
7 JGI25154J39366_1000009 3300002738 Bacteria 305408
8 JGI25154J39366_1002448 3300002738 Bacteria 4797
9 JGI25158J39367_1001490 3300002739 Bacteria 4085
10 JGI25157J39369_1000002 3300002741 Bacteria 305434
11 JGI25157J39369_1000251 3300002741 Bacteria 40025
12 JGI25152J39213_1000738 3300002773 Bacteria 16742
13 JGI25152J39213_1006919 3300002773 Bacteria 2999
14 JGI25150J39212_1000868 3300002774 Bacteria 10033
15 JGI25150J39212_1004489 3300002774 Bacteria 3101
16 JGI25159J45721_1000417 3300002987 Bacteria 19666
17 JGI25159J45721_1001150 3300002987 Bacteria 11299
18 JGI25159J45721_1001933 3300002987 Bacteria 8263
19 JGI25159J45721_1008673 3300002987 Bacteria 2770
20 JGI25151J46595_10006428 3300003187 Bacteria 5909
21 JGI25151J46595_10007156 3300003187 Bacteria 5500
22 JGI25151J46595_10016665 3300003187 Bacteria 3206
23 rootH1_10009119 3300003316 Bacteria 6425
24 rootH2_10036890 3300003320 Bacteria 1933
25 rootL2_10023281 3300003322 Bacteria 3269
26 rootL2_10040743 3300003322 Bacteria 1927
27 JGI25160J50197_1000472 3300003354 Bacteria 24628
28 JGI25161J50226_1000032 3300003374 Bacteria 138440
29 JGI25161J50226_1000064 3300003374 Bacteria 99448
30 Ga0055533_1000028 3300003756 Bacteria 311012
31 Ga0055533_1000057 3300003756 Bacteria 194035
32 Ga0055525_1000522 3300003759 Bacteria 18499
33 Ga0055535_1000856 3300003761 Bacteria 21517
34 Ga0055535_1001176 3300003761 Bacteria 15121
35 Ga0055542_1000021 3300003762 Bacteria 331499
36 Ga0055529_1000331 3300003763 Bacteria 53202
37 Ga0055526_1001029 3300003771 Bacteria 20391
38 Ga0055526_1024152 3300003771 Bacteria 2001
39 Ga0055537_1000036 3300003773 Bacteria 96045
40 Ga0055537_1000221 3300003773 Bacteria 41984
41 Ga0055537_1000565 3300003773 Bacteria 20867
42 Ga0055537_1002864 3300003773 Bacteria 5526
43 Ga0055537_1010531 3300003773 Bacteria 1944
44 Ga0055524_1000012 3300003775 Bacteria 260384
45 Ga0055524_1000287 3300003775 Bacteria 48964
46 Ga0055524_1000554 3300003775 Bacteria 28221
47 Ga0055524_1013988 3300003775 Bacteria 2997
48 Ga0055536_1003447 3300003781 Bacteria 8482
49 Ga0055536_1003631 3300003781 Bacteria 8227
50 Ga0055536_1004360 3300003781 Bacteria 7268
51 Ga0055536_1010599 3300003781 Bacteria 3635
52 Ga0055536_1012824 3300003781 Bacteria 3076
53 Ga0055534_1000018 3300003784 Bacteria 138136
54 Ga0055534_1000220 3300003784 Bacteria 41988
55 Ga0055534_1001383 3300003784 Bacteria 9696
56 Ga0055534_1004361 3300003784 Bacteria 4125
57 Ga0055528_1000509 3300003790 Bacteria 30550
58 Ga0055528_1003825 3300003790 Bacteria 7407
59 Ga0055528_1007055 3300003790 Bacteria 5021
60 Ga0055530_10000218 3300003791 Bacteria 51314
61 Ga0055530_10000430 3300003791 Bacteria 37250
62 Ga0055530_10002887 3300003791 Bacteria 10467
63 Ga0055530_10003706 3300003791 Bacteria 8509
64 Ga0055530_10008617 3300003791 Bacteria 4048
65 Ga0055540_1000012 3300003792 Bacteria 262667
66 Ga0055540_1000016 3300003792 Bacteria 232942
67 Ga0055540_1000039 3300003792 Bacteria 161844
68 Ga0055540_1000062 3300003792 Bacteria 128474
69 Ga0055540_1000420 3300003792 Bacteria 33992
70 Ga0055540_1000492 3300003792 Bacteria 30076
71 Ga0055540_1002048 3300003792 Bacteria 11151
72 Ga0055540_1006044 3300003792 Bacteria 4903
73 Ga0055540_1008499 3300003792 Bacteria 3689
74 Ga0055531_10000309 3300003794 Bacteria 48285
75 Ga0055531_10000313 3300003794 Bacteria 47791
76 Ga0055531_10000542 3300003794 Bacteria 33438
77 Ga0055531_10002364 3300003794 Bacteria 12685
78 Ga0055531_10003057 3300003794 Bacteria 10840
79 Ga0055531_10009223 3300003794 Bacteria 5075
80 Ga0055531_10012926 3300003794 Bacteria 3888
81 Ga0055531_10014062 3300003794 Bacteria 3635
82 Ga0055531_10020585 3300003794 Bacteria 2602
83 Ga0055543_1003006 3300004625 Bacteria 5217
84 Ga0055543_1005865 3300004625 Bacteria 3067
85 Ga0055543_1005952 3300004625 Bacteria 3029
86 Ga0055543_1006341 3300004625 Bacteria 2870
87 Ga0055543_1008256 3300004625 Bacteria 2318
88 Ga0065165_1000354 3300005262 Bacteria 75337
89 Ga0065165_1000935 3300005262 Bacteria 37344
90 Ga0065165_1001664 3300005262 Bacteria 22493
91 Ga0065165_1014104 3300005262 Bacteria 3120
92 Ga0065165_1015749 3300005262 Bacteria 2870
93 Ga0065165_1027589 3300005262 Bacteria 1847
94 Ga0065165_1031101 3300005262 Bacteria 1691
95 Ga0065714_10074978 3300005288 Bacteria 2964
96 Ga0065704_10105517 3300005289 Bacteria 2109
97 Ga0065704_10108668 3300005289 Bacteria 2022
98 Ga0065704_10126163 3300005289 Bacteria 1693
99 Ga0065712_10077432 3300005290 Bacteria 3482
100 Ga0065715_10025844 3300005293 Bacteria 1564
101 Ga0065715_10122914 3300005293 Bacteria 2192
102 Ga0065715_10207777 3300005293 Bacteria 1329
103 Ga0065707_10086952 3300005295 Bacteria 5233
104 Ga0070658_10088236 3300005327 Bacteria 2554
105 Ga0070658_10169512 3300005327 Bacteria 1834
106 Ga0070676_10000305 3300005328 Bacteria 22094
107 Ga0070676_10001353 3300005328 Bacteria 12331
108 Ga0070676_10001456 3300005328 Bacteria 11960
109 Ga0070676_10012035 3300005328 Bacteria 4715
110 Ga0070676_10021974 3300005328 Bacteria 3575
111 Ga0070683_100007952 3300005329 Bacteria 8995
112 Ga0070683_100297331 3300005329 Bacteria 1536
113 Ga0070690_100005973 3300005330 Bacteria 6875
114 Ga0070690_100010484 3300005330 Bacteria 5396
115 Ga0070690_100037982 3300005330 Bacteria 3036
116 Ga0070670_100012432 3300005331 Bacteria 7286
117 Ga0070670_100017269 3300005331 Bacteria 6189
118 Ga0070670_100025196 3300005331 Bacteria 5119
119 Ga0070670_100040203 3300005331 Bacteria 4022
120 Ga0070670_100075565 3300005331 Bacteria 2894
121 Ga0070670_100222624 3300005331 Bacteria 1642
122 Ga0070677_10004130 3300005333 Bacteria 4715
123 Ga0068869_100041163 3300005334 Bacteria 3307
124 Ga0068869_100045673 3300005334 Bacteria 3155
125 Ga0068869_100126844 3300005334 Bacteria 1958
126 Ga0070666_10007102 3300005335 Bacteria 6905
127 Ga0070666_10042863 3300005335 Bacteria 3028
128 Ga0070666_10145344 3300005335 Bacteria 1653
129 Ga0070680_100002531 3300005336 Bacteria 13546
130 Ga0070682_100098288 3300005337 Bacteria 1928
131 Ga0070682_100145677 3300005337 Bacteria 1619
132 Ga0068868_100003758 3300005338 Bacteria 10601
133 Ga0068868_100007012 3300005338 Bacteria 8009
134 Ga0068868_100010416 3300005338 Bacteria 6731
135 Ga0068868_100024715 3300005338 Bacteria 4561
136 Ga0068868_100026439 3300005338 Bacteria 4423
137 Ga0068868_100079207 3300005338 Bacteria 2632
138 Ga0068868_100089432 3300005338 Bacteria 2479
139 Ga0068868_100135869 3300005338 Bacteria 2015
140 Ga0068868_100226829 3300005338 Bacteria 1566
141 Ga0070660_100017780 3300005339 Bacteria 5186
142 Ga0070660_100104942 3300005339 Bacteria 2242
143 Ga0070660_100249041 3300005339 Bacteria 1448
144 Ga0070689_100005827 3300005340 Bacteria 8458
145 Ga0070687_100027806 3300005343 Bacteria 2736
146 Ga0070687_100051223 3300005343 Bacteria 2136
147 Ga0070661_100002137 3300005344 Bacteria 13617
148 Ga0070661_100004541 3300005344 Bacteria 9553
149 Ga0070661_100027419 3300005344 Bacteria 4101
150 Ga0070661_100225554 3300005344 Bacteria 1438
151 Ga0070668_100000930 3300005347 Bacteria 20445
152 Ga0070668_100002014 3300005347 Bacteria 14861
153 Ga0070668_100014358 3300005347 Bacteria 5918
154 Ga0070668_100129226 3300005347 Bacteria 2026
155 Ga0070669_100003934 3300005353 Bacteria 10748
156 Ga0070669_100008074 3300005353 Bacteria 7520
157 Ga0070669_100059655 3300005353 Bacteria 2802
158 Ga0070669_100197831 3300005353 Bacteria 1580
159 Ga0070675_100000703 3300005354 Bacteria 23209
160 Ga0070675_100002563 3300005354 Bacteria 13606
161 Ga0070675_100005844 3300005354 Bacteria 9423
162 Ga0070675_100008566 3300005354 Bacteria 7941
163 Ga0070675_100012697 3300005354 Bacteria 6607
164 Ga0070675_100018066 3300005354 Bacteria 5612
165 Ga0070675_100136272 3300005354 Bacteria 2095
166 Ga0070675_100155626 3300005354 Bacteria 1962
167 Ga0070671_100005574 3300005355 Bacteria 10029
168 Ga0070671_100018775 3300005355 Bacteria 5620
169 Ga0070671_100034852 3300005355 Bacteria 4168
170 Ga0070671_100047811 3300005355 Bacteria 3556
171 Ga0070671_100074851 3300005355 Bacteria 2829
172 Ga0070674_100000518 3300005356 Bacteria 19349
173 Ga0070674_100002778 3300005356 Bacteria 9676
174 Ga0070674_100002952 3300005356 Bacteria 9433
175 Ga0070674_100003318 3300005356 Bacteria 9011
176 Ga0070674_100004623 3300005356 Bacteria 7864
177 Ga0070674_100025030 3300005356 Bacteria 3879
178 Ga0070674_100039485 3300005356 Bacteria 3188
179 Ga0070674_100058684 3300005356 Bacteria 2676
180 Ga0070674_100069552 3300005356 Bacteria 2484
181 Ga0070673_100002198 3300005364 Bacteria 11789
182 Ga0070673_100002713 3300005364 Bacteria 10854
183 Ga0070673_100006984 3300005364 Bacteria 7395
184 Ga0070673_100014798 3300005364 Bacteria 5454
185 Ga0070673_100017830 3300005364 Bacteria 5058
186 Ga0070673_100141075 3300005364 Bacteria 2032
187 Ga0070673_100163511 3300005364 Bacteria 1895
188 Ga0070673_100211707 3300005364 Bacteria 1674
189 Ga0070673_100216577 3300005364 Bacteria 1655
190 Ga0070688_100077724 3300005365 Bacteria 2139
191 Ga0070659_100000178 3300005366 Bacteria 48934
192 Ga0070659_100013767 3300005366 Bacteria 6031
193 Ga0070659_100036994 3300005366 Bacteria 3804
194 Ga0070659_100090482 3300005366 Bacteria 2452
195 Ga0070667_100000887 3300005367 Bacteria 27641
196 Ga0070667_100001423 3300005367 Bacteria 21447
197 Ga0070667_100022085 3300005367 Bacteria 5278
198 Ga0070667_100166632 3300005367 Bacteria 1943
199 Ga0070667_100255817 3300005367 Bacteria 1567
200 Ga0070700_100011768 3300005441 Bacteria 4856
201 Ga0070700_100060568 3300005441 Bacteria 2386
202 Ga0070663_100067903 3300005455 Bacteria 2587
203 Ga0070663_100123499 3300005455 Bacteria 1958
204 Ga0070678_100000683 3300005456 Bacteria 16725
205 Ga0070678_100027992 3300005456 Bacteria 3836
206 Ga0070678_100093366 3300005456 Bacteria 2314
207 Ga0070678_100140093 3300005456 Bacteria 1934
208 Ga0070678_100160270 3300005456 Bacteria 1822
209 Ga0070678_100160965 3300005456 Bacteria 1818
210 Ga0070678_100183807 3300005456 Bacteria 1713
211 Ga0070678_100227746 3300005456 Bacteria 1552
212 Ga0070662_100000646 3300005457 Bacteria 21061
213 Ga0070662_100010127 3300005457 Bacteria 6177
214 Ga0070662_100019033 3300005457 Bacteria 4655
215 Ga0070662_100090650 3300005457 Bacteria 2295
216 Ga0070681_10303528 3300005458 Bacteria 1506
217 Ga0068867_100000234 3300005459 Bacteria 36383
218 Ga0068867_100001306 3300005459 Bacteria 17230
219 Ga0068867_100004484 3300005459 Bacteria 9810
220 Ga0068867_100006316 3300005459 Bacteria 8384
221 Ga0068867_100006419 3300005459 Bacteria 8306
222 Ga0068867_100006718 3300005459 Bacteria 8133
223 Ga0068867_100006852 3300005459 Bacteria 8058
224 Ga0068867_100010351 3300005459 Bacteria 6580
225 Ga0068867_100014751 3300005459 Bacteria 5538
226 Ga0068867_100079902 3300005459 Bacteria 2462
227 Ga0070685_10116931 3300005466 Bacteria 1651
228 Ga0070706_100006474 3300005467 Bacteria 11054
229 Ga0070707_100266424 3300005468 Bacteria 1666
230 Ga0070699_100104211 3300005518 Bacteria 2488
231 Ga0070679_100060332 3300005530 Bacteria 3780
232 Ga0070679_100076637 3300005530 Bacteria 3333
233 Ga0070679_100152598 3300005530 Bacteria 2286
234 Ga0070684_100002660 3300005535 Bacteria 13192
235 Ga0070684_100134427 3300005535 Bacteria 2233
236 Ga0068853_100035486 3300005539 Bacteria 4236
237 Ga0068853_100046733 3300005539 Bacteria 3713
238 Ga0068853_100087126 3300005539 Bacteria 2739
239 Ga0068853_100259887 3300005539 Bacteria 1596
240 Ga0070672_100000150 3300005543 Bacteria 38126
241 Ga0070672_100000188 3300005543 Bacteria 34174
242 Ga0070672_100003178 3300005543 Bacteria 10627
243 Ga0070672_100029365 3300005543 Bacteria 4122
244 Ga0070672_100061568 3300005543 Bacteria 2959
245 Ga0070672_100090311 3300005543 Bacteria 2470
246 Ga0070672_100098835 3300005543 Bacteria 2364
247 Ga0070672_100204136 3300005543 Bacteria 1653
248 Ga0070665_100235466 3300005548 Bacteria 1831
249 Ga0068855_100008323 3300005563 Bacteria 12537
250 Ga0068855_100017415 3300005563 Bacteria 8643
251 Ga0068855_100231884 3300005563 Bacteria 2067
252 Ga0068855_100276875 3300005563 Bacteria 1865
253 Ga0068855_100277889 3300005563 Bacteria 1860
254 Ga0070664_100034043 3300005564 Bacteria 4272
255 Ga0070664_100064440 3300005564 Bacteria 3125
256 Ga0068857_100000422 3300005577 Bacteria 29970
257 Ga0068857_100025951 3300005577 Bacteria 5161
258 Ga0068857_100033075 3300005577 Bacteria 4572
259 Ga0068857_100137230 3300005577 Bacteria 2209
260 Ga0068854_100001586 3300005578 Bacteria 13835
261 Ga0068854_100072293 3300005578 Bacteria 2525
262 Ga0068854_100137384 3300005578 Bacteria 1872
263 Ga0068856_100004817 3300005614 Bacteria 13375
264 Ga0068856_100050218 3300005614 Bacteria 4112
265 Ga0068856_100105028 3300005614 Bacteria 2819
266 Ga0068852_100003415 3300005616 Bacteria 11092
267 Ga0068852_100040628 3300005616 Bacteria 3926
268 Ga0068852_100041540 3300005616 Bacteria 3887
269 Ga0068852_100111142 3300005616 Bacteria 2491
270 Ga0068852_100180723 3300005616 Bacteria 1983
271 Ga0068852_100185549 3300005616 Bacteria 1959
272 Ga0068859_100003146 3300005617 Bacteria 16781
273 Ga0068859_100030836 3300005617 Bacteria 5381
274 Ga0068859_100090165 3300005617 Bacteria 3117
275 Ga0068859_100148499 3300005617 Bacteria 2419
276 Ga0068859_100154049 3300005617 Bacteria 2375
277 Ga0068864_100001395 3300005618 Bacteria 20021
278 Ga0068864_100006994 3300005618 Bacteria 9256
279 Ga0068864_100012986 3300005618 Bacteria 6893
280 Ga0068864_100031021 3300005618 Bacteria 4533
281 Ga0068864_100094537 3300005618 Bacteria 2642
282 Ga0068866_10027755 3300005718 Bacteria 2690
283 Ga0068861_100000357 3300005719 Bacteria 26082
284 Ga0068861_100005099 3300005719 Bacteria 8855
285 Ga0068861_100024110 3300005719 Bacteria 4396
286 Ga0068861_100026409 3300005719 Bacteria 4221
287 Ga0068861_100148574 3300005719 Bacteria 1920
288 Ga0068851_10061466 3300005834 Bacteria 1925
289 Ga0068851_10066642 3300005834 Bacteria 1856
290 Ga0068851_10090274 3300005834 Bacteria 1612
291 Ga0068851_10103958 3300005834 Bacteria 1509
292 Ga0068870_10025973 3300005840 Bacteria 2913
293 Ga0068863_100004937 3300005841 Bacteria 13152
294 Ga0068863_100006024 3300005841 Bacteria 11893
295 Ga0068863_100045223 3300005841 Bacteria 4178
296 Ga0068863_100077904 3300005841 Bacteria 3137
297 Ga0068863_100163097 3300005841 Bacteria 2136
298 Ga0068863_100171074 3300005841 Bacteria 2084
299 Ga0068863_100192095 3300005841 Bacteria 1962
300 Ga0068858_100001070 3300005842 Bacteria 28311
301 Ga0068858_100005932 3300005842 Bacteria 11927
302 Ga0068858_100006988 3300005842 Bacteria 10963
303 Ga0068860_100001404 3300005843 Bacteria 26110
304 Ga0068860_100001441 3300005843 Bacteria 25753
305 Ga0068860_100003633 3300005843 Bacteria 15860
306 Ga0068860_100018213 3300005843 Bacteria 6835
307 Ga0068860_100056492 3300005843 Bacteria 3731
308 Ga0068860_100069015 3300005843 Bacteria 3359
309 Ga0068862_100008643 3300005844 Bacteria 8424
310 Ga0068862_100012198 3300005844 Bacteria 7103
311 Ga0068862_100014297 3300005844 Bacteria 6585
312 Ga0068862_100089917 3300005844 Bacteria 2673
313 Ga0075365_10000234 3300006038 Bacteria 18998
314 Ga0075365_10013483 3300006038 Bacteria 4892
315 Ga0075365_10017690 3300006038 Bacteria 4368
316 Ga0075365_10040013 3300006038 Bacteria 3055
317 Ga0075364_10081580 3300006051 Bacteria 2139
318 Ga0075432_10015726 3300006058 Bacteria 2582
319 Ga0075362_10013909 3300006177 Bacteria 3234
320 Ga0075362_10019047 3300006177 Bacteria 2849
321 Ga0075362_10025386 3300006177 Bacteria 2522
322 Ga0075362_10025904 3300006177 Bacteria 2501
323 Ga0075362_10051494 3300006177 Bacteria 1843
324 Ga0075367_10023649 3300006178 Bacteria 3459
325 Ga0075367_10046511 3300006178 Bacteria 2550
326 Ga0075367_10062297 3300006178 Bacteria 2227
327 Ga0075367_10138911 3300006178 Bacteria 1505
328 Ga0075369_10001213 3300006186 Bacteria 8746
329 Ga0075369_10048776 3300006186 Bacteria 1828
330 Ga0075369_10052095 3300006186 Bacteria 1774
331 Ga0075366_10003302 3300006195 Bacteria 8485
332 Ga0075366_10005390 3300006195 Bacteria 6930
333 Ga0075366_10011482 3300006195 Bacteria 5003
334 Ga0075366_10044896 3300006195 Bacteria 2619
335 Ga0075366_10050413 3300006195 Bacteria 2471
336 Ga0075366_10058716 3300006195 Bacteria 2285
337 Ga0075366_10088581 3300006195 Bacteria 1853
338 Ga0075366_10097862 3300006195 Bacteria 1760
339 Ga0097621_100040696 3300006237 Bacteria 3738
340 Ga0097621_100048451 3300006237 Bacteria 3447
341 Ga0097621_100060446 3300006237 Bacteria 3106
342 Ga0097621_100061415 3300006237 Bacteria 3082
343 Ga0097621_100151552 3300006237 Bacteria 1988
344 Ga0075370_10000246 3300006353 Bacteria 19428
345 Ga0075370_10001169 3300006353 Bacteria 11034
346 Ga0075370_10003627 3300006353 Bacteria 7385
347 Ga0075370_10003633 3300006353 Bacteria 7381
348 Ga0075370_10006991 3300006353 Bacteria 5720
349 Ga0075370_10008378 3300006353 Bacteria 5319
350 Ga0075370_10017146 3300006353 Bacteria 3909
351 Ga0075370_10028091 3300006353 Bacteria 3125
352 Ga0075370_10028308 3300006353 Bacteria 3114
353 Ga0075370_10031633 3300006353 Bacteria 2954
354 Ga0075370_10037655 3300006353 Bacteria 2720
355 Ga0075370_10043263 3300006353 Bacteria 2545
356 Ga0075370_10052826 3300006353 Bacteria 2306
357 Ga0075370_10059175 3300006353 Bacteria 2180
358 Ga0068871_100014788 3300006358 Bacteria 5827
359 Ga0068871_100026057 3300006358 Bacteria 4558
360 Ga0068871_100051277 3300006358 Bacteria 3341
361 Ga0068871_100073545 3300006358 Bacteria 2818
362 Ga0068871_100129646 3300006358 Bacteria 2137
363 Ga0075429_100095617 3300006880 Bacteria 2591
364 Ga0068865_100002164 3300006881 Bacteria 11577
365 Ga0068865_100004824 3300006881 Bacteria 8148
366 Ga0068865_100005297 3300006881 Bacteria 7806
367 Ga0068865_100025563 3300006881 Bacteria 3885
368 Ga0068865_100195010 3300006881 Bacteria 1569
369 Ga0097620_100003146 3300006931 Bacteria 16781
370 Ga0097620_100030836 3300006931 Bacteria 5381
371 Ga0097620_100090164 3300006931 Bacteria 3117
372 Ga0097620_100148494 3300006931 Bacteria 2419
373 Ga0097620_100154058 3300006931 Bacteria 2375
374 Ga0099823_1007351 3300006944 Bacteria 11174
375 Ga0079104_1000011 3300006946 Bacteria 359962
376 Ga0079104_1000019 3300006946 Bacteria 269313
377 Ga0099826_10000096 3300006948 Bacteria 41938
378 Ga0099826_10007062 3300006948 Bacteria 8243
379 Ga0105244_10003175 3300009036 Bacteria 11930
380 Ga0105244_10101048 3300009036 Bacteria 1410
381 Ga0105250_10017928 3300009092 Bacteria 2873
382 Ga0105240_10000951 3300009093 Bacteria 51613
383 Ga0105240_10001089 3300009093 Bacteria 47935
384 Ga0105245_10009930 3300009098 Bacteria 8293
385 Ga0105245_10071820 3300009098 Bacteria 3144
386 Ga0105245_10105118 3300009098 Bacteria 2618
387 Ga0114129_10134779 3300009147 Bacteria 3389
388 Ga0105243_10000400 3300009148 Bacteria 45768
389 Ga0105243_10001880 3300009148 Bacteria 17890
390 Ga0105243_10003082 3300009148 Bacteria 13722
391 Ga0105243_10015844 3300009148 Bacteria 5703
392 Ga0105243_10020381 3300009148 Bacteria 5028
393 Ga0105243_10247510 3300009148 Bacteria 1590
394 Ga0105243_10267990 3300009148 Bacteria 1532
395 Ga0105241_10043500 3300009174 Bacteria 3402
396 Ga0105242_10006688 3300009176 Bacteria 8899
397 Ga0105242_10028293 3300009176 Bacteria 4461
398 Ga0105242_10034606 3300009176 Bacteria 4050
399 Ga0105242_10035127 3300009176 Bacteria 4020
400 Ga0105242_10173431 3300009176 Bacteria 1897
401 Ga0105248_10014279 3300009177 Bacteria 8743
402 Ga0105248_10021294 3300009177 Bacteria 7185
403 Ga0105248_10107959 3300009177 Bacteria 3139
404 Ga0105248_10135771 3300009177 Bacteria 2775
405 Ga0105248_10173519 3300009177 Bacteria 2430
406 Ga0105248_10173966 3300009177 Bacteria 2427
407 Ga0105237_10003603 3300009545 Bacteria 18306
408 Ga0105237_10030715 3300009545 Bacteria 5454
409 Ga0105237_10057916 3300009545 Bacteria 3877
410 Ga0105238_10007548 3300009551 Bacteria 10891
411 Ga0105238_10007948 3300009551 Bacteria 10612
412 Ga0105238_10020812 3300009551 Bacteria 6681
413 Ga0105238_10112379 3300009551 Bacteria 2703
414 Ga0105249_10001498 3300009553 Bacteria 20478
415 Ga0105249_10004113 3300009553 Bacteria 12563
416 Ga0105249_10152584 3300009553 Bacteria 2225
417 Ga0105239_10005179 3300010375 Bacteria 15367
418 Ga0105239_10100070 3300010375 Bacteria 3206
419 Ga0105246_10024888 3300011119 Bacteria 3896
420 Ga0105246_10116819 3300011119 Bacteria 1970
421 Ga0157319_1000009 3300012497 Bacteria 227971
422 Ga0157373_10008552 3300013100 Bacteria 7603
423 Ga0157373_10012879 3300013100 Bacteria 6140
424 Ga0157373_10133603 3300013100 Bacteria 1744
425 Ga0157370_10000583 3300013104 Bacteria 45511
426 Ga0157370_10019170 3300013104 Bacteria 6874
427 Ga0157370_10129097 3300013104 Bacteria 2358
428 Ga0157369_10009941 3300013105 Bacteria 10868
429 Ga0157369_10021442 3300013105 Bacteria 7227
430 Ga0157369_10035074 3300013105 Bacteria 5502
431 Ga0157374_10016391 3300013296 Bacteria 6511
432 Ga0157374_10037469 3300013296 Bacteria 4451
433 Ga0157374_10102555 3300013296 Bacteria 2744
434 Ga0157374_10183801 3300013296 Bacteria 2043
435 Ga0157374_10204401 3300013296 Bacteria 1935
436 Ga0157378_10034311 3300013297 Bacteria 4487
437 Ga0163162_10011301 3300013306 Bacteria 8707
438 Ga0163162_10022647 3300013306 Bacteria 6193
439 Ga0163162_10029102 3300013306 Bacteria 5466
440 Ga0163162_10074236 3300013306 Bacteria 3459
441 Ga0163162_10075996 3300013306 Bacteria 3420
442 Ga0163162_10122944 3300013306 Bacteria 2700
443 Ga0163162_10308257 3300013306 Bacteria 1715
444 Ga0157372_10002878 3300013307 Bacteria 18606
445 Ga0157372_10026418 3300013307 Bacteria 6318
446 Ga0157372_10039703 3300013307 Bacteria 5196
447 Ga0157375_10003456 3300013308 Bacteria 13690
448 Ga0157375_10017862 3300013308 Bacteria 6416
449 Ga0157375_10036590 3300013308 Bacteria 4698
450 Ga0157375_10038720 3300013308 Bacteria 4580
451 Ga0157375_10042838 3300013308 Bacteria 4385
452 Ga0157375_10063319 3300013308 Bacteria 3679
453 Ga0157375_10335149 3300013308 Bacteria 1678
454 Ga0157375_10445857 3300013308 Bacteria 1460
455 Ga0163163_10005453 3300014325 Bacteria 10993
456 Ga0163163_10294718 3300014325 Bacteria 1674
457 Ga0157380_10002934 3300014326 Bacteria 11595
458 Ga0157380_10003080 3300014326 Bacteria 11367
459 Ga0157380_10023913 3300014326 Bacteria 4616
460 Ga0157380_10105348 3300014326 Bacteria 2357
461 Ga0182008_10000398 3300014497 Bacteria 33725
462 Ga0182008_10001698 3300014497 Bacteria 14453
463 Ga0182008_10007000 3300014497 Bacteria 6254
464 Ga0182008_10013166 3300014497 Bacteria 4350
465 Ga0182008_10015404 3300014497 Bacteria 3989
466 Ga0182008_10034149 3300014497 Bacteria 2550
467 Ga0182008_10042429 3300014497 Bacteria 2266
468 Ga0157377_10000014 3300014745 Bacteria 213961
469 Ga0157379_10007780 3300014968 Bacteria 9280
470 Ga0157379_10012988 3300014968 Bacteria 7288
471 Ga0157379_10017193 3300014968 Bacteria 6370
472 Ga0157379_10027948 3300014968 Bacteria 5019
473 Ga0157379_10030440 3300014968 Bacteria 4805
474 Ga0157379_10095832 3300014968 Bacteria 2663
475 Ga0157379_10275757 3300014968 Bacteria 1530
476 Ga0157376_10002109 3300014969 Bacteria 13382
477 Ga0157376_10018872 3300014969 Bacteria 5301
478 Ga0157376_10035383 3300014969 Bacteria 4040
479 Ga0157376_10097017 3300014969 Bacteria 2567
480 Ga0157376_10130519 3300014969 Bacteria 2241
481 Ga0157376_10279849 3300014969 Bacteria 1571
482 Ga0182006_1001743 3300015261 Bacteria 12616
483 Ga0182006_1014199 3300015261 Bacteria 3437
484 Ga0182006_1035107 3300015261 Bacteria 2001
485 Ga0182006_1039934 3300015261 Bacteria 1849
486 Ga0182007_10003330 3300015262 Bacteria 7604
487 Ga0182007_10029258 3300015262 Bacteria 1887
488 Ga0183362_10001 3300015683 Bacteria 2046624
489 Ga0163161_10000149 3300017792 Bacteria 64127
490 Ga0163161_10004629 3300017792 Bacteria 9576
491 Ga0163161_10007626 3300017792 Bacteria 7485
492 Ga0163161_10010900 3300017792 Bacteria 6303
493 Ga0163161_10013402 3300017792 Bacteria 5704
494 Ga0163161_10018680 3300017792 Bacteria 4860
495 Ga0163161_10028738 3300017792 Bacteria 3950
496 Ga0163161_10046965 3300017792 Bacteria 3117
497 Ga0163161_10064859 3300017792 Bacteria 2665
498 Ga0163161_10087430 3300017792 Bacteria 2302
499 Ga0213872_10001558 3300021361 Bacteria 14675
500 Ga0213872_10024989 3300021361 Bacteria 2747
501 Ga0213872_10041667 3300021361 Bacteria 2095
502 Ga0213876_10028678 3300021384 Bacteria 2935
503 Ga0209435_100001 3300025206 Bacteria 1424171
504 Ga0209436_108179 3300025208 Bacteria 2107
505 Ga0209674_100007 3300025226 Bacteria 1077082
506 Ga0209672_100751 3300025228 Bacteria 15798
507 Ga0209672_103873 3300025228 Bacteria 2944
508 Ga0209147_102627 3300025229 Bacteria 4230
509 Ga0209563_100033 3300025230 Bacteria 457883
510 Ga0209563_103671 3300025230 Bacteria 3118
511 Ga0207427_101232 3300025231 Bacteria 9812
512 Ga0209258_100058 3300025242 Bacteria 331567
513 Ga0209258_100353 3300025242 Bacteria 63996
514 Ga0207425_1000218 3300025245 Bacteria 45206
515 Ga0207425_1001283 3300025245 Bacteria 10899
516 Ga0207425_1002538 3300025245 Bacteria 6365
517 Ga0207425_1006474 3300025245 Bacteria 3201
518 Ga0207425_1012416 3300025245 Bacteria 1999
519 Ga0207425_1015207 3300025245 Bacteria 1732
520 Ga0209646_1000001 3300025246 Bacteria 3092932
521 Ga0209646_1000053 3300025246 Bacteria 284737
522 Ga0209026_1000003 3300025250 Bacteria 1060571
523 Ga0209026_1000020 3300025250 Bacteria 376211
524 Ga0209026_1002653 3300025250 Bacteria 6505
525 Ga0209677_100132 3300025253 Bacteria 72060
526 Ga0209677_100161 3300025253 Bacteria 59768
527 Ga0209677_103481 3300025253 Bacteria 5069
528 Ga0209148_1000071 3300025254 Bacteria 331551
529 Ga0209148_1003552 3300025254 Bacteria 4233
530 Ga0209759_1000001 3300025256 Bacteria 2799452
531 Ga0209759_1000017 3300025256 Bacteria 376232
532 Ga0209759_1000913 3300025256 Bacteria 21908
533 Ga0209759_1001199 3300025256 Bacteria 16128
534 Ga0209759_1002284 3300025256 Bacteria 8656
535 Ga0209129_1000023 3300025258 Bacteria 420646
536 Ga0209129_1000041 3300025258 Bacteria 307590
537 Ga0209129_1001863 3300025258 Bacteria 11142
538 Ga0209129_1007583 3300025258 Bacteria 3196
539 Ga0209129_1008749 3300025258 Bacteria 2767
540 Ga0209565_1000004 3300025263 Bacteria 983150
541 Ga0209565_1000075 3300025263 Bacteria 162259
542 Ga0209565_1000327 3300025263 Bacteria 42380
543 Ga0209565_1000609 3300025263 Bacteria 23714
544 Ga0209565_1000693 3300025263 Bacteria 20872
545 Ga0209565_1003001 3300025263 Bacteria 5719
546 Ga0209455_1000136 3300025272 Bacteria 146375
547 Ga0209673_1000066 3300025273 Bacteria 250037
548 Ga0209673_1000289 3300025273 Bacteria 93941
549 Ga0209673_1000357 3300025273 Bacteria 82249
550 Ga0209673_1000362 3300025273 Bacteria 81651
551 Ga0209673_1000798 3300025273 Bacteria 41767
552 Ga0209673_1006734 3300025273 Bacteria 5472
553 Ga0209673_1009202 3300025273 Bacteria 4307
554 Ga0209673_1009683 3300025273 Bacteria 4141
555 Ga0209673_1017231 3300025273 Bacteria 2668
556 Ga0209673_1019046 3300025273 Bacteria 2476
557 Ga0209130_1000069 3300025284 Bacteria 179177
558 Ga0209130_1000082 3300025284 Bacteria 164441
559 Ga0209130_1000094 3300025284 Bacteria 145569
560 Ga0209130_1002257 3300025284 Bacteria 9954
561 Ga0209130_1003786 3300025284 Bacteria 6155
562 Ga0209675_1000061 3300025291 Bacteria 181096
563 Ga0209675_1000074 3300025291 Bacteria 162260
564 Ga0209675_1000177 3300025291 Bacteria 73574
565 Ga0209675_1000325 3300025291 Bacteria 42380
566 Ga0209675_1001059 3300025291 Bacteria 17058
567 Ga0209675_1001796 3300025291 Bacteria 11724
568 Ga0209675_1004674 3300025291 Bacteria 6008
569 Ga0209675_1005211 3300025291 Bacteria 5510
570 Ga0209675_1012304 3300025291 Bacteria 2769
571 Ga0209676_1000005 3300025292 Bacteria 1076001
572 Ga0209676_1000029 3300025292 Bacteria 520536
573 Ga0209676_1000105 3300025292 Bacteria 224151
574 Ga0209676_1000142 3300025292 Bacteria 175752
575 Ga0209676_1000186 3300025292 Bacteria 142440
576 Ga0209676_1003917 3300025292 Bacteria 8635
577 Ga0209676_1017519 3300025292 Bacteria 2532
578 Ga0209025_1000351 3300025294 Bacteria 99585
579 Ga0209025_1000579 3300025294 Bacteria 66370
580 Ga0209025_1000644 3300025294 Bacteria 61330
581 Ga0209025_1005852 3300025294 Bacteria 9833
582 Ga0209025_1010713 3300025294 Bacteria 6167
583 Ga0209025_1022914 3300025294 Bacteria 3290
584 Ga0209025_1027340 3300025294 Bacteria 2831
585 Ga0209564_1000003 3300025295 Bacteria 1585848
586 Ga0209564_1000029 3300025295 Bacteria 505995
587 Ga0209564_1000090 3300025295 Bacteria 249298
588 Ga0209564_1000527 3300025295 Bacteria 62263
589 Ga0209564_1005458 3300025295 Bacteria 7254
590 Ga0209564_1005474 3300025295 Bacteria 7234
591 Ga0209564_1009963 3300025295 Bacteria 4441
592 Ga0209564_1022209 3300025295 Bacteria 2251
593 Ga0209758_1000043 3300025297 Bacteria 402310
594 Ga0209758_1000044 3300025297 Bacteria 398448
595 Ga0209758_1000057 3300025297 Bacteria 333111
596 Ga0209758_1020115 3300025297 Bacteria 3177
597 Ga0209758_1041408 3300025297 Bacteria 1722
598 Ga0209050_1000003 3300025298 Bacteria 1609245
599 Ga0209050_1000007 3300025298 Bacteria 1187891
600 Ga0209050_1000082 3300025298 Bacteria 266864
601 Ga0209050_1000149 3300025298 Bacteria 163252
602 Ga0209050_1000569 3300025298 Bacteria 59887
603 Ga0209050_1001141 3300025298 Bacteria 31960
604 Ga0209050_1001330 3300025298 Bacteria 27524
605 Ga0209050_1004588 3300025298 Bacteria 9259
606 Ga0209050_1005248 3300025298 Bacteria 8259
607 Ga0209050_1006884 3300025298 Bacteria 6593
608 Ga0209256_1000001 3300025299 Bacteria 2166974
609 Ga0209256_1000020 3300025299 Bacteria 542402
610 Ga0209256_1000022 3300025299 Bacteria 481843
611 Ga0209256_1000024 3300025299 Bacteria 448909
612 Ga0209256_1002170 3300025299 Bacteria 16860
613 Ga0209256_1002204 3300025299 Bacteria 16682
614 Ga0207426_1000001 3300025302 Bacteria 1341301
615 Ga0207426_1000025 3300025302 Bacteria 532921
616 Ga0207426_1000031 3300025302 Bacteria 460699
617 Ga0207426_1001168 3300025302 Bacteria 23518
618 Ga0209051_1000003 3300025303 Bacteria 1609245
619 Ga0209051_1000029 3300025303 Bacteria 403675
620 Ga0209051_1000036 3300025303 Bacteria 339863
621 Ga0209051_1000063 3300025303 Bacteria 249739
622 Ga0209051_1000064 3300025303 Bacteria 231735
623 Ga0209051_1000078 3300025303 Bacteria 201965
624 Ga0209051_1000213 3300025303 Bacteria 98755
625 Ga0209051_1000243 3300025303 Bacteria 91605
626 Ga0209051_1000455 3300025303 Bacteria 54195
627 Ga0209051_1001500 3300025303 Bacteria 19504
628 Ga0209051_1004021 3300025303 Bacteria 9305
629 Ga0209051_1006392 3300025303 Bacteria 6651
630 Ga0209051_1006879 3300025303 Bacteria 6318
631 Ga0209051_1008919 3300025303 Bacteria 5238
632 Ga0209257_1000011 3300025304 Bacteria 1112630
633 Ga0209257_1000012 3300025304 Bacteria 1111138
634 Ga0209257_1000018 3300025304 Bacteria 836016
635 Ga0209257_1000021 3300025304 Bacteria 771986
636 Ga0209257_1000030 3300025304 Bacteria 689812
637 Ga0209257_1000109 3300025304 Bacteria 239439
638 Ga0209257_1000118 3300025304 Bacteria 225963
639 Ga0209257_1000226 3300025304 Bacteria 133836
640 Ga0209257_1000980 3300025304 Bacteria 38745
641 Ga0209257_1002930 3300025304 Bacteria 15721
642 Ga0209257_1003485 3300025304 Bacteria 13420
643 Ga0209257_1018343 3300025304 Bacteria 2698
644 Ga0209257_1019700 3300025304 Bacteria 2527
645 Ga0207697_10006077 3300025315 Bacteria 5519
646 Ga0207697_10020917 3300025315 Bacteria 2679
647 Ga0207697_10023400 3300025315 Bacteria 2529
648 Ga0207697_10055501 3300025315 Bacteria 1642
649 Ga0207656_10003985 3300025321 Bacteria 5119
650 Ga0207656_10012705 3300025321 Bacteria 3206
651 Ga0207656_10013411 3300025321 Bacteria 3132
652 Ga0207656_10020257 3300025321 Bacteria 2642
653 Ga0207656_10025458 3300025321 Bacteria 2402
654 Ga0207696_1015363 3300025711 Bacteria 2598
655 Ga0207655_1026542 3300025728 Bacteria 2780
656 Ga0207682_10000759 3300025893 Bacteria 14883
657 Ga0207682_10013091 3300025893 Bacteria 3233
658 Ga0207642_10029763 3300025899 Bacteria 2265
659 Ga0207680_10001601 3300025903 Bacteria 10703
660 Ga0207645_10003471 3300025907 Bacteria 11944
661 Ga0207645_10004926 3300025907 Bacteria 9791
662 Ga0207645_10011577 3300025907 Bacteria 6015
663 Ga0207645_10012714 3300025907 Bacteria 5707
664 Ga0207645_10018093 3300025907 Bacteria 4644
665 Ga0207645_10028617 3300025907 Bacteria 3597
666 Ga0207643_10012919 3300025908 Bacteria 4516
667 Ga0207705_10123016 3300025909 Bacteria 1927
668 Ga0207684_10011095 3300025910 Bacteria 7887
669 Ga0207654_10034398 3300025911 Bacteria 2815
670 Ga0207695_10002904 3300025913 Bacteria 24801
671 Ga0207695_10018222 3300025913 Bacteria 8125
672 Ga0207695_10155131 3300025913 Bacteria 2225
673 Ga0207671_10005965 3300025914 Bacteria 11041
674 Ga0207671_10103190 3300025914 Bacteria 2162
675 Ga0207662_10029873 3300025918 Bacteria 3160
676 Ga0207657_10035067 3300025919 Bacteria 4504
677 Ga0207657_10050686 3300025919 Bacteria 3611
678 Ga0207657_10056390 3300025919 Bacteria 3390
679 Ga0207657_10129827 3300025919 Bacteria 2066
680 Ga0207649_10009799 3300025920 Bacteria 5249
681 Ga0207649_10097267 3300025920 Bacteria 1941
682 Ga0207652_10015168 3300025921 Bacteria 6252
683 Ga0207652_10139706 3300025921 Bacteria 2165
684 Ga0207646_10157201 3300025922 Bacteria 2051
685 Ga0207681_10000899 3300025923 Bacteria 19447
686 Ga0207681_10010511 3300025923 Bacteria 5669
687 Ga0207694_10016398 3300025924 Bacteria 5594
688 Ga0207694_10034080 3300025924 Bacteria 3903
689 Ga0207694_10043051 3300025924 Bacteria 3484
690 Ga0207694_10149216 3300025924 Bacteria 1883
691 Ga0207650_10000878 3300025925 Bacteria 22741
692 Ga0207650_10002442 3300025925 Bacteria 12942
693 Ga0207650_10014659 3300025925 Bacteria 5445
694 Ga0207650_10140005 3300025925 Bacteria 1901
695 Ga0207659_10000135 3300025926 Bacteria 43365
696 Ga0207659_10000207 3300025926 Bacteria 35338
697 Ga0207659_10001596 3300025926 Bacteria 13455
698 Ga0207659_10006224 3300025926 Bacteria 7300
699 Ga0207659_10032239 3300025926 Bacteria 3594
700 Ga0207659_10141460 3300025926 Bacteria 1868
701 Ga0207659_10259042 3300025926 Bacteria 1414
702 Ga0207687_10015611 3300025927 Bacteria 4982
703 Ga0207687_10098169 3300025927 Bacteria 2150
704 Ga0207644_10001220 3300025931 Bacteria 16541
705 Ga0207644_10001228 3300025931 Bacteria 16510
706 Ga0207644_10021457 3300025931 Bacteria 4400
707 Ga0207644_10041528 3300025931 Bacteria 3254
708 Ga0207644_10046621 3300025931 Bacteria 3089
709 Ga0207644_10244143 3300025931 Bacteria 1431
710 Ga0207690_10000359 3300025932 Bacteria 30319
711 Ga0207690_10039046 3300025932 Bacteria 3095
712 Ga0207690_10102670 3300025932 Bacteria 2045
713 Ga0207690_10224641 3300025932 Bacteria 1438
714 Ga0207706_10000654 3300025933 Bacteria 36592
715 Ga0207706_10002883 3300025933 Bacteria 16654
716 Ga0207706_10002944 3300025933 Bacteria 16449
717 Ga0207706_10017782 3300025933 Bacteria 6403
718 Ga0207706_10073320 3300025933 Bacteria 3010
719 Ga0207706_10078450 3300025933 Bacteria 2904
720 Ga0207706_10200717 3300025933 Bacteria 1749
721 Ga0207686_10013697 3300025934 Bacteria 4493
722 Ga0207686_10025763 3300025934 Bacteria 3426
723 Ga0207686_10073882 3300025934 Bacteria 2201
724 Ga0207709_10000038 3300025935 Bacteria 266638
725 Ga0207709_10000147 3300025935 Bacteria 97401
726 Ga0207709_10000214 3300025935 Bacteria 74364
727 Ga0207709_10004723 3300025935 Bacteria 7828
728 Ga0207709_10009501 3300025935 Bacteria 5351
729 Ga0207709_10020370 3300025935 Bacteria 3741
730 Ga0207709_10032522 3300025935 Bacteria 3055
731 Ga0207670_10039836 3300025936 Bacteria 3080
732 Ga0207669_10001219 3300025937 Bacteria 10928
733 Ga0207669_10001590 3300025937 Bacteria 9667
734 Ga0207669_10004703 3300025937 Bacteria 6041
735 Ga0207669_10006838 3300025937 Bacteria 5244
736 Ga0207669_10009417 3300025937 Bacteria 4650
737 Ga0207669_10013232 3300025937 Bacteria 4090
738 Ga0207669_10021720 3300025937 Bacteria 3394
739 Ga0207669_10052263 3300025937 Bacteria 2453
740 Ga0207704_10002775 3300025938 Bacteria 7905
741 Ga0207704_10005625 3300025938 Bacteria 5785
742 Ga0207704_10029924 3300025938 Bacteria 3046
743 Ga0207691_10001187 3300025940 Bacteria 25907
744 Ga0207691_10001712 3300025940 Bacteria 21616
745 Ga0207691_10039447 3300025940 Bacteria 4369
746 Ga0207691_10133271 3300025940 Bacteria 2193
747 Ga0207691_10150673 3300025940 Bacteria 2045
748 Ga0207711_10004508 3300025941 Bacteria 11863
749 Ga0207711_10045951 3300025941 Bacteria 3731
750 Ga0207711_10048324 3300025941 Bacteria 3640
751 Ga0207711_10120738 3300025941 Bacteria 2339
752 Ga0207711_10144084 3300025941 Bacteria 2145
753 Ga0207689_10005835 3300025942 Bacteria 10916
754 Ga0207689_10006945 3300025942 Bacteria 9952
755 Ga0207689_10023078 3300025942 Bacteria 5225
756 Ga0207689_10101824 3300025942 Bacteria 2359
757 Ga0207689_10153379 3300025942 Bacteria 1899
758 Ga0207661_10012975 3300025944 Bacteria 6080
759 Ga0207679_10000220 3300025945 Bacteria 45059
760 Ga0207679_10003707 3300025945 Bacteria 9470
761 Ga0207679_10017872 3300025945 Bacteria 4741
762 Ga0207679_10072079 3300025945 Bacteria 2608
763 Ga0207667_10025000 3300025949 Bacteria 6547
764 Ga0207667_10054838 3300025949 Bacteria 4192
765 Ga0207667_10103527 3300025949 Bacteria 2936
766 Ga0207651_10000798 3300025960 Bacteria 13560
767 Ga0207651_10002450 3300025960 Bacteria 8878
768 Ga0207651_10013478 3300025960 Bacteria 4680
769 Ga0207651_10018259 3300025960 Bacteria 4168
770 Ga0207651_10047090 3300025960 Bacteria 2904
771 Ga0207651_10047832 3300025960 Bacteria 2887
772 Ga0207651_10055284 3300025960 Bacteria 2725
773 Ga0207651_10110123 3300025960 Bacteria 2065
774 Ga0207712_10000828 3300025961 Bacteria 22710
775 Ga0207668_10001541 3300025972 Bacteria 13480
776 Ga0207668_10014399 3300025972 Bacteria 4894
777 Ga0207668_10025183 3300025972 Bacteria 3848
778 Ga0207668_10117088 3300025972 Bacteria 2010
779 Ga0207668_10183343 3300025972 Bacteria 1653
780 Ga0207640_10006017 3300025981 Bacteria 6631
781 Ga0207640_10095449 3300025981 Bacteria 2071
782 Ga0207658_10000860 3300025986 Bacteria 25382
783 Ga0207658_10003454 3300025986 Bacteria 11183
784 Ga0207658_10005178 3300025986 Bacteria 8976
785 Ga0207658_10056497 3300025986 Bacteria 2913
786 Ga0207677_10005607 3300026023 Bacteria 6819
787 Ga0207677_10012083 3300026023 Bacteria 4948
788 Ga0207677_10014359 3300026023 Bacteria 4623
789 Ga0207677_10015442 3300026023 Bacteria 4492
790 Ga0207677_10026317 3300026023 Bacteria 3646
791 Ga0207677_10079217 3300026023 Bacteria 2349
792 Ga0207677_10153967 3300026023 Bacteria 1778
793 Ga0207703_10001624 3300026035 Bacteria 20249
794 Ga0207703_10002139 3300026035 Bacteria 17362
795 Ga0207703_10009455 3300026035 Bacteria 7654
796 Ga0207639_10039741 3300026041 Bacteria 3507
797 Ga0207678_10160314 3300026067 Bacteria 1921
798 Ga0207678_10199620 3300026067 Bacteria 1710
799 Ga0207708_10073767 3300026075 Bacteria 2616
800 Ga0207708_10075749 3300026075 Bacteria 2580
801 Ga0207702_10002918 3300026078 Bacteria 16003
802 Ga0207702_10011208 3300026078 Bacteria 7478
803 Ga0207702_10099543 3300026078 Bacteria 2563
804 Ga0207702_10240766 3300026078 Bacteria 1695
805 Ga0207641_10001135 3300026088 Bacteria 26751
806 Ga0207641_10005572 3300026088 Bacteria 10729
807 Ga0207641_10019756 3300026088 Bacteria 5530
808 Ga0207641_10020064 3300026088 Bacteria 5488
809 Ga0207641_10036047 3300026088 Bacteria 4127
810 Ga0207641_10052146 3300026088 Bacteria 3464
811 Ga0207641_10070520 3300026088 Bacteria 3003
812 Ga0207641_10218443 3300026088 Bacteria 1766
813 Ga0207641_10314327 3300026088 Bacteria 1483
814 Ga0207648_10000062 3300026089 Bacteria 99889
815 Ga0207648_10002388 3300026089 Bacteria 20214
816 Ga0207648_10004104 3300026089 Bacteria 15074
817 Ga0207648_10006529 3300026089 Bacteria 11575
818 Ga0207648_10007879 3300026089 Bacteria 10392
819 Ga0207648_10022340 3300026089 Bacteria 5684
820 Ga0207648_10076245 3300026089 Bacteria 2923
821 Ga0207648_10144260 3300026089 Bacteria 2100
822 Ga0207648_10148564 3300026089 Bacteria 2068
823 Ga0207648_10159701 3300026089 Bacteria 1991
824 Ga0207676_10001093 3300026095 Bacteria 20538
825 Ga0207676_10007428 3300026095 Bacteria 7772
826 Ga0207676_10026622 3300026095 Bacteria 4301
827 Ga0207676_10037688 3300026095 Bacteria 3686
828 Ga0207676_10108534 3300026095 Bacteria 2317
829 Ga0207674_10001725 3300026116 Bacteria 27953
830 Ga0207674_10015020 3300026116 Bacteria 8530
831 Ga0207674_10041759 3300026116 Bacteria 4741
832 Ga0207674_10052794 3300026116 Bacteria 4145
833 Ga0207674_10112297 3300026116 Bacteria 2699
834 Ga0207675_100000868 3300026118 Bacteria 30104
835 Ga0207675_100002203 3300026118 Bacteria 19364
836 Ga0207675_100004188 3300026118 Bacteria 13958
837 Ga0207675_100005109 3300026118 Bacteria 12629
838 Ga0207683_10001181 3300026121 Bacteria 23629
839 Ga0207683_10023663 3300026121 Bacteria 5284
840 Ga0207683_10044028 3300026121 Bacteria 3901
841 Ga0207683_10044881 3300026121 Bacteria 3864
842 Ga0207683_10046127 3300026121 Bacteria 3812
843 Ga0207683_10108741 3300026121 Bacteria 2481
844 Ga0207683_10164978 3300026121 Bacteria 2004
845 Ga0207683_10177045 3300026121 Bacteria 1933
846 Ga0207683_10181255 3300026121 Bacteria 1910
847 Ga0207698_10004390 3300026142 Bacteria 8592
848 Ga0207698_10012848 3300026142 Bacteria 5500
849 Ga0207698_10024454 3300026142 Bacteria 4239
850 Ga0207698_10051797 3300026142 Bacteria 3140
851 Ga0207698_10099612 3300026142 Bacteria 2404
852 Ga0207698_10134379 3300026142 Bacteria 2120
853 Ga0207698_10200427 3300026142 Bacteria 1787
854 Ga0207698_10273412 3300026142 Bacteria 1559
855 Ga0209281_1000005 3300027111 Bacteria 1242284
856 Ga0209281_1000149 3300027111 Bacteria 167880
857 Ga0209389_1010627 3300027296 Bacteria 8307
858 Ga0209984_1002311 3300027424 Bacteria 2126
859 Ga0209968_1000125 3300027526 Bacteria 13613
860 Ga0209970_1000690 3300027614 Bacteria 5862
861 Ga0209282_1000228 3300027666 Bacteria 29111
862 Ga0209282_1000864 3300027666 Bacteria 15661
863 Ga0209971_1007153 3300027682 Bacteria 2646
864 Ga0209966_1000014 3300027695 Bacteria 81913
865 Ga0209974_10001071 3300027876 Bacteria 9696
866 Ga0209974_10014591 3300027876 Bacteria 2612
867 Ga0268266_10072143 3300028379 Bacteria 2993
868 Ga0268265_10030110 3300028380 Bacteria 3905
869 Ga0268265_10042246 3300028380 Bacteria 3381
870 Ga0268265_10083622 3300028380 Bacteria 2528
871 Ga0268264_10001193 3300028381 Bacteria 25104
872 Ga0268264_10001745 3300028381 Bacteria 19956
873 Ga0268264_10023892 3300028381 Bacteria 4986
874 Ga0268264_10093386 3300028381 Bacteria 2599
875 Ga0268264_10116829 3300028381 Bacteria 2345
876 Ga0268264_10126132 3300028381 Bacteria 2262
877 Ga0265336_10000012 3300028666 Bacteria 261478
878 Ga0307517_10001025 3300028786 Bacteria 47474
879 Ga0307515_10000064 3300028794 Bacteria 245452
880 Ga0307515_10000137 3300028794 Bacteria 173516
881 Ga0307515_10000139 3300028794 Bacteria 173074
882 Ga0307515_10000187 3300028794 Bacteria 151904
883 Ga0307515_10000727 3300028794 Bacteria 75922
884 Ga0307515_10000998 3300028794 Bacteria 64720
885 Ga0307515_10001587 3300028794 Bacteria 50732
886 Ga0307515_10002977 3300028794 Bacteria 35954
887 Ga0307515_10007083 3300028794 Bacteria 22277
888 Ga0307515_10014464 3300028794 Bacteria 14626
889 Ga0307515_10021785 3300028794 Bacteria 11339
890 Ga0307515_10068465 3300028794 Bacteria 4876
891 Ga0307515_10110315 3300028794 Bacteria 3221
892 Ga0265324_10003636 3300029957 Bacteria 7236
893 Ga0307512_10049207 3300030522 Bacteria 3402
894 Ga0314311_1018086 3300030733 Bacteria 2224
895 Ga0316178_1128022 3300030735 Bacteria 6105
896 Ga0316180_1003872 3300030736 Bacteria 2649
897 Ga0316183_1046777 3300030742 Bacteria 3782
898 Ga0316181_1014423 3300030744 Bacteria 6558
899 Ga0265330_10000117 3300031235 Bacteria 63961
900 Ga0265332_10000002 3300031238 Bacteria 709510
901 Ga0265332_10000033 3300031238 Bacteria 153334
902 Ga0265332_10000125 3300031238 Bacteria 63932
903 Ga0265331_10001854 3300031250 Bacteria 14925
904 Ga0265327_10000309 3300031251 Bacteria 94387
905 Ga0265327_10000779 3300031251 Bacteria 49235
906 Ga0265327_10001589 3300031251 Bacteria 27701
907 Ga0265327_10011830 3300031251 Bacteria 5962
908 Ga0265316_10000833 3300031344 Bacteria 34174
909 Ga0307513_10000019 3300031456 Bacteria 231194
910 Ga0307513_10000051 3300031456 Bacteria 149733
911 Ga0307513_10002833 3300031456 Bacteria 23769
912 Ga0307513_10007462 3300031456 Bacteria 14170
913 Ga0307513_10008369 3300031456 Bacteria 13245
914 Ga0307513_10058693 3300031456 Bacteria 4087
915 Ga0307513_10310883 3300031456 Bacteria 1338
916 Ga0307509_10000092 3300031507 Bacteria 124019
917 Ga0307509_10003532 3300031507 Bacteria 23562
918 Ga0307509_10037154 3300031507 Bacteria 5325
919 Ga0307509_10038946 3300031507 Bacteria 5181
920 Ga0307509_10056231 3300031507 Bacteria 4177
921 Ga0307509_10095060 3300031507 Bacteria 3037
922 Ga0307509_10103755 3300031507 Bacteria 2870
923 Ga0307509_10146780 3300031507 Bacteria 2283
924 Ga0307408_100000008 3300031548 Bacteria 456355
925 Ga0307408_100000407 3300031548 Bacteria 38725
926 Ga0307408_100006921 3300031548 Bacteria 7505
927 Ga0307408_100025292 3300031548 Bacteria 4066
928 Ga0307408_100051504 3300031548 Bacteria 2965
929 Ga0307408_100071443 3300031548 Bacteria 2566
930 Ga0307408_100075069 3300031548 Bacteria 2511
931 Ga0307408_100119969 3300031548 Bacteria 2035
932 Ga0307408_100124722 3300031548 Bacteria 2000
933 Ga0307508_10000004 3300031616 Bacteria 287547
934 Ga0307508_10001570 3300031616 Bacteria 25499
935 Ga0307514_10003976 3300031649 Bacteria 13806
936 Ga0307514_10040375 3300031649 Bacteria 3679
937 Ga0307514_10040483 3300031649 Bacteria 3673
938 Ga0265314_10000012 3300031711 Bacteria 415184
939 Ga0265314_10147752 3300031711 Bacteria 1445
940 Ga0307516_10000109 3300031730 Bacteria 94762
941 Ga0307516_10003586 3300031730 Bacteria 19792
942 Ga0307516_10005086 3300031730 Bacteria 15898
943 Ga0307516_10007069 3300031730 Bacteria 12982
944 Ga0307516_10019753 3300031730 Bacteria 6971
945 Ga0307516_10050860 3300031730 Bacteria 4063
946 Ga0307516_10172547 3300031730 Bacteria 1902
947 Ga0307516_10210361 3300031730 Bacteria 1660
948 Ga0307405_10062736 3300031731 Bacteria 2354
949 Ga0307405_10123767 3300031731 Bacteria 1774
950 Ga0307405_10154149 3300031731 Bacteria 1619
951 Ga0307405_10185738 3300031731 Bacteria 1496
952 Ga0307413_10145654 3300031824 Bacteria 1643
953 Ga0307410_10005512 3300031852 Bacteria 6707
954 Ga0307406_10000050 3300031901 Bacteria 66438
955 Ga0307406_10000440 3300031901 Bacteria 24253
956 Ga0307406_10003882 3300031901 Bacteria 8142
957 Ga0307406_10004637 3300031901 Bacteria 7485
958 Ga0307406_10071343 3300031901 Bacteria 2276
959 Ga0307412_10013847 3300031911 Bacteria 4741
960 Ga0307412_10029763 3300031911 Bacteria 3430
961 Ga0307412_10088191 3300031911 Bacteria 2163
962 Ga0307409_100004771 3300031995 Bacteria 7684
963 Ga0307409_100048315 3300031995 Bacteria 3237
964 Ga0307416_100003421 3300032002 Bacteria 9318
965 Ga0307416_100013163 3300032002 Bacteria 5613
966 Ga0307416_100073184 3300032002 Bacteria 2856
967 Ga0307414_10007644 3300032004 Bacteria 6084
968 Ga0307414_10023583 3300032004 Bacteria 3906
969 Ga0307414_10030258 3300032004 Bacteria 3534
970 Ga0307414_10092110 3300032004 Bacteria 2255
971 Ga0307414_10117542 3300032004 Bacteria 2037
972 Ga0307414_10129557 3300032004 Bacteria 1956
973 Ga0307411_10005288 3300032005 Bacteria 6322
974 Ga0307411_10014448 3300032005 Bacteria 4393
975 Ga0307411_10110231 3300032005 Bacteria 1967
976 Ga0307411_10113643 3300032005 Bacteria 1943
977 Ga0307411_10155332 3300032005 Bacteria 1706
978 Ga0307415_100007187 3300032126 Bacteria 6073
979 Ga0307507_10012966 3300033179 Bacteria 10205
980 Ga0307507_10048731 3300033179 Bacteria 4116
981 Ga0307510_10002759 3300033180 Bacteria 20117
982 Ga0373934_0006495 3300035086 Bacteria 4339
983 Ga0373932_0012678 3300035112 Bacteria 2080
984 Ga0373939_0000008 3300035114 Bacteria 77597
985 Ga0373957_0091396 3300035120 Bacteria 1210
986 Ga0373931_0000533 3300035691 Bacteria 15615
987 Ga0373931_0025052 3300035691 Bacteria 3029
988 Ga0373937_0025203 3300036401 Bacteria 5370
989 Ga0373925_0003362 3300037068 Bacteria 12410
990 Ga0373925_0147863 3300037068 Bacteria 1843
991 Ga0395899_0000992 3300037312 Bacteria 26097
992 Ga0395899_0013417 3300037312 Bacteria 6269
993 Ga0395899_0025496 3300037312 Bacteria 4463
994 Ga0395899_0027819 3300037312 Bacteria 4260
995 Ga0395900_0004787 3300037418 Bacteria 14263
996 Ga0395900_0020937 3300037418 Bacteria 6683
997 Ga0395900_0026497 3300037418 Bacteria 5936
998 Ga0395900_0029664 3300037418 Bacteria 5612
999 Ga0395900_0079616 3300037418 Bacteria 3367
1000 Ga0395898_0006328 3300037466 Bacteria 12651
1001 Ga0395898_0036706 3300037466 Bacteria 4865
1002 Ga0395898_0054593 3300037466 Bacteria 3898
1003 Ga0395905_0000148 3300037471 Bacteria 116301
1004 Ga0395905_0000382 3300037471 Bacteria 63066
1005 Ga0395905_0002029 3300037471 Bacteria 23136
1006 Ga0395905_0003923 3300037471 Bacteria 15650
1007 Ga0395905_0005758 3300037471 Bacteria 12595
1008 Ga0395905_0006766 3300037471 Bacteria 11482
1009 Ga0395905_0015358 3300037471 Bacteria 7278
1010 Ga0395905_0017190 3300037471 Bacteria 6870
1011 Ga0395905_0021027 3300037471 Bacteria 6179
1012 Ga0395905_0029796 3300037471 Bacteria 5143
1013 Ga0395905_0032872 3300037471 Bacteria 4876
1014 Ga0395905_0050244 3300037471 Bacteria 3907
1015 Ga0395905_0054783 3300037471 Bacteria 3732
1016 Ga0395905_0084413 3300037471 Bacteria 2975
1017 Ga0395905_0095056 3300037471 Bacteria 2796
1018 Ga0395901_0010348 3300038443 Bacteria 9448
1019 Ga0395901_0034728 3300038443 Bacteria 5208
1020 Ga0395901_0049039 3300038443 Bacteria 4386
1021 Ga0395901_0106293 3300038443 Bacteria 2946
1022 Ga0395901_0150472 3300038443 Bacteria 2446
1023 Ga0395901_0327295 3300038443 Bacteria 1585
1024 Ga0436365_0538258 3300039437 Bacteria 1412
1025 Ga0436361_0026531 3300039447 Bacteria 11861
1026 Ga0436361_0258710 3300039447 Bacteria 1489
1027 Ga0436361_0572364 3300039447 Bacteria 7145
1028 Ga0436361_0848510 3300039447 Bacteria 27411
1029 Ga0436363_0660497 3300039450 Bacteria 10660
1030 Ga0439436_0016367 3300041404 Bacteria 2225
1031 Ga0439439_0011910 3300041406 Bacteria 2097
1032 Ga0439447_025116 3300041407 Bacteria 1537
1033 Ga0439466_0015578 3300041411 Bacteria 2761
1034 Ga0451789_0102886 3300041443 Bacteria 3368
1035 Ga0451789_0982253 3300041443 Bacteria 2279
1036 Ga0451798_0381267 3300041458 Bacteria 3331
1037 Ga0451802_1471416 3300041460 Bacteria 1826
1038 Ga0451804_0153252 3300041463 Bacteria 2499
1039 Ga0451851_0707665 3300041507 Bacteria 1935
1040 Ga0439437_004350 3300042000 Bacteria 1543
1041 Ga0439445_0013762 3300042004 Bacteria 1961
1042 Ga0439432_021391 3300042006 Bacteria 2145
1043 Ga0439432_037869 3300042006 Bacteria 1537
1044 Ga0439449_0001661 3300042007 Bacteria 8742
1045 Ga0439449_0002564 3300042007 Bacteria 7100
1046 Ga0439449_0002664 3300042007 Bacteria 6951
1047 Ga0439449_0062728 3300042007 Bacteria 1371
1048 Ga0439452_010143 3300042010 Bacteria 2751
1049 Ga0439462_0001024 3300042015 Bacteria 5994
1050 Ga0450911_001627 3300042115 Bacteria 5005
1051 Ga0450917_000573 3300042120 Bacteria 2755
1052 Ga0450923_009925 3300042125 Bacteria 1677
1053 Ga0450888_000521 3300042126 Bacteria 3636
1054 Ga0450890_000453 3300042127 Bacteria 5991
1055 Ga0450892_001840 3300042130 Bacteria 1916
1056 Ga0439446_0014972 3300042156 Bacteria 2147
1057 Ga0439459_0004826 3300042438 Bacteria 2186
1058 Ga0439464_0004333 3300042439 Bacteria 3627
1059 Ga0450893_0001792 3300042532 Bacteria 3307
1060 Ga0451577_0000114 3300042876 Bacteria 175957
1061 Ga0451577_0001993 3300042876 Bacteria 25464
1062 Ga0451577_0003232 3300042876 Bacteria 18320
1063 Ga0451577_0028693 3300042876 Bacteria 5031
1064 Ga0451577_0099799 3300042876 Bacteria 2593
1065 Ga0451577_0242541 3300042876 Bacteria 1631
1066 Ga0466969_0000002 3300044656 Bacteria 178693
1067 Ga0466969_0004958 3300044656 Bacteria 7088
1068 Ga0466969_0010775 3300044656 Bacteria 4842
1069 Ga0466972_0001432 3300044658 Bacteria 11582
1070 Ga0466972_0001996 3300044658 Bacteria 9985
1071 Ga0453683_0016380 3300044673 Bacteria 4782
1072 Ga0466965_0008514 3300044683 Bacteria 4744
1073 Ga0466966_0005727 3300044684 Bacteria 8181
1074 Ga0466966_0024374 3300044684 Bacteria 3958
1075 Ga0466966_0026318 3300044684 Bacteria 3798
1076 Ga0466966_0136381 3300044684 Bacteria 1500
1077 Ga0466961_0010534 3300044693 Bacteria 5896
1078 Ga0466961_0023826 3300044693 Bacteria 3938
1079 Ga0466961_0061473 3300044693 Bacteria 2387
1080 Ga0466964_0001984 3300044706 Bacteria 7181
1081 Ga0466964_0002512 3300044706 Bacteria 6523
1082 Ga0466964_0019378 3300044706 Bacteria 2614
1083 Ga0453684_0000606 3300044712 Bacteria 132056
1084 Ga0453684_0006765 3300044712 Bacteria 21578
1085 Ga0453684_0029871 3300044712 Bacteria 7721
1086 Ga0453684_0073573 3300044712 Bacteria 4306
1087 Ga0453684_0099934 3300044712 Bacteria 3552
1088 Ga0453684_0256555 3300044712 Bacteria 2005
1089 Ga0453684_0331768 3300044712 Bacteria 1720
1090 Ga0466971_0010968 3300044719 Bacteria 3964
1091 Ga0466970_0011589 3300044765 Bacteria 4497
1092 Ga0466970_0015713 3300044765 Bacteria 3897
1093 Ga0466957_0001959 3300044842 Bacteria 10945
1094 Ga0466957_0025793 3300044842 Bacteria 3484
1095 Ga0466959_0000666 3300045049 Bacteria 20034
1096 Ga0466959_0003830 3300045049 Bacteria 9978
1097 Ga0466959_0008467 3300045049 Bacteria 7274
1098 Ga0466959_0019965 3300045049 Bacteria 4931
1099 Ga0466959_0050801 3300045049 Bacteria 3043
1100 Ga0451576_0001159 3300045051 Bacteria 47493
1101 Ga0451576_0024264 3300045051 Bacteria 6552
1102 Ga0451576_0185201 3300045051 Bacteria 2174
1103 Ga0451576_0230389 3300045051 Bacteria 1935
1104 Ga0466958_0018392 3300045836 Bacteria 4055
1105 Ga0466967_0006653 3300045976 Bacteria 8218
1106 Ga0495592_0000085 3300046454 Bacteria 82502
1107 Ga0495590_0030763 3300046457 Bacteria 1881
1108 Ga0495629_0100170 3300046459 Bacteria 2022
1109 Ga0495650_0008300 3300046471 Bacteria 6083
1110 Ga0495650_0014309 3300046471 Bacteria 4136
1111 Ga0495639_0014497 3300046475 Bacteria 3413
1112 Ga0495639_0061082 3300046475 Bacteria 1727
1113 Ga0495583_0000017 3300046506 Bacteria 310888
1114 Ga0495606_0007405 3300046507 Bacteria 9841
1115 Ga0495610_0035905 3300046512 Bacteria 2539
1116 Ga0495643_0008485 3300046522 Bacteria 6498
1117 Ga0495663_0015081 3300046525 Bacteria 2175
1118 Ga0495642_0013344 3300046528 Bacteria 3176
1119 Ga0495654_0019169 3300046530 Bacteria 3579
1120 Ga0495640_0077443 3300046533 Bacteria 2217
1121 Ga0495598_0007958 3300046537 Bacteria 2452
1122 Ga0495621_0028065 3300046539 Bacteria 1911
1123 Ga0495621_0035437 3300046539 Bacteria 1729
1124 Ga0495597_0000860 3300046542 Bacteria 23777
1125 Ga0495656_0001200 3300046615 Bacteria 8448
1126 Ga0495656_0007392 3300046615 Bacteria 3880
1127 Ga0495668_0012058 3300046616 Bacteria 5144
1128 Ga0495668_0024872 3300046616 Bacteria 3405
1129 Ga0495668_0025999 3300046616 Bacteria 3324
1130 Ga0495668_0035048 3300046616 Bacteria 2813
1131 Ga0495625_0000044 3300046660 Bacteria 203855
1132 Ga0495625_0000639 3300046660 Bacteria 50372
1133 Ga0495625_0024244 3300046660 Bacteria 4619
1134 Ga0495625_0159359 3300046660 Bacteria 1513
1135 Ga0495658_0008307 3300046683 Bacteria 5144
1136 Ga0495671_0042892 3300046692 Bacteria 2272
1137 Ga0495649_0000151 3300046694 Bacteria 60742
1138 Ga0495649_0002613 3300046694 Bacteria 12571
1139 Ga0495589_0007070 3300046794 Bacteria 5886
1140 Ga0495660_0010693 3300046810 Bacteria 5333
1141 Ga0495636_0057084 3300047318 Bacteria 1644
1142 Ga0495676_0024202 3300047321 Bacteria 5260
1143 Ga0495676_0225323 3300047321 Bacteria 1290
1144 Ga0495687_001028 3300047443 Bacteria 27765
1145 Ga0495687_014016 3300047443 Bacteria 4148
1146 Ga0495687_018047 3300047443 Bacteria 3499
1147 Ga0495686_0001809 3300047472 Bacteria 21607
1148 Ga0495686_0005751 3300047472 Bacteria 9690
1149 Ga0495686_0072663 3300047472 Bacteria 2115
1150 Ga0495686_0078679 3300047472 Bacteria 2018
1151 Ga0495593_0047176 3300047673 Bacteria 2292
1152 Ga0495593_0052839 3300047673 Bacteria 2146
1153 Ga0495602_0208866 3300048088 Bacteria 1484
1154 Ga0495614_0020043 3300048089 Bacteria 2893
1155 Ga0495615_0005712 3300048090 Bacteria 2257
1156 Ga0496100_0053001 3300048903 Bacteria 2640
1157 Ga0496101_0003019 3300048904 Bacteria 10374
1158 Ga0496102_0006763 3300048905 Bacteria 9791
1159 Ga0496102_0113807 3300048905 Bacteria 2524
1160 Ga0496104_0087344 3300048907 Bacteria 2978
1161 Ga0496105_0008621 3300048908 Bacteria 7927
1162 Ga0496106_0019139 3300048909 Bacteria 5076
1163 Ga0496106_0045643 3300048909 Bacteria 3292
1164 Ga0496106_0060086 3300048909 Bacteria 2881
1165 Ga0496107_0053764 3300048910 Bacteria 2905
1166 Ga0496108_0068001 3300048911 Bacteria 3005
1167 Ga0496109_0107082 3300048912 Bacteria 2597
1168 Ga0496110_0246336 3300048913 Bacteria 1626
1169 Ga0496111_0017144 3300048914 Bacteria 5002
1170 Ga0496112_0284028 3300048915 Bacteria 1602
1171 Ga0496113_0003290 3300048916 Bacteria 9653
1172 Ga0496114_0001821 3300048917 Bacteria 16167
1173 Ga0496114_0194687 3300048917 Bacteria 1774
1174 Ga0496116_0067077 3300048919 Bacteria 2293
1175 Ga0496117_0017641 3300048920 Bacteria 5955
1176 Ga0496118_0076428 3300048921 Bacteria 2381
1177 Ga0496121_0000166 3300048924 Bacteria 145051
1178 Ga0496121_0024477 3300048924 Bacteria 5770
1179 Ga0496121_0117372 3300048924 Bacteria 2016
1180 Ga0496122_0000274 3300048925 Bacteria 115100
1181 Ga0496123_0000262 3300048926 Bacteria 106366
1182 Ga0496123_0022733 3300048926 Bacteria 4822
1183 Ga0496124_0026316 3300048927 Bacteria 5247
1184 Ga0496124_0087183 3300048927 Bacteria 2553
1185 Ga0496124_0129422 3300048927 Bacteria 2007
1186 Ga0496125_0005447 3300048928 Bacteria 14141
1187 Ga0496125_0007916 3300048928 Bacteria 11221
1188 Ga0496125_0010221 3300048928 Bacteria 9513
1189 Ga0496125_0045207 3300048928 Bacteria 3710
1190 Ga0496125_0064393 3300048928 Bacteria 2913
1191 Ga0496125_0106677 3300048928 Bacteria 2044
1192 Ga0496125_0125154 3300048928 Bacteria 1823
1193 Ga0496126_0035583 3300048929 Bacteria 4666
1194 Ga0496126_0039612 3300048929 Bacteria 4371
1195 Ga0496126_0064731 3300048929 Bacteria 3274
1196 Ga0496126_0087756 3300048929 Bacteria 2741
1197 Ga0501298_006817 3300049521 Bacteria 1880
1198 Ga0501300_002934 3300049523 Bacteria 2543
1199 Ga0501315_000613 3300049531 Bacteria 2584
1200 Ga0501317_001883 3300049533 Bacteria 1897
1201 Ga0501031_0000678 3300049568 Bacteria 20287
1202 Ga0501043_0001160 3300049579 Bacteria 23141
1203 Ga0501046_0001185 3300049580 Bacteria 25348
1204 Ga0501047_0001232 3300049581 Bacteria 25329
1205 Ga0501047_0144572 3300049581 Bacteria 2256
1206 Ga0501048_0015099 3300049582 Bacteria 5707
1207 Ga0501199_003264 3300049650 Bacteria 1548
1208 Ga0501211_000039 3300049658 Bacteria 8874
1209 Ga0501222_005437 3300049662 Bacteria 1717
1210 Ga0501227_003642 3300049665 Bacteria 3337
1211 Ga0501233_002550 3300049668 Bacteria 3222
1212 Ga0501235_015347 3300049669 Bacteria 1689
1213 Ga0501249_003156 3300049679 Bacteria 3314
1214 Ga0501255_000879 3300049684 Bacteria 2244
1215 Ga0501221_001616 3300049704 Bacteria 3743
1216 Ga0501229_000147 3300049706 Bacteria 7305
1217 Ga0501080_0135023 3300049742 Bacteria 2283
1218 Ga0501262_000134 3300049759 Bacteria 9160
1219 Ga0501262_000522 3300049759 Bacteria 4560
1220 Ga0501267_002268 3300049764 Bacteria 1714
1221 Ga0501283_005483 3300049779 Bacteria 1746
1222 Ga0501035_0020751 3300049822 Bacteria 6038
1223 nmdc:mga03683_11374_c1 3300050489 Bacteria 3221
1224 nmdc:mga03683_1731_c1 3300050489 Bacteria 6585
1225 nmdc:mga03683_29665_c1 3300050489 Bacteria 2182
1226 nmdc:mga03683_43882_c1 3300050489 Bacteria 1846
1227 nmdc:mga0yw44_1756_c1 3300050492 Bacteria 8832
1228 nmdc:mga0yw44_44339_c1 3300050492 Bacteria 2660
1229 nmdc:mga0yw44_95707_c1 3300050492 Bacteria 1884
1230 nmdc:mga0k408_108946_c1 3300050493 Bacteria 1636
1231 nmdc:mga0k408_127848_c1 3300050493 Bacteria 1508
1232 nmdc:mga0k408_13106_c1 3300050493 Bacteria 4541
1233 nmdc:mga0k408_163046_c1 3300050493 Bacteria 1328
1234 nmdc:mga0k408_3137_c1 3300050493 Bacteria 8761
1235 nmdc:mga0k408_3243_c1 3300050493 Bacteria 8613
1236 nmdc:mga0k408_33152_c1 3300050493 Bacteria 2953
1237 nmdc:mga0k408_34566_c1 3300050493 Bacteria 2894
1238 nmdc:mga0k408_3717_c1 3300050493 Bacteria 8085
1239 nmdc:mga0k408_38735_c1 3300050493 Bacteria 2737
1240 nmdc:mga0k408_41642_c1 3300050493 Bacteria 2645
1241 nmdc:mga0k408_42352_c1 3300050493 Bacteria 2623
1242 nmdc:mga0k408_56179_c1 3300050493 Bacteria 2284
1243 nmdc:mga06z11_79888_c1 3300050494 Bacteria 1752
1244 nmdc:mga07m45_150_c1 3300050496 Bacteria 27900
1245 nmdc:mga07m45_1625_c1 3300050496 Bacteria 10341
1246 nmdc:mga07m45_16722_c1 3300050496 Bacteria 3929
1247 nmdc:mga07m45_2249_c1 3300050496 Bacteria 9010
1248 nmdc:mga07m45_2640_c1 3300050496 Bacteria 1953
1249 nmdc:mga07m45_28765_c1 3300050496 Bacteria 2126
1250 nmdc:mga07m45_29017_c1 3300050496 Bacteria 3056
1251 nmdc:mga07m45_29589_c1 3300050496 Bacteria 3030
1252 nmdc:mga07m45_38568_c1 3300050496 Bacteria 2666
1253 nmdc:mga05p37_22357_c1 3300050507 Bacteria 6444
1254 nmdc:mga09592_3773_c1 3300050508 Bacteria 12196
1255 nmdc:mga0qj67_9921_c1 3300050509 Bacteria 7101
1256 nmdc:mga0sz30_8986_c1 3300050516 Bacteria 3789
1257 Ga0495601_0010718 3300053077 Bacteria 5468
1258 Ga0500610_0024972 3300053079 Bacteria 2975
1259 Ga0500635_0000053 3300053080 Bacteria 74604
1260 Ga0500578_0000011 3300053086 Bacteria 217243
1261 Ga0500578_0020439 3300053086 Bacteria 4255
1262 Ga0500643_005802 3300053087 Bacteria 5262
1263 Ga0500583_0008528 3300053092 Bacteria 3683
1264 Ga0500651_0000053 3300053093 Bacteria 76219
1265 Ga0500651_0039754 3300053093 Bacteria 2961
1266 Ga0500651_0045243 3300053093 Bacteria 2770
1267 Ga0500571_009242 3300053110 Bacteria 5412
1268 Ga0500593_001023 3300053117 Bacteria 10150
1269 Ga0500594_0002798 3300053118 Bacteria 3799
1270 Ga0500594_0009467 3300053118 Bacteria 2244
1271 Ga0500642_0043132 3300053130 Bacteria 1958
1272 Ga0500652_006726 3300053131 Bacteria 3720
1273 Ga0500655_011021 3300053133 Bacteria 1635
1274 Ga0500658_0000012 3300053134 Bacteria 160010
1275 Ga0500658_0029729 3300053134 Bacteria 2127
1276 Ga0500658_0036987 3300053134 Bacteria 1939
1277 Ga0500559_0000017 3300053136 Bacteria 143646
1278 Ga0500559_0008060 3300053136 Bacteria 4636
1279 Ga0500574_000398 3300053141 Bacteria 5473
1280 Ga0500574_014530 3300053141 Bacteria 1859
1281 Ga0500616_0034802 3300053153 Bacteria 2742
1282 Ga0500619_000181 3300053154 Bacteria 15103
1283 Ga0500622_0000097 3300053156 Bacteria 89802
1284 Ga0500622_0001258 3300053156 Bacteria 20685
1285 Ga0500622_0002974 3300053156 Bacteria 11744
1286 Ga0500634_0043295 3300053161 Bacteria 2441
1287 Ga0500636_0057982 3300053177 Bacteria 2265
1288 Ga0500645_000200 3300053730 Bacteria 46278
1289 Ga0500645_001413 3300053730 Bacteria 12233
1290 Ga0587085_004029 3300059506 Bacteria 1642
1291 Ga0466962_0012218 3300061719 Bacteria 4127
1292 Ga0466962_0017271 3300061719 Bacteria 3476

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10000398 Ga0182008_1000039825 339
2 3300013105 Ga0157369_10009941 Ga0157369_100099413 344
3 3300035120 Ga0373957_0091396 Ga0373957_0091396_153_1199 344
4 3300025295 Ga0209564_1022209 Ga0209564_10222092 354
5 3300025919 Ga0207657_10050686 Ga0207657_100506863 356
6 3300048088 Ga0495602_0208866 Ga0495602_0208866_366_1463 360
7 3300047318 Ga0495636_0057084 Ga0495636_0057084_515_1624 366
8 3300002705 JGI25156J39149_1012858 JGI25156J39149_10128582 370
9 3300013104 Ga0157370_10000583 Ga0157370_1000058343 370
10 3300048926 Ga0496123_0022733 Ga0496123_0022733_17_1135 370
11 3300047321 Ga0495676_0225323 Ga0495676_0225323_15_1169 378
12 3300031456 Ga0307513_10008369 Ga0307513_1000836913 383
13 3300005331 Ga0070670_100012432 Ga0070670_1000124323 388
14 3300005354 Ga0070675_100136272 Ga0070675_1001362721 388
15 3300005364 Ga0070673_100216577 Ga0070673_1002165771 388
16 3300005367 Ga0070667_100166632 Ga0070667_1001666321 388
17 3300005543 Ga0070672_100003178 Ga0070672_10000317811 388
18 3300005616 Ga0068852_100180723 Ga0068852_1001807232 388
19 3300006237 Ga0097621_100151552 Ga0097621_1001515522 388
20 3300006358 Ga0068871_100014788 Ga0068871_1000147886 388
21 3300006358 Ga0068871_100129646 Ga0068871_1001296462 388
22 3300009177 Ga0105248_10173966 Ga0105248_101739662 388
23 3300013296 Ga0157374_10183801 Ga0157374_101838012 388
24 3300013308 Ga0157375_10335149 Ga0157375_103351492 388
25 3300014969 Ga0157376_10097017 Ga0157376_100970172 388
26 3300025909 Ga0207705_10123016 Ga0207705_101230162 388
27 3300025925 Ga0207650_10014659 Ga0207650_100146592 388
28 3300025926 Ga0207659_10259042 Ga0207659_102590421 388
29 3300025940 Ga0207691_10133271 Ga0207691_101332712 388
30 3300025960 Ga0207651_10110123 Ga0207651_101101232 388
31 3300026121 Ga0207683_10177045 Ga0207683_101770452 388
32 3300037068 Ga0373925_0147863 Ga0373925_0147863_396_1685 388
33 3300044712 Ga0453684_0256555 Ga0453684_0256555_745_1995 389
34 3300050508 nmdc:mga09592_3773_c1 nmdc:mga09592_3773_c1_5700_6971 389
35 3300050509 nmdc:mga0qj67_9921_c1 nmdc:mga0qj67_9921_c1_4771_6042 389
36 3300005614 Ga0068856_100105028 Ga0068856_1001050282 390
37 3300025931 Ga0207644_10046621 Ga0207644_100466213 390
38 3300026078 Ga0207702_10099543 Ga0207702_100995432 390
39 3300032004 Ga0307414_10092110 Ga0307414_100921102 390
40 3300032005 Ga0307411_10110231 Ga0307411_101102312 390
41 3300037471 Ga0395905_0002029 Ga0395905_0002029_9229_10476 390
42 3300042120 Ga0450917_000573 Ga0450917_000573_409_1662 390
43 3300042126 Ga0450888_000521 Ga0450888_000521_855_2108 390
44 3300042127 Ga0450890_000453 Ga0450890_000453_4424_5677 390
45 3300042130 Ga0450892_001840 Ga0450892_001840_350_1603 390
46 3300042532 Ga0450893_0001792 Ga0450893_0001792_457_1710 390
47 3300049521 Ga0501298_006817 Ga0501298_006817_325_1578 390
48 3300049523 Ga0501300_002934 Ga0501300_002934_244_1497 390
49 3300049531 Ga0501315_000613 Ga0501315_000613_900_2153 390
50 3300049533 Ga0501317_001883 Ga0501317_001883_256_1509 390
51 3300049650 Ga0501199_003264 Ga0501199_003264_227_1480 390
52 3300049658 Ga0501211_000039 Ga0501211_000039_4706_5959 390
53 3300049662 Ga0501222_005437 Ga0501222_005437_254_1507 390
54 3300049665 Ga0501227_003642 Ga0501227_003642_1528_2781 390
55 3300049668 Ga0501233_002550 Ga0501233_002550_1520_2773 390
56 3300049669 Ga0501235_015347 Ga0501235_015347_226_1479 390
57 3300049684 Ga0501255_000879 Ga0501255_000879_596_1849 390
58 3300049704 Ga0501221_001616 Ga0501221_001616_1854_3107 390
59 3300049706 Ga0501229_000147 Ga0501229_000147_824_2077 390
60 3300049759 Ga0501262_000522 Ga0501262_000522_3243_4496 390
61 3300049764 Ga0501267_002268 Ga0501267_002268_310_1563 390
62 3300049779 Ga0501283_005483 Ga0501283_005483_441_1694 390
63 3300025931 Ga0207644_10244143 Ga0207644_102441431 391
64 3300031548 Ga0307408_100000008 Ga0307408_100000008143 391
65 3300046522 Ga0495643_0008485 Ga0495643_0008485_1869_3131 391
66 3300046616 Ga0495668_0025999 Ga0495668_0025999_384_1646 391
67 3300047443 Ga0495687_014016 Ga0495687_014016_1854_3116 391
68 3300005337 Ga0070682_100098288 Ga0070682_1000982882 392
69 3300031711 Ga0265314_10147752 Ga0265314_101477521 392
70 3300005336 Ga0070680_100002531 Ga0070680_1000025316 393
71 3300005530 Ga0070679_100152598 Ga0070679_1001525982 393
72 3300025921 Ga0207652_10015168 Ga0207652_100151687 393
73 iso_pu_bacteria 2643221658 2644325845 393
74 iso_pu_bacteria 2899924645 2899925057 393
75 iso_pu_bacteria 2928037797 2928038818 393
76 3300005344 Ga0070661_100225554 Ga0070661_1002255541 394
77 3300009098 Ga0105245_10009930 Ga0105245_100099308 394
78 3300009148 Ga0105243_10015844 Ga0105243_100158442 394
79 3300011119 Ga0105246_10024888 Ga0105246_100248883 394
80 3300013308 Ga0157375_10038720 Ga0157375_100387203 394
81 3300021361 Ga0213872_10024989 Ga0213872_100249892 394
82 3300025303 Ga0209051_1001500 Ga0209051_100150015 394
83 3300031456 Ga0307513_10058693 Ga0307513_100586933 394
84 3300039447 Ga0436361_0572364 Ga0436361_0572364_961_2202 394
85 3300042876 Ga0451577_0028693 Ga0451577_0028693_542_1852 394
86 3300005339 Ga0070660_100017780 Ga0070660_1000177804 395
87 3300005456 Ga0070678_100160270 Ga0070678_1001602701 395
88 3300005456 Ga0070678_100227746 Ga0070678_1002277462 395
89 3300005530 Ga0070679_100076637 Ga0070679_1000766372 395
90 3300005543 Ga0070672_100090311 Ga0070672_1000903112 395
91 3300005563 Ga0068855_100017415 Ga0068855_1000174151 395
92 3300009093 Ga0105240_10001089 Ga0105240_1000108921 395
93 3300009147 Ga0114129_10134779 Ga0114129_101347792 395
94 3300009148 Ga0105243_10247510 Ga0105243_102475101 395
95 3300009551 Ga0105238_10007948 Ga0105238_100079487 395
96 3300014325 Ga0163163_10294718 Ga0163163_102947182 395
97 3300014497 Ga0182008_10007000 Ga0182008_100070002 395
98 3300025273 Ga0209673_1019046 Ga0209673_10190462 395
99 3300025295 Ga0209564_1000003 Ga0209564_1000003372 395
100 3300025919 Ga0207657_10035067 Ga0207657_100350673 395
101 3300025925 Ga0207650_10140005 Ga0207650_101400052 395
102 3300025949 Ga0207667_10025000 Ga0207667_100250006 395
103 3300026089 Ga0207648_10148564 Ga0207648_101485642 395
104 3300035114 Ga0373939_0000008 Ga0373939_0000008_67574_68827 395
105 3300035691 Ga0373931_0000533 Ga0373931_0000533_6397_7650 395
106 3300048924 Ga0496121_0024477 Ga0496121_0024477_2673_3866 395
107 3300053161 Ga0500634_0043295 Ga0500634_0043295_465_1652 395
108 3300003794 Ga0055531_10000313 Ga0055531_1000031316 396
109 3300005293 Ga0065715_10025844 Ga0065715_100258441 396
110 3300005337 Ga0070682_100145677 Ga0070682_1001456771 396
111 3300005344 Ga0070661_100027419 Ga0070661_1000274195 396
112 3300005355 Ga0070671_100047811 Ga0070671_1000478112 396
113 3300005364 Ga0070673_100141075 Ga0070673_1001410752 396
114 3300005455 Ga0070663_100123499 Ga0070663_1001234991 396
115 3300005456 Ga0070678_100140093 Ga0070678_1001400932 396
116 3300005543 Ga0070672_100061568 Ga0070672_1000615682 396
117 3300005578 Ga0068854_100137384 Ga0068854_1001373842 396
118 3300005616 Ga0068852_100041540 Ga0068852_1000415402 396
119 3300005834 Ga0068851_10103958 Ga0068851_101039582 396
120 3300009148 Ga0105243_10000400 Ga0105243_1000040016 396
121 3300025298 Ga0209050_1004588 Ga0209050_10045882 396
122 3300025303 Ga0209051_1006879 Ga0209051_10068793 396
123 3300025304 Ga0209257_1000021 Ga0209257_1000021422 396
124 3300025315 Ga0207697_10055501 Ga0207697_100555012 396
125 3300025935 Ga0207709_10000038 Ga0207709_10000038188 396
126 3300025960 Ga0207651_10047090 Ga0207651_100470902 396
127 3300025981 Ga0207640_10095449 Ga0207640_100954492 396
128 3300026067 Ga0207678_10160314 Ga0207678_101603141 396
129 3300026142 Ga0207698_10051797 Ga0207698_100517972 396
130 3300044712 Ga0453684_0029871 Ga0453684_0029871_4649_5968 396
131 3300048920 Ga0496117_0017641 Ga0496117_0017641_2436_3626 396
132 3300003773 Ga0055537_1000036 Ga0055537_100003613 397
133 3300003784 Ga0055534_1000018 Ga0055534_100001871 397
134 3300003790 Ga0055528_1000509 Ga0055528_100050920 397
135 3300005328 Ga0070676_10000305 Ga0070676_1000030515 397
136 3300005334 Ga0068869_100045673 Ga0068869_1000456731 397
137 3300005335 Ga0070666_10042863 Ga0070666_100428632 397
138 3300005343 Ga0070687_100027806 Ga0070687_1000278062 397
139 3300005347 Ga0070668_100002014 Ga0070668_1000020144 397
140 3300005353 Ga0070669_100003934 Ga0070669_1000039348 397
141 3300005354 Ga0070675_100005844 Ga0070675_1000058442 397
142 3300005356 Ga0070674_100002952 Ga0070674_1000029521 397
143 3300005456 Ga0070678_100027992 Ga0070678_1000279923 397
144 3300005459 Ga0068867_100006718 Ga0068867_1000067188 397
145 3300005719 Ga0068861_100000357 Ga0068861_1000003578 397
146 3300005841 Ga0068863_100045223 Ga0068863_1000452235 397
147 3300005842 Ga0068858_100005932 Ga0068858_1000059328 397
148 3300005843 Ga0068860_100001441 Ga0068860_10000144124 397
149 3300006881 Ga0068865_100005297 Ga0068865_1000052972 397
150 3300009036 Ga0105244_10003175 Ga0105244_100031754 397
151 3300009148 Ga0105243_10003082 Ga0105243_100030829 397
152 3300009176 Ga0105242_10028293 Ga0105242_100282932 397
153 3300009177 Ga0105248_10173519 Ga0105248_101735193 397
154 3300009553 Ga0105249_10001498 Ga0105249_1000149821 397
155 3300013100 Ga0157373_10133603 Ga0157373_101336031 397
156 3300013104 Ga0157370_10019170 Ga0157370_100191706 397
157 3300013307 Ga0157372_10026418 Ga0157372_100264184 397
158 3300014326 Ga0157380_10002934 Ga0157380_1000293411 397
159 3300014497 Ga0182008_10001698 Ga0182008_100016989 397
160 3300014968 Ga0157379_10030440 Ga0157379_100304402 397
161 3300015261 Ga0182006_1001743 Ga0182006_10017438 397
162 3300017792 Ga0163161_10087430 Ga0163161_100874302 397
163 3300025907 Ga0207645_10003471 Ga0207645_100034719 397
164 3300025918 Ga0207662_10029873 Ga0207662_100298734 397
165 3300025923 Ga0207681_10000899 Ga0207681_100008999 397
166 3300025924 Ga0207694_10149216 Ga0207694_101492162 397
167 3300025926 Ga0207659_10006224 Ga0207659_100062243 397
168 3300025934 Ga0207686_10013697 Ga0207686_100136975 397
169 3300025937 Ga0207669_10001219 Ga0207669_100012199 397
170 3300025938 Ga0207704_10002775 Ga0207704_100027755 397
171 3300025940 Ga0207691_10150673 Ga0207691_101506732 397
172 3300025942 Ga0207689_10006945 Ga0207689_100069452 397
173 3300025961 Ga0207712_10000828 Ga0207712_1000082821 397
174 3300025972 Ga0207668_10014399 Ga0207668_100143993 397
175 3300025986 Ga0207658_10003454 Ga0207658_100034549 397
176 3300026035 Ga0207703_10001624 Ga0207703_100016246 397
177 3300026088 Ga0207641_10001135 Ga0207641_1000113523 397
178 3300026089 Ga0207648_10159701 Ga0207648_101597012 397
179 3300026118 Ga0207675_100004188 Ga0207675_1000041885 397
180 3300026121 Ga0207683_10164978 Ga0207683_101649782 397
181 3300026142 Ga0207698_10099612 Ga0207698_100996122 397
182 3300028380 Ga0268265_10042246 Ga0268265_100422462 397
183 3300028381 Ga0268264_10001745 Ga0268264_1000174521 397
184 3300041404 Ga0439436_0016367 Ga0439436_0016367_662_1858 397
185 3300045049 Ga0466959_0050801 Ga0466959_0050801_1825_3030 397
186 3300046660 Ga0495625_0000044 Ga0495625_0000044_93229_94422 397
187 3300046692 Ga0495671_0042892 Ga0495671_0042892_560_1753 397
188 3300047321 Ga0495676_0024202 Ga0495676_0024202_1521_2714 397
189 3300047673 Ga0495593_0047176 Ga0495593_0047176_902_2095 397
190 3300048089 Ga0495614_0020043 Ga0495614_0020043_498_1691 397
191 3300048927 Ga0496124_0087183 Ga0496124_0087183_529_1722 397
192 3300048928 Ga0496125_0064393 Ga0496125_0064393_515_1708 397
193 3300048928 Ga0496125_0106677 Ga0496125_0106677_477_1670 397
194 3300050494 nmdc:mga06z11_79888_c1 nmdc:mga06z11_79888_c1_495_1694 397
195 3300050496 nmdc:mga07m45_29589_c1 nmdc:mga07m45_29589_c1_1558_2757 397
196 3300050507 nmdc:mga05p37_22357_c1 nmdc:mga05p37_22357_c1_4923_6176 397
197 3300053079 Ga0500610_0024972 Ga0500610_0024972_159_1352 397
198 3300053093 Ga0500651_0000053 Ga0500651_0000053_67074_68267 397
199 3300053110 Ga0500571_009242 Ga0500571_009242_694_1887 397
200 3300053134 Ga0500658_0029729 Ga0500658_0029729_265_1458 397
201 3300053134 Ga0500658_0036987 Ga0500658_0036987_482_1675 397
202 3300053141 Ga0500574_000398 Ga0500574_000398_305_1498 397
203 3300005467 Ga0070706_100006474 Ga0070706_1000064742 398
204 3300005518 Ga0070699_100104211 Ga0070699_1001042112 398
205 3300006186 Ga0075369_10052095 Ga0075369_100520951 398
206 3300006353 Ga0075370_10028091 Ga0075370_100280913 398
207 3300025321 Ga0207656_10025458 Ga0207656_100254582 398
208 3300025910 Ga0207684_10011095 Ga0207684_100110952 398
209 3300025920 Ga0207649_10097267 Ga0207649_100972672 398
210 3300025926 Ga0207659_10141460 Ga0207659_101414602 398
211 3300046539 Ga0495621_0035437 Ga0495621_0035437_264_1550 398
212 3300050493 nmdc:mga0k408_56179_c1 nmdc:mga0k408_56179_c1_512_1798 398
213 3300005354 Ga0070675_100155626 Ga0070675_1001556261 399
214 3300031238 Ga0265332_10000125 Ga0265332_1000012560 399
215 3300031730 Ga0307516_10003586 Ga0307516_100035869 399
216 3300037471 Ga0395905_0021027 Ga0395905_0021027_455_1792 399
217 3300005293 Ga0065715_10207777 Ga0065715_102077771 400
218 3300005328 Ga0070676_10012035 Ga0070676_100120353 400
219 3300005331 Ga0070670_100040203 Ga0070670_1000402035 400
220 3300005331 Ga0070670_100075565 Ga0070670_1000755652 400
221 3300005338 Ga0068868_100026439 Ga0068868_1000264393 400
222 3300005364 Ga0070673_100014798 Ga0070673_1000147982 400
223 3300005367 Ga0070667_100022085 Ga0070667_1000220853 400
224 3300005459 Ga0068867_100006852 Ga0068867_1000068522 400
225 3300005577 Ga0068857_100025951 Ga0068857_1000259513 400
226 3300005840 Ga0068870_10025973 Ga0068870_100259732 400
227 3300006195 Ga0075366_10044896 Ga0075366_100448962 400
228 3300025907 Ga0207645_10011577 Ga0207645_100115773 400
229 3300025908 Ga0207643_10012919 Ga0207643_100129193 400
230 3300025927 Ga0207687_10098169 Ga0207687_100981692 400
231 3300025960 Ga0207651_10018259 Ga0207651_100182593 400
232 3300025986 Ga0207658_10056497 Ga0207658_100564973 400
233 3300026089 Ga0207648_10006529 Ga0207648_1000652910 400
234 3300026116 Ga0207674_10015020 Ga0207674_100150208 400
235 3300027526 Ga0209968_1000125 Ga0209968_10001259 400
236 3300027695 Ga0209966_1000014 Ga0209966_100001420 400
237 3300032126 Ga0307415_100007187 Ga0307415_1000071873 400
238 3300050493 nmdc:mga0k408_108946_c1 nmdc:mga0k408_108946_c1_57_1292 400
239 iso_pu_bacteria 2547132374 2548500586 400
240 iso_pu_bacteria 2643221717 2644646865 400
241 3300028794 Ga0307515_10000064 Ga0307515_10000064127 401
242 3300031456 Ga0307513_10007462 Ga0307513_1000746211 401
243 3300050489 nmdc:mga03683_1731_c1 nmdc:mga03683_1731_c1_4161_5399 401
244 3300050493 nmdc:mga0k408_41642_c1 nmdc:mga0k408_41642_c1_732_1970 401
245 iso_pu_bacteria 2643221603 2644030817 401
246 iso_pu_bacteria 2881101125 2881101915 401
247 3300003322 rootL2_10040743 rootL2_100407432 402
248 3300005331 Ga0070670_100222624 Ga0070670_1002226242 402
249 3300005335 Ga0070666_10145344 Ga0070666_101453442 402
250 3300005354 Ga0070675_100000703 Ga0070675_1000007032 402
251 3300005356 Ga0070674_100004623 Ga0070674_1000046233 402
252 3300005364 Ga0070673_100002713 Ga0070673_10000271310 402
253 3300005365 Ga0070688_100077724 Ga0070688_1000777241 402
254 3300005459 Ga0068867_100006316 Ga0068867_1000063166 402
255 3300005466 Ga0070685_10116931 Ga0070685_101169312 402
256 3300005543 Ga0070672_100000188 Ga0070672_1000001883 402
257 3300005548 Ga0070665_100235466 Ga0070665_1002354661 402
258 3300005618 Ga0068864_100094537 Ga0068864_1000945372 402
259 3300006237 Ga0097621_100040696 Ga0097621_1000406962 402
260 3300006353 Ga0075370_10000246 Ga0075370_1000024617 402
261 3300006358 Ga0068871_100073545 Ga0068871_1000735452 402
262 3300013306 Ga0163162_10074236 Ga0163162_100742362 402
263 3300013308 Ga0157375_10445857 Ga0157375_104458572 402
264 3300017792 Ga0163161_10028738 Ga0163161_100287384 402
265 3300025315 Ga0207697_10023400 Ga0207697_100234001 402
266 3300025321 Ga0207656_10012705 Ga0207656_100127052 402
267 3300025925 Ga0207650_10000878 Ga0207650_1000087814 402
268 3300025926 Ga0207659_10000207 Ga0207659_1000020712 402
269 3300025931 Ga0207644_10001228 Ga0207644_1000122814 402
270 3300025937 Ga0207669_10001590 Ga0207669_1000159010 402
271 3300025940 Ga0207691_10001187 Ga0207691_1000118721 402
272 3300025960 Ga0207651_10000798 Ga0207651_100007986 402
273 3300026023 Ga0207677_10015442 Ga0207677_100154422 402
274 3300026089 Ga0207648_10007879 Ga0207648_100078797 402
275 3300026095 Ga0207676_10026622 Ga0207676_100266224 402
276 3300026142 Ga0207698_10200427 Ga0207698_102004272 402
277 3300031548 Ga0307408_100025292 Ga0307408_1000252923 402
278 3300031824 Ga0307413_10145654 Ga0307413_101456542 402
279 3300031852 Ga0307410_10005512 Ga0307410_100055123 402
280 3300031901 Ga0307406_10003882 Ga0307406_100038822 402
281 3300031911 Ga0307412_10088191 Ga0307412_100881911 402
282 3300031995 Ga0307409_100004771 Ga0307409_1000047713 402
283 3300032002 Ga0307416_100013163 Ga0307416_1000131632 402
284 3300032005 Ga0307411_10014448 Ga0307411_100144482 402
285 3300039447 Ga0436361_0258710 Ga0436361_0258710_123_1364 402
286 3300042115 Ga0450911_001627 Ga0450911_001627_388_1620 402
287 3300042876 Ga0451577_0000114 Ga0451577_0000114_112761_113993 402
288 3300044712 Ga0453684_0000606 Ga0453684_0000606_76790_78022 402
289 3300045051 Ga0451576_0001159 Ga0451576_0001159_43499_44731 402
290 3300048928 Ga0496125_0007916 Ga0496125_0007916_4629_5858 402
291 3300048928 Ga0496125_0045207 Ga0496125_0045207_455_1687 402
292 3300048928 Ga0496125_0125154 Ga0496125_0125154_537_1769 402
293 3300048929 Ga0496126_0064731 Ga0496126_0064731_1783_3012 402
294 3300050496 nmdc:mga07m45_1625_c1 nmdc:mga07m45_1625_c1_3720_5006 402
295 iso_pu_bacteria 2513020051 2513229123 402
296 iso_pu_bacteria 2643221544 2643742760 402
297 iso_pu_bacteria 2643221585 2643933394 402
298 iso_pu_bacteria 2643221639 2644217621 402
299 iso_pu_bacteria 2643221646 2644258644 402
300 iso_pu_bacteria 2643221656 2644314643 402
301 iso_pu_bacteria 2738541337 2739056659 402
302 iso_pu_bacteria 2886848708 2886852427 402
303 iso_pu_bacteria 2886848708 2886853182 402
304 3300005262 Ga0065165_1000354 Ga0065165_100035441 403
305 3300005328 Ga0070676_10021974 Ga0070676_100219742 403
306 3300005353 Ga0070669_100197831 Ga0070669_1001978311 403
307 3300005459 Ga0068867_100010351 Ga0068867_1000103514 403
308 3300006353 Ga0075370_10059175 Ga0075370_100591752 403
309 3300006880 Ga0075429_100095617 Ga0075429_1000956172 403
310 3300025907 Ga0207645_10028617 Ga0207645_100286173 403
311 3300025941 Ga0207711_10144084 Ga0207711_101440841 403
312 3300026023 Ga0207677_10153967 Ga0207677_101539672 403
313 3300028794 Ga0307515_10000139 Ga0307515_1000013987 403
314 3300028794 Ga0307515_10014464 Ga0307515_100144643 403
315 3300031730 Ga0307516_10000109 Ga0307516_1000010948 403
316 3300031730 Ga0307516_10050860 Ga0307516_100508601 403
317 3300033179 Ga0307507_10012966 Ga0307507_100129661 403
318 3300037471 Ga0395905_0000382 Ga0395905_0000382_51230_52525 403
319 3300037471 Ga0395905_0050244 Ga0395905_0050244_1305_2609 403
320 3300038443 Ga0395901_0150472 Ga0395901_0150472_1017_2321 403
321 3300038443 Ga0395901_0327295 Ga0395901_0327295_244_1563 403
322 3300042007 Ga0439449_0001661 Ga0439449_0001661_5878_7146 403
323 3300042015 Ga0439462_0001024 Ga0439462_0001024_929_2197 403
324 3300042876 Ga0451577_0003232 Ga0451577_0003232_9503_10732 403
325 3300044712 Ga0453684_0099934 Ga0453684_0099934_1317_2555 403
326 3300044712 Ga0453684_0331768 Ga0453684_0331768_400_1629 403
327 3300046525 Ga0495663_0015081 Ga0495663_0015081_680_1978 403
328 3300046528 Ga0495642_0013344 Ga0495642_0013344_783_2081 403
329 3300046615 Ga0495656_0007392 Ga0495656_0007392_2053_3351 403
330 3300050496 nmdc:mga07m45_28765_c1 nmdc:mga07m45_28765_c1_214_1443 403
331 iso_pu_bacteria 2643221570 2643864414 403
332 iso_pu_bacteria 2643221596 2643992950 403
333 iso_pu_bacteria 2643221652 2644291883 403
334 iso_pu_bacteria 2643221660 2644337942 403
335 iso_pu_bacteria 2919704043 2919707483 403
336 iso_pu_bacteria 2990710928 2990715008 403
337 3300003773 Ga0055537_1000221 Ga0055537_10002217 404
338 3300003781 Ga0055536_1003447 Ga0055536_10034476 404
339 3300003781 Ga0055536_1004360 Ga0055536_10043604 404
340 3300003784 Ga0055534_1000220 Ga0055534_100022038 404
341 3300003792 Ga0055540_1000420 Ga0055540_10004207 404
342 3300003792 Ga0055540_1000492 Ga0055540_100049222 404
343 3300003794 Ga0055531_10000309 Ga0055531_1000030940 404
344 3300003794 Ga0055531_10000542 Ga0055531_100005429 404
345 3300005327 Ga0070658_10169512 Ga0070658_101695122 404
346 3300005338 Ga0068868_100007012 Ga0068868_1000070123 404
347 3300005338 Ga0068868_100024715 Ga0068868_1000247154 404
348 3300005366 Ga0070659_100036994 Ga0070659_1000369943 404
349 3300005457 Ga0070662_100010127 Ga0070662_1000101272 404
350 3300005563 Ga0068855_100276875 Ga0068855_1002768752 404
351 3300005563 Ga0068855_100277889 Ga0068855_1002778892 404
352 3300005578 Ga0068854_100072293 Ga0068854_1000722932 404
353 3300005616 Ga0068852_100040628 Ga0068852_1000406283 404
354 3300005841 Ga0068863_100171074 Ga0068863_1001710742 404
355 3300006038 Ga0075365_10000234 Ga0075365_100002342 404
356 3300006038 Ga0075365_10017690 Ga0075365_100176902 404
357 3300006058 Ga0075432_10015726 Ga0075432_100157262 404
358 3300006177 Ga0075362_10013909 Ga0075362_100139093 404
359 3300006177 Ga0075362_10051494 Ga0075362_100514941 404
360 3300006353 Ga0075370_10017146 Ga0075370_100171463 404
361 3300006948 Ga0099826_10000096 Ga0099826_1000009637 404
362 3300009036 Ga0105244_10101048 Ga0105244_101010481 404
363 3300009177 Ga0105248_10021294 Ga0105248_100212945 404
364 3300013296 Ga0157374_10102555 Ga0157374_101025552 404
365 3300013306 Ga0163162_10022647 Ga0163162_100226472 404
366 3300013307 Ga0157372_10039703 Ga0157372_100397035 404
367 3300014969 Ga0157376_10002109 Ga0157376_100021099 404
368 3300015261 Ga0182006_1014199 Ga0182006_10141993 404
369 3300025263 Ga0209565_1000327 Ga0209565_10003278 404
370 3300025273 Ga0209673_1000798 Ga0209673_100079837 404
371 3300025291 Ga0209675_1000325 Ga0209675_100032537 404
372 3300025292 Ga0209676_1000105 Ga0209676_100010571 404
373 3300025298 Ga0209050_1001141 Ga0209050_10011417 404
374 3300025303 Ga0209051_1000064 Ga0209051_1000064150 404
375 3300025303 Ga0209051_1000078 Ga0209051_100007815 404
376 3300025304 Ga0209257_1000012 Ga0209257_1000012274 404
377 3300025304 Ga0209257_1000109 Ga0209257_1000109150 404
378 3300025933 Ga0207706_10002883 Ga0207706_1000288310 404
379 3300026023 Ga0207677_10005607 Ga0207677_100056072 404
380 3300026041 Ga0207639_10039741 Ga0207639_100397412 404
381 3300026078 Ga0207702_10240766 Ga0207702_102407662 404
382 3300026088 Ga0207641_10218443 Ga0207641_102184432 404
383 3300026095 Ga0207676_10108534 Ga0207676_101085342 404
384 3300026116 Ga0207674_10052794 Ga0207674_100527945 404
385 3300027666 Ga0209282_1000228 Ga0209282_10002288 404
386 3300037312 Ga0395899_0000992 Ga0395899_0000992_5264_6535 404
387 3300037418 Ga0395900_0004787 Ga0395900_0004787_10222_11493 404
388 3300037418 Ga0395900_0020937 Ga0395900_0020937_187_1422 404
389 3300037418 Ga0395900_0029664 Ga0395900_0029664_3958_5307 404
390 3300037418 Ga0395900_0079616 Ga0395900_0079616_1371_2702 404
391 3300037466 Ga0395898_0006328 Ga0395898_0006328_9452_10801 404
392 3300037466 Ga0395898_0036706 Ga0395898_0036706_1798_3069 404
393 3300037471 Ga0395905_0000148 Ga0395905_0000148_74747_76072 404
394 3300037471 Ga0395905_0003923 Ga0395905_0003923_1591_2862 404
395 3300037471 Ga0395905_0029796 Ga0395905_0029796_222_1478 404
396 3300037471 Ga0395905_0032872 Ga0395905_0032872_82_1431 404
397 3300038443 Ga0395901_0034728 Ga0395901_0034728_1039_2310 404
398 3300038443 Ga0395901_0106293 Ga0395901_0106293_622_1890 404
399 3300039437 Ga0436365_0538258 Ga0436365_0538258_90_1346 404
400 3300044673 Ga0453683_0016380 Ga0453683_0016380_3345_4580 404
401 3300044684 Ga0466966_0024374 Ga0466966_0024374_401_1669 404
402 3300045049 Ga0466959_0008467 Ga0466959_0008467_3197_4465 404
403 3300046660 Ga0495625_0000639 Ga0495625_0000639_46095_47366 404
404 3300048911 Ga0496108_0068001 Ga0496108_0068001_1326_2600 404
405 3300048916 Ga0496113_0003290 Ga0496113_0003290_2500_3738 404
406 3300048924 Ga0496121_0000166 Ga0496121_0000166_75075_76346 404
407 3300049581 Ga0501047_0144572 Ga0501047_0144572_15_1319 404
408 3300049742 Ga0501080_0135023 Ga0501080_0135023_954_2213 404
409 3300050492 nmdc:mga0yw44_1756_c1 nmdc:mga0yw44_1756_c1_4098_5336 404
410 3300050492 nmdc:mga0yw44_44339_c1 nmdc:mga0yw44_44339_c1_1110_2348 404
411 3300050496 nmdc:mga07m45_38568_c1 nmdc:mga07m45_38568_c1_965_2236 404
412 3300053134 Ga0500658_0000012 Ga0500658_0000012_57732_59003 404
413 3300003775 Ga0055524_1000554 Ga0055524_100055421 405
414 3300003775 Ga0055524_1013988 Ga0055524_10139882 405
415 3300003794 Ga0055531_10003057 Ga0055531_100030574 405
416 3300003794 Ga0055531_10009223 Ga0055531_100092232 405
417 3300004625 Ga0055543_1003006 Ga0055543_10030061 405
418 3300005262 Ga0065165_1000935 Ga0065165_100093525 405
419 3300005293 Ga0065715_10122914 Ga0065715_101229142 405
420 3300005327 Ga0070658_10088236 Ga0070658_100882362 405
421 3300005330 Ga0070690_100010484 Ga0070690_1000104843 405
422 3300005331 Ga0070670_100017269 Ga0070670_1000172694 405
423 3300005334 Ga0068869_100126844 Ga0068869_1001268442 405
424 3300005338 Ga0068868_100010416 Ga0068868_1000104164 405
425 3300005340 Ga0070689_100005827 Ga0070689_1000058275 405
426 3300005354 Ga0070675_100002563 Ga0070675_1000025633 405
427 3300005354 Ga0070675_100012697 Ga0070675_1000126976 405
428 3300005355 Ga0070671_100005574 Ga0070671_1000055745 405
429 3300005356 Ga0070674_100039485 Ga0070674_1000394853 405
430 3300005356 Ga0070674_100069552 Ga0070674_1000695522 405
431 3300005364 Ga0070673_100002198 Ga0070673_1000021983 405
432 3300005364 Ga0070673_100163511 Ga0070673_1001635112 405
433 3300005456 Ga0070678_100000683 Ga0070678_10000068310 405
434 3300005456 Ga0070678_100160965 Ga0070678_1001609652 405
435 3300005530 Ga0070679_100060332 Ga0070679_1000603322 405
436 3300005543 Ga0070672_100098835 Ga0070672_1000988352 405
437 3300005616 Ga0068852_100185549 Ga0068852_1001855491 405
438 3300005617 Ga0068859_100003146 Ga0068859_1000031469 405
439 3300005618 Ga0068864_100001395 Ga0068864_10000139516 405
440 3300005719 Ga0068861_100148574 Ga0068861_1001485742 405
441 3300005834 Ga0068851_10090274 Ga0068851_100902741 405
442 3300005841 Ga0068863_100004937 Ga0068863_1000049373 405
443 3300005842 Ga0068858_100001070 Ga0068858_10000107014 405
444 3300006177 Ga0075362_10025904 Ga0075362_100259042 405
445 3300006178 Ga0075367_10046511 Ga0075367_100465112 405
446 3300006195 Ga0075366_10050413 Ga0075366_100504132 405
447 3300006195 Ga0075366_10058716 Ga0075366_100587162 405
448 3300006237 Ga0097621_100060446 Ga0097621_1000604462 405
449 3300006237 Ga0097621_100061415 Ga0097621_1000614152 405
450 3300006353 Ga0075370_10001169 Ga0075370_100011698 405
451 3300006353 Ga0075370_10006991 Ga0075370_100069913 405
452 3300006353 Ga0075370_10043263 Ga0075370_100432632 405
453 3300006881 Ga0068865_100004824 Ga0068865_1000048247 405
454 3300006931 Ga0097620_100003146 Ga0097620_1000031469 405
455 3300006944 Ga0099823_1007351 Ga0099823_10073514 405
456 3300009148 Ga0105243_10267990 Ga0105243_102679901 405
457 3300009177 Ga0105248_10014279 Ga0105248_100142795 405
458 3300009553 Ga0105249_10004113 Ga0105249_100041137 405
459 3300012497 Ga0157319_1000009 Ga0157319_100000923 405
460 3300013296 Ga0157374_10037469 Ga0157374_100374692 405
461 3300013296 Ga0157374_10204401 Ga0157374_102044012 405
462 3300013306 Ga0163162_10075996 Ga0163162_100759962 405
463 3300013306 Ga0163162_10122944 Ga0163162_101229442 405
464 3300013308 Ga0157375_10036590 Ga0157375_100365903 405
465 3300014325 Ga0163163_10005453 Ga0163163_100054539 405
466 3300014326 Ga0157380_10105348 Ga0157380_101053481 405
467 3300014497 Ga0182008_10042429 Ga0182008_100424291 405
468 3300014968 Ga0157379_10007780 Ga0157379_100077808 405
469 3300014969 Ga0157376_10035383 Ga0157376_100353834 405
470 3300017792 Ga0163161_10046965 Ga0163161_100469652 405
471 3300025250 Ga0209026_1002653 Ga0209026_10026533 405
472 3300025273 Ga0209673_1009683 Ga0209673_10096834 405
473 3300025298 Ga0209050_1001330 Ga0209050_100133024 405
474 3300025299 Ga0209256_1002170 Ga0209256_10021708 405
475 3300025299 Ga0209256_1002204 Ga0209256_10022049 405
476 3300025303 Ga0209051_1008919 Ga0209051_10089194 405
477 3300025304 Ga0209257_1002930 Ga0209257_10029307 405
478 3300025304 Ga0209257_1003485 Ga0209257_100348513 405
479 3300025321 Ga0207656_10020257 Ga0207656_100202572 405
480 3300025903 Ga0207680_10001601 Ga0207680_1000160110 405
481 3300025926 Ga0207659_10001596 Ga0207659_1000159612 405
482 3300025926 Ga0207659_10032239 Ga0207659_100322394 405
483 3300025931 Ga0207644_10001220 Ga0207644_100012207 405
484 3300025932 Ga0207690_10224641 Ga0207690_102246411 405
485 3300025933 Ga0207706_10017782 Ga0207706_100177827 405
486 3300025936 Ga0207670_10039836 Ga0207670_100398362 405
487 3300025937 Ga0207669_10013232 Ga0207669_100132324 405
488 3300025941 Ga0207711_10004508 Ga0207711_1000450810 405
489 3300025941 Ga0207711_10120738 Ga0207711_101207382 405
490 3300025960 Ga0207651_10002450 Ga0207651_100024508 405
491 3300025960 Ga0207651_10047832 Ga0207651_100478322 405
492 3300025972 Ga0207668_10117088 Ga0207668_101170881 405
493 3300026023 Ga0207677_10012083 Ga0207677_100120833 405
494 3300026035 Ga0207703_10002139 Ga0207703_1000213914 405
495 3300026075 Ga0207708_10073767 Ga0207708_100737672 405
496 3300026088 Ga0207641_10005572 Ga0207641_100055723 405
497 3300026095 Ga0207676_10001093 Ga0207676_1000109315 405
498 3300026121 Ga0207683_10001181 Ga0207683_1000118110 405
499 3300026121 Ga0207683_10181255 Ga0207683_101812551 405
500 3300026142 Ga0207698_10134379 Ga0207698_101343791 405
501 3300027296 Ga0209389_1010627 Ga0209389_10106276 405
502 3300028794 Ga0307515_10000187 Ga0307515_1000018739 405
503 3300028794 Ga0307515_10001587 Ga0307515_1000158717 405
504 3300031235 Ga0265330_10000117 Ga0265330_1000011721 405
505 3300031238 Ga0265332_10000002 Ga0265332_10000002346 405
506 3300031251 Ga0265327_10000779 Ga0265327_1000077927 405
507 3300031507 Ga0307509_10037154 Ga0307509_100371544 405
508 3300031507 Ga0307509_10103755 Ga0307509_101037552 405
509 3300031548 Ga0307408_100124722 Ga0307408_1001247222 405
510 3300031616 Ga0307508_10001570 Ga0307508_1000157017 405
511 3300031649 Ga0307514_10040483 Ga0307514_100404832 405
512 3300031711 Ga0265314_10000012 Ga0265314_1000001239 405
513 3300031731 Ga0307405_10062736 Ga0307405_100627362 405
514 3300032002 Ga0307416_100073184 Ga0307416_1000731842 405
515 3300035112 Ga0373932_0012678 Ga0373932_0012678_126_1364 405
516 3300037068 Ga0373925_0003362 Ga0373925_0003362_7204_8430 405
517 3300037312 Ga0395899_0013417 Ga0395899_0013417_3171_4421 405
518 3300037312 Ga0395899_0025496 Ga0395899_0025496_1163_2407 405
519 3300037418 Ga0395900_0026497 Ga0395900_0026497_2530_3774 405
520 3300037471 Ga0395905_0006766 Ga0395905_0006766_9484_10731 405
521 3300037471 Ga0395905_0084413 Ga0395905_0084413_848_2092 405
522 3300037471 Ga0395905_0095056 Ga0395905_0095056_1155_2390 405
523 3300038443 Ga0395901_0010348 Ga0395901_0010348_1599_2849 405
524 3300041406 Ga0439439_0011910 Ga0439439_0011910_663_1901 405
525 3300042000 Ga0439437_004350 Ga0439437_004350_19_1278 405
526 3300042006 Ga0439432_021391 Ga0439432_021391_539_1777 405
527 3300042007 Ga0439449_0002564 Ga0439449_0002564_3233_4471 405
528 3300042010 Ga0439452_010143 Ga0439452_010143_1249_2487 405
529 3300042125 Ga0450923_009925 Ga0450923_009925_283_1521 405
530 3300042156 Ga0439446_0014972 Ga0439446_0014972_285_1523 405
531 3300042438 Ga0439459_0004826 Ga0439459_0004826_758_2017 405
532 3300042439 Ga0439464_0004333 Ga0439464_0004333_233_1471 405
533 3300042876 Ga0451577_0001993 Ga0451577_0001993_18782_20023 405
534 3300042876 Ga0451577_0099799 Ga0451577_0099799_235_1470 405
535 3300044706 Ga0466964_0019378 Ga0466964_0019378_1018_2322 405
536 3300044712 Ga0453684_0006765 Ga0453684_0006765_18632_19930 405
537 3300045051 Ga0451576_0024264 Ga0451576_0024264_498_1742 405
538 3300046471 Ga0495650_0014309 Ga0495650_0014309_830_2077 405
539 3300046475 Ga0495639_0014497 Ga0495639_0014497_514_1761 405
540 3300046506 Ga0495583_0000017 Ga0495583_0000017_50910_52145 405
541 3300046507 Ga0495606_0007405 Ga0495606_0007405_6424_7659 405
542 3300046537 Ga0495598_0007958 Ga0495598_0007958_1199_2437 405
543 3300046539 Ga0495621_0028065 Ga0495621_0028065_169_1404 405
544 3300046616 Ga0495668_0035048 Ga0495668_0035048_1488_2723 405
545 3300046694 Ga0495649_0000151 Ga0495649_0000151_41271_42506 405
546 3300046794 Ga0495589_0007070 Ga0495589_0007070_772_2007 405
547 3300047673 Ga0495593_0052839 Ga0495593_0052839_200_1447 405
548 3300048903 Ga0496100_0053001 Ga0496100_0053001_720_1967 405
549 3300048904 Ga0496101_0003019 Ga0496101_0003019_5938_7185 405
550 3300048905 Ga0496102_0006763 Ga0496102_0006763_3924_5171 405
551 3300048907 Ga0496104_0087344 Ga0496104_0087344_815_2053 405
552 3300048908 Ga0496105_0008621 Ga0496105_0008621_775_2022 405
553 3300048909 Ga0496106_0019139 Ga0496106_0019139_2552_3799 405
554 3300048912 Ga0496109_0107082 Ga0496109_0107082_985_2232 405
555 3300048913 Ga0496110_0246336 Ga0496110_0246336_81_1328 405
556 3300048914 Ga0496111_0017144 Ga0496111_0017144_2851_4098 405
557 3300048915 Ga0496112_0284028 Ga0496112_0284028_265_1512 405
558 3300048917 Ga0496114_0194687 Ga0496114_0194687_79_1326 405
559 3300048927 Ga0496124_0026316 Ga0496124_0026316_1909_3168 405
560 3300049568 Ga0501031_0000678 Ga0501031_0000678_9794_11032 405
561 3300049579 Ga0501043_0001160 Ga0501043_0001160_4514_5788 405
562 3300049580 Ga0501046_0001185 Ga0501046_0001185_4514_5788 405
563 3300049581 Ga0501047_0001232 Ga0501047_0001232_19558_20832 405
564 3300049582 Ga0501048_0015099 Ga0501048_0015099_206_1480 405
565 3300050493 nmdc:mga0k408_13106_c1 nmdc:mga0k408_13106_c1_2127_3368 405
566 3300050493 nmdc:mga0k408_34566_c1 nmdc:mga0k408_34566_c1_326_1564 405
567 3300050496 nmdc:mga07m45_2249_c1 nmdc:mga07m45_2249_c1_4023_5261 405
568 3300053156 Ga0500622_0002974 Ga0500622_0002974_4228_5487 405
569 3300059506 Ga0587085_004029 Ga0587085_004029_27_1280 405
570 iso_pu_bacteria 2511231002 2511247036 405
571 iso_pu_bacteria 2513020051 2513231368 405
572 iso_pu_bacteria 2513020051 2513231369 405
573 iso_pu_bacteria 2547132374 2548501001 405
574 iso_pu_bacteria 2585428057 2587730989 405
575 iso_pu_bacteria 2585428058 2587736841 405
576 iso_pu_bacteria 2585428062 2587756021 405
577 iso_pu_bacteria 2588253510 2588291741 405
578 iso_pu_bacteria 2599185214 2599626607 405
579 iso_pu_bacteria 2599185214 2599626608 405
580 iso_pu_bacteria 2599185226 2599675671 405
581 iso_pu_bacteria 2599185226 2599675672 405
582 iso_pu_bacteria 2599185227 2599684144 405
583 iso_pu_bacteria 2599185227 2599684145 405
584 iso_pu_bacteria 2599185229 2599696158 405
585 iso_pu_bacteria 2599185229 2599696159 405
586 iso_pu_bacteria 2643221570 2643866709 405
587 iso_pu_bacteria 2643221592 2643972430 405
588 iso_pu_bacteria 2643221596 2643993442 405
589 iso_pu_bacteria 2643221609 2644062694 405
590 iso_pu_bacteria 2643221611 2644076292 405
591 iso_pu_bacteria 2643221625 2644138562 405
592 iso_pu_bacteria 2643221628 2644163257 405
593 iso_pu_bacteria 2643221628 2644163258 405
594 iso_pu_bacteria 2643221648 2644272938 405
595 iso_pu_bacteria 2643221652 2644294580 405
596 iso_pu_bacteria 2643221658 2644327887 405
597 iso_pu_bacteria 2643221658 2644327888 405
598 iso_pu_bacteria 2643221672 2644397848 405
599 iso_pu_bacteria 2643221672 2644397849 405
600 iso_pu_bacteria 2643221683 2644468312 405
601 iso_pu_bacteria 2643221683 2644468313 405
602 iso_pu_bacteria 2643221717 2644645886 405
603 iso_pu_bacteria 2721755523 2722884103 405
604 iso_pu_bacteria 2721755523 2722884104 405
605 iso_pu_bacteria 2738541277 2738718017 405
606 iso_pu_bacteria 2738541277 2738718018 405
607 iso_pu_bacteria 2738541307 2738885086 405
608 iso_pu_bacteria 2738541307 2738885087 405
609 iso_pu_bacteria 2738543012 2739244626 405
610 iso_pu_bacteria 2738543013 2739251466 405
611 iso_pu_bacteria 2738543019 2739278703 405
612 iso_pu_bacteria 2738543019 2739278704 405
613 iso_pu_bacteria 2816332133 2816475170 405
614 iso_pu_bacteria 2818991446 2819595710 405
615 iso_pu_bacteria 2818991446 2819595711 405
616 iso_pu_bacteria 2831265667 2831266722 405
617 iso_pu_bacteria 2831265667 2831266723 405
618 iso_pu_bacteria 2831864461 2831866193 405
619 iso_pu_bacteria 2838054893 2838057197 405
620 iso_pu_bacteria 2838054893 2838057198 405
621 iso_pu_bacteria 2839138175 2839139836 405
622 iso_pu_bacteria 2839138175 2839139837 405
623 iso_pu_bacteria 2842677519 2842679629 405
624 iso_pu_bacteria 2842677519 2842679630 405
625 iso_pu_bacteria 2842718218 2842719962 405
626 iso_pu_bacteria 2842733646 2842735005 405
627 iso_pu_bacteria 2842733646 2842735006 405
628 iso_pu_bacteria 2842747753 2842751183 405
629 iso_pu_bacteria 2842747753 2842751184 405
630 iso_pu_bacteria 2885192300 2885192472 405
631 iso_pu_bacteria 2885192300 2885192473 405
632 iso_pu_bacteria 2885198086 2885200254 405
633 iso_pu_bacteria 2885198086 2885200255 405
634 iso_pu_bacteria 2885211737 2885213950 405
635 iso_pu_bacteria 2885211737 2885213951 405
636 iso_pu_bacteria 2899924645 2899925056 405
637 iso_pu_bacteria 2904449895 2904455735 405
638 iso_pu_bacteria 2904449895 2904455736 405
639 iso_pu_bacteria 2904456579 2904462751 405
640 iso_pu_bacteria 2904456579 2904462752 405
641 iso_pu_bacteria 2904541872 2904544814 405
642 iso_pu_bacteria 2904541872 2904544815 405
643 iso_pu_bacteria 2919462493 2919467274 405
644 iso_pu_bacteria 2919462493 2919467275 405
645 iso_pu_bacteria 2928037797 2928038819 405
646 iso_pu_bacteria 2928044640 2928045576 405
647 iso_pu_bacteria 2928044640 2928045577 405
648 iso_pu_bacteria 2928051484 2928053192 405
649 iso_pu_bacteria 2928051484 2928053193 405
650 iso_pu_bacteria 2928064002 2928066798 405
651 iso_pu_bacteria 2928064002 2928066799 405
652 iso_pu_bacteria 2928070936 2928071308 405
653 iso_pu_bacteria 2928070936 2928071309 405
654 iso_pu_bacteria 2928084124 2928084757 405
655 iso_pu_bacteria 2928084124 2928084758 405
656 iso_pu_bacteria 2928115317 2928119866 405
657 iso_pu_bacteria 2928115317 2928119867 405
658 iso_pu_bacteria 2929160207 2929163513 405
659 iso_pu_bacteria 2929160207 2929163514 405
660 iso_pu_bacteria 2929520902 2929522718 405
661 iso_pu_bacteria 2945909444 2945912212 405
662 iso_pu_bacteria 2945909444 2945912213 405
663 iso_pu_bacteria 2945945610 2945947732 405
664 iso_pu_bacteria 2945945610 2945947733 405
665 iso_pu_bacteria 2945972063 2945977407 405
666 iso_pu_bacteria 2945972063 2945977408 405
667 iso_pu_bacteria 2945984333 2945985480 405
668 iso_pu_bacteria 2945984333 2945985481 405
669 iso_pu_bacteria 2954767861 2954772051 405
670 iso_pu_bacteria 2954767861 2954772052 405
671 iso_pu_bacteria 2974320154 2974323087 405
672 iso_pu_bacteria 2990710928 2990712678 405
673 3300005339 Ga0070660_100249041 Ga0070660_1002490411 406
674 3300005366 Ga0070659_100090482 Ga0070659_1000904822 406
675 3300005458 Ga0070681_10303528 Ga0070681_103035281 406
676 3300005459 Ga0068867_100000234 Ga0068867_10000023425 406
677 3300005618 Ga0068864_100031021 Ga0068864_1000310212 406
678 3300006195 Ga0075366_10003302 Ga0075366_100033022 406
679 3300009148 Ga0105243_10001880 Ga0105243_1000188018 406
680 3300014745 Ga0157377_10000014 Ga0157377_1000001443 406
681 3300021361 Ga0213872_10041667 Ga0213872_100416672 406
682 3300025230 Ga0209563_103671 Ga0209563_1036713 406
683 3300025256 Ga0209759_1001199 Ga0209759_10011998 406
684 3300025273 Ga0209673_1017231 Ga0209673_10172312 406
685 3300025932 Ga0207690_10039046 Ga0207690_100390464 406
686 3300025935 Ga0207709_10004723 Ga0207709_100047233 406
687 3300025941 Ga0207711_10048324 Ga0207711_100483242 406
688 3300025960 Ga0207651_10055284 Ga0207651_100552843 406
689 3300026088 Ga0207641_10036047 Ga0207641_100360472 406
690 3300026089 Ga0207648_10000062 Ga0207648_1000006267 406
691 3300026095 Ga0207676_10037688 Ga0207676_100376883 406
692 3300026142 Ga0207698_10012848 Ga0207698_100128481 406
693 3300027614 Ga0209970_1000690 Ga0209970_10006902 406
694 3300028794 Ga0307515_10021785 Ga0307515_100217855 406
695 3300028794 Ga0307515_10068465 Ga0307515_100684657 406
696 3300031238 Ga0265332_10000033 Ga0265332_10000033142 406
697 3300031456 Ga0307513_10002833 Ga0307513_1000283313 406
698 3300031507 Ga0307509_10056231 Ga0307509_100562312 406
699 3300031730 Ga0307516_10005086 Ga0307516_1000508613 406
700 3300037471 Ga0395905_0015358 Ga0395905_0015358_5957_7228 406
701 3300038443 Ga0395901_0010348 Ga0395901_0010348_3109_4365 406
702 3300039447 Ga0436361_0026531 Ga0436361_0026531_786_2027 406
703 3300044712 Ga0453684_0073573 Ga0453684_0073573_1686_2996 406
704 3300048090 Ga0495615_0005712 Ga0495615_0005712_697_2001 406
705 3300049822 Ga0501035_0020751 Ga0501035_0020751_878_2143 406
706 3300050493 nmdc:mga0k408_163046_c1 nmdc:mga0k408_163046_c1_24_1268 406
707 3300050493 nmdc:mga0k408_38735_c1 nmdc:mga0k408_38735_c1_68_1369 406
708 3300053093 Ga0500651_0045243 Ga0500651_0045243_990_2222 406
709 iso_pu_bacteria 2643221654 2644305123 406
710 3300005262 Ga0065165_1001664 Ga0065165_100166415 407
711 3300005328 Ga0070676_10001353 Ga0070676_100013535 407
712 3300005338 Ga0068868_100003758 Ga0068868_1000037588 407
713 3300005364 Ga0070673_100006984 Ga0070673_1000069848 407
714 3300005367 Ga0070667_100001423 Ga0070667_1000014235 407
715 3300005459 Ga0068867_100001306 Ga0068867_1000013068 407
716 3300005577 Ga0068857_100137230 Ga0068857_1001372302 407
717 3300006195 Ga0075366_10088581 Ga0075366_100885811 407
718 3300006195 Ga0075366_10097862 Ga0075366_100978622 407
719 3300006353 Ga0075370_10008378 Ga0075370_100083783 407
720 3300006881 Ga0068865_100195010 Ga0068865_1001950101 407
721 3300013308 Ga0157375_10017862 Ga0157375_100178622 407
722 3300014968 Ga0157379_10027948 Ga0157379_100279484 407
723 3300014968 Ga0157379_10095832 Ga0157379_100958323 407
724 3300014968 Ga0157379_10275757 Ga0157379_102757571 407
725 3300025273 Ga0209673_1006734 Ga0209673_10067345 407
726 3300025297 Ga0209758_1000057 Ga0209758_1000057115 407
727 3300025298 Ga0209050_1000149 Ga0209050_1000149161 407
728 3300025907 Ga0207645_10012714 Ga0207645_100127148 407
729 3300025942 Ga0207689_10101824 Ga0207689_101018242 407
730 3300025960 Ga0207651_10013478 Ga0207651_100134783 407
731 3300025986 Ga0207658_10000860 Ga0207658_100008607 407
732 3300026089 Ga0207648_10004104 Ga0207648_100041048 407
733 3300026116 Ga0207674_10112297 Ga0207674_101122972 407
734 3300027876 Ga0209974_10001071 Ga0209974_100010712 407
735 3300028794 Ga0307515_10000727 Ga0307515_1000072742 407
736 3300028794 Ga0307515_10000998 Ga0307515_1000099833 407
737 3300030522 Ga0307512_10049207 Ga0307512_100492072 407
738 3300031251 Ga0265327_10000779 Ga0265327_1000077921 407
739 3300031456 Ga0307513_10000019 Ga0307513_1000001972 407
740 3300031507 Ga0307509_10146780 Ga0307509_101467802 407
741 3300031616 Ga0307508_10000004 Ga0307508_10000004228 407
742 3300031730 Ga0307516_10172547 Ga0307516_101725471 407
743 3300033179 Ga0307507_10048731 Ga0307507_100487313 407
744 3300041443 Ga0451789_0102886 Ga0451789_0102886_943_2190 407
745 3300041443 Ga0451789_0982253 Ga0451789_0982253_401_1648 407
746 3300041458 Ga0451798_0381267 Ga0451798_0381267_1902_3149 407
747 3300041460 Ga0451802_1471416 Ga0451802_1471416_53_1300 407
748 3300041463 Ga0451804_0153252 Ga0451804_0153252_676_1923 407
749 3300041507 Ga0451851_0707665 Ga0451851_0707665_95_1342 407
750 3300046512 Ga0495610_0035905 Ga0495610_0035905_1164_2411 407
751 3300047472 Ga0495686_0078679 Ga0495686_0078679_336_1583 407
752 3300048928 Ga0496125_0010221 Ga0496125_0010221_5637_6887 407
753 3300048929 Ga0496126_0035583 Ga0496126_0035583_102_1352 407
754 3300053086 Ga0500578_0000011 Ga0500578_0000011_92323_93570 407
755 3300053093 Ga0500651_0039754 Ga0500651_0039754_1027_2274 407
756 3300053117 Ga0500593_001023 Ga0500593_001023_7306_8538 407
757 3300053130 Ga0500642_0043132 Ga0500642_0043132_611_1858 407
758 3300053131 Ga0500652_006726 Ga0500652_006726_1567_2814 407
759 3300053156 Ga0500622_0000097 Ga0500622_0000097_60901_62148 407
760 3300002773 JGI25152J39213_1000738 JGI25152J39213_100073810 408
761 3300002987 JGI25159J45721_1000417 JGI25159J45721_10004177 408
762 3300002987 JGI25159J45721_1001150 JGI25159J45721_10011507 408
763 3300003187 JGI25151J46595_10006428 JGI25151J46595_100064283 408
764 3300003316 rootH1_10009119 rootH1_100091193 408
765 3300003322 rootL2_10023281 rootL2_100232813 408
766 3300003354 JGI25160J50197_1000472 JGI25160J50197_10004727 408
767 3300003374 JGI25161J50226_1000032 JGI25161J50226_100003293 408
768 3300003374 JGI25161J50226_1000064 JGI25161J50226_10000642 408
769 3300003771 Ga0055526_1001029 Ga0055526_100102912 408
770 3300003771 Ga0055526_1024152 Ga0055526_10241521 408
771 3300003773 Ga0055537_1000565 Ga0055537_10005656 408
772 3300003773 Ga0055537_1010531 Ga0055537_10105312 408
773 3300003775 Ga0055524_1000012 Ga0055524_1000012109 408
774 3300003775 Ga0055524_1000287 Ga0055524_100028730 408
775 3300003781 Ga0055536_1012824 Ga0055536_10128241 408
776 3300003790 Ga0055528_1007055 Ga0055528_10070555 408
777 3300003791 Ga0055530_10000218 Ga0055530_1000021843 408
778 3300003791 Ga0055530_10003706 Ga0055530_100037063 408
779 3300003792 Ga0055540_1000012 Ga0055540_1000012228 408
780 3300003792 Ga0055540_1000039 Ga0055540_100003910 408
781 3300003792 Ga0055540_1000062 Ga0055540_1000062111 408
782 3300003794 Ga0055531_10002364 Ga0055531_100023649 408
783 3300003794 Ga0055531_10012926 Ga0055531_100129261 408
784 3300005290 Ga0065712_10077432 Ga0065712_100774321 408
785 3300005328 Ga0070676_10001456 Ga0070676_100014567 408
786 3300005329 Ga0070683_100007952 Ga0070683_1000079528 408
787 3300005329 Ga0070683_100297331 Ga0070683_1002973311 408
788 3300005330 Ga0070690_100037982 Ga0070690_1000379823 408
789 3300005331 Ga0070670_100025196 Ga0070670_1000251962 408
790 3300005333 Ga0070677_10004130 Ga0070677_100041302 408
791 3300005334 Ga0068869_100041163 Ga0068869_1000411633 408
792 3300005335 Ga0070666_10007102 Ga0070666_100071022 408
793 3300005338 Ga0068868_100079207 Ga0068868_1000792072 408
794 3300005338 Ga0068868_100089432 Ga0068868_1000894321 408
795 3300005338 Ga0068868_100135869 Ga0068868_1001358691 408
796 3300005338 Ga0068868_100226829 Ga0068868_1002268291 408
797 3300005343 Ga0070687_100051223 Ga0070687_1000512232 408
798 3300005344 Ga0070661_100002137 Ga0070661_1000021371 408
799 3300005344 Ga0070661_100004541 Ga0070661_1000045413 408
800 3300005347 Ga0070668_100000930 Ga0070668_10000093016 408
801 3300005347 Ga0070668_100129226 Ga0070668_1001292261 408
802 3300005353 Ga0070669_100008074 Ga0070669_1000080742 408
803 3300005354 Ga0070675_100008566 Ga0070675_1000085662 408
804 3300005354 Ga0070675_100018066 Ga0070675_1000180664 408
805 3300005355 Ga0070671_100018775 Ga0070671_1000187755 408
806 3300005355 Ga0070671_100034852 Ga0070671_1000348524 408
807 3300005355 Ga0070671_100074851 Ga0070671_1000748512 408
808 3300005356 Ga0070674_100000518 Ga0070674_10000051810 408
809 3300005356 Ga0070674_100002778 Ga0070674_1000027785 408
810 3300005356 Ga0070674_100003318 Ga0070674_1000033182 408
811 3300005356 Ga0070674_100025030 Ga0070674_1000250302 408
812 3300005364 Ga0070673_100017830 Ga0070673_1000178304 408
813 3300005364 Ga0070673_100211707 Ga0070673_1002117071 408
814 3300005366 Ga0070659_100000178 Ga0070659_10000017822 408
815 3300005366 Ga0070659_100013767 Ga0070659_1000137676 408
816 3300005367 Ga0070667_100000887 Ga0070667_1000008878 408
817 3300005367 Ga0070667_100255817 Ga0070667_1002558171 408
818 3300005441 Ga0070700_100011768 Ga0070700_1000117684 408
819 3300005455 Ga0070663_100067903 Ga0070663_1000679032 408
820 3300005456 Ga0070678_100093366 Ga0070678_1000933662 408
821 3300005456 Ga0070678_100183807 Ga0070678_1001838071 408
822 3300005457 Ga0070662_100000646 Ga0070662_10000064610 408
823 3300005459 Ga0068867_100004484 Ga0068867_1000044845 408
824 3300005459 Ga0068867_100014751 Ga0068867_1000147515 408
825 3300005459 Ga0068867_100079902 Ga0068867_1000799022 408
826 3300005468 Ga0070707_100266424 Ga0070707_1002664241 408
827 3300005535 Ga0070684_100002660 Ga0070684_10000266012 408
828 3300005539 Ga0068853_100046733 Ga0068853_1000467332 408
829 3300005539 Ga0068853_100087126 Ga0068853_1000871264 408
830 3300005539 Ga0068853_100259887 Ga0068853_1002598872 408
831 3300005543 Ga0070672_100000150 Ga0070672_10000015020 408
832 3300005543 Ga0070672_100029365 Ga0070672_1000293652 408
833 3300005543 Ga0070672_100204136 Ga0070672_1002041361 408
834 3300005564 Ga0070664_100034043 Ga0070664_1000340434 408
835 3300005564 Ga0070664_100064440 Ga0070664_1000644402 408
836 3300005577 Ga0068857_100033075 Ga0068857_1000330753 408
837 3300005578 Ga0068854_100001586 Ga0068854_10000158611 408
838 3300005614 Ga0068856_100050218 Ga0068856_1000502184 408
839 3300005616 Ga0068852_100003415 Ga0068852_1000034155 408
840 3300005616 Ga0068852_100111142 Ga0068852_1001111422 408
841 3300005617 Ga0068859_100030836 Ga0068859_1000308365 408
842 3300005617 Ga0068859_100148499 Ga0068859_1001484992 408
843 3300005618 Ga0068864_100006994 Ga0068864_1000069946 408
844 3300005618 Ga0068864_100012986 Ga0068864_1000129862 408
845 3300005718 Ga0068866_10027755 Ga0068866_100277552 408
846 3300005719 Ga0068861_100024110 Ga0068861_1000241103 408
847 3300005719 Ga0068861_100026409 Ga0068861_1000264093 408
848 3300005834 Ga0068851_10061466 Ga0068851_100614662 408
849 3300005834 Ga0068851_10066642 Ga0068851_100666421 408
850 3300005841 Ga0068863_100006024 Ga0068863_1000060242 408
851 3300005841 Ga0068863_100077904 Ga0068863_1000779042 408
852 3300005841 Ga0068863_100163097 Ga0068863_1001630972 408
853 3300005841 Ga0068863_100192095 Ga0068863_1001920952 408
854 3300005842 Ga0068858_100006988 Ga0068858_1000069889 408
855 3300005843 Ga0068860_100001404 Ga0068860_10000140415 408
856 3300005843 Ga0068860_100056492 Ga0068860_1000564923 408
857 3300005843 Ga0068860_100069015 Ga0068860_1000690153 408
858 3300006038 Ga0075365_10040013 Ga0075365_100400132 408
859 3300006051 Ga0075364_10081580 Ga0075364_100815802 408
860 3300006178 Ga0075367_10023649 Ga0075367_100236492 408
861 3300006178 Ga0075367_10062297 Ga0075367_100622972 408
862 3300006186 Ga0075369_10001213 Ga0075369_100012137 408
863 3300006195 Ga0075366_10011482 Ga0075366_100114823 408
864 3300006237 Ga0097621_100048451 Ga0097621_1000484512 408
865 3300006353 Ga0075370_10003627 Ga0075370_100036275 408
866 3300006353 Ga0075370_10028308 Ga0075370_100283082 408
867 3300006353 Ga0075370_10052826 Ga0075370_100528261 408
868 3300006358 Ga0068871_100026057 Ga0068871_1000260575 408
869 3300006881 Ga0068865_100002164 Ga0068865_1000021645 408
870 3300006931 Ga0097620_100030836 Ga0097620_1000308365 408
871 3300006931 Ga0097620_100148494 Ga0097620_1001484942 408
872 3300006946 Ga0079104_1000019 Ga0079104_1000019197 408
873 3300009093 Ga0105240_10000951 Ga0105240_1000095141 408
874 3300009098 Ga0105245_10071820 Ga0105245_100718202 408
875 3300009176 Ga0105242_10006688 Ga0105242_100066882 408
876 3300009176 Ga0105242_10173431 Ga0105242_101734311 408
877 3300009177 Ga0105248_10107959 Ga0105248_101079592 408
878 3300009177 Ga0105248_10135771 Ga0105248_101357712 408
879 3300009545 Ga0105237_10003603 Ga0105237_100036036 408
880 3300009545 Ga0105237_10030715 Ga0105237_100307152 408
881 3300009551 Ga0105238_10007548 Ga0105238_100075483 408
882 3300009551 Ga0105238_10020812 Ga0105238_100208124 408
883 3300009553 Ga0105249_10152584 Ga0105249_101525842 408
884 3300010375 Ga0105239_10005179 Ga0105239_1000517913 408
885 3300010375 Ga0105239_10100070 Ga0105239_101000702 408
886 3300013100 Ga0157373_10008552 Ga0157373_100085525 408
887 3300013105 Ga0157369_10035074 Ga0157369_100350743 408
888 3300013296 Ga0157374_10016391 Ga0157374_100163914 408
889 3300013297 Ga0157378_10034311 Ga0157378_100343113 408
890 3300013306 Ga0163162_10029102 Ga0163162_100291024 408
891 3300013306 Ga0163162_10308257 Ga0163162_103082572 408
892 3300013307 Ga0157372_10002878 Ga0157372_1000287810 408
893 3300013308 Ga0157375_10003456 Ga0157375_100034565 408
894 3300013308 Ga0157375_10042838 Ga0157375_100428383 408
895 3300013308 Ga0157375_10063319 Ga0157375_100633194 408
896 3300014326 Ga0157380_10003080 Ga0157380_100030808 408
897 3300014326 Ga0157380_10023913 Ga0157380_100239133 408
898 3300014968 Ga0157379_10012988 Ga0157379_100129882 408
899 3300014968 Ga0157379_10017193 Ga0157379_100171934 408
900 3300014969 Ga0157376_10018872 Ga0157376_100188722 408
901 3300014969 Ga0157376_10130519 Ga0157376_101305192 408
902 3300014969 Ga0157376_10279849 Ga0157376_102798491 408
903 3300017792 Ga0163161_10004629 Ga0163161_100046295 408
904 3300017792 Ga0163161_10007626 Ga0163161_100076263 408
905 3300021384 Ga0213876_10028678 Ga0213876_100286784 408
906 3300025245 Ga0207425_1000218 Ga0207425_100021834 408
907 3300025245 Ga0207425_1002538 Ga0207425_10025382 408
908 3300025245 Ga0207425_1015207 Ga0207425_10152072 408
909 3300025258 Ga0209129_1000041 Ga0209129_1000041105 408
910 3300025263 Ga0209565_1000004 Ga0209565_1000004526 408
911 3300025263 Ga0209565_1000609 Ga0209565_10006097 408
912 3300025273 Ga0209673_1000357 Ga0209673_100035722 408
913 3300025284 Ga0209130_1000082 Ga0209130_100008256 408
914 3300025284 Ga0209130_1000094 Ga0209130_100009441 408
915 3300025291 Ga0209675_1000061 Ga0209675_1000061126 408
916 3300025291 Ga0209675_1004674 Ga0209675_10046745 408
917 3300025291 Ga0209675_1005211 Ga0209675_10052114 408
918 3300025292 Ga0209676_1000029 Ga0209676_1000029377 408
919 3300025294 Ga0209025_1005852 Ga0209025_10058524 408
920 3300025294 Ga0209025_1022914 Ga0209025_10229142 408
921 3300025295 Ga0209564_1000029 Ga0209564_1000029251 408
922 3300025295 Ga0209564_1005458 Ga0209564_10054586 408
923 3300025295 Ga0209564_1005474 Ga0209564_10054746 408
924 3300025295 Ga0209564_1009963 Ga0209564_10099633 408
925 3300025297 Ga0209758_1000043 Ga0209758_1000043189 408
926 3300025298 Ga0209050_1000003 Ga0209050_1000003439 408
927 3300025298 Ga0209050_1000569 Ga0209050_10005694 408
928 3300025299 Ga0209256_1000001 Ga0209256_1000001441 408
929 3300025299 Ga0209256_1000024 Ga0209256_1000024172 408
930 3300025302 Ga0207426_1000025 Ga0207426_1000025518 408
931 3300025302 Ga0207426_1001168 Ga0207426_10011681 408
932 3300025303 Ga0209051_1000003 Ga0209051_1000003439 408
933 3300025303 Ga0209051_1000063 Ga0209051_1000063116 408
934 3300025303 Ga0209051_1006392 Ga0209051_10063926 408
935 3300025304 Ga0209257_1000018 Ga0209257_1000018439 408
936 3300025304 Ga0209257_1000118 Ga0209257_100011891 408
937 3300025315 Ga0207697_10006077 Ga0207697_100060772 408
938 3300025315 Ga0207697_10020917 Ga0207697_100209172 408
939 3300025321 Ga0207656_10003985 Ga0207656_100039855 408
940 3300025893 Ga0207682_10000759 Ga0207682_1000075912 408
941 3300025893 Ga0207682_10013091 Ga0207682_100130911 408
942 3300025899 Ga0207642_10029763 Ga0207642_100297631 408
943 3300025907 Ga0207645_10004926 Ga0207645_100049267 408
944 3300025907 Ga0207645_10018093 Ga0207645_100180934 408
945 3300025913 Ga0207695_10002904 Ga0207695_100029045 408
946 3300025913 Ga0207695_10155131 Ga0207695_101551312 408
947 3300025914 Ga0207671_10005965 Ga0207671_100059658 408
948 3300025919 Ga0207657_10056390 Ga0207657_100563904 408
949 3300025919 Ga0207657_10129827 Ga0207657_101298272 408
950 3300025920 Ga0207649_10009799 Ga0207649_100097994 408
951 3300025921 Ga0207652_10139706 Ga0207652_101397062 408
952 3300025922 Ga0207646_10157201 Ga0207646_101572012 408
953 3300025923 Ga0207681_10010511 Ga0207681_100105112 408
954 3300025924 Ga0207694_10016398 Ga0207694_100163983 408
955 3300025924 Ga0207694_10034080 Ga0207694_100340803 408
956 3300025925 Ga0207650_10002442 Ga0207650_100024425 408
957 3300025926 Ga0207659_10000135 Ga0207659_1000013539 408
958 3300025927 Ga0207687_10015611 Ga0207687_100156112 408
959 3300025931 Ga0207644_10021457 Ga0207644_100214574 408
960 3300025931 Ga0207644_10041528 Ga0207644_100415282 408
961 3300025932 Ga0207690_10000359 Ga0207690_1000035922 408
962 3300025932 Ga0207690_10102670 Ga0207690_101026702 408
963 3300025933 Ga0207706_10000654 Ga0207706_100006545 408
964 3300025933 Ga0207706_10002944 Ga0207706_1000294417 408
965 3300025933 Ga0207706_10073320 Ga0207706_100733202 408
966 3300025933 Ga0207706_10078450 Ga0207706_100784502 408
967 3300025933 Ga0207706_10200717 Ga0207706_102007171 408
968 3300025934 Ga0207686_10073882 Ga0207686_100738822 408
969 3300025937 Ga0207669_10006838 Ga0207669_100068384 408
970 3300025937 Ga0207669_10009417 Ga0207669_100094172 408
971 3300025937 Ga0207669_10021720 Ga0207669_100217202 408
972 3300025937 Ga0207669_10052263 Ga0207669_100522633 408
973 3300025938 Ga0207704_10005625 Ga0207704_100056252 408
974 3300025940 Ga0207691_10001712 Ga0207691_100017125 408
975 3300025940 Ga0207691_10039447 Ga0207691_100394474 408
976 3300025941 Ga0207711_10045951 Ga0207711_100459512 408
977 3300025942 Ga0207689_10005835 Ga0207689_100058358 408
978 3300025942 Ga0207689_10023078 Ga0207689_100230782 408
979 3300025942 Ga0207689_10153379 Ga0207689_101533792 408
980 3300025944 Ga0207661_10012975 Ga0207661_100129753 408
981 3300025945 Ga0207679_10000220 Ga0207679_1000022045 408
982 3300025945 Ga0207679_10003707 Ga0207679_100037078 408
983 3300025945 Ga0207679_10072079 Ga0207679_100720792 408
984 3300025972 Ga0207668_10001541 Ga0207668_100015419 408
985 3300025972 Ga0207668_10183343 Ga0207668_101833431 408
986 3300025981 Ga0207640_10006017 Ga0207640_100060176 408
987 3300025986 Ga0207658_10005178 Ga0207658_100051786 408
988 3300026023 Ga0207677_10014359 Ga0207677_100143592 408
989 3300026023 Ga0207677_10026317 Ga0207677_100263172 408
990 3300026023 Ga0207677_10079217 Ga0207677_100792172 408
991 3300026035 Ga0207703_10009455 Ga0207703_100094552 408
992 3300026067 Ga0207678_10199620 Ga0207678_101996202 408
993 3300026078 Ga0207702_10011208 Ga0207702_100112085 408
994 3300026088 Ga0207641_10019756 Ga0207641_100197562 408
995 3300026088 Ga0207641_10020064 Ga0207641_100200643 408
996 3300026088 Ga0207641_10070520 Ga0207641_100705202 408
997 3300026088 Ga0207641_10314327 Ga0207641_103143271 408
998 3300026089 Ga0207648_10022340 Ga0207648_100223402 408
999 3300026089 Ga0207648_10076245 Ga0207648_100762452 408
1000 3300026089 Ga0207648_10144260 Ga0207648_101442602 408
1001 3300026095 Ga0207676_10007428 Ga0207676_100074282 408
1002 3300026116 Ga0207674_10041759 Ga0207674_100417593 408
1003 3300026118 Ga0207675_100000868 Ga0207675_1000008685 408
1004 3300026118 Ga0207675_100005109 Ga0207675_10000510910 408
1005 3300026121 Ga0207683_10023663 Ga0207683_100236632 408
1006 3300026121 Ga0207683_10044028 Ga0207683_100440281 408
1007 3300026121 Ga0207683_10044881 Ga0207683_100448814 408
1008 3300026121 Ga0207683_10046127 Ga0207683_100461271 408
1009 3300026142 Ga0207698_10004390 Ga0207698_100043904 408
1010 3300026142 Ga0207698_10024454 Ga0207698_100244543 408
1011 3300026142 Ga0207698_10273412 Ga0207698_102734121 408
1012 3300027111 Ga0209281_1000149 Ga0209281_100014996 408
1013 3300028379 Ga0268266_10072143 Ga0268266_100721432 408
1014 3300028381 Ga0268264_10001193 Ga0268264_1000119315 408
1015 3300028381 Ga0268264_10116829 Ga0268264_101168292 408
1016 3300028381 Ga0268264_10126132 Ga0268264_101261322 408
1017 3300028786 Ga0307517_10001025 Ga0307517_1000102510 408
1018 3300028794 Ga0307515_10007083 Ga0307515_1000708312 408
1019 3300028794 Ga0307515_10110315 Ga0307515_101103152 408
1020 3300031456 Ga0307513_10000051 Ga0307513_1000005167 408
1021 3300031507 Ga0307509_10000092 Ga0307509_100000926 408
1022 3300031507 Ga0307509_10003532 Ga0307509_1000353219 408
1023 3300031507 Ga0307509_10038946 Ga0307509_100389462 408
1024 3300031507 Ga0307509_10095060 Ga0307509_100950602 408
1025 3300031548 Ga0307408_100075069 Ga0307408_1000750691 408
1026 3300031730 Ga0307516_10007069 Ga0307516_100070697 408
1027 3300031731 Ga0307405_10123767 Ga0307405_101237671 408
1028 3300031901 Ga0307406_10071343 Ga0307406_100713431 408
1029 3300031911 Ga0307412_10029763 Ga0307412_100297632 408
1030 3300031995 Ga0307409_100048315 Ga0307409_1000483153 408
1031 3300032002 Ga0307416_100003421 Ga0307416_1000034219 408
1032 3300032004 Ga0307414_10007644 Ga0307414_100076446 408
1033 3300032004 Ga0307414_10129557 Ga0307414_101295572 408
1034 3300032005 Ga0307411_10005288 Ga0307411_100052887 408
1035 3300032005 Ga0307411_10155332 Ga0307411_101553321 408
1036 3300033180 Ga0307510_10002759 Ga0307510_1000275916 408
1037 3300035691 Ga0373931_0025052 Ga0373931_0025052_1233_2507 408
1038 3300036401 Ga0373937_0025203 Ga0373937_0025203_1053_2342 408
1039 3300037312 Ga0395899_0027819 Ga0395899_0027819_383_1627 408
1040 3300037466 Ga0395898_0054593 Ga0395898_0054593_1577_2821 408
1041 3300038443 Ga0395901_0049039 Ga0395901_0049039_2522_3766 408
1042 3300039450 Ga0436363_0660497 Ga0436363_0660497_5817_7100 408
1043 3300045051 Ga0451576_0185201 Ga0451576_0185201_832_2106 408
1044 3300046454 Ga0495592_0000085 Ga0495592_0000085_5061_6338 408
1045 3300046457 Ga0495590_0030763 Ga0495590_0030763_263_1549 408
1046 3300046459 Ga0495629_0100170 Ga0495629_0100170_201_1490 408
1047 3300046533 Ga0495640_0077443 Ga0495640_0077443_319_1608 408
1048 3300046616 Ga0495668_0012058 Ga0495668_0012058_3358_4638 408
1049 3300046616 Ga0495668_0024872 Ga0495668_0024872_1848_3137 408
1050 3300046660 Ga0495625_0024244 Ga0495625_0024244_2867_4153 408
1051 3300046660 Ga0495625_0159359 Ga0495625_0159359_184_1470 408
1052 3300046683 Ga0495658_0008307 Ga0495658_0008307_2433_3722 408
1053 3300046694 Ga0495649_0002613 Ga0495649_0002613_23_1309 408
1054 3300046810 Ga0495660_0010693 Ga0495660_0010693_2025_3311 408
1055 3300047443 Ga0495687_001028 Ga0495687_001028_16509_17795 408
1056 3300047443 Ga0495687_018047 Ga0495687_018047_23_1309 408
1057 3300047472 Ga0495686_0072663 Ga0495686_0072663_633_1910 408
1058 3300048905 Ga0496102_0113807 Ga0496102_0113807_135_1373 408
1059 3300048909 Ga0496106_0045643 Ga0496106_0045643_585_1859 408
1060 3300048909 Ga0496106_0060086 Ga0496106_0060086_326_1603 408
1061 3300048910 Ga0496107_0053764 Ga0496107_0053764_225_1499 408
1062 3300048917 Ga0496114_0001821 Ga0496114_0001821_10296_11549 408
1063 3300050489 nmdc:mga03683_11374_c1 nmdc:mga03683_11374_c1_255_1541 408
1064 3300050492 nmdc:mga0yw44_95707_c1 nmdc:mga0yw44_95707_c1_457_1743 408
1065 3300050493 nmdc:mga0k408_127848_c1 nmdc:mga0k408_127848_c1_162_1448 408
1066 3300050493 nmdc:mga0k408_3137_c1 nmdc:mga0k408_3137_c1_2364_3650 408
1067 3300050493 nmdc:mga0k408_3243_c1 nmdc:mga0k408_3243_c1_1244_2530 408
1068 3300050493 nmdc:mga0k408_3717_c1 nmdc:mga0k408_3717_c1_1512_2798 408
1069 3300050493 nmdc:mga0k408_42352_c1 nmdc:mga0k408_42352_c1_129_1415 408
1070 3300050496 nmdc:mga07m45_150_c1 nmdc:mga07m45_150_c1_13312_14598 408
1071 3300050496 nmdc:mga07m45_29017_c1 nmdc:mga07m45_29017_c1_1350_2636 408
1072 3300050516 nmdc:mga0sz30_8986_c1 nmdc:mga0sz30_8986_c1_1172_2458 408
1073 3300053077 Ga0495601_0010718 Ga0495601_0010718_381_1670 408
1074 3300053086 Ga0500578_0020439 Ga0500578_0020439_2463_3737 408
1075 3300053092 Ga0500583_0008528 Ga0500583_0008528_1638_2918 408
1076 3300053118 Ga0500594_0002798 Ga0500594_0002798_1399_2676 408
1077 3300053136 Ga0500559_0000017 Ga0500559_0000017_131057_132334 408
1078 3300053154 Ga0500619_000181 Ga0500619_000181_12497_13738 408
1079 3300053156 Ga0500622_0001258 Ga0500622_0001258_14044_15321 408
1080 3300053730 Ga0500645_000200 Ga0500645_000200_5705_7027 408
1081 3300053730 Ga0500645_001413 Ga0500645_001413_134_1459 408
1082 3300001979 JGI24740J21852_10020775 JGI24740J21852_100207752 409
1083 3300002704 JGI25155J39150_1000002 JGI25155J39150_100000234 409
1084 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003271 409
1085 3300002705 JGI25156J39149_1000837 JGI25156J39149_10008375 409
1086 3300002705 JGI25156J39149_1008895 JGI25156J39149_10088952 409
1087 3300002738 JGI25154J39366_1000009 JGI25154J39366_100000934 409
1088 3300002738 JGI25154J39366_1002448 JGI25154J39366_10024483 409
1089 3300002739 JGI25158J39367_1001490 JGI25158J39367_10014902 409
1090 3300002741 JGI25157J39369_1000002 JGI25157J39369_100000234 409
1091 3300002741 JGI25157J39369_1000251 JGI25157J39369_100025114 409
1092 3300002773 JGI25152J39213_1006919 JGI25152J39213_10069192 409
1093 3300002774 JGI25150J39212_1000868 JGI25150J39212_10008681 409
1094 3300002774 JGI25150J39212_1004489 JGI25150J39212_10044891 409
1095 3300002987 JGI25159J45721_1001933 JGI25159J45721_10019336 409
1096 3300002987 JGI25159J45721_1008673 JGI25159J45721_10086733 409
1097 3300003187 JGI25151J46595_10007156 JGI25151J46595_100071563 409
1098 3300003187 JGI25151J46595_10016665 JGI25151J46595_100166652 409
1099 3300003320 rootH2_10036890 rootH2_100368901 409
1100 3300003756 Ga0055533_1000028 Ga0055533_1000028231 409
1101 3300003756 Ga0055533_1000057 Ga0055533_100005786 409
1102 3300003759 Ga0055525_1000522 Ga0055525_10005222 409
1103 3300003761 Ga0055535_1000856 Ga0055535_100085610 409
1104 3300003761 Ga0055535_1000856 Ga0055535_10008569 409
1105 3300003761 Ga0055535_1001176 Ga0055535_100117611 409
1106 3300003762 Ga0055542_1000021 Ga0055542_1000021205 409
1107 3300003762 Ga0055542_1000021 Ga0055542_1000021206 409
1108 3300003763 Ga0055529_1000331 Ga0055529_10003316 409
1109 3300003773 Ga0055537_1000036 Ga0055537_100003614 409
1110 3300003773 Ga0055537_1002864 Ga0055537_10028641 409
1111 3300003781 Ga0055536_1003631 Ga0055536_10036316 409
1112 3300003781 Ga0055536_1003631 Ga0055536_10036317 409
1113 3300003781 Ga0055536_1010599 Ga0055536_10105992 409
1114 3300003784 Ga0055534_1000018 Ga0055534_100001870 409
1115 3300003784 Ga0055534_1001383 Ga0055534_10013836 409
1116 3300003784 Ga0055534_1004361 Ga0055534_10043612 409
1117 3300003790 Ga0055528_1000509 Ga0055528_100050921 409
1118 3300003790 Ga0055528_1003825 Ga0055528_10038256 409
1119 3300003791 Ga0055530_10000430 Ga0055530_1000043013 409
1120 3300003791 Ga0055530_10002887 Ga0055530_100028873 409
1121 3300003791 Ga0055530_10002887 Ga0055530_100028874 409
1122 3300003791 Ga0055530_10008617 Ga0055530_100086171 409
1123 3300003791 Ga0055530_10008617 Ga0055530_100086172 409
1124 3300003792 Ga0055540_1000016 Ga0055540_100001629 409
1125 3300003792 Ga0055540_1002048 Ga0055540_100204810 409
1126 3300003792 Ga0055540_1006044 Ga0055540_10060442 409
1127 3300003792 Ga0055540_1006044 Ga0055540_10060443 409
1128 3300003792 Ga0055540_1008499 Ga0055540_10084992 409
1129 3300003794 Ga0055531_10014062 Ga0055531_100140622 409
1130 3300003794 Ga0055531_10020585 Ga0055531_100205851 409
1131 3300004625 Ga0055543_1005865 Ga0055543_10058653 409
1132 3300004625 Ga0055543_1005952 Ga0055543_10059521 409
1133 3300004625 Ga0055543_1006341 Ga0055543_10063412 409
1134 3300004625 Ga0055543_1008256 Ga0055543_10082562 409
1135 3300005262 Ga0065165_1014104 Ga0065165_10141041 409
1136 3300005262 Ga0065165_1015749 Ga0065165_10157492 409
1137 3300005262 Ga0065165_1027589 Ga0065165_10275892 409
1138 3300005262 Ga0065165_1031101 Ga0065165_10311012 409
1139 3300005288 Ga0065714_10074978 Ga0065714_100749782 409
1140 3300005289 Ga0065704_10105517 Ga0065704_101055172 409
1141 3300005289 Ga0065704_10108668 Ga0065704_101086682 409
1142 3300005289 Ga0065704_10126163 Ga0065704_101261631 409
1143 3300005295 Ga0065707_10086952 Ga0065707_100869522 409
1144 3300005330 Ga0070690_100005973 Ga0070690_1000059735 409
1145 3300005339 Ga0070660_100104942 Ga0070660_1001049421 409
1146 3300005347 Ga0070668_100014358 Ga0070668_1000143582 409
1147 3300005353 Ga0070669_100059655 Ga0070669_1000596552 409
1148 3300005356 Ga0070674_100058684 Ga0070674_1000586842 409
1149 3300005441 Ga0070700_100060568 Ga0070700_1000605682 409
1150 3300005457 Ga0070662_100019033 Ga0070662_1000190332 409
1151 3300005457 Ga0070662_100090650 Ga0070662_1000906502 409
1152 3300005459 Ga0068867_100006419 Ga0068867_1000064197 409
1153 3300005535 Ga0070684_100134427 Ga0070684_1001344272 409
1154 3300005539 Ga0068853_100035486 Ga0068853_1000354862 409
1155 3300005539 Ga0068853_100035486 Ga0068853_1000354863 409
1156 3300005563 Ga0068855_100008323 Ga0068855_1000083238 409
1157 3300005563 Ga0068855_100231884 Ga0068855_1002318842 409
1158 3300005577 Ga0068857_100000422 Ga0068857_10000042223 409
1159 3300005614 Ga0068856_100004817 Ga0068856_1000048175 409
1160 3300005617 Ga0068859_100090165 Ga0068859_1000901652 409
1161 3300005617 Ga0068859_100154049 Ga0068859_1001540492 409
1162 3300005719 Ga0068861_100005099 Ga0068861_1000050991 409
1163 3300005843 Ga0068860_100003633 Ga0068860_1000036333 409
1164 3300005843 Ga0068860_100018213 Ga0068860_1000182132 409
1165 3300005844 Ga0068862_100008643 Ga0068862_1000086432 409
1166 3300005844 Ga0068862_100012198 Ga0068862_1000121982 409
1167 3300005844 Ga0068862_100014297 Ga0068862_1000142975 409
1168 3300005844 Ga0068862_100089917 Ga0068862_1000899172 409
1169 3300006038 Ga0075365_10013483 Ga0075365_100134833 409
1170 3300006177 Ga0075362_10019047 Ga0075362_100190471 409
1171 3300006177 Ga0075362_10025386 Ga0075362_100253862 409
1172 3300006178 Ga0075367_10138911 Ga0075367_101389111 409
1173 3300006186 Ga0075369_10048776 Ga0075369_100487762 409
1174 3300006195 Ga0075366_10005390 Ga0075366_100053902 409
1175 3300006353 Ga0075370_10003633 Ga0075370_100036333 409
1176 3300006353 Ga0075370_10003633 Ga0075370_100036334 409
1177 3300006353 Ga0075370_10031633 Ga0075370_100316332 409
1178 3300006353 Ga0075370_10037655 Ga0075370_100376551 409
1179 3300006358 Ga0068871_100051277 Ga0068871_1000512772 409
1180 3300006881 Ga0068865_100025563 Ga0068865_1000255634 409
1181 3300006931 Ga0097620_100090164 Ga0097620_1000901642 409
1182 3300006931 Ga0097620_100154058 Ga0097620_1001540582 409
1183 3300006946 Ga0079104_1000011 Ga0079104_1000011265 409
1184 3300006946 Ga0079104_1000011 Ga0079104_1000011266 409
1185 3300006948 Ga0099826_10007062 Ga0099826_100070621 409
1186 3300006948 Ga0099826_10007062 Ga0099826_100070622 409
1187 3300009036 Ga0105244_10003175 Ga0105244_100031753 409
1188 3300009092 Ga0105250_10017928 Ga0105250_100179282 409
1189 3300009098 Ga0105245_10105118 Ga0105245_101051182 409
1190 3300009148 Ga0105243_10003082 Ga0105243_1000308210 409
1191 3300009148 Ga0105243_10020381 Ga0105243_100203814 409
1192 3300009174 Ga0105241_10043500 Ga0105241_100435003 409
1193 3300009176 Ga0105242_10034606 Ga0105242_100346061 409
1194 3300009176 Ga0105242_10035127 Ga0105242_100351273 409
1195 3300009545 Ga0105237_10057916 Ga0105237_100579162 409
1196 3300009551 Ga0105238_10112379 Ga0105238_101123792 409
1197 3300011119 Ga0105246_10116819 Ga0105246_101168192 409
1198 3300013100 Ga0157373_10012879 Ga0157373_100128794 409
1199 3300013100 Ga0157373_10012879 Ga0157373_100128795 409
1200 3300013104 Ga0157370_10019170 Ga0157370_100191705 409
1201 3300013104 Ga0157370_10129097 Ga0157370_101290972 409
1202 3300013105 Ga0157369_10021442 Ga0157369_100214424 409
1203 3300013306 Ga0163162_10011301 Ga0163162_100113018 409
1204 3300013307 Ga0157372_10026418 Ga0157372_100264183 409
1205 3300014497 Ga0182008_10001698 Ga0182008_1000169810 409
1206 3300014497 Ga0182008_10013166 Ga0182008_100131662 409
1207 3300014497 Ga0182008_10015404 Ga0182008_100154041 409
1208 3300014497 Ga0182008_10034149 Ga0182008_100341492 409
1209 3300015261 Ga0182006_1001743 Ga0182006_10017439 409
1210 3300015261 Ga0182006_1035107 Ga0182006_10351071 409
1211 3300015261 Ga0182006_1039934 Ga0182006_10399342 409
1212 3300015262 Ga0182007_10003330 Ga0182007_100033306 409
1213 3300015262 Ga0182007_10029258 Ga0182007_100292582 409
1214 3300015683 Ga0183362_10001 Ga0183362_100011156 409
1215 3300017792 Ga0163161_10000149 Ga0163161_100001492 409
1216 3300017792 Ga0163161_10010900 Ga0163161_100109003 409
1217 3300017792 Ga0163161_10013402 Ga0163161_100134024 409
1218 3300017792 Ga0163161_10018680 Ga0163161_100186804 409
1219 3300017792 Ga0163161_10064859 Ga0163161_100648592 409
1220 3300021361 Ga0213872_10001558 Ga0213872_100015582 409
1221 3300025206 Ga0209435_100001 Ga0209435_100001682 409
1222 3300025208 Ga0209436_108179 Ga0209436_1081792 409
1223 3300025226 Ga0209674_100007 Ga0209674_100007812 409
1224 3300025228 Ga0209672_100751 Ga0209672_10075114 409
1225 3300025228 Ga0209672_103873 Ga0209672_1038732 409
1226 3300025229 Ga0209147_102627 Ga0209147_1026272 409
1227 3300025229 Ga0209147_102627 Ga0209147_1026273 409
1228 3300025230 Ga0209563_100033 Ga0209563_100033228 409
1229 3300025231 Ga0207427_101232 Ga0207427_1012323 409
1230 3300025242 Ga0209258_100058 Ga0209258_100058205 409
1231 3300025242 Ga0209258_100058 Ga0209258_100058206 409
1232 3300025242 Ga0209258_100353 Ga0209258_1003536 409
1233 3300025245 Ga0207425_1001283 Ga0207425_10012839 409
1234 3300025245 Ga0207425_1006474 Ga0207425_10064741 409
1235 3300025245 Ga0207425_1012416 Ga0207425_10124161 409
1236 3300025246 Ga0209646_1000001 Ga0209646_10000011051 409
1237 3300025246 Ga0209646_1000053 Ga0209646_1000053128 409
1238 3300025250 Ga0209026_1000003 Ga0209026_1000003682 409
1239 3300025250 Ga0209026_1000020 Ga0209026_1000020191 409
1240 3300025253 Ga0209677_100132 Ga0209677_10013223 409
1241 3300025253 Ga0209677_100161 Ga0209677_1001613 409
1242 3300025253 Ga0209677_103481 Ga0209677_1034812 409
1243 3300025254 Ga0209148_1000071 Ga0209148_1000071205 409
1244 3300025254 Ga0209148_1000071 Ga0209148_1000071206 409
1245 3300025254 Ga0209148_1003552 Ga0209148_10035523 409
1246 3300025256 Ga0209759_1000001 Ga0209759_1000001682 409
1247 3300025256 Ga0209759_1000017 Ga0209759_1000017128 409
1248 3300025256 Ga0209759_1000913 Ga0209759_10009136 409
1249 3300025256 Ga0209759_1002284 Ga0209759_10022843 409
1250 3300025258 Ga0209129_1000023 Ga0209129_100002310 409
1251 3300025258 Ga0209129_1000023 Ga0209129_10000239 409
1252 3300025258 Ga0209129_1001863 Ga0209129_10018632 409
1253 3300025258 Ga0209129_1007583 Ga0209129_10075833 409
1254 3300025258 Ga0209129_1008749 Ga0209129_10087492 409
1255 3300025263 Ga0209565_1000075 Ga0209565_100007585 409
1256 3300025263 Ga0209565_1000075 Ga0209565_100007587 409
1257 3300025263 Ga0209565_1000693 Ga0209565_10006936 409
1258 3300025263 Ga0209565_1000693 Ga0209565_10006937 409
1259 3300025263 Ga0209565_1003001 Ga0209565_10030013 409
1260 3300025263 Ga0209565_1003001 Ga0209565_10030014 409
1261 3300025272 Ga0209455_1000136 Ga0209455_1000136134 409
1262 3300025273 Ga0209673_1000066 Ga0209673_1000066145 409
1263 3300025273 Ga0209673_1000066 Ga0209673_1000066146 409
1264 3300025273 Ga0209673_1000289 Ga0209673_100028962 409
1265 3300025273 Ga0209673_1000289 Ga0209673_100028964 409
1266 3300025273 Ga0209673_1000362 Ga0209673_100036211 409
1267 3300025273 Ga0209673_1000362 Ga0209673_100036212 409
1268 3300025273 Ga0209673_1009202 Ga0209673_10092022 409
1269 3300025284 Ga0209130_1000069 Ga0209130_100006912 409
1270 3300025284 Ga0209130_1000069 Ga0209130_100006913 409
1271 3300025284 Ga0209130_1002257 Ga0209130_10022571 409
1272 3300025284 Ga0209130_1003786 Ga0209130_10037863 409
1273 3300025284 Ga0209130_1003786 Ga0209130_10037864 409
1274 3300025291 Ga0209675_1000074 Ga0209675_100007485 409
1275 3300025291 Ga0209675_1000074 Ga0209675_100007487 409
1276 3300025291 Ga0209675_1000177 Ga0209675_100017738 409
1277 3300025291 Ga0209675_1000177 Ga0209675_100017739 409
1278 3300025291 Ga0209675_1001059 Ga0209675_10010596 409
1279 3300025291 Ga0209675_1001059 Ga0209675_10010597 409
1280 3300025291 Ga0209675_1001796 Ga0209675_10017963 409
1281 3300025291 Ga0209675_1012304 Ga0209675_10123042 409
1282 3300025292 Ga0209676_1000005 Ga0209676_1000005820 409
1283 3300025292 Ga0209676_1000005 Ga0209676_1000005821 409
1284 3300025292 Ga0209676_1000142 Ga0209676_100014279 409
1285 3300025292 Ga0209676_1000142 Ga0209676_100014280 409
1286 3300025292 Ga0209676_1000186 Ga0209676_10001866 409
1287 3300025292 Ga0209676_1000186 Ga0209676_10001867 409
1288 3300025292 Ga0209676_1003917 Ga0209676_10039174 409
1289 3300025292 Ga0209676_1003917 Ga0209676_10039175 409
1290 3300025292 Ga0209676_1017519 Ga0209676_10175192 409
1291 3300025294 Ga0209025_1000351 Ga0209025_10003512 409
1292 3300025294 Ga0209025_1000579 Ga0209025_100057911 409
1293 3300025294 Ga0209025_1000579 Ga0209025_100057912 409
1294 3300025294 Ga0209025_1000644 Ga0209025_10006443 409
1295 3300025294 Ga0209025_1000644 Ga0209025_10006444 409
1296 3300025294 Ga0209025_1010713 Ga0209025_10107133 409
1297 3300025294 Ga0209025_1010713 Ga0209025_10107134 409
1298 3300025294 Ga0209025_1027340 Ga0209025_10273402 409
1299 3300025295 Ga0209564_1000090 Ga0209564_1000090128 409
1300 3300025295 Ga0209564_1000090 Ga0209564_1000090129 409
1301 3300025295 Ga0209564_1000527 Ga0209564_10005276 409
1302 3300025295 Ga0209564_1000527 Ga0209564_10005277 409
1303 3300025297 Ga0209758_1000044 Ga0209758_1000044278 409
1304 3300025297 Ga0209758_1000044 Ga0209758_1000044279 409
1305 3300025297 Ga0209758_1020115 Ga0209758_10201153 409
1306 3300025297 Ga0209758_1041408 Ga0209758_10414082 409
1307 3300025298 Ga0209050_1000007 Ga0209050_1000007276 409
1308 3300025298 Ga0209050_1000007 Ga0209050_1000007277 409
1309 3300025298 Ga0209050_1000082 Ga0209050_1000082176 409
1310 3300025298 Ga0209050_1005248 Ga0209050_10052482 409
1311 3300025298 Ga0209050_1005248 Ga0209050_10052483 409
1312 3300025298 Ga0209050_1006884 Ga0209050_10068845 409
1313 3300025299 Ga0209256_1000020 Ga0209256_1000020281 409
1314 3300025299 Ga0209256_1000020 Ga0209256_1000020282 409
1315 3300025299 Ga0209256_1000022 Ga0209256_1000022163 409
1316 3300025299 Ga0209256_1000022 Ga0209256_1000022164 409
1317 3300025302 Ga0207426_1000001 Ga0207426_1000001916 409
1318 3300025302 Ga0207426_1000001 Ga0207426_1000001917 409
1319 3300025302 Ga0207426_1000031 Ga0207426_1000031320 409
1320 3300025302 Ga0207426_1000031 Ga0207426_1000031321 409
1321 3300025303 Ga0209051_1000029 Ga0209051_1000029176 409
1322 3300025303 Ga0209051_1000036 Ga0209051_1000036171 409
1323 3300025303 Ga0209051_1000036 Ga0209051_1000036172 409
1324 3300025303 Ga0209051_1000213 Ga0209051_100021385 409
1325 3300025303 Ga0209051_1000213 Ga0209051_100021386 409
1326 3300025303 Ga0209051_1000243 Ga0209051_100024379 409
1327 3300025303 Ga0209051_1000243 Ga0209051_100024380 409
1328 3300025303 Ga0209051_1000455 Ga0209051_100045530 409
1329 3300025303 Ga0209051_1000455 Ga0209051_100045531 409
1330 3300025303 Ga0209051_1004021 Ga0209051_10040214 409
1331 3300025303 Ga0209051_1004021 Ga0209051_10040215 409
1332 3300025304 Ga0209257_1000011 Ga0209257_1000011794 409
1333 3300025304 Ga0209257_1000011 Ga0209257_1000011795 409
1334 3300025304 Ga0209257_1000030 Ga0209257_1000030169 409
1335 3300025304 Ga0209257_1000226 Ga0209257_100022695 409
1336 3300025304 Ga0209257_1000226 Ga0209257_100022696 409
1337 3300025304 Ga0209257_1000980 Ga0209257_10009802 409
1338 3300025304 Ga0209257_1000980 Ga0209257_10009803 409
1339 3300025304 Ga0209257_1018343 Ga0209257_10183432 409
1340 3300025304 Ga0209257_1019700 Ga0209257_10197002 409
1341 3300025321 Ga0207656_10013411 Ga0207656_100134112 409
1342 3300025711 Ga0207696_1015363 Ga0207696_10153632 409
1343 3300025728 Ga0207655_1026542 Ga0207655_10265422 409
1344 3300025911 Ga0207654_10034398 Ga0207654_100343981 409
1345 3300025913 Ga0207695_10018222 Ga0207695_100182223 409
1346 3300025914 Ga0207671_10103190 Ga0207671_101031902 409
1347 3300025924 Ga0207694_10043051 Ga0207694_100430512 409
1348 3300025934 Ga0207686_10025763 Ga0207686_100257632 409
1349 3300025935 Ga0207709_10000147 Ga0207709_100001472 409
1350 3300025935 Ga0207709_10000214 Ga0207709_100002142 409
1351 3300025935 Ga0207709_10009501 Ga0207709_100095012 409
1352 3300025935 Ga0207709_10009501 Ga0207709_100095013 409
1353 3300025935 Ga0207709_10020370 Ga0207709_100203702 409
1354 3300025935 Ga0207709_10032522 Ga0207709_100325222 409
1355 3300025937 Ga0207669_10004703 Ga0207669_100047032 409
1356 3300025938 Ga0207704_10029924 Ga0207704_100299242 409
1357 3300025945 Ga0207679_10017872 Ga0207679_100178722 409
1358 3300025949 Ga0207667_10054838 Ga0207667_100548383 409
1359 3300025949 Ga0207667_10103527 Ga0207667_101035272 409
1360 3300025972 Ga0207668_10025183 Ga0207668_100251833 409
1361 3300026075 Ga0207708_10075749 Ga0207708_100757492 409
1362 3300026078 Ga0207702_10002918 Ga0207702_100029187 409
1363 3300026088 Ga0207641_10052146 Ga0207641_100521463 409
1364 3300026089 Ga0207648_10002388 Ga0207648_100023883 409
1365 3300026116 Ga0207674_10001725 Ga0207674_1000172522 409
1366 3300026118 Ga0207675_100002203 Ga0207675_10000220315 409
1367 3300026121 Ga0207683_10108741 Ga0207683_101087412 409
1368 3300027111 Ga0209281_1000005 Ga0209281_1000005675 409
1369 3300027111 Ga0209281_1000005 Ga0209281_1000005676 409
1370 3300027424 Ga0209984_1002311 Ga0209984_10023112 409
1371 3300027666 Ga0209282_1000864 Ga0209282_100086410 409
1372 3300027666 Ga0209282_1000864 Ga0209282_10008649 409
1373 3300027682 Ga0209971_1007153 Ga0209971_10071532 409
1374 3300027876 Ga0209974_10014591 Ga0209974_100145912 409
1375 3300028380 Ga0268265_10030110 Ga0268265_100301102 409
1376 3300028380 Ga0268265_10083622 Ga0268265_100836222 409
1377 3300028381 Ga0268264_10023892 Ga0268264_100238923 409
1378 3300028381 Ga0268264_10093386 Ga0268264_100933862 409
1379 3300028666 Ga0265336_10000012 Ga0265336_1000001293 409
1380 3300028794 Ga0307515_10000137 Ga0307515_1000013764 409
1381 3300028794 Ga0307515_10000137 Ga0307515_1000013765 409
1382 3300028794 Ga0307515_10002977 Ga0307515_1000297715 409
1383 3300029957 Ga0265324_10003636 Ga0265324_100036366 409
1384 3300030733 Ga0314311_1018086 Ga0314311_10180862 409
1385 3300030735 Ga0316178_1128022 Ga0316178_11280223 409
1386 3300030735 Ga0316178_1128022 Ga0316178_11280224 409
1387 3300030736 Ga0316180_1003872 Ga0316180_10038722 409
1388 3300030742 Ga0316183_1046777 Ga0316183_10467772 409
1389 3300030742 Ga0316183_1046777 Ga0316183_10467773 409
1390 3300030744 Ga0316181_1014423 Ga0316181_10144234 409
1391 3300030744 Ga0316181_1014423 Ga0316181_10144235 409
1392 3300031250 Ga0265331_10001854 Ga0265331_1000185416 409
1393 3300031251 Ga0265327_10000309 Ga0265327_1000030990 409
1394 3300031251 Ga0265327_10001589 Ga0265327_1000158910 409
1395 3300031251 Ga0265327_10011830 Ga0265327_100118305 409
1396 3300031344 Ga0265316_10000833 Ga0265316_100008332 409
1397 3300031456 Ga0307513_10310883 Ga0307513_103108831 409
1398 3300031548 Ga0307408_100000407 Ga0307408_10000040728 409
1399 3300031548 Ga0307408_100006921 Ga0307408_10000692112 409
1400 3300031548 Ga0307408_100051504 Ga0307408_1000515042 409
1401 3300031548 Ga0307408_100071443 Ga0307408_1000714432 409
1402 3300031548 Ga0307408_100119969 Ga0307408_1001199692 409
1403 3300031649 Ga0307514_10003976 Ga0307514_100039766 409
1404 3300031649 Ga0307514_10040375 Ga0307514_100403752 409
1405 3300031649 Ga0307514_10040375 Ga0307514_100403753 409
1406 3300031730 Ga0307516_10019753 Ga0307516_100197534 409
1407 3300031730 Ga0307516_10210361 Ga0307516_102103612 409
1408 3300031731 Ga0307405_10154149 Ga0307405_101541491 409
1409 3300031731 Ga0307405_10185738 Ga0307405_101857381 409
1410 3300031901 Ga0307406_10000050 Ga0307406_1000005044 409
1411 3300031901 Ga0307406_10000440 Ga0307406_1000044020 409
1412 3300031901 Ga0307406_10004637 Ga0307406_100046372 409
1413 3300031901 Ga0307406_10004637 Ga0307406_100046373 409
1414 3300031911 Ga0307412_10013847 Ga0307412_100138475 409
1415 3300032004 Ga0307414_10023583 Ga0307414_100235832 409
1416 3300032004 Ga0307414_10030258 Ga0307414_100302582 409
1417 3300032004 Ga0307414_10117542 Ga0307414_101175421 409
1418 3300032005 Ga0307411_10113643 Ga0307411_101136432 409
1419 3300035086 Ga0373934_0006495 Ga0373934_0006495_493_1740 409
1420 3300037471 Ga0395905_0005758 Ga0395905_0005758_6529_7779 409
1421 3300037471 Ga0395905_0017190 Ga0395905_0017190_5346_6599 409
1422 3300037471 Ga0395905_0054783 Ga0395905_0054783_2060_3313 409
1423 3300039447 Ga0436361_0848510 Ga0436361_0848510_3407_4642 409
1424 3300041407 Ga0439447_025116 Ga0439447_025116_184_1428 409
1425 3300041411 Ga0439466_0015578 Ga0439466_0015578_506_1744 409
1426 3300042004 Ga0439445_0013762 Ga0439445_0013762_288_1526 409
1427 3300042006 Ga0439432_037869 Ga0439432_037869_56_1300 409
1428 3300042007 Ga0439449_0002664 Ga0439449_0002664_2655_3899 409
1429 3300042007 Ga0439449_0002664 Ga0439449_0002664_4065_5303 409
1430 3300042007 Ga0439449_0062728 Ga0439449_0062728_85_1341 409
1431 3300042876 Ga0451577_0242541 Ga0451577_0242541_265_1503 409
1432 3300044656 Ga0466969_0000002 Ga0466969_0000002_37990_39243 409
1433 3300044656 Ga0466969_0004958 Ga0466969_0004958_3629_4879 409
1434 3300044656 Ga0466969_0010775 Ga0466969_0010775_2255_3505 409
1435 3300044658 Ga0466972_0001432 Ga0466972_0001432_2311_3582 409
1436 3300044658 Ga0466972_0001996 Ga0466972_0001996_3010_4257 409
1437 3300044683 Ga0466965_0008514 Ga0466965_0008514_1120_2370 409
1438 3300044684 Ga0466966_0005727 Ga0466966_0005727_6876_8162 409
1439 3300044684 Ga0466966_0026318 Ga0466966_0026318_2269_3519 409
1440 3300044684 Ga0466966_0136381 Ga0466966_0136381_111_1361 409
1441 3300044693 Ga0466961_0010534 Ga0466961_0010534_1560_2807 409
1442 3300044693 Ga0466961_0023826 Ga0466961_0023826_1962_3212 409
1443 3300044693 Ga0466961_0061473 Ga0466961_0061473_731_2017 409
1444 3300044706 Ga0466964_0001984 Ga0466964_0001984_1984_3234 409
1445 3300044706 Ga0466964_0002512 Ga0466964_0002512_4814_6064 409
1446 3300044719 Ga0466971_0010968 Ga0466971_0010968_2005_3255 409
1447 3300044765 Ga0466970_0011589 Ga0466970_0011589_2509_3759 409
1448 3300044765 Ga0466970_0015713 Ga0466970_0015713_469_1719 409
1449 3300044842 Ga0466957_0001959 Ga0466957_0001959_3904_5154 409
1450 3300044842 Ga0466957_0025793 Ga0466957_0025793_239_1489 409
1451 3300045049 Ga0466959_0000666 Ga0466959_0000666_9462_10712 409
1452 3300045049 Ga0466959_0003830 Ga0466959_0003830_8582_9832 409
1453 3300045049 Ga0466959_0019965 Ga0466959_0019965_1308_2555 409
1454 3300045051 Ga0451576_0230389 Ga0451576_0230389_496_1743 409
1455 3300045836 Ga0466958_0018392 Ga0466958_0018392_1077_2327 409
1456 3300045976 Ga0466967_0006653 Ga0466967_0006653_5451_6701 409
1457 3300046471 Ga0495650_0008300 Ga0495650_0008300_1520_2770 409
1458 3300046475 Ga0495639_0061082 Ga0495639_0061082_417_1667 409
1459 3300046530 Ga0495654_0019169 Ga0495654_0019169_1458_2699 409
1460 3300046542 Ga0495597_0000860 Ga0495597_0000860_7071_8306 409
1461 3300046615 Ga0495656_0001200 Ga0495656_0001200_5654_6892 409
1462 3300046660 Ga0495625_0000044 Ga0495625_0000044_91792_93030 409
1463 3300047321 Ga0495676_0024202 Ga0495676_0024202_77_1321 409
1464 3300047472 Ga0495686_0001809 Ga0495686_0001809_7523_8812 409
1465 3300047472 Ga0495686_0005751 Ga0495686_0005751_5347_6597 409
1466 3300048919 Ga0496116_0067077 Ga0496116_0067077_849_2081 409
1467 3300048920 Ga0496117_0017641 Ga0496117_0017641_3826_5058 409
1468 3300048921 Ga0496118_0076428 Ga0496118_0076428_446_1675 409
1469 3300048924 Ga0496121_0117372 Ga0496121_0117372_71_1303 409
1470 3300048925 Ga0496122_0000274 Ga0496122_0000274_47741_48970 409
1471 3300048925 Ga0496122_0000274 Ga0496122_0000274_49152_50381 409
1472 3300048926 Ga0496123_0000262 Ga0496123_0000262_81335_82564 409
1473 3300048926 Ga0496123_0000262 Ga0496123_0000262_82746_83975 409
1474 3300048927 Ga0496124_0129422 Ga0496124_0129422_628_1857 409
1475 3300048928 Ga0496125_0005447 Ga0496125_0005447_11203_12453 409
1476 3300048929 Ga0496126_0039612 Ga0496126_0039612_85_1335 409
1477 3300048929 Ga0496126_0087756 Ga0496126_0087756_815_2056 409
1478 3300049679 Ga0501249_003156 Ga0501249_003156_427_1668 409
1479 3300049759 Ga0501262_000134 Ga0501262_000134_5653_6894 409
1480 3300049759 Ga0501262_000134 Ga0501262_000134_7097_8326 409
1481 3300050489 nmdc:mga03683_29665_c1 nmdc:mga03683_29665_c1_368_1597 409
1482 3300050489 nmdc:mga03683_43882_c1 nmdc:mga03683_43882_c1_60_1301 409
1483 3300050493 nmdc:mga0k408_33152_c1 nmdc:mga0k408_33152_c1_532_1770 409
1484 3300050496 nmdc:mga07m45_16722_c1 nmdc:mga07m45_16722_c1_1107_2345 409
1485 3300050496 nmdc:mga07m45_2640_c1 nmdc:mga07m45_2640_c1_537_1787 409
1486 3300053079 Ga0500610_0024972 Ga0500610_0024972_1555_2799 409
1487 3300053080 Ga0500635_0000053 Ga0500635_0000053_39126_40376 409
1488 3300053087 Ga0500643_005802 Ga0500643_005802_603_1847 409
1489 3300053093 Ga0500651_0000053 Ga0500651_0000053_65630_66874 409
1490 3300053118 Ga0500594_0009467 Ga0500594_0009467_660_1901 409
1491 3300053133 Ga0500655_011021 Ga0500655_011021_89_1333 409
1492 3300053136 Ga0500559_0008060 Ga0500559_0008060_2457_3707 409
1493 3300053141 Ga0500574_014530 Ga0500574_014530_593_1837 409
1494 3300053153 Ga0500616_0034802 Ga0500616_0034802_765_2006 409
1495 3300053177 Ga0500636_0057982 Ga0500636_0057982_434_1678 409
1496 3300061719 Ga0466962_0012218 Ga0466962_0012218_84_1334 409
1497 3300061719 Ga0466962_0017271 Ga0466962_0017271_986_2233 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

58

407

0.92

PF13433

Peripla_BP_5

Periplasmic binding protein domain

183

415

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ip9-assembly1.cif.gz_A structure of atu2422-gaba receptor in complex with gaba 0.8894 27 390
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.8873 27 405
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8852 26 391
3ipc-assembly1.cif.gz_A structure of atu2422-gaba f77a mutant receptor in complex with leucine 0.8851 27 390
3ip9-assembly1.cif.gz_A structure of atu2422-gaba receptor in complex with gaba 0.8846 27 390
ID Description Score Start End Superfamily
4xfkA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.897 154 409 3.40.50.2300
4xfkA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8824 154 409 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8763 28 366 3.40.190.10
4jb2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8721 154 282 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8666 28 366 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3N7JYL7-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9963 23 409
AF-A0A4Q3N6Q6-F1-model_v4 deleted 0.996 128 409
AF-A0A4Q3N6Q6-F1-model_v4 deleted 0.9855 128 409
AF-A0A3S0G2G8-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9816 27 399 GO:0006865
AF-A0A5F0UYF6-F1-model_v4 deleted 0.9722 281 409

Feature Viewer

pLDDT pTM Quality
94.19 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map