F494338

General Info

Members Datasets Scaffolds Average Seq Length
1491 538 1483 133

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_001717|Ga0500595_001717_7826_8311
Length 161
Sequence MVWRHSTGRRLEQRQSGLCPDFKANKEFSMTRELFWLTLTVILTGLLWVPYVLNRCQVRGLGGAMANPSRNDKPHAEWATRLMFAHDNAVENLVIFAPLVLILAEIDYSSKWTVYACAVYFWSRVAHLIVYALGLPVFRTLAFTVGFLAQAVLALGIFKIV

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
5 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
6 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
7 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
103 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
104 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
126 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
149 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
150 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
218 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
219 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
220 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
227 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
228 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
229 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
230 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
231 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
232 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
233 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
234 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
235 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
236 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
237 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
238 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
242 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
243 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
244 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
245 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
246 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
247 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
250 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
251 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
252 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
253 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
254 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
255 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
265 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
266 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
267 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
278 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
284 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
289 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
290 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
292 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
293 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
294 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
295 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
296 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
297 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
298 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
300 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
301 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
302 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
303 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
304 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
305 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
306 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
307 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
308 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
309 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
310 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
311 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
312 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
313 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
314 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
315 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
316 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
317 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
318 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
319 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
320 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
321 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
322 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
323 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
324 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
325 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
326 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
327 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
328 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
329 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
332 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
333 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
334 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
335 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
336 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
337 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
338 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
339 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
340 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
341 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
342 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
343 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
344 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
345 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
346 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
347 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
348 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
349 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
350 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
351 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
352 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
353 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
354 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
355 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
356 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
357 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
358 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
359 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
360 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
361 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
362 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
363 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
364 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
365 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
366 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
367 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
368 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
369 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
370 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
371 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
372 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
373 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
374 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
375 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
376 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
377 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
378 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
379 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
380 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
381 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
382 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
383 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
384 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
385 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
386 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
387 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
388 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
389 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
390 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
391 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
392 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
393 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
394 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
395 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
396 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
397 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
398 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
399 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
400 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
401 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
402 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
403 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
404 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
405 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
406 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
407 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
408 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
409 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
410 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
411 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
412 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
413 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
414 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
415 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
416 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
417 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
418 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
419 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
420 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
421 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
422 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
423 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
424 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
425 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
426 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
427 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
428 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
429 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
430 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
431 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
432 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
433 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
434 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
435 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
436 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
437 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
438 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
439 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
440 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
441 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
442 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
456 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
457 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
458 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
459 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
460 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
461 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
462 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
463 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
464 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
465 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
466 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
467 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
468 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
471 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
472 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
473 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
474 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
475 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
476 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
477 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
478 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
479 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
480 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
481 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
482 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
483 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
484 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
485 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
486 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
487 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
488 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
489 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
490 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
491 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
492 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
493 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
494 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
495 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
496 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
497 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
498 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
499 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
500 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
501 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
502 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
503 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
504 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
505 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
506 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
507 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
508 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
509 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
510 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
511 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
512 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
513 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
514 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
515 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
516 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
517 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
518 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
519 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
520 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
521 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
522 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
523 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
524 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
525 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
526 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
527 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
528 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
529 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
530 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
531 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
532 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
533 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
534 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
536 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
537 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
538 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0.67
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.65
Nodule 0.94
Rhizoplane 6.57
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 6.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006151 3300000549 Bacteria 1502
2 JGI24736J21556_1019063 3300001904 Bacteria 1085
3 JGI24739J22299_10029071 3300001989 Bacteria 1925
4 JGI24737J22298_10026448 3300001990 Bacteria 1832
5 JGI24735J21928_10036631 3300002067 Bacteria 1439
6 JGI24735J21928_10069308 3300002067 Bacteria 1011
7 JGI24748J21848_1054316 3300002074 Bacteria 527
8 JGI24744J21845_10024791 3300002077 Bacteria 1172
9 JGI25406J46586_10020393 3300003203 Bacteria 2681
10 JGI25406J46586_10143480 3300003203 Bacteria 698
11 JGI25406J46586_10151684 3300003203 Bacteria 676
12 JGI25153J46596_10001436 3300003215 Bacteria 14265
13 rootH2_10047101 3300003320 Bacteria 1830
14 JGI25404J52841_10002090 3300003659 Bacteria 3703
15 JGI25404J52841_10004756 3300003659 Bacteria 2774
16 JGI25404J52841_10019050 3300003659 Bacteria 1487
17 JGI25404J52841_10087493 3300003659 Bacteria 651
18 JGI25405J52794_10049357 3300003911 Bacteria 900
19 Ga0070658_10019300 3300005327 Bacteria 5460
20 Ga0070683_100005606 3300005329 Bacteria 10489
21 Ga0070683_100045273 3300005329 Bacteria 4061
22 Ga0070683_100198250 3300005329 Bacteria 1906
23 Ga0070683_100565967 3300005329 Bacteria 1087
24 Ga0070683_100689860 3300005329 Bacteria 978
25 Ga0070690_100395641 3300005330 Bacteria 1013
26 Ga0068869_100216002 3300005334 Bacteria 1518
27 Ga0070680_100015488 3300005336 Bacteria 5980
28 Ga0070680_100021554 3300005336 Bacteria 5122
29 Ga0070680_100147196 3300005336 Bacteria 1976
30 Ga0070680_100224979 3300005336 Bacteria 1584
31 Ga0070682_100073268 3300005337 Bacteria 2197
32 Ga0070682_100151081 3300005337 Bacteria 1594
33 Ga0068868_100014248 3300005338 Bacteria 5855
34 Ga0068868_100354073 3300005338 Bacteria 1258
35 Ga0070660_100062081 3300005339 Bacteria 2902
36 Ga0070660_100265903 3300005339 Bacteria 1401
37 Ga0070660_100587922 3300005339 Bacteria 930
38 Ga0070660_101004132 3300005339 Bacteria 705
39 Ga0070691_10086951 3300005341 Bacteria 1537
40 Ga0070691_10509905 3300005341 Bacteria 697
41 Ga0070661_100014484 3300005344 Bacteria 5555
42 Ga0070661_100462185 3300005344 Bacteria 1011
43 Ga0070661_100611875 3300005344 Bacteria 882
44 Ga0070668_100024739 3300005347 Bacteria 4551
45 Ga0070668_100191433 3300005347 Bacteria 1675
46 Ga0070668_100288894 3300005347 Bacteria 1372
47 Ga0070668_100819924 3300005347 Bacteria 828
48 Ga0070668_101286160 3300005347 Bacteria 664
49 Ga0070675_101004799 3300005354 Bacteria 766
50 Ga0070671_101279121 3300005355 Bacteria 647
51 Ga0070674_100047261 3300005356 Bacteria 2947
52 Ga0070674_100940775 3300005356 Bacteria 755
53 Ga0070673_100285973 3300005364 Bacteria 1448
54 Ga0070688_100121601 3300005365 Bacteria 1750
55 Ga0070688_100484082 3300005365 Bacteria 931
56 Ga0070688_101100318 3300005365 Bacteria 635
57 Ga0070659_100368928 3300005366 Bacteria 1207
58 Ga0070659_100503508 3300005366 Bacteria 1032
59 Ga0070659_101753354 3300005366 Bacteria 556
60 Ga0070667_100435563 3300005367 Bacteria 1197
61 Ga0070667_100731178 3300005367 Bacteria 917
62 Ga0070667_101284482 3300005367 Bacteria 686
63 Ga0070703_10231566 3300005406 Bacteria 740
64 Ga0070709_10000102 3300005434 Bacteria 60511
65 Ga0070709_10005140 3300005434 Bacteria 7079
66 Ga0070709_10195133 3300005434 Bacteria 1431
67 Ga0070709_10311965 3300005434 Bacteria 1152
68 Ga0070709_10492366 3300005434 Bacteria 930
69 Ga0070709_10599692 3300005434 Bacteria 848
70 Ga0070709_10706596 3300005434 Bacteria 785
71 Ga0070714_100001753 3300005435 Bacteria 15824
72 Ga0070714_100022895 3300005435 Bacteria 5126
73 Ga0070714_100030514 3300005435 Bacteria 4487
74 Ga0070714_100036394 3300005435 Bacteria 4129
75 Ga0070714_100148831 3300005435 Bacteria 2108
76 Ga0070714_100877368 3300005435 Bacteria 871
77 Ga0070714_101566761 3300005435 Bacteria 644
78 Ga0070713_100002970 3300005436 Bacteria 11136
79 Ga0070713_100005921 3300005436 Bacteria 8407
80 Ga0070713_100015544 3300005436 Bacteria 5698
81 Ga0070713_100045016 3300005436 Bacteria 3614
82 Ga0070713_100140491 3300005436 Bacteria 2139
83 Ga0070713_100258975 3300005436 Bacteria 1589
84 Ga0070713_100956802 3300005436 Bacteria 825
85 Ga0070710_10000526 3300005437 Bacteria 18024
86 Ga0070710_10019960 3300005437 Bacteria 3471
87 Ga0070710_10052085 3300005437 Bacteria 2301
88 Ga0070710_10202213 3300005437 Bacteria 1255
89 Ga0070710_10286858 3300005437 Bacteria 1070
90 Ga0070701_10369705 3300005438 Bacteria 901
91 Ga0070711_100002160 3300005439 Bacteria 11157
92 Ga0070711_100009157 3300005439 Bacteria 6085
93 Ga0070711_100021560 3300005439 Bacteria 4168
94 Ga0070711_100091166 3300005439 Bacteria 2196
95 Ga0070711_100224437 3300005439 Bacteria 1462
96 Ga0070711_100341792 3300005439 Bacteria 1201
97 Ga0070711_100963038 3300005439 Bacteria 731
98 Ga0070705_100201702 3300005440 Bacteria 1364
99 Ga0070705_100673025 3300005440 Bacteria 810
100 Ga0070700_100093566 3300005441 Bacteria 1966
101 Ga0070708_100098711 3300005445 Bacteria 2671
102 Ga0070663_100038273 3300005455 Bacteria 3345
103 Ga0070663_100056577 3300005455 Bacteria 2811
104 Ga0070663_100248007 3300005455 Bacteria 1408
105 Ga0070663_100284375 3300005455 Bacteria 1319
106 Ga0070663_100461541 3300005455 Bacteria 1049
107 Ga0070678_100070698 3300005456 Bacteria 2611
108 Ga0070678_100122013 3300005456 Bacteria 2056
109 Ga0070678_101595481 3300005456 Bacteria 612
110 Ga0070662_100022874 3300005457 Bacteria 4286
111 Ga0070662_100103986 3300005457 Bacteria 2154
112 Ga0070662_100364458 3300005457 Bacteria 1186
113 Ga0070662_100483133 3300005457 Bacteria 1031
114 Ga0070681_10023500 3300005458 Bacteria 6201
115 Ga0070681_10032157 3300005458 Bacteria 5266
116 Ga0070681_10058028 3300005458 Bacteria 3851
117 Ga0070681_10084358 3300005458 Bacteria 3129
118 Ga0070681_10570220 3300005458 Bacteria 1046
119 Ga0070681_10845435 3300005458 Bacteria 833
120 Ga0070685_10661708 3300005466 Bacteria 758
121 Ga0070706_100500165 3300005467 Bacteria 1131
122 Ga0070706_100777464 3300005467 Bacteria 887
123 Ga0070707_100062447 3300005468 Bacteria 3574
124 Ga0070707_100183859 3300005468 Bacteria 2038
125 Ga0070707_101990451 3300005468 Bacteria 548
126 Ga0070698_100220036 3300005471 Bacteria 1832
127 Ga0070699_100501396 3300005518 Bacteria 1103
128 Ga0070699_101198594 3300005518 Bacteria 696
129 Ga0070679_100013119 3300005530 Bacteria 7935
130 Ga0070679_100026603 3300005530 Bacteria 5687
131 Ga0070679_100069248 3300005530 Bacteria 3519
132 Ga0070679_100104027 3300005530 Bacteria 2826
133 Ga0070679_100135854 3300005530 Bacteria 2440
134 Ga0070679_100536659 3300005530 Bacteria 1114
135 Ga0070679_101205562 3300005530 Bacteria 702
136 Ga0070684_100013256 3300005535 Bacteria 6641
137 Ga0070684_100024555 3300005535 Bacteria 5057
138 Ga0070684_100326270 3300005535 Bacteria 1410
139 Ga0070697_100091314 3300005536 Bacteria 2518
140 Ga0070697_100446253 3300005536 Bacteria 1127
141 Ga0068853_100010809 3300005539 Bacteria 7394
142 Ga0068853_100015334 3300005539 Bacteria 6297
143 Ga0068853_100751722 3300005539 Bacteria 932
144 Ga0068853_101244637 3300005539 Bacteria 719
145 Ga0068853_101941198 3300005539 Bacteria 571
146 Ga0070672_100264678 3300005543 Bacteria 1451
147 Ga0070672_100435239 3300005543 Bacteria 1128
148 Ga0070672_100674309 3300005543 Bacteria 904
149 Ga0070686_101525500 3300005544 Bacteria 564
150 Ga0070695_101049690 3300005545 Bacteria 665
151 Ga0070693_100149715 3300005547 Bacteria 1477
152 Ga0070665_100067345 3300005548 Bacteria 3590
153 Ga0070665_100232545 3300005548 Bacteria 1843
154 Ga0070665_100633109 3300005548 Bacteria 1083
155 Ga0070665_100752588 3300005548 Bacteria 987
156 Ga0070665_100803270 3300005548 Bacteria 954
157 Ga0070704_100975041 3300005549 Bacteria 766
158 Ga0068855_100013700 3300005563 Bacteria 9779
159 Ga0068855_100014164 3300005563 Bacteria 9608
160 Ga0068855_100033333 3300005563 Bacteria 6147
161 Ga0068855_100221967 3300005563 Bacteria 2118
162 Ga0068855_100750342 3300005563 Bacteria 1041
163 Ga0068855_100850357 3300005563 Bacteria 967
164 Ga0068855_101088469 3300005563 Bacteria 836
165 Ga0068855_101123183 3300005563 Bacteria 821
166 Ga0068855_101554138 3300005563 Bacteria 678
167 Ga0068855_102398272 3300005563 Bacteria 526
168 Ga0070664_100662320 3300005564 Bacteria 971
169 Ga0068857_100004954 3300005577 Bacteria 11311
170 Ga0068857_100025795 3300005577 Bacteria 5175
171 Ga0068857_100038647 3300005577 Bacteria 4226
172 Ga0068857_100153608 3300005577 Bacteria 2086
173 Ga0068857_100838610 3300005577 Bacteria 879
174 Ga0068857_101369238 3300005577 Bacteria 688
175 Ga0068854_100026378 3300005578 Bacteria 3993
176 Ga0068854_100631408 3300005578 Bacteria 918
177 Ga0068856_100000451 3300005614 Bacteria 45442
178 Ga0068856_100000659 3300005614 Bacteria 37359
179 Ga0068856_100012689 3300005614 Bacteria 8158
180 Ga0068856_100521784 3300005614 Bacteria 1209
181 Ga0068856_100884698 3300005614 Bacteria 912
182 Ga0068856_101305904 3300005614 Bacteria 741
183 Ga0070702_100124167 3300005615 Bacteria 1620
184 Ga0070702_101135733 3300005615 Bacteria 626
185 Ga0068852_100071562 3300005616 Bacteria 3045
186 Ga0068852_100139508 3300005616 Bacteria 2242
187 Ga0068852_100268538 3300005616 Bacteria 1641
188 Ga0068852_100427848 3300005616 Bacteria 1307
189 Ga0068852_100507167 3300005616 Bacteria 1202
190 Ga0068852_102437874 3300005616 Bacteria 544
191 Ga0068859_100420450 3300005617 Bacteria 1433
192 Ga0068859_100737395 3300005617 Bacteria 1074
193 Ga0068864_100027097 3300005618 Bacteria 4836
194 Ga0068864_100289129 3300005618 Bacteria 1532
195 Ga0068864_100708627 3300005618 Bacteria 984
196 Ga0068866_10212862 3300005718 Bacteria 1162
197 Ga0068866_10217413 3300005718 Bacteria 1151
198 Ga0068861_100202126 3300005719 Bacteria 1668
199 Ga0068861_100588907 3300005719 Bacteria 1019
200 Ga0068851_10044153 3300005834 Bacteria 2248
201 Ga0068851_10045043 3300005834 Bacteria 2229
202 Ga0068851_10057892 3300005834 Bacteria 1979
203 Ga0068851_10571996 3300005834 Bacteria 685
204 Ga0068863_100592395 3300005841 Bacteria 1097
205 Ga0068858_100084248 3300005842 Bacteria 2957
206 Ga0068858_100196916 3300005842 Bacteria 1904
207 Ga0068858_100428840 3300005842 Bacteria 1272
208 Ga0068858_100638292 3300005842 Bacteria 1034
209 Ga0068860_100008418 3300005843 Bacteria 10274
210 Ga0068860_100360322 3300005843 Bacteria 1432
211 Ga0068860_100677982 3300005843 Bacteria 1040
212 Ga0068862_100158586 3300005844 Bacteria 2018
213 Ga0068862_100174424 3300005844 Bacteria 1926
214 Ga0068862_100325654 3300005844 Bacteria 1419
215 Ga0068862_101177839 3300005844 Bacteria 764
216 Ga0081455_10003511 3300005937 Bacteria 18010
217 Ga0081455_10007726 3300005937 Bacteria 11281
218 Ga0081455_10012558 3300005937 Bacteria 8448
219 Ga0081455_10021916 3300005937 Bacteria 5984
220 Ga0081455_10025903 3300005937 Bacteria 5405
221 Ga0081455_10037165 3300005937 Bacteria 4328
222 Ga0081455_10496219 3300005937 Bacteria 821
223 Ga0081538_10016160 3300005981 Bacteria 5738
224 Ga0081540_1001538 3300005983 Bacteria 19791
225 Ga0081540_1002078 3300005983 Bacteria 16705
226 Ga0081540_1003660 3300005983 Bacteria 12052
227 Ga0081540_1008178 3300005983 Bacteria 7331
228 Ga0081540_1008898 3300005983 Bacteria 6964
229 Ga0081540_1014574 3300005983 Bacteria 5027
230 Ga0081540_1032957 3300005983 Bacteria 2820
231 Ga0081540_1086701 3300005983 Bacteria 1390
232 Ga0081540_1134711 3300005983 Bacteria 1002
233 Ga0081540_1305108 3300005983 Bacteria 547
234 Ga0081539_10000080 3300005985 Bacteria 222745
235 Ga0081539_10000498 3300005985 Bacteria 82216
236 Ga0081539_10011910 3300005985 Bacteria 6791
237 Ga0081539_10028294 3300005985 Bacteria 3527
238 Ga0081539_10071100 3300005985 Bacteria 1865
239 Ga0081539_10194479 3300005985 Bacteria 942
240 Ga0070717_10010508 3300006028 Bacteria 6993
241 Ga0070717_10018723 3300006028 Bacteria 5415
242 Ga0070717_10046983 3300006028 Bacteria 3535
243 Ga0070717_10053340 3300006028 Bacteria 3333
244 Ga0070717_10333654 3300006028 Bacteria 1353
245 Ga0070717_10445232 3300006028 Bacteria 1167
246 Ga0070717_11002044 3300006028 Bacteria 761
247 Ga0075365_10021569 3300006038 Bacteria 4020
248 Ga0075365_10176696 3300006038 Bacteria 1492
249 Ga0075365_10379106 3300006038 Bacteria 998
250 Ga0075368_10247084 3300006042 Bacteria 762
251 Ga0075363_100357461 3300006048 Bacteria 854
252 Ga0075363_100497625 3300006048 Bacteria 724
253 Ga0070716_100001641 3300006173 Bacteria 10099
254 Ga0070716_100002831 3300006173 Bacteria 8072
255 Ga0070716_100665850 3300006173 Bacteria 791
256 Ga0070716_100844507 3300006173 Bacteria 712
257 Ga0070716_101609299 3300006173 Bacteria 534
258 Ga0070712_100026574 3300006175 Bacteria 3857
259 Ga0070712_100153424 3300006175 Bacteria 1771
260 Ga0070712_101414810 3300006175 Bacteria 607
261 Ga0075362_10187526 3300006177 Bacteria 1004
262 Ga0075362_10195509 3300006177 Bacteria 983
263 Ga0075367_10023235 3300006178 Bacteria 3486
264 Ga0075367_10373781 3300006178 Bacteria 900
265 Ga0075367_10437006 3300006178 Bacteria 829
266 Ga0075367_10440525 3300006178 Bacteria 825
267 Ga0075366_10165600 3300006195 Bacteria 1340
268 Ga0075366_10243110 3300006195 Bacteria 1097
269 Ga0075366_10837026 3300006195 Bacteria 573
270 Ga0075366_10977563 3300006195 Bacteria 528
271 Ga0097621_100061477 3300006237 Bacteria 3081
272 Ga0097621_100196156 3300006237 Bacteria 1751
273 Ga0097621_100205780 3300006237 Bacteria 1710
274 Ga0097621_101842056 3300006237 Bacteria 577
275 Ga0097621_101889315 3300006237 Bacteria 570
276 Ga0075370_10362605 3300006353 Bacteria 867
277 Ga0068871_100305229 3300006358 Bacteria 1398
278 Ga0068871_100704021 3300006358 Bacteria 925
279 Ga0068871_100857972 3300006358 Bacteria 840
280 Ga0068871_100949221 3300006358 Bacteria 799
281 Ga0075434_100452156 3300006871 Bacteria 1306
282 Ga0075429_100897583 3300006880 Bacteria 776
283 Ga0068865_100050924 3300006881 Bacteria 2863
284 Ga0068865_100180232 3300006881 Bacteria 1626
285 Ga0097620_100420422 3300006931 Bacteria 1433
286 Ga0097620_100737365 3300006931 Bacteria 1074
287 Ga0099825_1039359 3300006941 Bacteria 1456
288 Ga0099824_1006683 3300006942 Bacteria 15693
289 Ga0099822_1000418 3300006943 Bacteria 38171
290 Ga0075435_100724066 3300007076 Bacteria 865
291 Ga0099794_10029452 3300007265 Bacteria 2558
292 Ga0099794_10111805 3300007265 Bacteria 1369
293 Ga0099794_10128782 3300007265 Bacteria 1277
294 Ga0099794_10458609 3300007265 Bacteria 669
295 Ga0099794_10474923 3300007265 Bacteria 657
296 Ga0099795_10080174 3300007788 Bacteria 1248
297 Ga0099795_10096198 3300007788 Bacteria 1155
298 Ga0099795_10128064 3300007788 Bacteria 1021
299 Ga0099795_10308116 3300007788 Bacteria 698
300 Ga0099795_10335215 3300007788 Bacteria 673
301 Ga0099795_10385831 3300007788 Bacteria 633
302 Ga0105251_10560716 3300009011 Bacteria 539
303 Ga0105244_10421508 3300009036 Bacteria 614
304 Ga0105250_10018383 3300009092 Bacteria 2831
305 Ga0105240_10010878 3300009093 Bacteria 12743
306 Ga0105240_10026626 3300009093 Bacteria 7588
307 Ga0105240_10097500 3300009093 Bacteria 3582
308 Ga0105240_10155163 3300009093 Bacteria 2724
309 Ga0105240_10236739 3300009093 Bacteria 2119
310 Ga0105240_10427922 3300009093 Bacteria 1486
311 Ga0105240_10608267 3300009093 Bacteria 1202
312 Ga0111539_10174814 3300009094 Bacteria 2508
313 Ga0111539_10439612 3300009094 Bacteria 1519
314 Ga0105245_10026065 3300009098 Bacteria 5144
315 Ga0105245_11121040 3300009098 Bacteria 833
316 Ga0105247_10044664 3300009101 Bacteria 2718
317 Ga0105247_10144089 3300009101 Bacteria 1564
318 Ga0105247_10203570 3300009101 Bacteria 1331
319 Ga0105247_10867839 3300009101 Bacteria 694
320 Ga0105247_11646848 3300009101 Bacteria 529
321 Ga0105243_10059410 3300009148 Bacteria 3051
322 Ga0105243_10659051 3300009148 Bacteria 1015
323 Ga0105241_10000375 3300009174 Bacteria 34023
324 Ga0105241_10237331 3300009174 Bacteria 1540
325 Ga0105241_10565195 3300009174 Bacteria 1023
326 Ga0105241_11255179 3300009174 Bacteria 704
327 Ga0105242_10093388 3300009176 Bacteria 2536
328 Ga0105242_10248578 3300009176 Bacteria 1602
329 Ga0105242_10381833 3300009176 Bacteria 1310
330 Ga0105242_10477824 3300009176 Bacteria 1180
331 Ga0105242_10791971 3300009176 Bacteria 937
332 Ga0105248_10049495 3300009177 Bacteria 4713
333 Ga0105237_10006382 3300009545 Bacteria 13085
334 Ga0105237_10008299 3300009545 Bacteria 11270
335 Ga0105237_10024116 3300009545 Bacteria 6224
336 Ga0105237_10080055 3300009545 Bacteria 3257
337 Ga0105237_10101460 3300009545 Bacteria 2870
338 Ga0105237_10148579 3300009545 Bacteria 2339
339 Ga0105237_10211233 3300009545 Bacteria 1941
340 Ga0105237_10219117 3300009545 Bacteria 1903
341 Ga0105237_10251855 3300009545 Bacteria 1768
342 Ga0105237_10644966 3300009545 Bacteria 1066
343 Ga0105237_11559825 3300009545 Bacteria 667
344 Ga0105237_11821153 3300009545 Bacteria 616
345 Ga0105238_10000885 3300009551 Bacteria 30833
346 Ga0105238_10005609 3300009551 Bacteria 12405
347 Ga0105238_10006417 3300009551 Bacteria 11705
348 Ga0105238_10091024 3300009551 Bacteria 3038
349 Ga0105238_10620117 3300009551 Bacteria 1090
350 Ga0105238_10982261 3300009551 Bacteria 865
351 Ga0105238_11066667 3300009551 Bacteria 830
352 Ga0105238_11231957 3300009551 Bacteria 773
353 Ga0105238_11351498 3300009551 Bacteria 739
354 Ga0105249_10079454 3300009553 Bacteria 3045
355 Ga0105249_10682842 3300009553 Bacteria 1086
356 Ga0105249_11678457 3300009553 Bacteria 708
357 Ga0105249_12466770 3300009553 Bacteria 592
358 Ga0099796_10008097 3300010159 Bacteria 2786
359 Ga0099796_10127663 3300010159 Bacteria 983
360 Ga0105239_10011070 3300010375 Bacteria 10068
361 Ga0105239_10020488 3300010375 Bacteria 7294
362 Ga0105239_10024299 3300010375 Bacteria 6674
363 Ga0105239_10132834 3300010375 Bacteria 2770
364 Ga0105239_10407574 3300010375 Bacteria 1539
365 Ga0105239_10537658 3300010375 Bacteria 1330
366 Ga0105239_10547699 3300010375 Bacteria 1317
367 Ga0105239_10573942 3300010375 Bacteria 1285
368 Ga0105239_10628018 3300010375 Bacteria 1226
369 Ga0105239_10686103 3300010375 Bacteria 1171
370 Ga0105246_10118216 3300011119 Bacteria 1960
371 Ga0105246_10512111 3300011119 Bacteria 1021
372 Ga0105246_10953329 3300011119 Bacteria 773
373 Ga0105246_11725248 3300011119 Bacteria 596
374 Ga0157337_1021823 3300012483 Bacteria 597
375 Ga0157338_1069532 3300012515 Bacteria 547
376 Ga0157373_10438767 3300013100 Bacteria 939
377 Ga0157371_10080655 3300013102 Bacteria 2304
378 Ga0157370_10163226 3300013104 Bacteria 2073
379 Ga0157370_10231909 3300013104 Bacteria 1708
380 Ga0157370_10270046 3300013104 Bacteria 1571
381 Ga0157370_10441653 3300013104 Bacteria 1196
382 Ga0157370_11983552 3300013104 Bacteria 522
383 Ga0157369_10003699 3300013105 Bacteria 18177
384 Ga0157369_10011122 3300013105 Bacteria 10232
385 Ga0157369_10016823 3300013105 Bacteria 8219
386 Ga0157369_10685838 3300013105 Bacteria 1055
387 Ga0157369_10715551 3300013105 Bacteria 1031
388 Ga0157374_10071289 3300013296 Bacteria 3276
389 Ga0157374_10290805 3300013296 Bacteria 1615
390 Ga0157374_10581877 3300013296 Bacteria 1129
391 Ga0157378_10529471 3300013297 Bacteria 1181
392 Ga0157378_10808792 3300013297 Bacteria 963
393 Ga0157378_11035404 3300013297 Bacteria 856
394 Ga0157378_13056578 3300013297 Bacteria 519
395 Ga0163162_10104898 3300013306 Bacteria 2921
396 Ga0163162_10132431 3300013306 Bacteria 2602
397 Ga0163162_10195168 3300013306 Bacteria 2153
398 Ga0163162_10355076 3300013306 Bacteria 1598
399 Ga0163162_13197226 3300013306 Bacteria 526
400 Ga0157372_10371500 3300013307 Bacteria 1666
401 Ga0157372_10616929 3300013307 Bacteria 1264
402 Ga0157372_10662518 3300013307 Bacteria 1215
403 Ga0157372_10821001 3300013307 Bacteria 1080
404 Ga0157372_11039526 3300013307 Bacteria 948
405 Ga0157372_11828009 3300013307 Bacteria 699
406 Ga0157375_10078938 3300013308 Bacteria 3326
407 Ga0157375_10097357 3300013308 Bacteria 3016
408 Ga0157375_10123103 3300013308 Bacteria 2706
409 Ga0157375_12341988 3300013308 Bacteria 637
410 Ga0157375_13145741 3300013308 Bacteria 551
411 Ga0163163_10019375 3300014325 Bacteria 6390
412 Ga0163163_10140744 3300014325 Bacteria 2455
413 Ga0163163_10294331 3300014325 Bacteria 1676
414 Ga0163163_10522793 3300014325 Bacteria 1249
415 Ga0157380_10967694 3300014326 Bacteria 882
416 Ga0157380_11005044 3300014326 Bacteria 868
417 Ga0157380_12459464 3300014326 Bacteria 586
418 Ga0182008_10151999 3300014497 Bacteria 1161
419 Ga0182008_10447148 3300014497 Bacteria 702
420 Ga0157379_10072179 3300014968 Bacteria 3088
421 Ga0157379_10128607 3300014968 Bacteria 2279
422 Ga0157379_10309838 3300014968 Bacteria 1440
423 Ga0157379_10865094 3300014968 Bacteria 856
424 Ga0157376_10264396 3300014969 Bacteria 1613
425 Ga0157376_11237193 3300014969 Bacteria 775
426 Ga0206356_10824015 3300020070 Bacteria 1604
427 Ga0206355_1375172 3300020076 Bacteria 906
428 Ga0206350_10271927 3300020080 Bacteria 993
429 Ga0206354_10310108 3300020081 Bacteria 2400
430 Ga0213873_10086560 3300021358 Bacteria 884
431 Ga0213873_10107998 3300021358 Bacteria 806
432 Ga0213874_10110235 3300021377 Bacteria 925
433 Ga0213874_10138265 3300021377 Bacteria 842
434 Ga0213876_10018891 3300021384 Bacteria 3640
435 Ga0213876_10108795 3300021384 Bacteria 1471
436 Ga0213876_10118908 3300021384 Bacteria 1403
437 Ga0213876_10203730 3300021384 Bacteria 1052
438 Ga0213876_10701295 3300021384 Bacteria 538
439 Ga0213875_10069234 3300021388 Bacteria 1648
440 Ga0213871_10008840 3300021441 Bacteria 2235
441 Ga0213871_10110776 3300021441 Bacteria 811
442 Ga0224712_10110279 3300022467 Bacteria 1179
443 Ga0209148_1010916 3300025254 Bacteria 1704
444 Ga0209233_1006072 3300025261 Bacteria 3931
445 Ga0209455_1007118 3300025272 Bacteria 3200
446 Ga0209455_1014353 3300025272 Bacteria 1795
447 Ga0209758_1002215 3300025297 Bacteria 20262
448 Ga0209758_1032638 3300025297 Bacteria 2108
449 Ga0209758_1071592 3300025297 Bacteria 1088
450 Ga0207697_10027916 3300025315 Bacteria 2307
451 Ga0207656_10056016 3300025321 Bacteria 1717
452 Ga0207656_10072434 3300025321 Bacteria 1534
453 Ga0207656_10076710 3300025321 Bacteria 1495
454 Ga0207696_1032698 3300025711 Bacteria 1564
455 Ga0207653_10017200 3300025885 Bacteria 2274
456 Ga0207692_10000386 3300025898 Bacteria 15209
457 Ga0207692_10176207 3300025898 Bacteria 1243
458 Ga0207692_10370189 3300025898 Bacteria 887
459 Ga0207692_10769614 3300025898 Bacteria 628
460 Ga0207642_10090211 3300025899 Bacteria 1512
461 Ga0207642_10234165 3300025899 Bacteria 1033
462 Ga0207710_10043541 3300025900 Bacteria 1997
463 Ga0207710_10060054 3300025900 Bacteria 1722
464 Ga0207710_10199320 3300025900 Bacteria 988
465 Ga0207710_10491124 3300025900 Bacteria 636
466 Ga0207688_10013695 3300025901 Bacteria 4408
467 Ga0207688_10102252 3300025901 Bacteria 1656
468 Ga0207688_10364613 3300025901 Bacteria 892
469 Ga0207647_10015721 3300025904 Bacteria 5182
470 Ga0207647_10251620 3300025904 Bacteria 1013
471 Ga0207685_10002099 3300025905 Bacteria 4460
472 Ga0207699_10000411 3300025906 Bacteria 21990
473 Ga0207699_10003008 3300025906 Bacteria 8013
474 Ga0207699_10072963 3300025906 Bacteria 2104
475 Ga0207699_10243468 3300025906 Bacteria 1237
476 Ga0207699_10482407 3300025906 Bacteria 893
477 Ga0207699_10615968 3300025906 Bacteria 791
478 Ga0207699_10861262 3300025906 Bacteria 668
479 Ga0207645_10600053 3300025907 Bacteria 747
480 Ga0207705_10049208 3300025909 Bacteria 3034
481 Ga0207705_11462528 3300025909 Bacteria 518
482 Ga0207684_10420975 3300025910 Bacteria 1148
483 Ga0207684_10689409 3300025910 Bacteria 869
484 Ga0207684_10879702 3300025910 Bacteria 754
485 Ga0207654_10000629 3300025911 Bacteria 19897
486 Ga0207654_10061939 3300025911 Bacteria 2190
487 Ga0207654_10787675 3300025911 Bacteria 686
488 Ga0207654_10853485 3300025911 Bacteria 659
489 Ga0207707_10001473 3300025912 Bacteria 21780
490 Ga0207707_10013690 3300025912 Bacteria 7074
491 Ga0207707_10015990 3300025912 Bacteria 6544
492 Ga0207707_10097004 3300025912 Bacteria 2576
493 Ga0207707_10118392 3300025912 Bacteria 2315
494 Ga0207707_10132231 3300025912 Bacteria 2182
495 Ga0207707_10154042 3300025912 Bacteria 2010
496 Ga0207707_10262126 3300025912 Bacteria 1500
497 Ga0207695_10001265 3300025913 Bacteria 42969
498 Ga0207695_10039200 3300025913 Bacteria 5093
499 Ga0207695_10039689 3300025913 Bacteria 5057
500 Ga0207695_10149556 3300025913 Bacteria 2275
501 Ga0207695_10177166 3300025913 Bacteria 2054
502 Ga0207695_10226999 3300025913 Bacteria 1773
503 Ga0207671_10005731 3300025914 Bacteria 11325
504 Ga0207671_10015794 3300025914 Bacteria 5893
505 Ga0207671_10094235 3300025914 Bacteria 2260
506 Ga0207671_10101843 3300025914 Bacteria 2176
507 Ga0207671_10153115 3300025914 Bacteria 1782
508 Ga0207671_10194177 3300025914 Bacteria 1584
509 Ga0207671_10360592 3300025914 Bacteria 1153
510 Ga0207671_10418282 3300025914 Bacteria 1066
511 Ga0207671_10438451 3300025914 Bacteria 1040
512 Ga0207671_10656257 3300025914 Bacteria 835
513 Ga0207671_11154680 3300025914 Bacteria 607
514 Ga0207671_11180234 3300025914 Bacteria 599
515 Ga0207693_10003644 3300025915 Bacteria 13157
516 Ga0207693_10039807 3300025915 Bacteria 3701
517 Ga0207693_10092044 3300025915 Bacteria 2377
518 Ga0207663_10000897 3300025916 Bacteria 13571
519 Ga0207663_10010802 3300025916 Bacteria 4875
520 Ga0207663_10053778 3300025916 Bacteria 2517
521 Ga0207663_10154973 3300025916 Bacteria 1610
522 Ga0207663_10171764 3300025916 Bacteria 1540
523 Ga0207663_10694508 3300025916 Bacteria 805
524 Ga0207660_10003205 3300025917 Bacteria 10703
525 Ga0207660_10022034 3300025917 Bacteria 4290
526 Ga0207660_10158340 3300025917 Bacteria 1745
527 Ga0207660_10633529 3300025917 Bacteria 871
528 Ga0207657_10011790 3300025919 Bacteria 8655
529 Ga0207657_10318372 3300025919 Bacteria 1230
530 Ga0207657_11231774 3300025919 Bacteria 568
531 Ga0207649_10595718 3300025920 Bacteria 850
532 Ga0207652_10006959 3300025921 Bacteria 9111
533 Ga0207652_10012754 3300025921 Bacteria 6794
534 Ga0207652_10038366 3300025921 Bacteria 4061
535 Ga0207652_10129055 3300025921 Bacteria 2254
536 Ga0207652_10325541 3300025921 Bacteria 1388
537 Ga0207652_11025320 3300025921 Bacteria 724
538 Ga0207646_10077709 3300025922 Bacteria 2966
539 Ga0207646_11560447 3300025922 Bacteria 570
540 Ga0207681_10050253 3300025923 Bacteria 2821
541 Ga0207694_10000082 3300025924 Bacteria 109787
542 Ga0207694_10025115 3300025924 Bacteria 4527
543 Ga0207694_10031933 3300025924 Bacteria 4026
544 Ga0207694_10032555 3300025924 Bacteria 3991
545 Ga0207694_10161959 3300025924 Bacteria 1807
546 Ga0207694_10706418 3300025924 Bacteria 850
547 Ga0207694_11325223 3300025924 Bacteria 609
548 Ga0207694_11390093 3300025924 Bacteria 593
549 Ga0207650_10247985 3300025925 Bacteria 1441
550 Ga0207687_10029908 3300025927 Bacteria 3667
551 Ga0207687_10105185 3300025927 Bacteria 2085
552 Ga0207687_10918961 3300025927 Bacteria 749
553 Ga0207700_10003087 3300025928 Bacteria 9611
554 Ga0207700_10006990 3300025928 Bacteria 6867
555 Ga0207700_10010852 3300025928 Bacteria 5779
556 Ga0207700_10011089 3300025928 Bacteria 5731
557 Ga0207700_10021835 3300025928 Bacteria 4380
558 Ga0207700_10029340 3300025928 Bacteria 3880
559 Ga0207700_10102684 3300025928 Bacteria 2284
560 Ga0207700_10613897 3300025928 Bacteria 968
561 Ga0207700_10862135 3300025928 Bacteria 810
562 Ga0207664_10004435 3300025929 Bacteria 9504
563 Ga0207664_10070887 3300025929 Bacteria 2806
564 Ga0207664_10140973 3300025929 Bacteria 2039
565 Ga0207664_10271666 3300025929 Bacteria 1485
566 Ga0207664_10553805 3300025929 Bacteria 1032
567 Ga0207664_10705276 3300025929 Bacteria 907
568 Ga0207664_11206854 3300025929 Bacteria 675
569 Ga0207690_10945993 3300025932 Bacteria 716
570 Ga0207706_10080562 3300025933 Bacteria 2863
571 Ga0207706_10098139 3300025933 Bacteria 2577
572 Ga0207706_10171143 3300025933 Bacteria 1908
573 Ga0207706_10460652 3300025933 Bacteria 1099
574 Ga0207686_10065126 3300025934 Bacteria 2323
575 Ga0207686_10675169 3300025934 Bacteria 819
576 Ga0207709_10065212 3300025935 Bacteria 2289
577 Ga0207709_10471578 3300025935 Bacteria 974
578 Ga0207670_10187476 3300025936 Bacteria 1563
579 Ga0207670_10771539 3300025936 Bacteria 800
580 Ga0207669_10032231 3300025937 Bacteria 2940
581 Ga0207669_10579773 3300025937 Bacteria 909
582 Ga0207669_10719273 3300025937 Bacteria 822
583 Ga0207704_10330524 3300025938 Bacteria 1179
584 Ga0207665_10001244 3300025939 Bacteria 17182
585 Ga0207665_10003077 3300025939 Bacteria 11195
586 Ga0207665_10129259 3300025939 Bacteria 1791
587 Ga0207665_10287312 3300025939 Bacteria 1226
588 Ga0207665_10689963 3300025939 Bacteria 802
589 Ga0207691_10273607 3300025940 Bacteria 1454
590 Ga0207691_10610493 3300025940 Bacteria 923
591 Ga0207711_10468581 3300025941 Bacteria 1173
592 Ga0207711_10501381 3300025941 Bacteria 1131
593 Ga0207661_10003495 3300025944 Bacteria 10912
594 Ga0207661_10010884 3300025944 Bacteria 6566
595 Ga0207661_10100708 3300025944 Bacteria 2425
596 Ga0207661_10956302 3300025944 Bacteria 789
597 Ga0207679_10461889 3300025945 Bacteria 1127
598 Ga0207667_10006677 3300025949 Bacteria 13949
599 Ga0207667_10008474 3300025949 Bacteria 12209
600 Ga0207667_10009542 3300025949 Bacteria 11419
601 Ga0207667_10109324 3300025949 Bacteria 2851
602 Ga0207667_10120372 3300025949 Bacteria 2705
603 Ga0207667_10261496 3300025949 Bacteria 1770
604 Ga0207667_10324817 3300025949 Bacteria 1571
605 Ga0207667_10513264 3300025949 Bacteria 1215
606 Ga0207667_10557116 3300025949 Bacteria 1159
607 Ga0207667_10559959 3300025949 Bacteria 1156
608 Ga0207667_11554073 3300025949 Bacteria 631
609 Ga0207651_10284249 3300025960 Bacteria 1369
610 Ga0207651_10297316 3300025960 Bacteria 1341
611 Ga0207712_10534468 3300025961 Bacteria 1006
612 Ga0207712_10654023 3300025961 Bacteria 914
613 Ga0207712_11556679 3300025961 Bacteria 592
614 Ga0207668_10062419 3300025972 Bacteria 2623
615 Ga0207668_10377764 3300025972 Bacteria 1192
616 Ga0207668_10405016 3300025972 Bacteria 1154
617 Ga0207640_10023703 3300025981 Bacteria 3692
618 Ga0207640_10956990 3300025981 Bacteria 751
619 Ga0207640_11103959 3300025981 Bacteria 702
620 Ga0207658_10453227 3300025986 Bacteria 1136
621 Ga0207658_10643294 3300025986 Bacteria 955
622 Ga0207658_11865055 3300025986 Bacteria 548
623 Ga0207677_10196330 3300026023 Bacteria 1600
624 Ga0207677_10323936 3300026023 Bacteria 1282
625 Ga0207703_10155612 3300026035 Bacteria 1997
626 Ga0207703_10201766 3300026035 Bacteria 1768
627 Ga0207703_10306009 3300026035 Bacteria 1451
628 Ga0207703_10401115 3300026035 Bacteria 1272
629 Ga0207703_11665711 3300026035 Bacteria 614
630 Ga0207703_12296747 3300026035 Bacteria 515
631 Ga0207639_10003792 3300026041 Bacteria 10175
632 Ga0207639_10171290 3300026041 Bacteria 1839
633 Ga0207639_10183444 3300026041 Bacteria 1782
634 Ga0207639_10443502 3300026041 Bacteria 1177
635 Ga0207639_10465134 3300026041 Bacteria 1150
636 Ga0207639_10651857 3300026041 Bacteria 974
637 Ga0207639_11205679 3300026041 Bacteria 710
638 Ga0207639_11437911 3300026041 Bacteria 647
639 Ga0207678_10113995 3300026067 Bacteria 2306
640 Ga0207678_10200272 3300026067 Bacteria 1707
641 Ga0207678_10219791 3300026067 Bacteria 1626
642 Ga0207678_10322042 3300026067 Bacteria 1330
643 Ga0207708_10104541 3300026075 Bacteria 2194
644 Ga0207708_10175317 3300026075 Bacteria 1700
645 Ga0207702_10000002 3300026078 Bacteria 491507
646 Ga0207702_10000478 3300026078 Bacteria 44978
647 Ga0207702_10061546 3300026078 Bacteria 3202
648 Ga0207702_10195697 3300026078 Bacteria 1871
649 Ga0207702_10391416 3300026078 Bacteria 1338
650 Ga0207702_10990687 3300026078 Bacteria 834
651 Ga0207702_11263645 3300026078 Bacteria 732
652 Ga0207641_10896810 3300026088 Bacteria 880
653 Ga0207641_11050143 3300026088 Bacteria 812
654 Ga0207648_10021511 3300026089 Bacteria 5798
655 Ga0207648_10995497 3300026089 Bacteria 785
656 Ga0207676_10089392 3300026095 Bacteria 2524
657 Ga0207676_10116170 3300026095 Bacteria 2248
658 Ga0207676_10849018 3300026095 Bacteria 893
659 Ga0207676_12492721 3300026095 Bacteria 514
660 Ga0207674_10007536 3300026116 Bacteria 12680
661 Ga0207674_10011165 3300026116 Bacteria 10100
662 Ga0207674_10028212 3300026116 Bacteria 5927
663 Ga0207674_10034482 3300026116 Bacteria 5290
664 Ga0207674_10103770 3300026116 Bacteria 2822
665 Ga0207674_10648307 3300026116 Bacteria 1020
666 Ga0207675_100404646 3300026118 Bacteria 1345
667 Ga0207675_101322776 3300026118 Bacteria 741
668 Ga0207683_10104603 3300026121 Bacteria 2530
669 Ga0207683_10198179 3300026121 Bacteria 1825
670 Ga0207683_10365184 3300026121 Bacteria 1326
671 Ga0207683_10783150 3300026121 Bacteria 885
672 Ga0207683_10960871 3300026121 Bacteria 793
673 Ga0207698_10122325 3300026142 Bacteria 2205
674 Ga0207698_10225106 3300026142 Bacteria 1698
675 Ga0207698_10417946 3300026142 Bacteria 1286
676 Ga0207698_10505617 3300026142 Bacteria 1177
677 Ga0207698_10535508 3300026142 Bacteria 1145
678 Ga0207698_10777761 3300026142 Bacteria 958
679 Ga0207698_10909777 3300026142 Bacteria 887
680 Ga0209589_1000003 3300027357 Bacteria 629130
681 Ga0209489_100003 3300027361 Bacteria 663105
682 Ga0209700_100003 3300027363 Bacteria 663105
683 Ga0209179_1033288 3300027512 Bacteria 1065
684 Ga0209179_1067049 3300027512 Bacteria 783
685 Ga0209179_1089564 3300027512 Bacteria 682
686 Ga0209179_1133571 3300027512 Bacteria 555
687 Ga0209588_1023809 3300027671 Bacteria 1932
688 Ga0209813_10177077 3300027866 Bacteria 778
689 Ga0268266_10162678 3300028379 Bacteria 2020
690 Ga0268266_10215025 3300028379 Bacteria 1764
691 Ga0268266_10264045 3300028379 Bacteria 1596
692 Ga0268266_10726009 3300028379 Bacteria 958
693 Ga0268266_10744311 3300028379 Bacteria 946
694 Ga0268266_11606005 3300028379 Bacteria 626
695 Ga0268266_11809873 3300028379 Bacteria 585
696 Ga0268265_10517250 3300028380 Bacteria 1127
697 Ga0268265_10587354 3300028380 Bacteria 1062
698 Ga0268265_10701635 3300028380 Bacteria 978
699 Ga0268264_10000043 3300028381 Bacteria 371761
700 Ga0268264_10497575 3300028381 Bacteria 1188
701 Ga0265337_1018947 3300028556 Bacteria 2177
702 Ga0265319_1012285 3300028563 Bacteria 3469
703 Ga0265334_10023180 3300028573 Bacteria 2525
704 Ga0265334_10086784 3300028573 Bacteria 1146
705 Ga0265318_10003124 3300028577 Bacteria 8474
706 Ga0265323_10001316 3300028653 Bacteria 12360
707 Ga0265322_10003976 3300028654 Bacteria 4428
708 Ga0265336_10000579 3300028666 Bacteria 20640
709 Ga0307517_10215992 3300028786 Bacteria 1173
710 Ga0307515_10055010 3300028794 Bacteria 5827
711 Ga0265338_10001398 3300028800 Bacteria 39299
712 Ga0265324_10010613 3300029957 Bacteria 3543
713 Ga0307511_10101511 3300030521 Bacteria 1885
714 Ga0307511_10119276 3300030521 Bacteria 1640
715 Ga0265762_1068277 3300030760 Bacteria 742
716 Ga0265763_1017816 3300030763 Bacteria 723
717 Ga0265770_1083041 3300030878 Bacteria 629
718 Ga0265330_10021534 3300031235 Bacteria 2940
719 Ga0265330_10029380 3300031235 Bacteria 2473
720 Ga0265332_10043626 3300031238 Bacteria 1936
721 Ga0265332_10087499 3300031238 Bacteria 1319
722 Ga0265325_10029462 3300031241 Bacteria 2950
723 Ga0265340_10002366 3300031247 Bacteria 10731
724 Ga0265339_10009369 3300031249 Bacteria 6160
725 Ga0265339_10019907 3300031249 Bacteria 3929
726 Ga0265339_10119706 3300031249 Bacteria 1355
727 Ga0265339_10325624 3300031249 Bacteria 728
728 Ga0265339_10539454 3300031249 Bacteria 537
729 Ga0265331_10038825 3300031250 Bacteria 2325
730 Ga0265331_10112707 3300031250 Bacteria 1247
731 Ga0265316_10090463 3300031344 Bacteria 2335
732 Ga0265316_10182294 3300031344 Bacteria 1563
733 Ga0307513_10462563 3300031456 Bacteria 991
734 Ga0307513_10547481 3300031456 Bacteria 870
735 Ga0307513_11044200 3300031456 Bacteria 528
736 Ga0307509_10224089 3300031507 Bacteria 1689
737 Ga0307509_10233876 3300031507 Bacteria 1637
738 Ga0307509_10264488 3300031507 Bacteria 1492
739 Ga0307509_10510776 3300031507 Bacteria 884
740 Ga0307509_10744184 3300031507 Bacteria 646
741 Ga0307408_100878894 3300031548 Bacteria 819
742 Ga0265313_10126662 3300031595 Bacteria 1110
743 Ga0265313_10284172 3300031595 Bacteria 668
744 Ga0307508_10001059 3300031616 Bacteria 31801
745 Ga0307508_10007228 3300031616 Bacteria 10340
746 Ga0307508_10060565 3300031616 Bacteria 3346
747 Ga0307508_10351820 3300031616 Bacteria 1065
748 Ga0265314_10008943 3300031711 Bacteria 8530
749 Ga0265342_10002731 3300031712 Bacteria 15016
750 Ga0265342_10031442 3300031712 Bacteria 3282
751 Ga0265342_10216379 3300031712 Bacteria 1034
752 Ga0307516_10015493 3300031730 Bacteria 8019
753 Ga0307516_10063699 3300031730 Bacteria 3568
754 Ga0307516_10096643 3300031730 Bacteria 2774
755 Ga0307516_10135644 3300031730 Bacteria 2236
756 Ga0307516_10145136 3300031730 Bacteria 2139
757 Ga0307516_10152987 3300031730 Bacteria 2065
758 Ga0307516_10176035 3300031730 Bacteria 1876
759 Ga0307516_10252540 3300031730 Bacteria 1457
760 Ga0307516_10547677 3300031730 Bacteria 811
761 Ga0307405_10745487 3300031731 Bacteria 815
762 Ga0307406_10829845 3300031901 Bacteria 782
763 Ga0307412_10235492 3300031911 Bacteria 1413
764 Ga0307409_100308665 3300031995 Bacteria 1475
765 Ga0307409_101601930 3300031995 Bacteria 679
766 Ga0307416_100901219 3300032002 Bacteria 984
767 Ga0307416_100987456 3300032002 Bacteria 945
768 Ga0307414_10389249 3300032004 Bacteria 1208
769 Ga0307411_11280264 3300032005 Bacteria 667
770 Ga0307415_100980503 3300032126 Bacteria 784
771 Ga0307507_10088859 3300033179 Bacteria 2663
772 Ga0307510_10010241 3300033180 Bacteria 11147
773 Ga0307510_10019329 3300033180 Bacteria 7992
774 Ga0307510_10109337 3300033180 Bacteria 2514
775 Ga0307510_10230706 3300033180 Bacteria 1354
776 Ga0307510_10340909 3300033180 Bacteria 951
777 Ga0315911_1000001 3300033442 Bacteria 1088602
778 Ga0316215_1000526 3300033544 Bacteria 4216
779 Ga0373926_0003514 3300035083 Bacteria 5070
780 Ga0373928_0002944 3300035084 Bacteria 3282
781 Ga0373929_0198895 3300035085 Bacteria 561
782 Ga0373934_0012801 3300035086 Bacteria 3169
783 Ga0373934_0018581 3300035086 Bacteria 2661
784 Ga0373934_0278486 3300035086 Bacteria 693
785 Ga0373940_0114722 3300035088 Bacteria 830
786 Ga0373944_0200611 3300035089 Bacteria 722
787 Ga0373949_0310641 3300035090 Bacteria 503
788 Ga0373952_0180603 3300035092 Bacteria 608
789 Ga0373923_0001405 3300035111 Bacteria 6867
790 Ga0373923_0033984 3300035111 Bacteria 2067
791 Ga0373932_0113753 3300035112 Bacteria 895
792 Ga0373936_0011153 3300035113 Bacteria 3396
793 Ga0373936_0014114 3300035113 Bacteria 3052
794 Ga0373936_0021286 3300035113 Bacteria 2521
795 Ga0373936_0255164 3300035113 Bacteria 784
796 Ga0373941_0177706 3300035115 Bacteria 797
797 Ga0373953_0001516 3300035117 Bacteria 6744
798 Ga0373953_0042708 3300035117 Bacteria 1808
799 Ga0373953_0046928 3300035117 Bacteria 1736
800 Ga0373953_0135714 3300035117 Bacteria 1051
801 Ga0373953_0178273 3300035117 Bacteria 916
802 Ga0373953_0267192 3300035117 Bacteria 745
803 Ga0373954_0000132 3300035118 Bacteria 25640
804 Ga0373954_0012512 3300035118 Bacteria 3773
805 Ga0373954_0120546 3300035118 Bacteria 1273
806 Ga0373954_0165687 3300035118 Bacteria 1082
807 Ga0373956_0041475 3300035119 Bacteria 2043
808 Ga0373956_0417455 3300035119 Bacteria 640
809 Ga0373957_0000168 3300035120 Bacteria 16641
810 Ga0373957_0024164 3300035120 Bacteria 2180
811 Ga0373957_0115560 3300035120 Bacteria 1083
812 Ga0373960_0116131 3300035121 Bacteria 884
813 Ga0373960_0347968 3300035121 Bacteria 561
814 Ga0373943_0033585 3300035170 Bacteria 2445
815 Ga0373943_0053207 3300035170 Bacteria 1998
816 Ga0373943_0121474 3300035170 Bacteria 1388
817 Ga0373943_0407583 3300035170 Bacteria 785
818 Ga0373946_0003228 3300035171 Bacteria 5789
819 Ga0373946_0074634 3300035171 Bacteria 1472
820 Ga0373946_0078850 3300035171 Bacteria 1438
821 Ga0373955_0001612 3300035172 Bacteria 9670
822 Ga0373955_0007649 3300035172 Bacteria 4978
823 Ga0373955_0055600 3300035172 Bacteria 2168
824 Ga0373955_0304498 3300035172 Bacteria 961
825 Ga0373942_0008063 3300035207 Bacteria 2450
826 Ga0373962_0303142 3300035242 Bacteria 567
827 Ga0373924_0006263 3300035410 Bacteria 4256
828 Ga0373924_0017596 3300035410 Bacteria 2744
829 Ga0373924_0047743 3300035410 Bacteria 1767
830 Ga0373924_0203407 3300035410 Bacteria 874
831 Ga0373931_0004299 3300035691 Bacteria 6490
832 Ga0373931_0063897 3300035691 Bacteria 1991
833 Ga0373935_0000435 3300035692 Bacteria 21766
834 Ga0373935_0019538 3300035692 Bacteria 4132
835 Ga0373935_0391622 3300035692 Bacteria 996
836 Ga0373935_0585129 3300035692 Bacteria 815
837 Ga0373935_0770135 3300035692 Bacteria 710
838 Ga0373927_0002587 3300035695 Bacteria 13194
839 Ga0373927_0008673 3300035695 Bacteria 6833
840 Ga0373927_0010027 3300035695 Bacteria 6346
841 Ga0373927_0027124 3300035695 Bacteria 3742
842 Ga0373927_0106796 3300035695 Bacteria 1823
843 Ga0373927_0462735 3300035695 Bacteria 838
844 Ga0373927_0493178 3300035695 Bacteria 809
845 Ga0373927_0575714 3300035695 Bacteria 744
846 Ga0373927_0661197 3300035695 Bacteria 690
847 Ga0373927_0832459 3300035695 Bacteria 609
848 Ga0373933_0000243 3300035724 Bacteria 35861
849 Ga0373933_0069361 3300035724 Bacteria 2143
850 Ga0373933_0218792 3300035724 Bacteria 1221
851 Ga0373947_0007586 3300035725 Bacteria 6278
852 Ga0373947_0012060 3300035725 Bacteria 4949
853 Ga0373947_0024670 3300035725 Bacteria 3505
854 Ga0373947_0038731 3300035725 Bacteria 2834
855 Ga0373947_0186019 3300035725 Bacteria 1354
856 Ga0373947_0355932 3300035725 Bacteria 983
857 Ga0373947_0436874 3300035725 Bacteria 886
858 Ga0373947_0608518 3300035725 Bacteria 745
859 Ga0373947_1198408 3300035725 Bacteria 517
860 Ga0373937_0039688 3300036401 Bacteria 4290
861 Ga0373937_0196956 3300036401 Bacteria 1893
862 Ga0373937_0244436 3300036401 Bacteria 1691
863 Ga0373937_0667895 3300036401 Bacteria 985
864 Ga0373937_0728048 3300036401 Bacteria 939
865 Ga0310109_054355 3300036534 Bacteria 514
866 Ga0373925_0001774 3300037068 Bacteria 18013
867 Ga0373925_0045958 3300037068 Bacteria 3245
868 Ga0373925_0054102 3300037068 Bacteria 3001
869 Ga0373925_0067551 3300037068 Bacteria 2697
870 Ga0373925_0483407 3300037068 Bacteria 1016
871 Ga0373925_0593208 3300037068 Bacteria 912
872 Ga0373925_0807177 3300037068 Bacteria 774
873 Ga0373925_0943314 3300037068 Bacteria 711
874 Ga0395900_0072533 3300037418 Bacteria 3540
875 Ga0395900_0809546 3300037418 Bacteria 864
876 Ga0395898_1678239 3300037466 Bacteria 558
877 Ga0395905_0022828 3300037471 Bacteria 5915
878 Ga0395905_1235047 3300037471 Bacteria 651
879 Ga0436364_0235897 3300037853 Bacteria 1865
880 Ga0436364_0740920 3300037853 Bacteria 1150
881 Ga0436364_1140579 3300037853 Bacteria 2910
882 Ga0395901_0797843 3300038443 Bacteria 933
883 Ga0395901_0997229 3300038443 Bacteria 814
884 Ga0436365_0090210 3300039437 Bacteria 695
885 Ga0436365_0136317 3300039437 Bacteria 1400
886 Ga0436365_0186711 3300039437 Bacteria 9695
887 Ga0436365_0482256 3300039437 Bacteria 5841
888 Ga0436365_0948552 3300039437 Bacteria 536
889 Ga0436365_0996952 3300039437 Bacteria 554
890 Ga0436365_1250872 3300039437 Bacteria 1039
891 Ga0436365_1444108 3300039437 Bacteria 949
892 Ga0436365_1455192 3300039437 Bacteria 969
893 Ga0436365_1458230 3300039437 Bacteria 513
894 Ga0436360_0485622 3300039438 Bacteria 4101
895 Ga0436360_0577390 3300039438 Bacteria 611
896 Ga0436360_0979855 3300039438 Bacteria 1072
897 Ga0436360_1055908 3300039438 Bacteria 610
898 Ga0436360_1355672 3300039438 Bacteria 1307
899 Ga0436361_0350312 3300039447 Bacteria 1229
900 Ga0436361_0886899 3300039447 Bacteria 1688
901 Ga0436361_0915746 3300039447 Bacteria 1009
902 Ga0436361_0924062 3300039447 Bacteria 1326
903 Ga0436361_1001085 3300039447 Bacteria 1420
904 Ga0436361_1175390 3300039447 Bacteria 638
905 Ga0436363_1278748 3300039450 Bacteria 680
906 Ga0436363_1347498 3300039450 Bacteria 5320
907 Ga0436362_0377775 3300039453 Bacteria 2257
908 Ga0436362_0382758 3300039453 Bacteria 507
909 Ga0436362_0610597 3300039453 Bacteria 1147
910 Ga0436362_1238292 3300039453 Bacteria 1159
911 Ga0439465_0103614 3300041413 Bacteria 984
912 Ga0451791_1702097 3300041451 Bacteria 938
913 Ga0451793_0207987 3300041452 Bacteria 1263
914 Ga0451797_1118947 3300041453 Bacteria 674
915 Ga0451795_0620610 3300041456 Bacteria 732
916 Ga0451798_0117060 3300041458 Bacteria 1076
917 Ga0451800_1531708 3300041459 Bacteria 694
918 Ga0451802_1867047 3300041460 Bacteria 552
919 Ga0451807_0039385 3300041486 Bacteria 607
920 Ga0451807_1920733 3300041486 Bacteria 629
921 Ga0451841_1263376 3300041498 Bacteria 612
922 Ga0451851_0996538 3300041507 Bacteria 696
923 Ga0451855_0429867 3300041511 Bacteria 608
924 Ga0451853_3357421 3300041512 Bacteria 690
925 Ga0451853_3867451 3300041512 Bacteria 870
926 Ga0466966_0094483 3300044684 Bacteria 1853
927 Ga0466966_0099429 3300044684 Bacteria 1800
928 Ga0466961_0898865 3300044693 Bacteria 527
929 Ga0466963_0306964 3300044694 Bacteria 1116
930 Ga0466963_0362647 3300044694 Bacteria 1021
931 Ga0466963_0915584 3300044694 Bacteria 618
932 Ga0466964_0096969 3300044706 Bacteria 1293
933 Ga0466971_0147944 3300044719 Bacteria 1096
934 Ga0466968_0284005 3300044735 Bacteria 793
935 Ga0466970_0086575 3300044765 Bacteria 1698
936 Ga0466957_0297805 3300044842 Bacteria 1083
937 Ga0466957_0407907 3300044842 Bacteria 930
938 Ga0466957_1375010 3300044842 Bacteria 513
939 Ga0466959_0011001 3300045049 Bacteria 6494
940 Ga0466967_0093443 3300045976 Bacteria 2737
941 Ga0466967_0139617 3300045976 Bacteria 2256
942 Ga0466967_0154900 3300045976 Bacteria 2145
943 Ga0466967_0272497 3300045976 Bacteria 1622
944 Ga0466967_1731067 3300045976 Bacteria 622
945 Ga0466967_2361388 3300045976 Bacteria 527
946 Ga0495617_175702 3300046452 Bacteria 675
947 Ga0495627_162677 3300046453 Bacteria 621
948 Ga0495592_0000316 3300046454 Bacteria 40498
949 Ga0495592_0047468 3300046454 Bacteria 3198
950 Ga0495592_0049440 3300046454 Bacteria 3126
951 Ga0495592_0181288 3300046454 Bacteria 1434
952 Ga0495603_0001446 3300046455 Bacteria 13824
953 Ga0495603_0022841 3300046455 Bacteria 3785
954 Ga0495603_0048318 3300046455 Bacteria 2533
955 Ga0495603_0145569 3300046455 Bacteria 1377
956 Ga0495603_0195978 3300046455 Bacteria 1168
957 Ga0495603_0501199 3300046455 Bacteria 695
958 Ga0495629_0000176 3300046459 Bacteria 56922
959 Ga0495629_0008069 3300046459 Bacteria 7750
960 Ga0495629_0115694 3300046459 Bacteria 1869
961 Ga0495638_0161606 3300046460 Bacteria 1292
962 Ga0495638_0167148 3300046460 Bacteria 1264
963 Ga0495641_0007242 3300046461 Bacteria 6978
964 Ga0495641_0246112 3300046461 Bacteria 804
965 Ga0495651_0002336 3300046462 Bacteria 14646
966 Ga0495651_0034663 3300046462 Bacteria 3934
967 Ga0495651_0036289 3300046462 Bacteria 3837
968 Ga0495651_0133363 3300046462 Bacteria 1811
969 Ga0495653_0002333 3300046463 Bacteria 15062
970 Ga0495653_0048677 3300046463 Bacteria 3271
971 Ga0495653_0677016 3300046463 Bacteria 628
972 Ga0495650_0114507 3300046471 Bacteria 998
973 Ga0495580_0001310 3300046472 Bacteria 21988
974 Ga0495580_0026506 3300046472 Bacteria 4225
975 Ga0495580_0241022 3300046472 Bacteria 1240
976 Ga0495580_0433341 3300046472 Bacteria 883
977 Ga0495582_0000545 3300046473 Bacteria 20797
978 Ga0495582_0019184 3300046473 Bacteria 3741
979 Ga0495582_0325338 3300046473 Bacteria 885
980 Ga0495605_0328411 3300046474 Bacteria 644
981 Ga0495639_0010592 3300046475 Bacteria 3970
982 Ga0495639_0089834 3300046475 Bacteria 1440
983 Ga0495639_0103776 3300046475 Bacteria 1344
984 Ga0495639_0272352 3300046475 Bacteria 840
985 Ga0495662_0003999 3300046476 Bacteria 7428
986 Ga0495662_0171896 3300046476 Bacteria 1068
987 Ga0495664_0016518 3300046477 Bacteria 4207
988 Ga0495664_0022116 3300046477 Bacteria 3681
989 Ga0495664_0112353 3300046477 Bacteria 1645
990 Ga0495664_0123109 3300046477 Bacteria 1568
991 Ga0495664_0140249 3300046477 Bacteria 1465
992 Ga0495664_0267503 3300046477 Bacteria 1033
993 Ga0495664_0761221 3300046477 Bacteria 570
994 Ga0495584_0493114 3300046491 Bacteria 624
995 Ga0495585_0035267 3300046492 Bacteria 2828
996 Ga0495585_0180295 3300046492 Bacteria 1086
997 Ga0495585_0279772 3300046492 Bacteria 825
998 Ga0495594_0000020 3300046499 Bacteria 80534
999 Ga0495594_0087977 3300046499 Bacteria 1739
1000 Ga0495594_0249012 3300046499 Bacteria 1012
1001 Ga0495594_0313122 3300046499 Bacteria 894
1002 Ga0495594_0511637 3300046499 Bacteria 682
1003 Ga0495594_0536512 3300046499 Bacteria 664
1004 Ga0495583_0212960 3300046506 Bacteria 783
1005 Ga0495606_0003820 3300046507 Bacteria 15624
1006 Ga0495606_0320351 3300046507 Bacteria 833
1007 Ga0495606_0328870 3300046507 Bacteria 818
1008 Ga0495606_0402991 3300046507 Bacteria 712
1009 Ga0495608_0005003 3300046511 Bacteria 9486
1010 Ga0495608_0076801 3300046511 Bacteria 2174
1011 Ga0495610_0070605 3300046512 Bacteria 1630
1012 Ga0495610_0181975 3300046512 Bacteria 873
1013 Ga0495616_0060187 3300046513 Bacteria 1866
1014 Ga0495618_0078963 3300046514 Bacteria 2098
1015 Ga0495618_0125439 3300046514 Bacteria 1644
1016 Ga0495618_0174603 3300046514 Bacteria 1366
1017 Ga0495618_0324373 3300046514 Bacteria 953
1018 Ga0495620_0251452 3300046515 Bacteria 674
1019 Ga0495620_0256667 3300046515 Bacteria 666
1020 Ga0495628_0010144 3300046516 Bacteria 8010
1021 Ga0495628_0058137 3300046516 Bacteria 3040
1022 Ga0495628_0075750 3300046516 Bacteria 2620
1023 Ga0495628_1190507 3300046516 Bacteria 517
1024 Ga0495630_0044087 3300046517 Bacteria 3333
1025 Ga0495630_0274763 3300046517 Bacteria 1287
1026 Ga0495630_0904493 3300046517 Bacteria 672
1027 Ga0495630_1100710 3300046517 Bacteria 602
1028 Ga0495631_0025372 3300046518 Bacteria 2730
1029 Ga0495631_0162612 3300046518 Bacteria 958
1030 Ga0495631_0363391 3300046518 Bacteria 616
1031 Ga0495632_0138676 3300046519 Bacteria 1129
1032 Ga0495632_0150187 3300046519 Bacteria 1077
1033 Ga0495632_0296297 3300046519 Bacteria 718
1034 Ga0495637_0336925 3300046520 Bacteria 531
1035 Ga0495644_0078643 3300046523 Bacteria 1242
1036 Ga0495644_0318893 3300046523 Bacteria 610
1037 Ga0495644_0430845 3300046523 Bacteria 524
1038 Ga0495648_0028869 3300046524 Bacteria 3688
1039 Ga0495648_0093578 3300046524 Bacteria 1676
1040 Ga0495666_0010941 3300046526 Bacteria 4525
1041 Ga0495652_0004857 3300046529 Bacteria 12762
1042 Ga0495652_0047989 3300046529 Bacteria 3661
1043 Ga0495652_0355006 3300046529 Bacteria 1049
1044 Ga0495652_0979629 3300046529 Bacteria 554
1045 Ga0495654_0090172 3300046530 Bacteria 1424
1046 Ga0495665_0000170 3300046531 Bacteria 32921
1047 Ga0495665_0137466 3300046531 Bacteria 1278
1048 Ga0495640_0002547 3300046533 Bacteria 14649
1049 Ga0495640_0010374 3300046533 Bacteria 7205
1050 Ga0495640_0094459 3300046533 Bacteria 1969
1051 Ga0495640_0593690 3300046533 Bacteria 669
1052 Ga0495640_0856612 3300046533 Bacteria 540
1053 Ga0495587_0001071 3300046536 Bacteria 17994
1054 Ga0495587_0031364 3300046536 Bacteria 3218
1055 Ga0495587_0602018 3300046536 Bacteria 605
1056 Ga0495598_0013908 3300046537 Bacteria 2004
1057 Ga0495609_0309606 3300046538 Bacteria 642
1058 Ga0495609_0427873 3300046538 Bacteria 528
1059 Ga0495621_0043795 3300046539 Bacteria 1580
1060 Ga0495645_0003790 3300046543 Bacteria 10277
1061 Ga0495645_0011662 3300046543 Bacteria 6188
1062 Ga0495622_0002079 3300046557 Bacteria 9785
1063 Ga0495622_0028006 3300046557 Bacteria 2630
1064 Ga0495622_0229126 3300046557 Bacteria 821
1065 Ga0495667_0007097 3300046559 Bacteria 7598
1066 Ga0495667_0046148 3300046559 Bacteria 2882
1067 Ga0495667_0558964 3300046559 Bacteria 714
1068 Ga0495656_0050030 3300046615 Bacteria 1782
1069 Ga0495656_0114997 3300046615 Bacteria 1263
1070 Ga0495668_0041329 3300046616 Bacteria 2568
1071 Ga0495668_0250745 3300046616 Bacteria 969
1072 Ga0495668_0304781 3300046616 Bacteria 873
1073 Ga0495668_0439123 3300046616 Bacteria 718
1074 Ga0495634_0000998 3300046642 Bacteria 26678
1075 Ga0495634_0019197 3300046642 Bacteria 4859
1076 Ga0495634_0111197 3300046642 Bacteria 1761
1077 Ga0495634_0402870 3300046642 Bacteria 812
1078 Ga0495611_0040906 3300046648 Bacteria 2067
1079 Ga0495611_0379933 3300046648 Bacteria 647
1080 Ga0495625_0260674 3300046660 Bacteria 1122
1081 Ga0495625_0400839 3300046660 Bacteria 857
1082 Ga0495635_0000040 3300046663 Bacteria 86519
1083 Ga0495635_0030879 3300046663 Bacteria 3722
1084 Ga0495635_0084818 3300046663 Bacteria 2167
1085 Ga0495635_0177498 3300046663 Bacteria 1448
1086 Ga0495659_0031086 3300046664 Bacteria 1861
1087 Ga0495659_0049398 3300046664 Bacteria 1527
1088 Ga0495661_0108816 3300046665 Bacteria 1548
1089 Ga0495588_0010035 3300046674 Bacteria 4389
1090 Ga0495588_0063546 3300046674 Bacteria 1914
1091 Ga0495588_0257880 3300046674 Bacteria 919
1092 Ga0495657_0000218 3300046675 Bacteria 51627
1093 Ga0495657_0204325 3300046675 Bacteria 1203
1094 Ga0495657_0460422 3300046675 Bacteria 744
1095 Ga0495657_0640031 3300046675 Bacteria 614
1096 Ga0495599_0000256 3300046678 Bacteria 33627
1097 Ga0495599_0044271 3300046678 Bacteria 2792
1098 Ga0495599_0049469 3300046678 Bacteria 2635
1099 Ga0495599_0097164 3300046678 Bacteria 1836
1100 Ga0495623_0013540 3300046679 Bacteria 5288
1101 Ga0495623_0085754 3300046679 Bacteria 1942
1102 Ga0495623_0422695 3300046679 Bacteria 714
1103 Ga0495623_0597224 3300046679 Bacteria 574
1104 Ga0495646_0003573 3300046680 Bacteria 9701
1105 Ga0495646_0083110 3300046680 Bacteria 1862
1106 Ga0495646_0534592 3300046680 Bacteria 600
1107 Ga0495647_0001303 3300046681 Bacteria 7665
1108 Ga0495647_0065497 3300046681 Bacteria 1443
1109 Ga0495647_0128312 3300046681 Bacteria 1072
1110 Ga0495647_0218145 3300046681 Bacteria 841
1111 Ga0495658_0002344 3300046683 Bacteria 9568
1112 Ga0495669_0004164 3300046684 Bacteria 5947
1113 Ga0495669_0052804 3300046684 Bacteria 1827
1114 Ga0495669_0101358 3300046684 Bacteria 1337
1115 Ga0495669_0210326 3300046684 Bacteria 931
1116 Ga0495669_0274305 3300046684 Bacteria 811
1117 Ga0495669_0393434 3300046684 Bacteria 671
1118 Ga0495613_0017244 3300046689 Bacteria 5380
1119 Ga0495613_0148878 3300046689 Bacteria 1670
1120 Ga0495613_0276398 3300046689 Bacteria 1167
1121 Ga0495613_0759863 3300046689 Bacteria 635
1122 Ga0495624_0009089 3300046690 Bacteria 6894
1123 Ga0495624_0037826 3300046690 Bacteria 3103
1124 Ga0495624_0295698 3300046690 Bacteria 977
1125 Ga0495624_0523356 3300046690 Bacteria 709
1126 Ga0495670_0082771 3300046691 Bacteria 1636
1127 Ga0495670_0170470 3300046691 Bacteria 1146
1128 Ga0495671_0074187 3300046692 Bacteria 1669
1129 Ga0495671_0153623 3300046692 Bacteria 1120
1130 Ga0495649_0276088 3300046694 Bacteria 859
1131 Ga0495589_0243042 3300046794 Bacteria 842
1132 Ga0495589_0381400 3300046794 Bacteria 648
1133 Ga0495600_0000541 3300046809 Bacteria 19518
1134 Ga0495600_0067787 3300046809 Bacteria 2332
1135 Ga0495600_0086718 3300046809 Bacteria 2042
1136 Ga0495581_0003140 3300047315 Bacteria 9453
1137 Ga0495581_0023393 3300047315 Bacteria 3580
1138 Ga0495581_0061621 3300047315 Bacteria 2168
1139 Ga0495581_0066144 3300047315 Bacteria 2090
1140 Ga0495581_0623858 3300047315 Bacteria 624
1141 Ga0495604_0001811 3300047317 Bacteria 17417
1142 Ga0495604_0343396 3300047317 Bacteria 993
1143 Ga0495604_0402588 3300047317 Bacteria 901
1144 Ga0495604_0521387 3300047317 Bacteria 769
1145 Ga0495604_0594829 3300047317 Bacteria 710
1146 Ga0495636_0464653 3300047318 Bacteria 609
1147 Ga0495674_0000600 3300047319 Bacteria 33795
1148 Ga0495674_0077886 3300047319 Bacteria 2850
1149 Ga0495674_0634500 3300047319 Bacteria 843
1150 Ga0495674_0750856 3300047319 Bacteria 762
1151 Ga0495672_0007934 3300047320 Bacteria 7915
1152 Ga0495672_0200728 3300047320 Bacteria 997
1153 Ga0495672_0260818 3300047320 Bacteria 836
1154 Ga0495676_0037688 3300047321 Bacteria 4021
1155 Ga0495676_0046483 3300047321 Bacteria 3522
1156 Ga0495676_0049266 3300047321 Bacteria 3389
1157 Ga0495676_0320194 3300047321 Bacteria 1042
1158 Ga0495680_0011919 3300047322 Bacteria 7672
1159 Ga0495680_0059137 3300047322 Bacteria 2960
1160 Ga0495680_0080401 3300047322 Bacteria 2463
1161 Ga0495680_0396202 3300047322 Bacteria 954
1162 Ga0495680_0433135 3300047322 Bacteria 903
1163 Ga0495680_0501396 3300047322 Bacteria 824
1164 Ga0495683_0058376 3300047323 Bacteria 1917
1165 Ga0495683_0088393 3300047323 Bacteria 1504
1166 Ga0495683_0158602 3300047323 Bacteria 1048
1167 Ga0495675_0055004 3300047444 Bacteria 2524
1168 Ga0495677_0123238 3300047445 Bacteria 989
1169 Ga0495677_0362708 3300047445 Bacteria 572
1170 Ga0495679_050073 3300047446 Bacteria 1258
1171 Ga0495685_282846 3300047447 Bacteria 523
1172 Ga0495673_0064876 3300047469 Bacteria 1552
1173 Ga0495673_0091021 3300047469 Bacteria 1246
1174 Ga0495673_0260515 3300047469 Bacteria 631
1175 Ga0495684_0000023 3300047471 Bacteria 133626
1176 Ga0495684_0035362 3300047471 Bacteria 3831
1177 Ga0495684_0041506 3300047471 Bacteria 3526
1178 Ga0495593_0003332 3300047673 Bacteria 9624
1179 Ga0495593_0005773 3300047673 Bacteria 7300
1180 Ga0495593_0086730 3300047673 Bacteria 1614
1181 Ga0495602_0008270 3300048088 Bacteria 10865
1182 Ga0495602_0079174 3300048088 Bacteria 2773
1183 Ga0495602_0222208 3300048088 Bacteria 1425
1184 Ga0495602_0480250 3300048088 Bacteria 872
1185 Ga0495614_0513275 3300048089 Bacteria 571
1186 Ga0496100_0005982 3300048903 Bacteria 6600
1187 Ga0496100_0162736 3300048903 Bacteria 1601
1188 Ga0496100_0386942 3300048903 Bacteria 1063
1189 Ga0496101_0025777 3300048904 Bacteria 4081
1190 Ga0496101_0038511 3300048904 Bacteria 3396
1191 Ga0496101_0224261 3300048904 Bacteria 1459
1192 Ga0496101_0637589 3300048904 Bacteria 842
1193 Ga0496102_0008125 3300048905 Bacteria 8979
1194 Ga0496102_0156905 3300048905 Bacteria 2139
1195 Ga0496102_0275430 3300048905 Bacteria 1586
1196 Ga0496102_0311979 3300048905 Bacteria 1482
1197 Ga0496102_0558399 3300048905 Bacteria 1068
1198 Ga0496103_0042708 3300048906 Bacteria 2791
1199 Ga0496103_0126537 3300048906 Bacteria 1630
1200 Ga0496104_0020842 3300048907 Bacteria 6011
1201 Ga0496104_0029258 3300048907 Bacteria 5109
1202 Ga0496104_0075547 3300048907 Bacteria 3208
1203 Ga0496104_0370557 3300048907 Bacteria 1345
1204 Ga0496104_0393197 3300048907 Bacteria 1298
1205 Ga0496105_0008473 3300048908 Bacteria 7989
1206 Ga0496105_0054973 3300048908 Bacteria 3287
1207 Ga0496105_0255995 3300048908 Bacteria 1417
1208 Ga0496105_0275710 3300048908 Bacteria 1357
1209 Ga0496105_0320305 3300048908 Bacteria 1243
1210 Ga0496105_0805733 3300048908 Bacteria 714
1211 Ga0496106_0008202 3300048909 Bacteria 7720
1212 Ga0496106_0041693 3300048909 Bacteria 3440
1213 Ga0496106_0046901 3300048909 Bacteria 3250
1214 Ga0496106_0050608 3300048909 Bacteria 3131
1215 Ga0496106_0061464 3300048909 Bacteria 2850
1216 Ga0496106_0075215 3300048909 Bacteria 2587
1217 Ga0496106_1198276 3300048909 Bacteria 592
1218 Ga0496107_0022899 3300048910 Bacteria 4416
1219 Ga0496107_0035705 3300048910 Bacteria 3564
1220 Ga0496107_0065602 3300048910 Bacteria 2632
1221 Ga0496107_0168783 3300048910 Bacteria 1623
1222 Ga0496107_0176583 3300048910 Bacteria 1586
1223 Ga0496107_0216401 3300048910 Bacteria 1425
1224 Ga0496107_0612891 3300048910 Bacteria 804
1225 Ga0496107_0636235 3300048910 Bacteria 787
1226 Ga0496108_0003213 3300048911 Bacteria 13143
1227 Ga0496108_0010940 3300048911 Bacteria 7368
1228 Ga0496108_0012155 3300048911 Bacteria 7001
1229 Ga0496108_0039596 3300048911 Bacteria 3928
1230 Ga0496108_0053217 3300048911 Bacteria 3394
1231 Ga0496108_1352100 3300048911 Bacteria 597
1232 Ga0496109_0002585 3300048912 Bacteria 15162
1233 Ga0496109_0016135 3300048912 Bacteria 6528
1234 Ga0496109_0025566 3300048912 Bacteria 5263
1235 Ga0496109_0260761 3300048912 Bacteria 1632
1236 Ga0496109_0507382 3300048912 Bacteria 1138
1237 Ga0496109_1310615 3300048912 Bacteria 660
1238 Ga0496110_0005094 3300048913 Bacteria 10266
1239 Ga0496110_0009693 3300048913 Bacteria 7800
1240 Ga0496110_0011502 3300048913 Bacteria 7245
1241 Ga0496110_0090813 3300048913 Bacteria 2731
1242 Ga0496110_0109266 3300048913 Bacteria 2483
1243 Ga0496110_0215738 3300048913 Bacteria 1745
1244 Ga0496110_0298264 3300048913 Bacteria 1468
1245 Ga0496110_1152860 3300048913 Bacteria 684
1246 Ga0496111_0041081 3300048914 Bacteria 3318
1247 Ga0496111_0152865 3300048914 Bacteria 1712
1248 Ga0496111_0164446 3300048914 Bacteria 1648
1249 Ga0496111_0165666 3300048914 Bacteria 1641
1250 Ga0496111_0204773 3300048914 Bacteria 1466
1251 Ga0496111_0266366 3300048914 Bacteria 1271
1252 Ga0496112_0000031 3300048915 Bacteria 120022
1253 Ga0496112_0002881 3300048915 Bacteria 13996
1254 Ga0496112_0055524 3300048915 Bacteria 3894
1255 Ga0496112_0118015 3300048915 Bacteria 2623
1256 Ga0496112_0189893 3300048915 Bacteria 2016
1257 Ga0496112_0366845 3300048915 Bacteria 1381
1258 Ga0496113_0006041 3300048916 Bacteria 7629
1259 Ga0496113_0014440 3300048916 Bacteria 5387
1260 Ga0496113_0039454 3300048916 Bacteria 3475
1261 Ga0496113_1074691 3300048916 Bacteria 632
1262 Ga0496114_0028470 3300048917 Bacteria 4586
1263 Ga0496114_0090800 3300048917 Bacteria 2593
1264 Ga0496114_0271973 3300048917 Bacteria 1493
1265 Ga0496114_0631052 3300048917 Bacteria 944
1266 Ga0496114_1571325 3300048917 Bacteria 546
1267 Ga0496115_0010614 3300048918 Bacteria 6888
1268 Ga0496115_0038527 3300048918 Bacteria 3793
1269 Ga0496115_0068732 3300048918 Bacteria 2868
1270 Ga0496115_0138134 3300048918 Bacteria 2010
1271 Ga0496115_0158378 3300048918 Bacteria 1871
1272 Ga0496115_0172524 3300048918 Bacteria 1788
1273 Ga0496115_0234195 3300048918 Bacteria 1514
1274 Ga0496115_0616443 3300048918 Bacteria 861
1275 Ga0496118_0001670 3300048921 Bacteria 32550
1276 Ga0496118_0043015 3300048921 Bacteria 3556
1277 Ga0496119_0064309 3300048922 Bacteria 2179
1278 Ga0496119_0405635 3300048922 Bacteria 649
1279 Ga0496120_0093413 3300048923 Bacteria 1603
1280 Ga0496120_0129130 3300048923 Bacteria 1297
1281 Ga0496121_0000183 3300048924 Bacteria 139168
1282 Ga0496121_0001473 3300048924 Bacteria 39642
1283 Ga0496121_0002518 3300048924 Bacteria 27800
1284 Ga0496121_0157177 3300048924 Bacteria 1667
1285 Ga0496121_0219605 3300048924 Bacteria 1340
1286 Ga0496121_0381970 3300048924 Bacteria 928
1287 Ga0496124_0001382 3300048927 Bacteria 36359
1288 Ga0496124_0016454 3300048927 Bacteria 7028
1289 Ga0496124_0299139 3300048927 Bacteria 1163
1290 Ga0496125_0048308 3300048928 Bacteria 3550
1291 Ga0496125_0060785 3300048928 Bacteria 3034
1292 Ga0496126_0004491 3300048929 Bacteria 16643
1293 Ga0496126_0013413 3300048929 Bacteria 8338
1294 Ga0496126_0063841 3300048929 Bacteria 3300
1295 Ga0496126_0115146 3300048929 Bacteria 2338
1296 Ga0496126_0129927 3300048929 Bacteria 2177
1297 Ga0496126_0223766 3300048929 Bacteria 1579
1298 Ga0496126_0242172 3300048929 Bacteria 1506
1299 Ga0496126_0394707 3300048929 Bacteria 1123
1300 Ga0496126_0498782 3300048929 Bacteria 973
1301 Ga0496126_0534124 3300048929 Bacteria 933
1302 Ga0496126_0643537 3300048929 Bacteria 830
1303 Ga0495678_065656 3300049459 Bacteria 1346
1304 Ga0495682_0171067 3300049460 Bacteria 773
1305 Ga0501031_0000442 3300049568 Bacteria 23895
1306 Ga0501032_0000773 3300049569 Bacteria 25943
1307 Ga0501033_0000025 3300049570 Bacteria 173634
1308 Ga0501033_0336470 3300049570 Bacteria 1059
1309 Ga0501034_0000021 3300049571 Bacteria 266023
1310 Ga0501036_0000069 3300049572 Bacteria 64331
1311 Ga0501037_0000034 3300049573 Bacteria 126321
1312 Ga0501038_0000537 3300049574 Bacteria 33396
1313 Ga0501039_0000198 3300049575 Bacteria 43456
1314 Ga0501042_0670899 3300049578 Bacteria 754
1315 Ga0501043_0001044 3300049579 Bacteria 24351
1316 Ga0501046_0011176 3300049580 Bacteria 7691
1317 Ga0501047_0000587 3300049581 Bacteria 38665
1318 Ga0501047_0047916 3300049581 Bacteria 4128
1319 Ga0501047_0748050 3300049581 Bacteria 794
1320 Ga0501048_0008991 3300049582 Bacteria 7520
1321 Ga0501067_0000331 3300049583 Bacteria 25804
1322 Ga0501067_0056192 3300049583 Bacteria 2181
1323 Ga0501068_0000039 3300049584 Bacteria 48466
1324 Ga0501069_0000910 3300049585 Bacteria 14124
1325 Ga0501069_0029131 3300049585 Bacteria 3030
1326 Ga0501069_0410822 3300049585 Bacteria 802
1327 Ga0501070_0033515 3300049586 Bacteria 4298
1328 Ga0501070_0140507 3300049586 Bacteria 1994
1329 Ga0501070_0282353 3300049586 Bacteria 1354
1330 Ga0501070_0306690 3300049586 Bacteria 1292
1331 Ga0501072_0007314 3300049588 Bacteria 8375
1332 Ga0501072_0250013 3300049588 Bacteria 1412
1333 Ga0501073_0000236 3300049589 Bacteria 36413
1334 Ga0501073_0069491 3300049589 Bacteria 2454
1335 Ga0501074_0000048 3300049590 Bacteria 56982
1336 Ga0501074_0030647 3300049590 Bacteria 3898
1337 Ga0501257_204124 3300049686 Bacteria 569
1338 Ga0501225_0182944 3300049705 Bacteria 656
1339 Ga0501079_0011390 3300049741 Bacteria 6788
1340 Ga0501079_0828095 3300049741 Bacteria 729
1341 Ga0501080_0034680 3300049742 Bacteria 4712
1342 Ga0501080_0278675 3300049742 Bacteria 1520
1343 Ga0501080_0472463 3300049742 Bacteria 1122
1344 Ga0501081_1022083 3300049743 Bacteria 625
1345 Ga0501083_0030815 3300049744 Bacteria 3681
1346 Ga0501035_0000865 3300049822 Bacteria 32300
1347 Ga0501044_0000028 3300049823 Bacteria 179203
1348 Ga0501044_0070718 3300049823 Bacteria 3549
1349 Ga0501044_0180205 3300049823 Bacteria 2080
1350 Ga0501044_0777983 3300049823 Bacteria 838
1351 Ga0501045_0191681 3300049824 Bacteria 1523
1352 nmdc:mga03683_245279_c1 3300050489 Bacteria 831
1353 nmdc:mga03683_555581_c1 3300050489 Bacteria 559
1354 nmdc:mga0yw44_172489_c1 3300050492 Bacteria 552
1355 nmdc:mga0yw44_343361_c1 3300050492 Bacteria 1004
1356 nmdc:mga0k408_184235_c2 3300050493 Bacteria 502
1357 nmdc:mga0k408_29543_c1 3300050493 Bacteria 3121
1358 nmdc:mga0k408_611302_c1 3300050493 Bacteria 642
1359 nmdc:mga0k408_695351_c1 3300050493 Bacteria 596
1360 nmdc:mga06z11_191886_c1 3300050494 Bacteria 1183
1361 nmdc:mga06z11_298778_c1 3300050494 Bacteria 957
1362 nmdc:mga04h51_171599_c1 3300050495 Bacteria 840
1363 nmdc:mga07m45_103042_c1 3300050496 Bacteria 1640
1364 nmdc:mga07m45_479438_c1 3300050496 Bacteria 721
1365 nmdc:mga07m45_907950_c1 3300050496 Bacteria 504
1366 nmdc:mga06r32_564965_c1 3300050510 Bacteria 1110
1367 nmdc:mga08y16_314653_c1 3300050511 Bacteria 1612
1368 nmdc:mga0n895_158416_c1 3300050512 Bacteria 2295
1369 nmdc:mga0n895_354924_c1 3300050512 Bacteria 1485
1370 nmdc:mga0rr50_700405_c1 3300050513 Bacteria 864
1371 nmdc:mga08x19_104020_c1 3300050514 Bacteria 1886
1372 nmdc:mga0a205_1029238_c1 3300050515 Bacteria 670
1373 nmdc:mga0sz30_202315_c1 3300050516 Bacteria 882
1374 nmdc:mga0sz30_345707_c1 3300050516 Bacteria 664
1375 Ga0495601_0032809 3300053077 Bacteria 3234
1376 Ga0495601_0047559 3300053077 Bacteria 2701
1377 Ga0495601_0050146 3300053077 Bacteria 2632
1378 Ga0495601_0221914 3300053077 Bacteria 1235
1379 Ga0495612_0086620 3300053078 Bacteria 1321
1380 Ga0495612_0163605 3300053078 Bacteria 972
1381 Ga0500635_0003272 3300053080 Bacteria 4065
1382 Ga0500635_0024104 3300053080 Bacteria 1905
1383 Ga0500635_0033210 3300053080 Bacteria 1682
1384 Ga0495655_0134726 3300053083 Bacteria 764
1385 Ga0495595_0000634 3300053084 Bacteria 13368
1386 Ga0495595_0096720 3300053084 Bacteria 1422
1387 Ga0495595_0245576 3300053084 Bacteria 896
1388 Ga0495595_0574087 3300053084 Bacteria 576
1389 Ga0495619_0000697 3300053085 Bacteria 21975
1390 Ga0495619_0013615 3300053085 Bacteria 5126
1391 Ga0495619_0072468 3300053085 Bacteria 2307
1392 Ga0495619_0531461 3300053085 Bacteria 808
1393 Ga0495619_0639362 3300053085 Bacteria 726
1394 Ga0500578_0261630 3300053086 Bacteria 1039
1395 Ga0500578_0319122 3300053086 Bacteria 916
1396 Ga0500647_0055764 3300053091 Bacteria 1901
1397 Ga0500647_0291114 3300053091 Bacteria 702
1398 Ga0500583_0073951 3300053092 Bacteria 1635
1399 Ga0500583_0417295 3300053092 Bacteria 641
1400 Ga0500651_0030288 3300053093 Bacteria 3404
1401 Ga0500651_0030472 3300053093 Bacteria 3394
1402 Ga0500651_0156988 3300053093 Bacteria 1362
1403 Ga0500566_0000010 3300053094 Bacteria 119976
1404 Ga0500566_0051918 3300053094 Bacteria 2344
1405 Ga0500566_0490302 3300053094 Bacteria 531
1406 Ga0500640_000055 3300053095 Bacteria 17705
1407 Ga0500641_0093867 3300053096 Bacteria 1282
1408 Ga0500654_142441 3300053099 Bacteria 869
1409 Ga0500554_000560 3300053102 Bacteria 7634
1410 Ga0500554_027963 3300053102 Bacteria 1635
1411 Ga0500556_0073406 3300053104 Bacteria 1281
1412 Ga0500556_0151239 3300053104 Bacteria 915
1413 Ga0500569_006916 3300053109 Bacteria 2517
1414 Ga0500572_000088 3300053111 Bacteria 29518
1415 Ga0500572_001292 3300053111 Bacteria 6993
1416 Ga0500591_200314 3300053115 Bacteria 691
1417 Ga0500595_000967 3300053119 Bacteria 16141
1418 Ga0500595_001717 3300053119 Bacteria 11435
1419 Ga0500595_002830 3300053119 Bacteria 8341
1420 Ga0500595_006501 3300053119 Bacteria 4949
1421 Ga0500595_008515 3300053119 Bacteria 4186
1422 Ga0500608_061747 3300053122 Bacteria 1790
1423 Ga0500608_112922 3300053122 Bacteria 1243
1424 Ga0500614_000734 3300053123 Bacteria 8346
1425 Ga0500655_065207 3300053133 Bacteria 737
1426 Ga0500658_0069848 3300053134 Bacteria 1479
1427 Ga0500658_0221356 3300053134 Bacteria 868
1428 Ga0500559_0001744 3300053136 Bacteria 11938
1429 Ga0500559_0024871 3300053136 Bacteria 2548
1430 Ga0500559_0088109 3300053136 Bacteria 1418
1431 Ga0500568_0023381 3300053139 Bacteria 2629
1432 Ga0500568_0093224 3300053139 Bacteria 1135
1433 Ga0500568_0119209 3300053139 Bacteria 984
1434 Ga0500573_0147868 3300053140 Bacteria 1288
1435 Ga0500577_0118571 3300053142 Bacteria 1099
1436 Ga0500588_0017368 3300053146 Bacteria 1877
1437 Ga0500589_046444 3300053147 Bacteria 2022
1438 Ga0500590_105444 3300053148 Bacteria 1346
1439 Ga0500590_176307 3300053148 Bacteria 934
1440 Ga0500590_189746 3300053148 Bacteria 882
1441 Ga0500603_000342 3300053150 Bacteria 12168
1442 Ga0500603_004423 3300053150 Bacteria 3008
1443 Ga0500603_013232 3300053150 Bacteria 1910
1444 Ga0500603_133042 3300053150 Bacteria 761
1445 Ga0500603_148305 3300053150 Bacteria 726
1446 Ga0500604_0009862 3300053151 Bacteria 2547
1447 Ga0500619_188296 3300053154 Bacteria 695
1448 Ga0500622_0074138 3300053156 Bacteria 1715
1449 Ga0500627_0092869 3300053158 Bacteria 1351
1450 Ga0500627_0415377 3300053158 Bacteria 571
1451 Ga0500630_003317 3300053159 Bacteria 7798
1452 Ga0500634_0171056 3300053161 Bacteria 989
1453 Ga0500638_000712 3300053162 Bacteria 8912
1454 Ga0500638_093941 3300053162 Bacteria 1408
1455 Ga0500638_159196 3300053162 Bacteria 996
1456 Ga0500638_162057 3300053162 Bacteria 983
1457 Ga0500638_353576 3300053162 Bacteria 544
1458 Ga0500639_000001 3300053163 Bacteria 244795
1459 Ga0500639_056128 3300053163 Bacteria 2040
1460 Ga0500639_057167 3300053163 Bacteria 2018
1461 Ga0500636_0078193 3300053177 Bacteria 1909
1462 Ga0500636_0091378 3300053177 Bacteria 1743
1463 Ga0500636_0194916 3300053177 Bacteria 1076
1464 Ga0500636_0303041 3300053177 Bacteria 785
1465 Ga0500636_0398726 3300053177 Bacteria 639
1466 Ga0500637_0002851 3300053178 Bacteria 7795
1467 Ga0500637_0005100 3300053178 Bacteria 6325
1468 Ga0500637_0035858 3300053178 Bacteria 2783
1469 Ga0500637_0364416 3300053178 Bacteria 763
1470 Ga0500576_254031 3300053725 Bacteria 544
1471 Ga0500609_008206 3300053731 Bacteria 1409
1472 Ga0500552_006330 3300053733 Bacteria 1325
1473 Ga0500596_006761 3300053735 Bacteria 1918
1474 Ga0500596_007614 3300053735 Bacteria 1763
1475 Ga0500601_006758 3300053737 Bacteria 1267
1476 Ga0500587_017740 3300053739 Bacteria 914
1477 Ga0501084_0001432 3300054114 Bacteria 18932
1478 Ga0500661_000387 3300055283 Bacteria 8106
1479 Ga0587115_088134 3300059626 Bacteria 560
1480 Ga0501082_0011376 3300060353 Bacteria 7654
1481 Ga0501082_0485625 3300060353 Bacteria 1080
1482 Ga0501082_1589670 3300060353 Bacteria 571
1483 Ga0466962_0140275 3300061719 Bacteria 1171

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025929 Ga0207664_10140973 Ga0207664_101409732 130
2 3300039437 Ga0436365_1458230 Ga0436365_1458230_11_412 130
3 3300039450 Ga0436363_1278748 Ga0436363_1278748_208_606 130
4 3300044694 Ga0466963_0915584 Ga0466963_0915584_155_553 130
5 iso_pu_bacteria 2508501128 2509150379 130
6 iso_pu_bacteria 2513237141 2513893561 130
7 iso_pu_bacteria 2922386360 2922390852 130
8 iso_pu_bacteria 8056673599 8056673996 130
9 3300000549 LJQas_1006151 LJQas_10061512 132
10 3300001904 JGI24736J21556_1019063 JGI24736J21556_10190632 132
11 3300001989 JGI24739J22299_10029071 JGI24739J22299_100290712 132
12 3300001990 JGI24737J22298_10026448 JGI24737J22298_100264482 132
13 3300002067 JGI24735J21928_10036631 JGI24735J21928_100366312 132
14 3300002067 JGI24735J21928_10069308 JGI24735J21928_100693082 132
15 3300002074 JGI24748J21848_1054316 JGI24748J21848_10543161 132
16 3300002077 JGI24744J21845_10024791 JGI24744J21845_100247912 132
17 3300003203 JGI25406J46586_10020393 JGI25406J46586_100203932 132
18 3300003203 JGI25406J46586_10143480 JGI25406J46586_101434801 132
19 3300003203 JGI25406J46586_10151684 JGI25406J46586_101516841 132
20 3300003215 JGI25153J46596_10001436 JGI25153J46596_1000143611 132
21 3300003320 rootH2_10047101 rootH2_100471012 132
22 3300003659 JGI25404J52841_10002090 JGI25404J52841_100020902 132
23 3300003659 JGI25404J52841_10004756 JGI25404J52841_100047564 132
24 3300003659 JGI25404J52841_10019050 JGI25404J52841_100190502 132
25 3300003659 JGI25404J52841_10087493 JGI25404J52841_100874932 132
26 3300003911 JGI25405J52794_10049357 JGI25405J52794_100493572 132
27 3300005327 Ga0070658_10019300 Ga0070658_100193005 132
28 3300005329 Ga0070683_100005606 Ga0070683_1000056069 132
29 3300005329 Ga0070683_100045273 Ga0070683_1000452733 132
30 3300005329 Ga0070683_100198250 Ga0070683_1001982503 132
31 3300005329 Ga0070683_100565967 Ga0070683_1005659672 132
32 3300005329 Ga0070683_100689860 Ga0070683_1006898602 132
33 3300005330 Ga0070690_100395641 Ga0070690_1003956412 132
34 3300005334 Ga0068869_100216002 Ga0068869_1002160022 132
35 3300005336 Ga0070680_100015488 Ga0070680_1000154884 132
36 3300005336 Ga0070680_100021554 Ga0070680_1000215544 132
37 3300005336 Ga0070680_100147196 Ga0070680_1001471962 132
38 3300005336 Ga0070680_100224979 Ga0070680_1002249791 132
39 3300005337 Ga0070682_100073268 Ga0070682_1000732682 132
40 3300005337 Ga0070682_100151081 Ga0070682_1001510812 132
41 3300005338 Ga0068868_100014248 Ga0068868_1000142482 132
42 3300005338 Ga0068868_100354073 Ga0068868_1003540732 132
43 3300005339 Ga0070660_100062081 Ga0070660_1000620814 132
44 3300005339 Ga0070660_100265903 Ga0070660_1002659031 132
45 3300005339 Ga0070660_100587922 Ga0070660_1005879222 132
46 3300005339 Ga0070660_101004132 Ga0070660_1010041321 132
47 3300005341 Ga0070691_10086951 Ga0070691_100869512 132
48 3300005341 Ga0070691_10509905 Ga0070691_105099052 132
49 3300005344 Ga0070661_100014484 Ga0070661_1000144843 132
50 3300005344 Ga0070661_100462185 Ga0070661_1004621851 132
51 3300005344 Ga0070661_100611875 Ga0070661_1006118752 132
52 3300005347 Ga0070668_100024739 Ga0070668_1000247394 132
53 3300005347 Ga0070668_100191433 Ga0070668_1001914331 132
54 3300005347 Ga0070668_100288894 Ga0070668_1002888942 132
55 3300005347 Ga0070668_100819924 Ga0070668_1008199242 132
56 3300005347 Ga0070668_101286160 Ga0070668_1012861601 132
57 3300005354 Ga0070675_101004799 Ga0070675_1010047992 132
58 3300005355 Ga0070671_101279121 Ga0070671_1012791211 132
59 3300005356 Ga0070674_100047261 Ga0070674_1000472614 132
60 3300005356 Ga0070674_100940775 Ga0070674_1009407752 132
61 3300005364 Ga0070673_100285973 Ga0070673_1002859731 132
62 3300005365 Ga0070688_100121601 Ga0070688_1001216012 132
63 3300005365 Ga0070688_100484082 Ga0070688_1004840821 132
64 3300005365 Ga0070688_101100318 Ga0070688_1011003181 132
65 3300005366 Ga0070659_100368928 Ga0070659_1003689282 132
66 3300005366 Ga0070659_100503508 Ga0070659_1005035082 132
67 3300005366 Ga0070659_101753354 Ga0070659_1017533541 132
68 3300005367 Ga0070667_100435563 Ga0070667_1004355632 132
69 3300005367 Ga0070667_100731178 Ga0070667_1007311781 132
70 3300005367 Ga0070667_101284482 Ga0070667_1012844822 132
71 3300005406 Ga0070703_10231566 Ga0070703_102315662 132
72 3300005434 Ga0070709_10000102 Ga0070709_1000010211 132
73 3300005434 Ga0070709_10005140 Ga0070709_100051402 132
74 3300005434 Ga0070709_10195133 Ga0070709_101951331 132
75 3300005434 Ga0070709_10311965 Ga0070709_103119652 132
76 3300005434 Ga0070709_10492366 Ga0070709_104923662 132
77 3300005434 Ga0070709_10599692 Ga0070709_105996922 132
78 3300005434 Ga0070709_10706596 Ga0070709_107065962 132
79 3300005435 Ga0070714_100001753 Ga0070714_1000017539 132
80 3300005435 Ga0070714_100022895 Ga0070714_1000228953 132
81 3300005435 Ga0070714_100030514 Ga0070714_1000305146 132
82 3300005435 Ga0070714_100036394 Ga0070714_1000363942 132
83 3300005435 Ga0070714_100148831 Ga0070714_1001488313 132
84 3300005435 Ga0070714_100877368 Ga0070714_1008773681 132
85 3300005435 Ga0070714_101566761 Ga0070714_1015667611 132
86 3300005436 Ga0070713_100002970 Ga0070713_1000029703 132
87 3300005436 Ga0070713_100005921 Ga0070713_1000059214 132
88 3300005436 Ga0070713_100015544 Ga0070713_1000155443 132
89 3300005436 Ga0070713_100045016 Ga0070713_1000450163 132
90 3300005436 Ga0070713_100140491 Ga0070713_1001404913 132
91 3300005436 Ga0070713_100258975 Ga0070713_1002589752 132
92 3300005436 Ga0070713_100956802 Ga0070713_1009568022 132
93 3300005437 Ga0070710_10000526 Ga0070710_100005265 132
94 3300005437 Ga0070710_10019960 Ga0070710_100199602 132
95 3300005437 Ga0070710_10052085 Ga0070710_100520854 132
96 3300005437 Ga0070710_10202213 Ga0070710_102022132 132
97 3300005437 Ga0070710_10286858 Ga0070710_102868582 132
98 3300005438 Ga0070701_10369705 Ga0070701_103697052 132
99 3300005439 Ga0070711_100002160 Ga0070711_1000021608 132
100 3300005439 Ga0070711_100009157 Ga0070711_1000091573 132
101 3300005439 Ga0070711_100021560 Ga0070711_1000215603 132
102 3300005439 Ga0070711_100091166 Ga0070711_1000911662 132
103 3300005439 Ga0070711_100224437 Ga0070711_1002244372 132
104 3300005439 Ga0070711_100341792 Ga0070711_1003417922 132
105 3300005439 Ga0070711_100963038 Ga0070711_1009630382 132
106 3300005440 Ga0070705_100201702 Ga0070705_1002017022 132
107 3300005440 Ga0070705_100673025 Ga0070705_1006730252 132
108 3300005441 Ga0070700_100093566 Ga0070700_1000935662 132
109 3300005445 Ga0070708_100098711 Ga0070708_1000987112 132
110 3300005455 Ga0070663_100038273 Ga0070663_1000382732 132
111 3300005455 Ga0070663_100056577 Ga0070663_1000565772 132
112 3300005455 Ga0070663_100248007 Ga0070663_1002480072 132
113 3300005455 Ga0070663_100284375 Ga0070663_1002843752 132
114 3300005455 Ga0070663_100461541 Ga0070663_1004615412 132
115 3300005456 Ga0070678_100070698 Ga0070678_1000706984 132
116 3300005456 Ga0070678_100122013 Ga0070678_1001220133 132
117 3300005456 Ga0070678_101595481 Ga0070678_1015954811 132
118 3300005457 Ga0070662_100022874 Ga0070662_1000228744 132
119 3300005457 Ga0070662_100103986 Ga0070662_1001039862 132
120 3300005457 Ga0070662_100364458 Ga0070662_1003644582 132
121 3300005457 Ga0070662_100483133 Ga0070662_1004831332 132
122 3300005458 Ga0070681_10023500 Ga0070681_100235003 132
123 3300005458 Ga0070681_10032157 Ga0070681_100321574 132
124 3300005458 Ga0070681_10058028 Ga0070681_100580282 132
125 3300005458 Ga0070681_10084358 Ga0070681_100843584 132
126 3300005458 Ga0070681_10570220 Ga0070681_105702201 132
127 3300005458 Ga0070681_10845435 Ga0070681_108454352 132
128 3300005466 Ga0070685_10661708 Ga0070685_106617082 132
129 3300005467 Ga0070706_100500165 Ga0070706_1005001652 132
130 3300005467 Ga0070706_100777464 Ga0070706_1007774642 132
131 3300005468 Ga0070707_100062447 Ga0070707_1000624473 132
132 3300005468 Ga0070707_100183859 Ga0070707_1001838593 132
133 3300005468 Ga0070707_101990451 Ga0070707_1019904511 132
134 3300005471 Ga0070698_100220036 Ga0070698_1002200362 132
135 3300005518 Ga0070699_100501396 Ga0070699_1005013961 132
136 3300005518 Ga0070699_101198594 Ga0070699_1011985941 132
137 3300005530 Ga0070679_100013119 Ga0070679_1000131192 132
138 3300005530 Ga0070679_100026603 Ga0070679_1000266032 132
139 3300005530 Ga0070679_100069248 Ga0070679_1000692482 132
140 3300005530 Ga0070679_100104027 Ga0070679_1001040272 132
141 3300005530 Ga0070679_100135854 Ga0070679_1001358541 132
142 3300005530 Ga0070679_100536659 Ga0070679_1005366591 132
143 3300005530 Ga0070679_101205562 Ga0070679_1012055621 132
144 3300005535 Ga0070684_100013256 Ga0070684_1000132567 132
145 3300005535 Ga0070684_100024555 Ga0070684_1000245553 132
146 3300005535 Ga0070684_100326270 Ga0070684_1003262702 132
147 3300005536 Ga0070697_100091314 Ga0070697_1000913142 132
148 3300005536 Ga0070697_100446253 Ga0070697_1004462532 132
149 3300005539 Ga0068853_100010809 Ga0068853_1000108095 132
150 3300005539 Ga0068853_100015334 Ga0068853_1000153345 132
151 3300005539 Ga0068853_100751722 Ga0068853_1007517222 132
152 3300005539 Ga0068853_101244637 Ga0068853_1012446372 132
153 3300005539 Ga0068853_101941198 Ga0068853_1019411981 132
154 3300005543 Ga0070672_100264678 Ga0070672_1002646782 132
155 3300005543 Ga0070672_100435239 Ga0070672_1004352392 132
156 3300005543 Ga0070672_100674309 Ga0070672_1006743091 132
157 3300005544 Ga0070686_101525500 Ga0070686_1015255001 132
158 3300005545 Ga0070695_101049690 Ga0070695_1010496901 132
159 3300005547 Ga0070693_100149715 Ga0070693_1001497152 132
160 3300005548 Ga0070665_100067345 Ga0070665_1000673454 132
161 3300005548 Ga0070665_100232545 Ga0070665_1002325452 132
162 3300005548 Ga0070665_100633109 Ga0070665_1006331092 132
163 3300005548 Ga0070665_100752588 Ga0070665_1007525882 132
164 3300005548 Ga0070665_100803270 Ga0070665_1008032702 132
165 3300005549 Ga0070704_100975041 Ga0070704_1009750412 132
166 3300005563 Ga0068855_100013700 Ga0068855_1000137008 132
167 3300005563 Ga0068855_100014164 Ga0068855_1000141642 132
168 3300005563 Ga0068855_100033333 Ga0068855_1000333335 132
169 3300005563 Ga0068855_100221967 Ga0068855_1002219672 132
170 3300005563 Ga0068855_100750342 Ga0068855_1007503422 132
171 3300005563 Ga0068855_100850357 Ga0068855_1008503572 132
172 3300005563 Ga0068855_101088469 Ga0068855_1010884692 132
173 3300005563 Ga0068855_101123183 Ga0068855_1011231831 132
174 3300005563 Ga0068855_101554138 Ga0068855_1015541382 132
175 3300005563 Ga0068855_102398272 Ga0068855_1023982721 132
176 3300005564 Ga0070664_100662320 Ga0070664_1006623202 132
177 3300005577 Ga0068857_100004954 Ga0068857_1000049549 132
178 3300005577 Ga0068857_100025795 Ga0068857_1000257952 132
179 3300005577 Ga0068857_100038647 Ga0068857_1000386474 132
180 3300005577 Ga0068857_100153608 Ga0068857_1001536082 132
181 3300005577 Ga0068857_100838610 Ga0068857_1008386102 132
182 3300005577 Ga0068857_101369238 Ga0068857_1013692382 132
183 3300005578 Ga0068854_100026378 Ga0068854_1000263782 132
184 3300005578 Ga0068854_100631408 Ga0068854_1006314082 132
185 3300005614 Ga0068856_100000451 Ga0068856_10000045131 132
186 3300005614 Ga0068856_100000659 Ga0068856_10000065928 132
187 3300005614 Ga0068856_100012689 Ga0068856_1000126892 132
188 3300005614 Ga0068856_100521784 Ga0068856_1005217842 132
189 3300005614 Ga0068856_100884698 Ga0068856_1008846982 132
190 3300005614 Ga0068856_101305904 Ga0068856_1013059042 132
191 3300005615 Ga0070702_100124167 Ga0070702_1001241672 132
192 3300005615 Ga0070702_101135733 Ga0070702_1011357332 132
193 3300005616 Ga0068852_100071562 Ga0068852_1000715623 132
194 3300005616 Ga0068852_100139508 Ga0068852_1001395083 132
195 3300005616 Ga0068852_100268538 Ga0068852_1002685383 132
196 3300005616 Ga0068852_100427848 Ga0068852_1004278482 132
197 3300005616 Ga0068852_100507167 Ga0068852_1005071672 132
198 3300005616 Ga0068852_102437874 Ga0068852_1024378741 132
199 3300005617 Ga0068859_100420450 Ga0068859_1004204502 132
200 3300005617 Ga0068859_100737395 Ga0068859_1007373952 132
201 3300005618 Ga0068864_100027097 Ga0068864_1000270977 132
202 3300005618 Ga0068864_100289129 Ga0068864_1002891292 132
203 3300005618 Ga0068864_100708627 Ga0068864_1007086272 132
204 3300005718 Ga0068866_10212862 Ga0068866_102128622 132
205 3300005718 Ga0068866_10217413 Ga0068866_102174132 132
206 3300005719 Ga0068861_100202126 Ga0068861_1002021261 132
207 3300005719 Ga0068861_100588907 Ga0068861_1005889072 132
208 3300005834 Ga0068851_10044153 Ga0068851_100441532 132
209 3300005834 Ga0068851_10045043 Ga0068851_100450434 132
210 3300005834 Ga0068851_10057892 Ga0068851_100578922 132
211 3300005834 Ga0068851_10571996 Ga0068851_105719962 132
212 3300005841 Ga0068863_100592395 Ga0068863_1005923951 132
213 3300005842 Ga0068858_100084248 Ga0068858_1000842483 132
214 3300005842 Ga0068858_100196916 Ga0068858_1001969162 132
215 3300005842 Ga0068858_100428840 Ga0068858_1004288402 132
216 3300005842 Ga0068858_100638292 Ga0068858_1006382922 132
217 3300005843 Ga0068860_100008418 Ga0068860_1000084187 132
218 3300005843 Ga0068860_100360322 Ga0068860_1003603222 132
219 3300005843 Ga0068860_100677982 Ga0068860_1006779822 132
220 3300005844 Ga0068862_100158586 Ga0068862_1001585862 132
221 3300005844 Ga0068862_100174424 Ga0068862_1001744242 132
222 3300005844 Ga0068862_100325654 Ga0068862_1003256542 132
223 3300005844 Ga0068862_101177839 Ga0068862_1011778392 132
224 3300005937 Ga0081455_10003511 Ga0081455_1000351115 132
225 3300005937 Ga0081455_10007726 Ga0081455_100077269 132
226 3300005937 Ga0081455_10012558 Ga0081455_100125582 132
227 3300005937 Ga0081455_10021916 Ga0081455_100219164 132
228 3300005937 Ga0081455_10025903 Ga0081455_100259032 132
229 3300005937 Ga0081455_10037165 Ga0081455_100371657 132
230 3300005937 Ga0081455_10496219 Ga0081455_104962192 132
231 3300005981 Ga0081538_10016160 Ga0081538_100161606 132
232 3300005983 Ga0081540_1001538 Ga0081540_100153813 132
233 3300005983 Ga0081540_1002078 Ga0081540_100207816 132
234 3300005983 Ga0081540_1003660 Ga0081540_10036606 132
235 3300005983 Ga0081540_1008178 Ga0081540_10081786 132
236 3300005983 Ga0081540_1008898 Ga0081540_10088984 132
237 3300005983 Ga0081540_1014574 Ga0081540_10145746 132
238 3300005983 Ga0081540_1032957 Ga0081540_10329573 132
239 3300005983 Ga0081540_1086701 Ga0081540_10867011 132
240 3300005983 Ga0081540_1134711 Ga0081540_11347112 132
241 3300005983 Ga0081540_1305108 Ga0081540_13051082 132
242 3300005985 Ga0081539_10000080 Ga0081539_10000080195 132
243 3300005985 Ga0081539_10000498 Ga0081539_1000049828 132
244 3300005985 Ga0081539_10011910 Ga0081539_100119104 132
245 3300005985 Ga0081539_10028294 Ga0081539_100282944 132
246 3300005985 Ga0081539_10071100 Ga0081539_100711002 132
247 3300005985 Ga0081539_10194479 Ga0081539_101944792 132
248 3300006028 Ga0070717_10010508 Ga0070717_100105084 132
249 3300006028 Ga0070717_10018723 Ga0070717_100187232 132
250 3300006028 Ga0070717_10046983 Ga0070717_100469832 132
251 3300006028 Ga0070717_10053340 Ga0070717_100533404 132
252 3300006028 Ga0070717_10333654 Ga0070717_103336542 132
253 3300006028 Ga0070717_10445232 Ga0070717_104452322 132
254 3300006028 Ga0070717_11002044 Ga0070717_110020441 132
255 3300006038 Ga0075365_10021569 Ga0075365_100215694 132
256 3300006038 Ga0075365_10176696 Ga0075365_101766962 132
257 3300006038 Ga0075365_10379106 Ga0075365_103791062 132
258 3300006042 Ga0075368_10247084 Ga0075368_102470841 132
259 3300006048 Ga0075363_100357461 Ga0075363_1003574611 132
260 3300006048 Ga0075363_100497625 Ga0075363_1004976252 132
261 3300006173 Ga0070716_100001641 Ga0070716_1000016414 132
262 3300006173 Ga0070716_100002831 Ga0070716_1000028314 132
263 3300006173 Ga0070716_100665850 Ga0070716_1006658502 132
264 3300006173 Ga0070716_100844507 Ga0070716_1008445072 132
265 3300006173 Ga0070716_101609299 Ga0070716_1016092991 132
266 3300006175 Ga0070712_100026574 Ga0070712_1000265743 132
267 3300006175 Ga0070712_100153424 Ga0070712_1001534242 132
268 3300006175 Ga0070712_101414810 Ga0070712_1014148101 132
269 3300006177 Ga0075362_10187526 Ga0075362_101875262 132
270 3300006177 Ga0075362_10195509 Ga0075362_101955092 132
271 3300006178 Ga0075367_10023235 Ga0075367_100232354 132
272 3300006178 Ga0075367_10373781 Ga0075367_103737812 132
273 3300006178 Ga0075367_10437006 Ga0075367_104370062 132
274 3300006178 Ga0075367_10440525 Ga0075367_104405251 132
275 3300006195 Ga0075366_10165600 Ga0075366_101656002 132
276 3300006195 Ga0075366_10243110 Ga0075366_102431102 132
277 3300006195 Ga0075366_10837026 Ga0075366_108370262 132
278 3300006195 Ga0075366_10977563 Ga0075366_109775631 132
279 3300006237 Ga0097621_100061477 Ga0097621_1000614773 132
280 3300006237 Ga0097621_100196156 Ga0097621_1001961562 132
281 3300006237 Ga0097621_100205780 Ga0097621_1002057802 132
282 3300006237 Ga0097621_101842056 Ga0097621_1018420561 132
283 3300006237 Ga0097621_101889315 Ga0097621_1018893151 132
284 3300006353 Ga0075370_10362605 Ga0075370_103626051 132
285 3300006358 Ga0068871_100305229 Ga0068871_1003052293 132
286 3300006358 Ga0068871_100704021 Ga0068871_1007040212 132
287 3300006358 Ga0068871_100857972 Ga0068871_1008579722 132
288 3300006358 Ga0068871_100949221 Ga0068871_1009492212 132
289 3300006871 Ga0075434_100452156 Ga0075434_1004521562 132
290 3300006880 Ga0075429_100897583 Ga0075429_1008975831 132
291 3300006881 Ga0068865_100050924 Ga0068865_1000509242 132
292 3300006881 Ga0068865_100180232 Ga0068865_1001802322 132
293 3300006931 Ga0097620_100420422 Ga0097620_1004204222 132
294 3300006931 Ga0097620_100737365 Ga0097620_1007373651 132
295 3300006941 Ga0099825_1039359 Ga0099825_10393592 132
296 3300006942 Ga0099824_1006683 Ga0099824_10066837 132
297 3300006943 Ga0099822_1000418 Ga0099822_100041815 132
298 3300007076 Ga0075435_100724066 Ga0075435_1007240661 132
299 3300007265 Ga0099794_10029452 Ga0099794_100294524 132
300 3300007265 Ga0099794_10111805 Ga0099794_101118052 132
301 3300007265 Ga0099794_10128782 Ga0099794_101287822 132
302 3300007265 Ga0099794_10458609 Ga0099794_104586091 132
303 3300007265 Ga0099794_10474923 Ga0099794_104749231 132
304 3300007788 Ga0099795_10080174 Ga0099795_100801742 132
305 3300007788 Ga0099795_10096198 Ga0099795_100961981 132
306 3300007788 Ga0099795_10128064 Ga0099795_101280641 132
307 3300007788 Ga0099795_10308116 Ga0099795_103081162 132
308 3300007788 Ga0099795_10335215 Ga0099795_103352152 132
309 3300007788 Ga0099795_10385831 Ga0099795_103858312 132
310 3300009011 Ga0105251_10560716 Ga0105251_105607161 132
311 3300009036 Ga0105244_10421508 Ga0105244_104215082 132
312 3300009092 Ga0105250_10018383 Ga0105250_100183832 132
313 3300009093 Ga0105240_10010878 Ga0105240_100108785 132
314 3300009093 Ga0105240_10026626 Ga0105240_100266264 132
315 3300009093 Ga0105240_10097500 Ga0105240_100975004 132
316 3300009093 Ga0105240_10155163 Ga0105240_101551632 132
317 3300009093 Ga0105240_10236739 Ga0105240_102367392 132
318 3300009093 Ga0105240_10427922 Ga0105240_104279222 132
319 3300009093 Ga0105240_10608267 Ga0105240_106082672 132
320 3300009094 Ga0111539_10174814 Ga0111539_101748142 132
321 3300009094 Ga0111539_10439612 Ga0111539_104396122 132
322 3300009098 Ga0105245_10026065 Ga0105245_100260653 132
323 3300009098 Ga0105245_11121040 Ga0105245_111210402 132
324 3300009101 Ga0105247_10044664 Ga0105247_100446641 132
325 3300009101 Ga0105247_10144089 Ga0105247_101440893 132
326 3300009101 Ga0105247_10203570 Ga0105247_102035702 132
327 3300009101 Ga0105247_10867839 Ga0105247_108678391 132
328 3300009101 Ga0105247_11646848 Ga0105247_116468481 132
329 3300009148 Ga0105243_10059410 Ga0105243_100594104 132
330 3300009148 Ga0105243_10659051 Ga0105243_106590512 132
331 3300009174 Ga0105241_10000375 Ga0105241_100003755 132
332 3300009174 Ga0105241_10237331 Ga0105241_102373312 132
333 3300009174 Ga0105241_10565195 Ga0105241_105651951 132
334 3300009174 Ga0105241_11255179 Ga0105241_112551791 132
335 3300009176 Ga0105242_10093388 Ga0105242_100933883 132
336 3300009176 Ga0105242_10248578 Ga0105242_102485782 132
337 3300009176 Ga0105242_10381833 Ga0105242_103818332 132
338 3300009176 Ga0105242_10477824 Ga0105242_104778242 132
339 3300009176 Ga0105242_10791971 Ga0105242_107919712 132
340 3300009177 Ga0105248_10049495 Ga0105248_100494952 132
341 3300009545 Ga0105237_10006382 Ga0105237_100063825 132
342 3300009545 Ga0105237_10008299 Ga0105237_100082998 132
343 3300009545 Ga0105237_10024116 Ga0105237_100241164 132
344 3300009545 Ga0105237_10080055 Ga0105237_100800554 132
345 3300009545 Ga0105237_10101460 Ga0105237_101014604 132
346 3300009545 Ga0105237_10148579 Ga0105237_101485792 132
347 3300009545 Ga0105237_10211233 Ga0105237_102112332 132
348 3300009545 Ga0105237_10219117 Ga0105237_102191172 132
349 3300009545 Ga0105237_10251855 Ga0105237_102518552 132
350 3300009545 Ga0105237_10644966 Ga0105237_106449662 132
351 3300009545 Ga0105237_11559825 Ga0105237_115598251 132
352 3300009545 Ga0105237_11821153 Ga0105237_118211531 132
353 3300009551 Ga0105238_10000885 Ga0105238_1000088526 132
354 3300009551 Ga0105238_10005609 Ga0105238_1000560910 132
355 3300009551 Ga0105238_10006417 Ga0105238_100064176 132
356 3300009551 Ga0105238_10091024 Ga0105238_100910242 132
357 3300009551 Ga0105238_10620117 Ga0105238_106201171 132
358 3300009551 Ga0105238_10982261 Ga0105238_109822611 132
359 3300009551 Ga0105238_11066667 Ga0105238_110666672 132
360 3300009551 Ga0105238_11231957 Ga0105238_112319572 132
361 3300009551 Ga0105238_11351498 Ga0105238_113514981 132
362 3300009553 Ga0105249_10079454 Ga0105249_100794541 132
363 3300009553 Ga0105249_10682842 Ga0105249_106828422 132
364 3300009553 Ga0105249_11678457 Ga0105249_116784572 132
365 3300009553 Ga0105249_12466770 Ga0105249_124667701 132
366 3300010159 Ga0099796_10008097 Ga0099796_100080974 132
367 3300010159 Ga0099796_10127663 Ga0099796_101276632 132
368 3300010375 Ga0105239_10011070 Ga0105239_100110706 132
369 3300010375 Ga0105239_10020488 Ga0105239_100204888 132
370 3300010375 Ga0105239_10024299 Ga0105239_100242994 132
371 3300010375 Ga0105239_10132834 Ga0105239_101328342 132
372 3300010375 Ga0105239_10407574 Ga0105239_104075741 132
373 3300010375 Ga0105239_10537658 Ga0105239_105376582 132
374 3300010375 Ga0105239_10547699 Ga0105239_105476992 132
375 3300010375 Ga0105239_10573942 Ga0105239_105739422 132
376 3300010375 Ga0105239_10628018 Ga0105239_106280181 132
377 3300010375 Ga0105239_10686103 Ga0105239_106861032 132
378 3300011119 Ga0105246_10118216 Ga0105246_101182163 132
379 3300011119 Ga0105246_10512111 Ga0105246_105121112 132
380 3300011119 Ga0105246_10953329 Ga0105246_109533292 132
381 3300011119 Ga0105246_11725248 Ga0105246_117252481 132
382 3300012483 Ga0157337_1021823 Ga0157337_10218231 132
383 3300012515 Ga0157338_1069532 Ga0157338_10695321 132
384 3300013100 Ga0157373_10438767 Ga0157373_104387671 132
385 3300013102 Ga0157371_10080655 Ga0157371_100806552 132
386 3300013104 Ga0157370_10163226 Ga0157370_101632262 132
387 3300013104 Ga0157370_10231909 Ga0157370_102319092 132
388 3300013104 Ga0157370_10270046 Ga0157370_102700462 132
389 3300013104 Ga0157370_10441653 Ga0157370_104416532 132
390 3300013104 Ga0157370_11983552 Ga0157370_119835521 132
391 3300013105 Ga0157369_10003699 Ga0157369_1000369910 132
392 3300013105 Ga0157369_10011122 Ga0157369_100111227 132
393 3300013105 Ga0157369_10016823 Ga0157369_100168239 132
394 3300013105 Ga0157369_10685838 Ga0157369_106858382 132
395 3300013105 Ga0157369_10715551 Ga0157369_107155512 132
396 3300013296 Ga0157374_10071289 Ga0157374_100712893 132
397 3300013296 Ga0157374_10290805 Ga0157374_102908051 132
398 3300013296 Ga0157374_10581877 Ga0157374_105818772 132
399 3300013297 Ga0157378_10529471 Ga0157378_105294712 132
400 3300013297 Ga0157378_10808792 Ga0157378_108087922 132
401 3300013297 Ga0157378_11035404 Ga0157378_110354042 132
402 3300013297 Ga0157378_13056578 Ga0157378_130565781 132
403 3300013306 Ga0163162_10104898 Ga0163162_101048983 132
404 3300013306 Ga0163162_10132431 Ga0163162_101324315 132
405 3300013306 Ga0163162_10195168 Ga0163162_101951682 132
406 3300013306 Ga0163162_10355076 Ga0163162_103550762 132
407 3300013306 Ga0163162_13197226 Ga0163162_131972261 132
408 3300013307 Ga0157372_10371500 Ga0157372_103715002 132
409 3300013307 Ga0157372_10616929 Ga0157372_106169292 132
410 3300013307 Ga0157372_10662518 Ga0157372_106625181 132
411 3300013307 Ga0157372_10821001 Ga0157372_108210012 132
412 3300013307 Ga0157372_11039526 Ga0157372_110395261 132
413 3300013307 Ga0157372_11828009 Ga0157372_118280091 132
414 3300013308 Ga0157375_10078938 Ga0157375_100789386 132
415 3300013308 Ga0157375_10097357 Ga0157375_100973572 132
416 3300013308 Ga0157375_10123103 Ga0157375_101231032 132
417 3300013308 Ga0157375_12341988 Ga0157375_123419881 132
418 3300013308 Ga0157375_13145741 Ga0157375_131457411 132
419 3300014325 Ga0163163_10019375 Ga0163163_100193757 132
420 3300014325 Ga0163163_10140744 Ga0163163_101407443 132
421 3300014325 Ga0163163_10294331 Ga0163163_102943311 132
422 3300014325 Ga0163163_10522793 Ga0163163_105227932 132
423 3300014326 Ga0157380_10967694 Ga0157380_109676942 132
424 3300014326 Ga0157380_11005044 Ga0157380_110050442 132
425 3300014326 Ga0157380_12459464 Ga0157380_124594641 132
426 3300014497 Ga0182008_10151999 Ga0182008_101519992 132
427 3300014497 Ga0182008_10447148 Ga0182008_104471482 132
428 3300014968 Ga0157379_10072179 Ga0157379_100721792 132
429 3300014968 Ga0157379_10128607 Ga0157379_101286071 132
430 3300014968 Ga0157379_10309838 Ga0157379_103098382 132
431 3300014968 Ga0157379_10865094 Ga0157379_108650942 132
432 3300014969 Ga0157376_10264396 Ga0157376_102643962 132
433 3300014969 Ga0157376_11237193 Ga0157376_112371932 132
434 3300020070 Ga0206356_10824015 Ga0206356_108240152 132
435 3300020076 Ga0206355_1375172 Ga0206355_13751722 132
436 3300020080 Ga0206350_10271927 Ga0206350_102719272 132
437 3300020081 Ga0206354_10310108 Ga0206354_103101083 132
438 3300021358 Ga0213873_10086560 Ga0213873_100865602 132
439 3300021358 Ga0213873_10107998 Ga0213873_101079981 132
440 3300021377 Ga0213874_10110235 Ga0213874_101102352 132
441 3300021377 Ga0213874_10138265 Ga0213874_101382652 132
442 3300021384 Ga0213876_10018891 Ga0213876_100188913 132
443 3300021384 Ga0213876_10108795 Ga0213876_101087952 132
444 3300021384 Ga0213876_10118908 Ga0213876_101189081 132
445 3300021384 Ga0213876_10203730 Ga0213876_102037302 132
446 3300021384 Ga0213876_10701295 Ga0213876_107012951 132
447 3300021388 Ga0213875_10069234 Ga0213875_100692343 132
448 3300021441 Ga0213871_10008840 Ga0213871_100088402 132
449 3300021441 Ga0213871_10110776 Ga0213871_101107762 132
450 3300022467 Ga0224712_10110279 Ga0224712_101102792 132
451 3300025254 Ga0209148_1010916 Ga0209148_10109162 132
452 3300025261 Ga0209233_1006072 Ga0209233_10060724 132
453 3300025272 Ga0209455_1007118 Ga0209455_10071183 132
454 3300025272 Ga0209455_1014353 Ga0209455_10143532 132
455 3300025297 Ga0209758_1002215 Ga0209758_10022155 132
456 3300025297 Ga0209758_1032638 Ga0209758_10326383 132
457 3300025297 Ga0209758_1071592 Ga0209758_10715921 132
458 3300025315 Ga0207697_10027916 Ga0207697_100279162 132
459 3300025321 Ga0207656_10056016 Ga0207656_100560162 132
460 3300025321 Ga0207656_10072434 Ga0207656_100724342 132
461 3300025321 Ga0207656_10076710 Ga0207656_100767102 132
462 3300025711 Ga0207696_1032698 Ga0207696_10326981 132
463 3300025885 Ga0207653_10017200 Ga0207653_100172001 132
464 3300025898 Ga0207692_10000386 Ga0207692_100003866 132
465 3300025898 Ga0207692_10176207 Ga0207692_101762072 132
466 3300025898 Ga0207692_10370189 Ga0207692_103701892 132
467 3300025898 Ga0207692_10769614 Ga0207692_107696142 132
468 3300025899 Ga0207642_10090211 Ga0207642_100902112 132
469 3300025899 Ga0207642_10234165 Ga0207642_102341652 132
470 3300025900 Ga0207710_10043541 Ga0207710_100435413 132
471 3300025900 Ga0207710_10060054 Ga0207710_100600542 132
472 3300025900 Ga0207710_10199320 Ga0207710_101993202 132
473 3300025900 Ga0207710_10491124 Ga0207710_104911242 132
474 3300025901 Ga0207688_10013695 Ga0207688_100136952 132
475 3300025901 Ga0207688_10102252 Ga0207688_101022523 132
476 3300025901 Ga0207688_10364613 Ga0207688_103646132 132
477 3300025904 Ga0207647_10015721 Ga0207647_100157218 132
478 3300025904 Ga0207647_10251620 Ga0207647_102516202 132
479 3300025905 Ga0207685_10002099 Ga0207685_100020991 132
480 3300025906 Ga0207699_10000411 Ga0207699_1000041117 132
481 3300025906 Ga0207699_10003008 Ga0207699_100030082 132
482 3300025906 Ga0207699_10072963 Ga0207699_100729632 132
483 3300025906 Ga0207699_10243468 Ga0207699_102434682 132
484 3300025906 Ga0207699_10482407 Ga0207699_104824071 132
485 3300025906 Ga0207699_10615968 Ga0207699_106159682 132
486 3300025906 Ga0207699_10861262 Ga0207699_108612622 132
487 3300025907 Ga0207645_10600053 Ga0207645_106000532 132
488 3300025909 Ga0207705_10049208 Ga0207705_100492083 132
489 3300025909 Ga0207705_11462528 Ga0207705_114625281 132
490 3300025910 Ga0207684_10420975 Ga0207684_104209752 132
491 3300025910 Ga0207684_10689409 Ga0207684_106894092 132
492 3300025910 Ga0207684_10879702 Ga0207684_108797021 132
493 3300025911 Ga0207654_10000629 Ga0207654_1000062910 132
494 3300025911 Ga0207654_10061939 Ga0207654_100619392 132
495 3300025911 Ga0207654_10787675 Ga0207654_107876751 132
496 3300025911 Ga0207654_10853485 Ga0207654_108534851 132
497 3300025912 Ga0207707_10001473 Ga0207707_1000147316 132
498 3300025912 Ga0207707_10013690 Ga0207707_100136903 132
499 3300025912 Ga0207707_10015990 Ga0207707_100159906 132
500 3300025912 Ga0207707_10097004 Ga0207707_100970042 132
501 3300025912 Ga0207707_10118392 Ga0207707_101183922 132
502 3300025912 Ga0207707_10132231 Ga0207707_101322312 132
503 3300025912 Ga0207707_10154042 Ga0207707_101540423 132
504 3300025912 Ga0207707_10262126 Ga0207707_102621262 132
505 3300025913 Ga0207695_10001265 Ga0207695_1000126527 132
506 3300025913 Ga0207695_10039200 Ga0207695_100392009 132
507 3300025913 Ga0207695_10039689 Ga0207695_100396892 132
508 3300025913 Ga0207695_10149556 Ga0207695_101495563 132
509 3300025913 Ga0207695_10177166 Ga0207695_101771663 132
510 3300025913 Ga0207695_10226999 Ga0207695_102269993 132
511 3300025914 Ga0207671_10005731 Ga0207671_100057317 132
512 3300025914 Ga0207671_10015794 Ga0207671_100157944 132
513 3300025914 Ga0207671_10094235 Ga0207671_100942352 132
514 3300025914 Ga0207671_10101843 Ga0207671_101018432 132
515 3300025914 Ga0207671_10153115 Ga0207671_101531151 132
516 3300025914 Ga0207671_10194177 Ga0207671_101941772 132
517 3300025914 Ga0207671_10360592 Ga0207671_103605922 132
518 3300025914 Ga0207671_10418282 Ga0207671_104182822 132
519 3300025914 Ga0207671_10438451 Ga0207671_104384512 132
520 3300025914 Ga0207671_10656257 Ga0207671_106562572 132
521 3300025914 Ga0207671_11154680 Ga0207671_111546802 132
522 3300025914 Ga0207671_11180234 Ga0207671_111802341 132
523 3300025915 Ga0207693_10003644 Ga0207693_100036447 132
524 3300025915 Ga0207693_10039807 Ga0207693_100398074 132
525 3300025915 Ga0207693_10092044 Ga0207693_100920442 132
526 3300025916 Ga0207663_10000897 Ga0207663_100008975 132
527 3300025916 Ga0207663_10010802 Ga0207663_100108022 132
528 3300025916 Ga0207663_10053778 Ga0207663_100537783 132
529 3300025916 Ga0207663_10154973 Ga0207663_101549732 132
530 3300025916 Ga0207663_10171764 Ga0207663_101717642 132
531 3300025916 Ga0207663_10694508 Ga0207663_106945082 132
532 3300025917 Ga0207660_10003205 Ga0207660_100032058 132
533 3300025917 Ga0207660_10022034 Ga0207660_100220342 132
534 3300025917 Ga0207660_10158340 Ga0207660_101583402 132
535 3300025917 Ga0207660_10633529 Ga0207660_106335292 132
536 3300025919 Ga0207657_10011790 Ga0207657_100117906 132
537 3300025919 Ga0207657_10318372 Ga0207657_103183722 132
538 3300025919 Ga0207657_11231774 Ga0207657_112317741 132
539 3300025920 Ga0207649_10595718 Ga0207649_105957181 132
540 3300025921 Ga0207652_10006959 Ga0207652_100069597 132
541 3300025921 Ga0207652_10012754 Ga0207652_100127543 132
542 3300025921 Ga0207652_10038366 Ga0207652_100383663 132
543 3300025921 Ga0207652_10129055 Ga0207652_101290552 132
544 3300025921 Ga0207652_10325541 Ga0207652_103255412 132
545 3300025921 Ga0207652_11025320 Ga0207652_110253202 132
546 3300025922 Ga0207646_10077709 Ga0207646_100777093 132
547 3300025922 Ga0207646_11560447 Ga0207646_115604471 132
548 3300025923 Ga0207681_10050253 Ga0207681_100502533 132
549 3300025924 Ga0207694_10000082 Ga0207694_100000825 132
550 3300025924 Ga0207694_10025115 Ga0207694_100251153 132
551 3300025924 Ga0207694_10031933 Ga0207694_100319334 132
552 3300025924 Ga0207694_10032555 Ga0207694_100325554 132
553 3300025924 Ga0207694_10161959 Ga0207694_101619592 132
554 3300025924 Ga0207694_10706418 Ga0207694_107064181 132
555 3300025924 Ga0207694_11325223 Ga0207694_113252231 132
556 3300025924 Ga0207694_11390093 Ga0207694_113900931 132
557 3300025925 Ga0207650_10247985 Ga0207650_102479852 132
558 3300025927 Ga0207687_10029908 Ga0207687_100299083 132
559 3300025927 Ga0207687_10105185 Ga0207687_101051852 132
560 3300025927 Ga0207687_10918961 Ga0207687_109189612 132
561 3300025928 Ga0207700_10003087 Ga0207700_100030876 132
562 3300025928 Ga0207700_10006990 Ga0207700_100069905 132
563 3300025928 Ga0207700_10010852 Ga0207700_100108523 132
564 3300025928 Ga0207700_10011089 Ga0207700_100110893 132
565 3300025928 Ga0207700_10021835 Ga0207700_100218352 132
566 3300025928 Ga0207700_10029340 Ga0207700_100293403 132
567 3300025928 Ga0207700_10102684 Ga0207700_101026842 132
568 3300025928 Ga0207700_10613897 Ga0207700_106138972 132
569 3300025928 Ga0207700_10862135 Ga0207700_108621352 132
570 3300025929 Ga0207664_10004435 Ga0207664_100044355 132
571 3300025929 Ga0207664_10070887 Ga0207664_100708874 132
572 3300025929 Ga0207664_10271666 Ga0207664_102716661 132
573 3300025929 Ga0207664_10553805 Ga0207664_105538051 132
574 3300025929 Ga0207664_10705276 Ga0207664_107052762 132
575 3300025929 Ga0207664_11206854 Ga0207664_112068541 132
576 3300025932 Ga0207690_10945993 Ga0207690_109459932 132
577 3300025933 Ga0207706_10080562 Ga0207706_100805622 132
578 3300025933 Ga0207706_10098139 Ga0207706_100981394 132
579 3300025933 Ga0207706_10171143 Ga0207706_101711432 132
580 3300025933 Ga0207706_10460652 Ga0207706_104606522 132
581 3300025934 Ga0207686_10065126 Ga0207686_100651262 132
582 3300025934 Ga0207686_10675169 Ga0207686_106751691 132
583 3300025935 Ga0207709_10065212 Ga0207709_100652122 132
584 3300025935 Ga0207709_10471578 Ga0207709_104715782 132
585 3300025936 Ga0207670_10187476 Ga0207670_101874762 132
586 3300025936 Ga0207670_10771539 Ga0207670_107715392 132
587 3300025937 Ga0207669_10032231 Ga0207669_100322314 132
588 3300025937 Ga0207669_10579773 Ga0207669_105797732 132
589 3300025937 Ga0207669_10719273 Ga0207669_107192732 132
590 3300025938 Ga0207704_10330524 Ga0207704_103305242 132
591 3300025939 Ga0207665_10001244 Ga0207665_100012449 132
592 3300025939 Ga0207665_10003077 Ga0207665_100030779 132
593 3300025939 Ga0207665_10129259 Ga0207665_101292592 132
594 3300025939 Ga0207665_10287312 Ga0207665_102873122 132
595 3300025939 Ga0207665_10689963 Ga0207665_106899631 132
596 3300025940 Ga0207691_10273607 Ga0207691_102736072 132
597 3300025940 Ga0207691_10610493 Ga0207691_106104931 132
598 3300025941 Ga0207711_10468581 Ga0207711_104685812 132
599 3300025941 Ga0207711_10501381 Ga0207711_105013812 132
600 3300025944 Ga0207661_10003495 Ga0207661_100034956 132
601 3300025944 Ga0207661_10010884 Ga0207661_100108846 132
602 3300025944 Ga0207661_10100708 Ga0207661_101007081 132
603 3300025944 Ga0207661_10956302 Ga0207661_109563021 132
604 3300025945 Ga0207679_10461889 Ga0207679_104618892 132
605 3300025949 Ga0207667_10006677 Ga0207667_100066776 132
606 3300025949 Ga0207667_10008474 Ga0207667_1000847411 132
607 3300025949 Ga0207667_10009542 Ga0207667_100095427 132
608 3300025949 Ga0207667_10109324 Ga0207667_101093242 132
609 3300025949 Ga0207667_10120372 Ga0207667_101203723 132
610 3300025949 Ga0207667_10261496 Ga0207667_102614963 132
611 3300025949 Ga0207667_10324817 Ga0207667_103248172 132
612 3300025949 Ga0207667_10513264 Ga0207667_105132642 132
613 3300025949 Ga0207667_10557116 Ga0207667_105571162 132
614 3300025949 Ga0207667_10559959 Ga0207667_105599592 132
615 3300025949 Ga0207667_11554073 Ga0207667_115540731 132
616 3300025960 Ga0207651_10284249 Ga0207651_102842492 132
617 3300025960 Ga0207651_10297316 Ga0207651_102973162 132
618 3300025961 Ga0207712_10534468 Ga0207712_105344682 132
619 3300025961 Ga0207712_10654023 Ga0207712_106540232 132
620 3300025961 Ga0207712_11556679 Ga0207712_115566791 132
621 3300025972 Ga0207668_10062419 Ga0207668_100624192 132
622 3300025972 Ga0207668_10377764 Ga0207668_103777642 132
623 3300025972 Ga0207668_10405016 Ga0207668_104050163 132
624 3300025981 Ga0207640_10023703 Ga0207640_100237033 132
625 3300025981 Ga0207640_10956990 Ga0207640_109569901 132
626 3300025981 Ga0207640_11103959 Ga0207640_111039591 132
627 3300025986 Ga0207658_10453227 Ga0207658_104532272 132
628 3300025986 Ga0207658_10643294 Ga0207658_106432942 132
629 3300025986 Ga0207658_11865055 Ga0207658_118650551 132
630 3300026023 Ga0207677_10196330 Ga0207677_101963302 132
631 3300026023 Ga0207677_10323936 Ga0207677_103239362 132
632 3300026035 Ga0207703_10155612 Ga0207703_101556122 132
633 3300026035 Ga0207703_10201766 Ga0207703_102017662 132
634 3300026035 Ga0207703_10306009 Ga0207703_103060092 132
635 3300026035 Ga0207703_10401115 Ga0207703_104011152 132
636 3300026035 Ga0207703_11665711 Ga0207703_116657111 132
637 3300026035 Ga0207703_12296747 Ga0207703_122967471 132
638 3300026041 Ga0207639_10003792 Ga0207639_100037925 132
639 3300026041 Ga0207639_10171290 Ga0207639_101712903 132
640 3300026041 Ga0207639_10183444 Ga0207639_101834442 132
641 3300026041 Ga0207639_10443502 Ga0207639_104435021 132
642 3300026041 Ga0207639_10465134 Ga0207639_104651342 132
643 3300026041 Ga0207639_10651857 Ga0207639_106518571 132
644 3300026041 Ga0207639_11205679 Ga0207639_112056791 132
645 3300026041 Ga0207639_11437911 Ga0207639_114379111 132
646 3300026067 Ga0207678_10113995 Ga0207678_101139952 132
647 3300026067 Ga0207678_10200272 Ga0207678_102002722 132
648 3300026067 Ga0207678_10219791 Ga0207678_102197912 132
649 3300026067 Ga0207678_10322042 Ga0207678_103220422 132
650 3300026075 Ga0207708_10104541 Ga0207708_101045413 132
651 3300026075 Ga0207708_10175317 Ga0207708_101753172 132
652 3300026078 Ga0207702_10000002 Ga0207702_10000002415 132
653 3300026078 Ga0207702_10000478 Ga0207702_1000047831 132
654 3300026078 Ga0207702_10061546 Ga0207702_100615463 132
655 3300026078 Ga0207702_10195697 Ga0207702_101956972 132
656 3300026078 Ga0207702_10391416 Ga0207702_103914162 132
657 3300026078 Ga0207702_10990687 Ga0207702_109906872 132
658 3300026078 Ga0207702_11263645 Ga0207702_112636451 132
659 3300026088 Ga0207641_10896810 Ga0207641_108968102 132
660 3300026088 Ga0207641_11050143 Ga0207641_110501431 132
661 3300026089 Ga0207648_10021511 Ga0207648_100215112 132
662 3300026089 Ga0207648_10995497 Ga0207648_109954971 132
663 3300026095 Ga0207676_10089392 Ga0207676_100893922 132
664 3300026095 Ga0207676_10116170 Ga0207676_101161702 132
665 3300026095 Ga0207676_10849018 Ga0207676_108490182 132
666 3300026095 Ga0207676_12492721 Ga0207676_124927211 132
667 3300026116 Ga0207674_10007536 Ga0207674_100075369 132
668 3300026116 Ga0207674_10011165 Ga0207674_100111655 132
669 3300026116 Ga0207674_10028212 Ga0207674_100282123 132
670 3300026116 Ga0207674_10034482 Ga0207674_100344824 132
671 3300026116 Ga0207674_10103770 Ga0207674_101037702 132
672 3300026116 Ga0207674_10648307 Ga0207674_106483072 132
673 3300026118 Ga0207675_100404646 Ga0207675_1004046462 132
674 3300026118 Ga0207675_101322776 Ga0207675_1013227762 132
675 3300026121 Ga0207683_10104603 Ga0207683_101046031 132
676 3300026121 Ga0207683_10198179 Ga0207683_101981792 132
677 3300026121 Ga0207683_10365184 Ga0207683_103651842 132
678 3300026121 Ga0207683_10783150 Ga0207683_107831502 132
679 3300026121 Ga0207683_10960871 Ga0207683_109608712 132
680 3300026142 Ga0207698_10122325 Ga0207698_101223252 132
681 3300026142 Ga0207698_10225106 Ga0207698_102251062 132
682 3300026142 Ga0207698_10417946 Ga0207698_104179462 132
683 3300026142 Ga0207698_10505617 Ga0207698_105056173 132
684 3300026142 Ga0207698_10535508 Ga0207698_105355082 132
685 3300026142 Ga0207698_10777761 Ga0207698_107777612 132
686 3300026142 Ga0207698_10909777 Ga0207698_109097772 132
687 3300027357 Ga0209589_1000003 Ga0209589_1000003462 132
688 3300027361 Ga0209489_100003 Ga0209489_100003513 132
689 3300027363 Ga0209700_100003 Ga0209700_100003513 132
690 3300027512 Ga0209179_1033288 Ga0209179_10332882 132
691 3300027512 Ga0209179_1067049 Ga0209179_10670491 132
692 3300027512 Ga0209179_1089564 Ga0209179_10895642 132
693 3300027512 Ga0209179_1133571 Ga0209179_11335711 132
694 3300027671 Ga0209588_1023809 Ga0209588_10238093 132
695 3300027866 Ga0209813_10177077 Ga0209813_101770772 132
696 3300028379 Ga0268266_10162678 Ga0268266_101626782 132
697 3300028379 Ga0268266_10215025 Ga0268266_102150252 132
698 3300028379 Ga0268266_10264045 Ga0268266_102640452 132
699 3300028379 Ga0268266_10726009 Ga0268266_107260092 132
700 3300028379 Ga0268266_10744311 Ga0268266_107443112 132
701 3300028379 Ga0268266_11606005 Ga0268266_116060052 132
702 3300028379 Ga0268266_11809873 Ga0268266_118098732 132
703 3300028380 Ga0268265_10517250 Ga0268265_105172502 132
704 3300028380 Ga0268265_10587354 Ga0268265_105873542 132
705 3300028380 Ga0268265_10701635 Ga0268265_107016352 132
706 3300028381 Ga0268264_10000043 Ga0268264_10000043124 132
707 3300028381 Ga0268264_10497575 Ga0268264_104975751 132
708 3300028556 Ga0265337_1018947 Ga0265337_10189472 132
709 3300028563 Ga0265319_1012285 Ga0265319_10122852 132
710 3300028573 Ga0265334_10023180 Ga0265334_100231802 132
711 3300028573 Ga0265334_10086784 Ga0265334_100867841 132
712 3300028577 Ga0265318_10003124 Ga0265318_100031242 132
713 3300028653 Ga0265323_10001316 Ga0265323_100013165 132
714 3300028654 Ga0265322_10003976 Ga0265322_100039762 132
715 3300028666 Ga0265336_10000579 Ga0265336_1000057911 132
716 3300028786 Ga0307517_10215992 Ga0307517_102159921 132
717 3300028794 Ga0307515_10055010 Ga0307515_100550101 132
718 3300028800 Ga0265338_10001398 Ga0265338_1000139810 132
719 3300029957 Ga0265324_10010613 Ga0265324_100106132 132
720 3300030521 Ga0307511_10101511 Ga0307511_101015112 132
721 3300030521 Ga0307511_10119276 Ga0307511_101192762 132
722 3300030760 Ga0265762_1068277 Ga0265762_10682771 132
723 3300030763 Ga0265763_1017816 Ga0265763_10178161 132
724 3300030878 Ga0265770_1083041 Ga0265770_10830412 132
725 3300031235 Ga0265330_10021534 Ga0265330_100215342 132
726 3300031235 Ga0265330_10029380 Ga0265330_100293804 132
727 3300031238 Ga0265332_10043626 Ga0265332_100436263 132
728 3300031238 Ga0265332_10087499 Ga0265332_100874991 132
729 3300031241 Ga0265325_10029462 Ga0265325_100294624 132
730 3300031247 Ga0265340_10002366 Ga0265340_100023662 132
731 3300031249 Ga0265339_10009369 Ga0265339_100093695 132
732 3300031249 Ga0265339_10019907 Ga0265339_100199074 132
733 3300031249 Ga0265339_10119706 Ga0265339_101197062 132
734 3300031249 Ga0265339_10325624 Ga0265339_103256241 132
735 3300031249 Ga0265339_10539454 Ga0265339_105394541 132
736 3300031250 Ga0265331_10038825 Ga0265331_100388251 132
737 3300031250 Ga0265331_10112707 Ga0265331_101127072 132
738 3300031344 Ga0265316_10090463 Ga0265316_100904632 132
739 3300031344 Ga0265316_10182294 Ga0265316_101822941 132
740 3300031456 Ga0307513_10462563 Ga0307513_104625632 132
741 3300031456 Ga0307513_10547481 Ga0307513_105474812 132
742 3300031456 Ga0307513_11044200 Ga0307513_110442001 132
743 3300031507 Ga0307509_10224089 Ga0307509_102240893 132
744 3300031507 Ga0307509_10233876 Ga0307509_102338763 132
745 3300031507 Ga0307509_10264488 Ga0307509_102644882 132
746 3300031507 Ga0307509_10510776 Ga0307509_105107761 132
747 3300031507 Ga0307509_10744184 Ga0307509_107441841 132
748 3300031548 Ga0307408_100878894 Ga0307408_1008788941 132
749 3300031595 Ga0265313_10126662 Ga0265313_101266622 132
750 3300031595 Ga0265313_10284172 Ga0265313_102841721 132
751 3300031616 Ga0307508_10001059 Ga0307508_1000105918 132
752 3300031616 Ga0307508_10007228 Ga0307508_100072282 132
753 3300031616 Ga0307508_10060565 Ga0307508_100605652 132
754 3300031616 Ga0307508_10351820 Ga0307508_103518202 132
755 3300031711 Ga0265314_10008943 Ga0265314_100089433 132
756 3300031712 Ga0265342_10002731 Ga0265342_100027319 132
757 3300031712 Ga0265342_10031442 Ga0265342_100314425 132
758 3300031712 Ga0265342_10216379 Ga0265342_102163791 132
759 3300031730 Ga0307516_10015493 Ga0307516_100154938 132
760 3300031730 Ga0307516_10063699 Ga0307516_100636994 132
761 3300031730 Ga0307516_10096643 Ga0307516_100966432 132
762 3300031730 Ga0307516_10135644 Ga0307516_101356441 132
763 3300031730 Ga0307516_10145136 Ga0307516_101451363 132
764 3300031730 Ga0307516_10152987 Ga0307516_101529872 132
765 3300031730 Ga0307516_10176035 Ga0307516_101760352 132
766 3300031730 Ga0307516_10252540 Ga0307516_102525401 132
767 3300031730 Ga0307516_10547677 Ga0307516_105476772 132
768 3300031731 Ga0307405_10745487 Ga0307405_107454872 132
769 3300031901 Ga0307406_10829845 Ga0307406_108298452 132
770 3300031911 Ga0307412_10235492 Ga0307412_102354922 132
771 3300031995 Ga0307409_100308665 Ga0307409_1003086652 132
772 3300031995 Ga0307409_101601930 Ga0307409_1016019301 132
773 3300032002 Ga0307416_100901219 Ga0307416_1009012192 132
774 3300032002 Ga0307416_100987456 Ga0307416_1009874562 132
775 3300032004 Ga0307414_10389249 Ga0307414_103892491 132
776 3300032005 Ga0307411_11280264 Ga0307411_112802641 132
777 3300032126 Ga0307415_100980503 Ga0307415_1009805032 132
778 3300033179 Ga0307507_10088859 Ga0307507_100888593 132
779 3300033180 Ga0307510_10010241 Ga0307510_1001024110 132
780 3300033180 Ga0307510_10019329 Ga0307510_100193292 132
781 3300033180 Ga0307510_10109337 Ga0307510_101093372 132
782 3300033180 Ga0307510_10230706 Ga0307510_102307062 132
783 3300033180 Ga0307510_10340909 Ga0307510_103409092 132
784 3300033442 Ga0315911_1000001 Ga0315911_1000001268 132
785 3300033544 Ga0316215_1000526 Ga0316215_10005264 132
786 3300035083 Ga0373926_0003514 Ga0373926_0003514_15_428 132
787 3300035084 Ga0373928_0002944 Ga0373928_0002944_2238_2636 132
788 3300035085 Ga0373929_0198895 Ga0373929_0198895_26_424 132
789 3300035086 Ga0373934_0012801 Ga0373934_0012801_1456_1857 132
790 3300035086 Ga0373934_0018581 Ga0373934_0018581_1165_1563 132
791 3300035086 Ga0373934_0278486 Ga0373934_0278486_171_569 132
792 3300035088 Ga0373940_0114722 Ga0373940_0114722_27_425 132
793 3300035089 Ga0373944_0200611 Ga0373944_0200611_252_650 132
794 3300035090 Ga0373949_0310641 Ga0373949_0310641_83_481 132
795 3300035092 Ga0373952_0180603 Ga0373952_0180603_64_462 132
796 3300035111 Ga0373923_0001405 Ga0373923_0001405_1638_2036 132
797 3300035111 Ga0373923_0033984 Ga0373923_0033984_299_712 132
798 3300035112 Ga0373932_0113753 Ga0373932_0113753_81_479 132
799 3300035113 Ga0373936_0011153 Ga0373936_0011153_2837_3235 132
800 3300035113 Ga0373936_0014114 Ga0373936_0014114_82_480 132
801 3300035113 Ga0373936_0021286 Ga0373936_0021286_1450_1863 132
802 3300035113 Ga0373936_0255164 Ga0373936_0255164_364_771 132
803 3300035115 Ga0373941_0177706 Ga0373941_0177706_295_708 132
804 3300035117 Ga0373953_0001516 Ga0373953_0001516_6097_6495 132
805 3300035117 Ga0373953_0042708 Ga0373953_0042708_832_1245 132
806 3300035117 Ga0373953_0046928 Ga0373953_0046928_128_529 132
807 3300035117 Ga0373953_0135714 Ga0373953_0135714_483_896 132
808 3300035117 Ga0373953_0178273 Ga0373953_0178273_484_882 132
809 3300035117 Ga0373953_0267192 Ga0373953_0267192_33_431 132
810 3300035118 Ga0373954_0000132 Ga0373954_0000132_23634_24032 132
811 3300035118 Ga0373954_0012512 Ga0373954_0012512_2116_2529 132
812 3300035118 Ga0373954_0120546 Ga0373954_0120546_412_810 132
813 3300035118 Ga0373954_0165687 Ga0373954_0165687_519_962 132
814 3300035119 Ga0373956_0041475 Ga0373956_0041475_680_1078 132
815 3300035119 Ga0373956_0417455 Ga0373956_0417455_166_579 132
816 3300035120 Ga0373957_0000168 Ga0373957_0000168_5422_5820 132
817 3300035120 Ga0373957_0024164 Ga0373957_0024164_299_712 132
818 3300035120 Ga0373957_0115560 Ga0373957_0115560_353_754 132
819 3300035121 Ga0373960_0116131 Ga0373960_0116131_317_715 132
820 3300035121 Ga0373960_0347968 Ga0373960_0347968_93_491 132
821 3300035170 Ga0373943_0033585 Ga0373943_0033585_1564_1962 132
822 3300035170 Ga0373943_0053207 Ga0373943_0053207_1524_1937 132
823 3300035170 Ga0373943_0121474 Ga0373943_0121474_154_552 132
824 3300035170 Ga0373943_0407583 Ga0373943_0407583_93_491 132
825 3300035171 Ga0373946_0003228 Ga0373946_0003228_4277_4675 132
826 3300035171 Ga0373946_0074634 Ga0373946_0074634_900_1313 132
827 3300035171 Ga0373946_0078850 Ga0373946_0078850_36_434 132
828 3300035172 Ga0373955_0001612 Ga0373955_0001612_1562_1960 132
829 3300035172 Ga0373955_0007649 Ga0373955_0007649_1388_1789 132
830 3300035172 Ga0373955_0055600 Ga0373955_0055600_473_886 132
831 3300035172 Ga0373955_0304498 Ga0373955_0304498_292_735 132
832 3300035207 Ga0373942_0008063 Ga0373942_0008063_131_529 132
833 3300035242 Ga0373962_0303142 Ga0373962_0303142_27_425 132
834 3300035410 Ga0373924_0006263 Ga0373924_0006263_3199_3612 132
835 3300035410 Ga0373924_0017596 Ga0373924_0017596_26_424 132
836 3300035410 Ga0373924_0047743 Ga0373924_0047743_1087_1488 132
837 3300035410 Ga0373924_0203407 Ga0373924_0203407_437_835 132
838 3300035691 Ga0373931_0004299 Ga0373931_0004299_2789_3187 132
839 3300035691 Ga0373931_0063897 Ga0373931_0063897_1581_1979 132
840 3300035692 Ga0373935_0000435 Ga0373935_0000435_2314_2712 132
841 3300035692 Ga0373935_0019538 Ga0373935_0019538_2821_3222 132
842 3300035692 Ga0373935_0391622 Ga0373935_0391622_310_708 132
843 3300035692 Ga0373935_0585129 Ga0373935_0585129_207_605 132
844 3300035692 Ga0373935_0770135 Ga0373935_0770135_296_694 132
845 3300035695 Ga0373927_0002587 Ga0373927_0002587_10697_11095 132
846 3300035695 Ga0373927_0008673 Ga0373927_0008673_3422_3820 132
847 3300035695 Ga0373927_0010027 Ga0373927_0010027_1557_1955 132
848 3300035695 Ga0373927_0027124 Ga0373927_0027124_167_565 132
849 3300035695 Ga0373927_0106796 Ga0373927_0106796_730_1128 132
850 3300035695 Ga0373927_0462735 Ga0373927_0462735_137_550 132
851 3300035695 Ga0373927_0493178 Ga0373927_0493178_19_453 132
852 3300035695 Ga0373927_0575714 Ga0373927_0575714_97_504 132
853 3300035695 Ga0373927_0661197 Ga0373927_0661197_34_432 132
854 3300035695 Ga0373927_0832459 Ga0373927_0832459_111_509 132
855 3300035724 Ga0373933_0000243 Ga0373933_0000243_16761_17159 132
856 3300035724 Ga0373933_0069361 Ga0373933_0069361_840_1238 132
857 3300035724 Ga0373933_0218792 Ga0373933_0218792_514_957 132
858 3300035725 Ga0373947_0007586 Ga0373947_0007586_957_1370 132
859 3300035725 Ga0373947_0012060 Ga0373947_0012060_392_790 132
860 3300035725 Ga0373947_0024670 Ga0373947_0024670_1546_1944 132
861 3300035725 Ga0373947_0038731 Ga0373947_0038731_412_810 132
862 3300035725 Ga0373947_0186019 Ga0373947_0186019_735_1133 132
863 3300035725 Ga0373947_0355932 Ga0373947_0355932_215_613 132
864 3300035725 Ga0373947_0436874 Ga0373947_0436874_438_839 132
865 3300035725 Ga0373947_0608518 Ga0373947_0608518_17_415 132
866 3300035725 Ga0373947_1198408 Ga0373947_1198408_22_435 132
867 3300036401 Ga0373937_0039688 Ga0373937_0039688_3732_4130 132
868 3300036401 Ga0373937_0196956 Ga0373937_0196956_1292_1693 132
869 3300036401 Ga0373937_0244436 Ga0373937_0244436_797_1195 132
870 3300036401 Ga0373937_0667895 Ga0373937_0667895_338_751 132
871 3300036401 Ga0373937_0728048 Ga0373937_0728048_490_888 132
872 3300036534 Ga0310109_054355 Ga0310109_054355_74_490 132
873 3300037068 Ga0373925_0001774 Ga0373925_0001774_6114_6512 132
874 3300037068 Ga0373925_0045958 Ga0373925_0045958_1620_2018 132
875 3300037068 Ga0373925_0054102 Ga0373925_0054102_437_850 132
876 3300037068 Ga0373925_0067551 Ga0373925_0067551_1128_1526 132
877 3300037068 Ga0373925_0483407 Ga0373925_0483407_310_717 132
878 3300037068 Ga0373925_0593208 Ga0373925_0593208_439_837 132
879 3300037068 Ga0373925_0807177 Ga0373925_0807177_309_710 132
880 3300037068 Ga0373925_0943314 Ga0373925_0943314_30_443 132
881 3300037418 Ga0395900_0072533 Ga0395900_0072533_2943_3356 132
882 3300037418 Ga0395900_0809546 Ga0395900_0809546_57_455 132
883 3300037466 Ga0395898_1678239 Ga0395898_1678239_100_498 132
884 3300037471 Ga0395905_0022828 Ga0395905_0022828_4584_4982 132
885 3300037471 Ga0395905_1235047 Ga0395905_1235047_111_509 132
886 3300037853 Ga0436364_0235897 Ga0436364_0235897_1301_1714 132
887 3300037853 Ga0436364_0740920 Ga0436364_0740920_71_484 132
888 3300037853 Ga0436364_1140579 Ga0436364_1140579_2005_2418 132
889 3300038443 Ga0395901_0797843 Ga0395901_0797843_494_892 132
890 3300038443 Ga0395901_0997229 Ga0395901_0997229_175_573 132
891 3300039437 Ga0436365_0090210 Ga0436365_0090210_122_535 132
892 3300039437 Ga0436365_0136317 Ga0436365_0136317_742_1155 132
893 3300039437 Ga0436365_0186711 Ga0436365_0186711_2655_3053 132
894 3300039437 Ga0436365_0482256 Ga0436365_0482256_258_671 132
895 3300039437 Ga0436365_0948552 Ga0436365_0948552_85_483 132
896 3300039437 Ga0436365_0996952 Ga0436365_0996952_31_429 132
897 3300039437 Ga0436365_1250872 Ga0436365_1250872_603_1016 132
898 3300039437 Ga0436365_1444108 Ga0436365_1444108_356_769 132
899 3300039437 Ga0436365_1455192 Ga0436365_1455192_40_453 132
900 3300039438 Ga0436360_0485622 Ga0436360_0485622_1332_1745 132
901 3300039438 Ga0436360_0577390 Ga0436360_0577390_11_409 132
902 3300039438 Ga0436360_0979855 Ga0436360_0979855_307_723 132
903 3300039438 Ga0436360_1055908 Ga0436360_1055908_27_440 132
904 3300039438 Ga0436360_1355672 Ga0436360_1355672_655_1068 132
905 3300039447 Ga0436361_0350312 Ga0436361_0350312_577_990 132
906 3300039447 Ga0436361_0886899 Ga0436361_0886899_127_540 132
907 3300039447 Ga0436361_0915746 Ga0436361_0915746_118_531 132
908 3300039447 Ga0436361_0924062 Ga0436361_0924062_586_999 132
909 3300039447 Ga0436361_1001085 Ga0436361_1001085_837_1250 132
910 3300039447 Ga0436361_1175390 Ga0436361_1175390_229_627 132
911 3300039450 Ga0436363_1347498 Ga0436363_1347498_2832_3245 132
912 3300039453 Ga0436362_0377775 Ga0436362_0377775_1797_2195 132
913 3300039453 Ga0436362_0382758 Ga0436362_0382758_84_482 132
914 3300039453 Ga0436362_0610597 Ga0436362_0610597_81_494 132
915 3300039453 Ga0436362_1238292 Ga0436362_1238292_349_762 132
916 3300041413 Ga0439465_0103614 Ga0439465_0103614_428_826 132
917 3300041451 Ga0451791_1702097 Ga0451791_1702097_38_451 132
918 3300041452 Ga0451793_0207987 Ga0451793_0207987_840_1238 132
919 3300041453 Ga0451797_1118947 Ga0451797_1118947_259_657 132
920 3300041456 Ga0451795_0620610 Ga0451795_0620610_150_548 132
921 3300041458 Ga0451798_0117060 Ga0451798_0117060_172_570 132
922 3300041459 Ga0451800_1531708 Ga0451800_1531708_133_531 132
923 3300041460 Ga0451802_1867047 Ga0451802_1867047_20_418 132
924 3300041486 Ga0451807_0039385 Ga0451807_0039385_140_538 132
925 3300041486 Ga0451807_1920733 Ga0451807_1920733_192_590 132
926 3300041498 Ga0451841_1263376 Ga0451841_1263376_41_439 132
927 3300041507 Ga0451851_0996538 Ga0451851_0996538_34_432 132
928 3300041511 Ga0451855_0429867 Ga0451855_0429867_66_464 132
929 3300041512 Ga0451853_3357421 Ga0451853_3357421_150_548 132
930 3300041512 Ga0451853_3867451 Ga0451853_3867451_140_538 132
931 3300044684 Ga0466966_0094483 Ga0466966_0094483_1019_1432 132
932 3300044684 Ga0466966_0099429 Ga0466966_0099429_552_965 132
933 3300044693 Ga0466961_0898865 Ga0466961_0898865_15_428 132
934 3300044694 Ga0466963_0306964 Ga0466963_0306964_252_656 132
935 3300044694 Ga0466963_0362647 Ga0466963_0362647_77_490 132
936 3300044706 Ga0466964_0096969 Ga0466964_0096969_655_1053 132
937 3300044719 Ga0466971_0147944 Ga0466971_0147944_262_660 132
938 3300044735 Ga0466968_0284005 Ga0466968_0284005_369_782 132
939 3300044765 Ga0466970_0086575 Ga0466970_0086575_682_1095 132
940 3300044842 Ga0466957_0297805 Ga0466957_0297805_487_885 132
941 3300044842 Ga0466957_0407907 Ga0466957_0407907_13_426 132
942 3300044842 Ga0466957_1375010 Ga0466957_1375010_75_488 132
943 3300045049 Ga0466959_0011001 Ga0466959_0011001_5417_5830 132
944 3300045976 Ga0466967_0093443 Ga0466967_0093443_398_796 132
945 3300045976 Ga0466967_0139617 Ga0466967_0139617_1150_1554 132
946 3300045976 Ga0466967_0154900 Ga0466967_0154900_472_885 132
947 3300045976 Ga0466967_0272497 Ga0466967_0272497_952_1365 132
948 3300045976 Ga0466967_1731067 Ga0466967_1731067_194_607 132
949 3300045976 Ga0466967_2361388 Ga0466967_2361388_97_495 132
950 3300046452 Ga0495617_175702 Ga0495617_175702_96_494 132
951 3300046453 Ga0495627_162677 Ga0495627_162677_42_440 132
952 3300046454 Ga0495592_0000316 Ga0495592_0000316_778_1176 132
953 3300046454 Ga0495592_0047468 Ga0495592_0047468_444_842 132
954 3300046454 Ga0495592_0049440 Ga0495592_0049440_2325_2738 132
955 3300046454 Ga0495592_0181288 Ga0495592_0181288_906_1307 132
956 3300046455 Ga0495603_0001446 Ga0495603_0001446_12175_12573 132
957 3300046455 Ga0495603_0022841 Ga0495603_0022841_2852_3250 132
958 3300046455 Ga0495603_0048318 Ga0495603_0048318_1772_2170 132
959 3300046455 Ga0495603_0145569 Ga0495603_0145569_482_880 132
960 3300046455 Ga0495603_0195978 Ga0495603_0195978_445_843 132
961 3300046455 Ga0495603_0501199 Ga0495603_0501199_115_528 132
962 3300046459 Ga0495629_0000176 Ga0495629_0000176_51977_52375 132
963 3300046459 Ga0495629_0008069 Ga0495629_0008069_4425_4823 132
964 3300046459 Ga0495629_0115694 Ga0495629_0115694_1071_1469 132
965 3300046460 Ga0495638_0161606 Ga0495638_0161606_770_1168 132
966 3300046460 Ga0495638_0167148 Ga0495638_0167148_739_1137 132
967 3300046461 Ga0495641_0007242 Ga0495641_0007242_2158_2556 132
968 3300046461 Ga0495641_0246112 Ga0495641_0246112_104_502 132
969 3300046462 Ga0495651_0002336 Ga0495651_0002336_1533_1931 132
970 3300046462 Ga0495651_0034663 Ga0495651_0034663_141_554 132
971 3300046462 Ga0495651_0036289 Ga0495651_0036289_2342_2743 132
972 3300046462 Ga0495651_0133363 Ga0495651_0133363_1118_1516 132
973 3300046463 Ga0495653_0002333 Ga0495653_0002333_12716_13114 132
974 3300046463 Ga0495653_0048677 Ga0495653_0048677_2231_2632 132
975 3300046463 Ga0495653_0677016 Ga0495653_0677016_134_532 132
976 3300046471 Ga0495650_0114507 Ga0495650_0114507_169_567 132
977 3300046472 Ga0495580_0001310 Ga0495580_0001310_2534_2932 132
978 3300046472 Ga0495580_0026506 Ga0495580_0026506_2980_3393 132
979 3300046472 Ga0495580_0241022 Ga0495580_0241022_317_715 132
980 3300046472 Ga0495580_0433341 Ga0495580_0433341_345_743 132
981 3300046473 Ga0495582_0000545 Ga0495582_0000545_6312_6710 132
982 3300046473 Ga0495582_0019184 Ga0495582_0019184_379_777 132
983 3300046473 Ga0495582_0325338 Ga0495582_0325338_403_801 132
984 3300046474 Ga0495605_0328411 Ga0495605_0328411_89_487 132
985 3300046475 Ga0495639_0010592 Ga0495639_0010592_2195_2593 132
986 3300046475 Ga0495639_0089834 Ga0495639_0089834_533_931 132
987 3300046475 Ga0495639_0103776 Ga0495639_0103776_875_1288 132
988 3300046475 Ga0495639_0272352 Ga0495639_0272352_307_705 132
989 3300046476 Ga0495662_0003999 Ga0495662_0003999_148_546 132
990 3300046476 Ga0495662_0171896 Ga0495662_0171896_67_465 132
991 3300046477 Ga0495664_0016518 Ga0495664_0016518_1619_2020 132
992 3300046477 Ga0495664_0022116 Ga0495664_0022116_2126_2539 132
993 3300046477 Ga0495664_0112353 Ga0495664_0112353_247_645 132
994 3300046477 Ga0495664_0123109 Ga0495664_0123109_1100_1498 132
995 3300046477 Ga0495664_0140249 Ga0495664_0140249_272_685 132
996 3300046477 Ga0495664_0267503 Ga0495664_0267503_31_429 132
997 3300046477 Ga0495664_0761221 Ga0495664_0761221_28_441 132
998 3300046491 Ga0495584_0493114 Ga0495584_0493114_92_490 132
999 3300046492 Ga0495585_0035267 Ga0495585_0035267_2204_2602 132
1000 3300046492 Ga0495585_0180295 Ga0495585_0180295_429_827 132
1001 3300046492 Ga0495585_0279772 Ga0495585_0279772_413_811 132
1002 3300046499 Ga0495594_0000020 Ga0495594_0000020_77943_78341 132
1003 3300046499 Ga0495594_0087977 Ga0495594_0087977_271_669 132
1004 3300046499 Ga0495594_0249012 Ga0495594_0249012_591_989 132
1005 3300046499 Ga0495594_0313122 Ga0495594_0313122_335_733 132
1006 3300046499 Ga0495594_0511637 Ga0495594_0511637_13_447 132
1007 3300046499 Ga0495594_0536512 Ga0495594_0536512_130_528 132
1008 3300046506 Ga0495583_0212960 Ga0495583_0212960_333_731 132
1009 3300046507 Ga0495606_0003820 Ga0495606_0003820_775_1173 132
1010 3300046507 Ga0495606_0320351 Ga0495606_0320351_66_464 132
1011 3300046507 Ga0495606_0328870 Ga0495606_0328870_229_627 132
1012 3300046507 Ga0495606_0402991 Ga0495606_0402991_148_546 132
1013 3300046511 Ga0495608_0005003 Ga0495608_0005003_3837_4235 132
1014 3300046511 Ga0495608_0076801 Ga0495608_0076801_317_718 132
1015 3300046512 Ga0495610_0070605 Ga0495610_0070605_772_1170 132
1016 3300046512 Ga0495610_0181975 Ga0495610_0181975_410_808 132
1017 3300046513 Ga0495616_0060187 Ga0495616_0060187_532_930 132
1018 3300046514 Ga0495618_0078963 Ga0495618_0078963_821_1222 132
1019 3300046514 Ga0495618_0125439 Ga0495618_0125439_1138_1536 132
1020 3300046514 Ga0495618_0174603 Ga0495618_0174603_376_789 132
1021 3300046514 Ga0495618_0324373 Ga0495618_0324373_306_704 132
1022 3300046515 Ga0495620_0251452 Ga0495620_0251452_64_462 132
1023 3300046515 Ga0495620_0256667 Ga0495620_0256667_37_435 132
1024 3300046516 Ga0495628_0010144 Ga0495628_0010144_3582_3980 132
1025 3300046516 Ga0495628_0058137 Ga0495628_0058137_918_1319 132
1026 3300046516 Ga0495628_0075750 Ga0495628_0075750_281_694 132
1027 3300046516 Ga0495628_1190507 Ga0495628_1190507_108_506 132
1028 3300046517 Ga0495630_0044087 Ga0495630_0044087_2735_3148 132
1029 3300046517 Ga0495630_0274763 Ga0495630_0274763_820_1221 132
1030 3300046517 Ga0495630_0904493 Ga0495630_0904493_193_591 132
1031 3300046517 Ga0495630_1100710 Ga0495630_1100710_61_459 132
1032 3300046518 Ga0495631_0025372 Ga0495631_0025372_1864_2262 132
1033 3300046518 Ga0495631_0162612 Ga0495631_0162612_346_744 132
1034 3300046518 Ga0495631_0363391 Ga0495631_0363391_121_519 132
1035 3300046519 Ga0495632_0138676 Ga0495632_0138676_54_452 132
1036 3300046519 Ga0495632_0150187 Ga0495632_0150187_444_842 132
1037 3300046519 Ga0495632_0296297 Ga0495632_0296297_293_691 132
1038 3300046520 Ga0495637_0336925 Ga0495637_0336925_22_420 132
1039 3300046523 Ga0495644_0078643 Ga0495644_0078643_266_664 132
1040 3300046523 Ga0495644_0318893 Ga0495644_0318893_23_421 132
1041 3300046523 Ga0495644_0430845 Ga0495644_0430845_71_469 132
1042 3300046524 Ga0495648_0028869 Ga0495648_0028869_2906_3304 132
1043 3300046524 Ga0495648_0093578 Ga0495648_0093578_1170_1568 132
1044 3300046526 Ga0495666_0010941 Ga0495666_0010941_2749_3147 132
1045 3300046529 Ga0495652_0004857 Ga0495652_0004857_10823_11221 132
1046 3300046529 Ga0495652_0047989 Ga0495652_0047989_2240_2641 132
1047 3300046529 Ga0495652_0355006 Ga0495652_0355006_586_984 132
1048 3300046529 Ga0495652_0979629 Ga0495652_0979629_90_488 132
1049 3300046530 Ga0495654_0090172 Ga0495654_0090172_431_829 132
1050 3300046531 Ga0495665_0000170 Ga0495665_0000170_2195_2593 132
1051 3300046531 Ga0495665_0137466 Ga0495665_0137466_66_479 132
1052 3300046533 Ga0495640_0002547 Ga0495640_0002547_11836_12234 132
1053 3300046533 Ga0495640_0010374 Ga0495640_0010374_6485_6886 132
1054 3300046533 Ga0495640_0094459 Ga0495640_0094459_1532_1930 132
1055 3300046533 Ga0495640_0593690 Ga0495640_0593690_156_554 132
1056 3300046533 Ga0495640_0856612 Ga0495640_0856612_33_431 132
1057 3300046536 Ga0495587_0001071 Ga0495587_0001071_5252_5650 132
1058 3300046536 Ga0495587_0031364 Ga0495587_0031364_705_1106 132
1059 3300046536 Ga0495587_0602018 Ga0495587_0602018_165_563 132
1060 3300046537 Ga0495598_0013908 Ga0495598_0013908_1591_1989 132
1061 3300046538 Ga0495609_0309606 Ga0495609_0309606_190_588 132
1062 3300046538 Ga0495609_0427873 Ga0495609_0427873_109_507 132
1063 3300046539 Ga0495621_0043795 Ga0495621_0043795_222_620 132
1064 3300046543 Ga0495645_0003790 Ga0495645_0003790_1306_1719 132
1065 3300046543 Ga0495645_0011662 Ga0495645_0011662_5293_5691 132
1066 3300046557 Ga0495622_0002079 Ga0495622_0002079_2581_2979 132
1067 3300046557 Ga0495622_0028006 Ga0495622_0028006_738_1136 132
1068 3300046557 Ga0495622_0229126 Ga0495622_0229126_373_771 132
1069 3300046559 Ga0495667_0007097 Ga0495667_0007097_1949_2347 132
1070 3300046559 Ga0495667_0046148 Ga0495667_0046148_552_965 132
1071 3300046559 Ga0495667_0558964 Ga0495667_0558964_264_665 132
1072 3300046615 Ga0495656_0050030 Ga0495656_0050030_1144_1542 132
1073 3300046615 Ga0495656_0114997 Ga0495656_0114997_801_1199 132
1074 3300046616 Ga0495668_0041329 Ga0495668_0041329_1724_2122 132
1075 3300046616 Ga0495668_0250745 Ga0495668_0250745_186_584 132
1076 3300046616 Ga0495668_0304781 Ga0495668_0304781_287_685 132
1077 3300046616 Ga0495668_0439123 Ga0495668_0439123_204_602 132
1078 3300046642 Ga0495634_0000998 Ga0495634_0000998_3911_4309 132
1079 3300046642 Ga0495634_0019197 Ga0495634_0019197_1471_1884 132
1080 3300046642 Ga0495634_0111197 Ga0495634_0111197_175_573 132
1081 3300046642 Ga0495634_0402870 Ga0495634_0402870_84_485 132
1082 3300046648 Ga0495611_0040906 Ga0495611_0040906_184_582 132
1083 3300046648 Ga0495611_0379933 Ga0495611_0379933_48_446 132
1084 3300046660 Ga0495625_0260674 Ga0495625_0260674_421_819 132
1085 3300046660 Ga0495625_0400839 Ga0495625_0400839_416_814 132
1086 3300046663 Ga0495635_0000040 Ga0495635_0000040_12422_12820 132
1087 3300046663 Ga0495635_0030879 Ga0495635_0030879_604_1002 132
1088 3300046663 Ga0495635_0084818 Ga0495635_0084818_463_864 132
1089 3300046663 Ga0495635_0177498 Ga0495635_0177498_921_1319 132
1090 3300046664 Ga0495659_0031086 Ga0495659_0031086_945_1343 132
1091 3300046664 Ga0495659_0049398 Ga0495659_0049398_953_1351 132
1092 3300046665 Ga0495661_0108816 Ga0495661_0108816_540_938 132
1093 3300046674 Ga0495588_0010035 Ga0495588_0010035_3915_4313 132
1094 3300046674 Ga0495588_0063546 Ga0495588_0063546_1377_1775 132
1095 3300046674 Ga0495588_0257880 Ga0495588_0257880_507_905 132
1096 3300046675 Ga0495657_0000218 Ga0495657_0000218_38642_39040 132
1097 3300046675 Ga0495657_0204325 Ga0495657_0204325_382_795 132
1098 3300046675 Ga0495657_0460422 Ga0495657_0460422_77_475 132
1099 3300046675 Ga0495657_0640031 Ga0495657_0640031_43_441 132
1100 3300046678 Ga0495599_0000256 Ga0495599_0000256_8459_8857 132
1101 3300046678 Ga0495599_0044271 Ga0495599_0044271_734_1147 132
1102 3300046678 Ga0495599_0049469 Ga0495599_0049469_222_620 132
1103 3300046678 Ga0495599_0097164 Ga0495599_0097164_181_582 132
1104 3300046679 Ga0495623_0013540 Ga0495623_0013540_1141_1542 132
1105 3300046679 Ga0495623_0085754 Ga0495623_0085754_417_815 132
1106 3300046679 Ga0495623_0422695 Ga0495623_0422695_213_611 132
1107 3300046679 Ga0495623_0597224 Ga0495623_0597224_101_499 132
1108 3300046680 Ga0495646_0003573 Ga0495646_0003573_2927_3325 132
1109 3300046680 Ga0495646_0083110 Ga0495646_0083110_584_985 132
1110 3300046680 Ga0495646_0534592 Ga0495646_0534592_180_578 132
1111 3300046681 Ga0495647_0001303 Ga0495647_0001303_2135_2533 132
1112 3300046681 Ga0495647_0065497 Ga0495647_0065497_21_434 132
1113 3300046681 Ga0495647_0128312 Ga0495647_0128312_188_586 132
1114 3300046681 Ga0495647_0218145 Ga0495647_0218145_429_827 132
1115 3300046683 Ga0495658_0002344 Ga0495658_0002344_2953_3351 132
1116 3300046684 Ga0495669_0004164 Ga0495669_0004164_4442_4840 132
1117 3300046684 Ga0495669_0052804 Ga0495669_0052804_426_824 132
1118 3300046684 Ga0495669_0101358 Ga0495669_0101358_100_498 132
1119 3300046684 Ga0495669_0210326 Ga0495669_0210326_323_721 132
1120 3300046684 Ga0495669_0274305 Ga0495669_0274305_340_738 132
1121 3300046684 Ga0495669_0393434 Ga0495669_0393434_52_450 132
1122 3300046689 Ga0495613_0017244 Ga0495613_0017244_675_1073 132
1123 3300046689 Ga0495613_0148878 Ga0495613_0148878_798_1196 132
1124 3300046689 Ga0495613_0276398 Ga0495613_0276398_105_503 132
1125 3300046689 Ga0495613_0759863 Ga0495613_0759863_40_474 132
1126 3300046690 Ga0495624_0009089 Ga0495624_0009089_3866_4264 132
1127 3300046690 Ga0495624_0037826 Ga0495624_0037826_371_784 132
1128 3300046690 Ga0495624_0295698 Ga0495624_0295698_87_488 132
1129 3300046690 Ga0495624_0523356 Ga0495624_0523356_25_423 132
1130 3300046691 Ga0495670_0082771 Ga0495670_0082771_554_952 132
1131 3300046691 Ga0495670_0170470 Ga0495670_0170470_265_663 132
1132 3300046692 Ga0495671_0074187 Ga0495671_0074187_341_739 132
1133 3300046692 Ga0495671_0153623 Ga0495671_0153623_40_438 132
1134 3300046694 Ga0495649_0276088 Ga0495649_0276088_60_458 132
1135 3300046794 Ga0495589_0243042 Ga0495589_0243042_354_752 132
1136 3300046794 Ga0495589_0381400 Ga0495589_0381400_238_636 132
1137 3300046809 Ga0495600_0000541 Ga0495600_0000541_9046_9444 132
1138 3300046809 Ga0495600_0067787 Ga0495600_0067787_274_672 132
1139 3300046809 Ga0495600_0086718 Ga0495600_0086718_312_713 132
1140 3300047315 Ga0495581_0003140 Ga0495581_0003140_2195_2593 132
1141 3300047315 Ga0495581_0023393 Ga0495581_0023393_2541_2954 132
1142 3300047315 Ga0495581_0061621 Ga0495581_0061621_1482_1916 132
1143 3300047315 Ga0495581_0066144 Ga0495581_0066144_11_409 132
1144 3300047315 Ga0495581_0623858 Ga0495581_0623858_113_511 132
1145 3300047317 Ga0495604_0001811 Ga0495604_0001811_10659_11057 132
1146 3300047317 Ga0495604_0343396 Ga0495604_0343396_389_802 132
1147 3300047317 Ga0495604_0402588 Ga0495604_0402588_74_472 132
1148 3300047317 Ga0495604_0521387 Ga0495604_0521387_228_626 132
1149 3300047317 Ga0495604_0594829 Ga0495604_0594829_282_680 132
1150 3300047318 Ga0495636_0464653 Ga0495636_0464653_108_506 132
1151 3300047319 Ga0495674_0000600 Ga0495674_0000600_7400_7798 132
1152 3300047319 Ga0495674_0077886 Ga0495674_0077886_95_508 132
1153 3300047319 Ga0495674_0634500 Ga0495674_0634500_256_657 132
1154 3300047319 Ga0495674_0750856 Ga0495674_0750856_145_543 132
1155 3300047320 Ga0495672_0007934 Ga0495672_0007934_5765_6163 132
1156 3300047320 Ga0495672_0200728 Ga0495672_0200728_364_762 132
1157 3300047320 Ga0495672_0260818 Ga0495672_0260818_378_776 132
1158 3300047321 Ga0495676_0037688 Ga0495676_0037688_458_856 132
1159 3300047321 Ga0495676_0046483 Ga0495676_0046483_241_639 132
1160 3300047321 Ga0495676_0049266 Ga0495676_0049266_1435_1833 132
1161 3300047321 Ga0495676_0320194 Ga0495676_0320194_209_622 132
1162 3300047322 Ga0495680_0011919 Ga0495680_0011919_3860_4258 132
1163 3300047322 Ga0495680_0059137 Ga0495680_0059137_42_440 132
1164 3300047322 Ga0495680_0080401 Ga0495680_0080401_1292_1693 132
1165 3300047322 Ga0495680_0396202 Ga0495680_0396202_520_933 132
1166 3300047322 Ga0495680_0433135 Ga0495680_0433135_173_571 132
1167 3300047322 Ga0495680_0501396 Ga0495680_0501396_316_714 132
1168 3300047323 Ga0495683_0058376 Ga0495683_0058376_1508_1906 132
1169 3300047323 Ga0495683_0088393 Ga0495683_0088393_380_778 132
1170 3300047323 Ga0495683_0158602 Ga0495683_0158602_201_599 132
1171 3300047444 Ga0495675_0055004 Ga0495675_0055004_1048_1449 132
1172 3300047445 Ga0495677_0123238 Ga0495677_0123238_502_900 132
1173 3300047445 Ga0495677_0362708 Ga0495677_0362708_100_498 132
1174 3300047446 Ga0495679_050073 Ga0495679_050073_577_975 132
1175 3300047447 Ga0495685_282846 Ga0495685_282846_53_451 132
1176 3300047469 Ga0495673_0064876 Ga0495673_0064876_1023_1421 132
1177 3300047469 Ga0495673_0091021 Ga0495673_0091021_94_492 132
1178 3300047469 Ga0495673_0260515 Ga0495673_0260515_192_590 132
1179 3300047471 Ga0495684_0000023 Ga0495684_0000023_39452_39850 132
1180 3300047471 Ga0495684_0035362 Ga0495684_0035362_210_623 132
1181 3300047471 Ga0495684_0041506 Ga0495684_0041506_589_987 132
1182 3300047673 Ga0495593_0003332 Ga0495593_0003332_2584_2982 132
1183 3300047673 Ga0495593_0005773 Ga0495593_0005773_3199_3597 132
1184 3300047673 Ga0495593_0086730 Ga0495593_0086730_187_600 132
1185 3300048088 Ga0495602_0008270 Ga0495602_0008270_4396_4794 132
1186 3300048088 Ga0495602_0079174 Ga0495602_0079174_1619_2020 132
1187 3300048088 Ga0495602_0222208 Ga0495602_0222208_844_1257 132
1188 3300048088 Ga0495602_0480250 Ga0495602_0480250_14_412 132
1189 3300048089 Ga0495614_0513275 Ga0495614_0513275_118_516 132
1190 3300048903 Ga0496100_0005982 Ga0496100_0005982_4876_5274 132
1191 3300048903 Ga0496100_0162736 Ga0496100_0162736_438_866 132
1192 3300048903 Ga0496100_0386942 Ga0496100_0386942_544_942 132
1193 3300048904 Ga0496101_0025777 Ga0496101_0025777_1290_1688 132
1194 3300048904 Ga0496101_0038511 Ga0496101_0038511_1693_2091 132
1195 3300048904 Ga0496101_0224261 Ga0496101_0224261_494_892 132
1196 3300048904 Ga0496101_0637589 Ga0496101_0637589_304_717 132
1197 3300048905 Ga0496102_0008125 Ga0496102_0008125_1595_1993 132
1198 3300048905 Ga0496102_0156905 Ga0496102_0156905_1185_1583 132
1199 3300048905 Ga0496102_0275430 Ga0496102_0275430_102_500 132
1200 3300048905 Ga0496102_0311979 Ga0496102_0311979_644_1072 132
1201 3300048905 Ga0496102_0558399 Ga0496102_0558399_97_495 132
1202 3300048906 Ga0496103_0042708 Ga0496103_0042708_1560_1958 132
1203 3300048906 Ga0496103_0126537 Ga0496103_0126537_944_1342 132
1204 3300048907 Ga0496104_0020842 Ga0496104_0020842_2126_2524 132
1205 3300048907 Ga0496104_0029258 Ga0496104_0029258_1462_1890 132
1206 3300048907 Ga0496104_0075547 Ga0496104_0075547_2595_2993 132
1207 3300048907 Ga0496104_0370557 Ga0496104_0370557_545_958 132
1208 3300048907 Ga0496104_0393197 Ga0496104_0393197_830_1228 132
1209 3300048908 Ga0496105_0008473 Ga0496105_0008473_2530_2928 132
1210 3300048908 Ga0496105_0054973 Ga0496105_0054973_2640_3038 132
1211 3300048908 Ga0496105_0255995 Ga0496105_0255995_732_1160 132
1212 3300048908 Ga0496105_0275710 Ga0496105_0275710_550_948 132
1213 3300048908 Ga0496105_0320305 Ga0496105_0320305_50_448 132
1214 3300048908 Ga0496105_0805733 Ga0496105_0805733_217_615 132
1215 3300048909 Ga0496106_0008202 Ga0496106_0008202_715_1113 132
1216 3300048909 Ga0496106_0041693 Ga0496106_0041693_1823_2221 132
1217 3300048909 Ga0496106_0046901 Ga0496106_0046901_2017_2415 132
1218 3300048909 Ga0496106_0050608 Ga0496106_0050608_845_1243 132
1219 3300048909 Ga0496106_0061464 Ga0496106_0061464_209_637 132
1220 3300048909 Ga0496106_0075215 Ga0496106_0075215_1568_1966 132
1221 3300048909 Ga0496106_1198276 Ga0496106_1198276_22_435 132
1222 3300048910 Ga0496107_0022899 Ga0496107_0022899_2794_3192 132
1223 3300048910 Ga0496107_0035705 Ga0496107_0035705_1137_1535 132
1224 3300048910 Ga0496107_0065602 Ga0496107_0065602_1930_2328 132
1225 3300048910 Ga0496107_0168783 Ga0496107_0168783_802_1200 132
1226 3300048910 Ga0496107_0176583 Ga0496107_0176583_453_851 132
1227 3300048910 Ga0496107_0216401 Ga0496107_0216401_701_1099 132
1228 3300048910 Ga0496107_0612891 Ga0496107_0612891_97_495 132
1229 3300048910 Ga0496107_0636235 Ga0496107_0636235_80_508 132
1230 3300048911 Ga0496108_0003213 Ga0496108_0003213_6657_7055 132
1231 3300048911 Ga0496108_0010940 Ga0496108_0010940_235_633 132
1232 3300048911 Ga0496108_0012155 Ga0496108_0012155_5901_6299 132
1233 3300048911 Ga0496108_0039596 Ga0496108_0039596_1396_1794 132
1234 3300048911 Ga0496108_0053217 Ga0496108_0053217_2706_3134 132
1235 3300048911 Ga0496108_1352100 Ga0496108_1352100_172_570 132
1236 3300048912 Ga0496109_0002585 Ga0496109_0002585_7483_7881 132
1237 3300048912 Ga0496109_0016135 Ga0496109_0016135_5042_5440 132
1238 3300048912 Ga0496109_0025566 Ga0496109_0025566_4445_4873 132
1239 3300048912 Ga0496109_0260761 Ga0496109_0260761_923_1321 132
1240 3300048912 Ga0496109_0507382 Ga0496109_0507382_175_573 132
1241 3300048912 Ga0496109_1310615 Ga0496109_1310615_105_503 132
1242 3300048913 Ga0496110_0005094 Ga0496110_0005094_5902_6330 132
1243 3300048913 Ga0496110_0009693 Ga0496110_0009693_1474_1872 132
1244 3300048913 Ga0496110_0011502 Ga0496110_0011502_4348_4746 132
1245 3300048913 Ga0496110_0090813 Ga0496110_0090813_230_628 132
1246 3300048913 Ga0496110_0109266 Ga0496110_0109266_36_434 132
1247 3300048913 Ga0496110_0215738 Ga0496110_0215738_959_1357 132
1248 3300048913 Ga0496110_0298264 Ga0496110_0298264_792_1190 132
1249 3300048913 Ga0496110_1152860 Ga0496110_1152860_245_643 132
1250 3300048914 Ga0496111_0041081 Ga0496111_0041081_100_498 132
1251 3300048914 Ga0496111_0152865 Ga0496111_0152865_179_577 132
1252 3300048914 Ga0496111_0164446 Ga0496111_0164446_672_1085 132
1253 3300048914 Ga0496111_0165666 Ga0496111_0165666_586_984 132
1254 3300048914 Ga0496111_0204773 Ga0496111_0204773_213_611 132
1255 3300048914 Ga0496111_0266366 Ga0496111_0266366_824_1222 132
1256 3300048915 Ga0496112_0000031 Ga0496112_0000031_71560_71958 132
1257 3300048915 Ga0496112_0002881 Ga0496112_0002881_4805_5203 132
1258 3300048915 Ga0496112_0055524 Ga0496112_0055524_3445_3858 132
1259 3300048915 Ga0496112_0118015 Ga0496112_0118015_1673_2071 132
1260 3300048915 Ga0496112_0189893 Ga0496112_0189893_1151_1579 132
1261 3300048915 Ga0496112_0366845 Ga0496112_0366845_703_1101 132
1262 3300048916 Ga0496113_0006041 Ga0496113_0006041_2448_2846 132
1263 3300048916 Ga0496113_0014440 Ga0496113_0014440_2671_3069 132
1264 3300048916 Ga0496113_0039454 Ga0496113_0039454_2830_3228 132
1265 3300048916 Ga0496113_1074691 Ga0496113_1074691_165_578 132
1266 3300048917 Ga0496114_0028470 Ga0496114_0028470_1156_1554 132
1267 3300048917 Ga0496114_0090800 Ga0496114_0090800_1286_1684 132
1268 3300048917 Ga0496114_0271973 Ga0496114_0271973_274_687 132
1269 3300048917 Ga0496114_0631052 Ga0496114_0631052_92_490 132
1270 3300048917 Ga0496114_1571325 Ga0496114_1571325_119_532 132
1271 3300048918 Ga0496115_0010614 Ga0496115_0010614_6293_6691 132
1272 3300048918 Ga0496115_0038527 Ga0496115_0038527_1598_1996 132
1273 3300048918 Ga0496115_0068732 Ga0496115_0068732_1280_1693 132
1274 3300048918 Ga0496115_0138134 Ga0496115_0138134_835_1263 132
1275 3300048918 Ga0496115_0158378 Ga0496115_0158378_1413_1811 132
1276 3300048918 Ga0496115_0172524 Ga0496115_0172524_186_584 132
1277 3300048918 Ga0496115_0234195 Ga0496115_0234195_1046_1444 132
1278 3300048918 Ga0496115_0616443 Ga0496115_0616443_257_670 132
1279 3300048921 Ga0496118_0001670 Ga0496118_0001670_18830_19228 132
1280 3300048921 Ga0496118_0043015 Ga0496118_0043015_1431_1829 132
1281 3300048922 Ga0496119_0064309 Ga0496119_0064309_775_1173 132
1282 3300048922 Ga0496119_0405635 Ga0496119_0405635_44_442 132
1283 3300048923 Ga0496120_0093413 Ga0496120_0093413_40_438 132
1284 3300048923 Ga0496120_0129130 Ga0496120_0129130_693_1091 132
1285 3300048924 Ga0496121_0000183 Ga0496121_0000183_36564_36962 132
1286 3300048924 Ga0496121_0001473 Ga0496121_0001473_28129_28527 132
1287 3300048924 Ga0496121_0002518 Ga0496121_0002518_19650_20048 132
1288 3300048924 Ga0496121_0157177 Ga0496121_0157177_38_451 132
1289 3300048924 Ga0496121_0219605 Ga0496121_0219605_911_1309 132
1290 3300048924 Ga0496121_0381970 Ga0496121_0381970_49_447 132
1291 3300048927 Ga0496124_0001382 Ga0496124_0001382_20897_21295 132
1292 3300048927 Ga0496124_0016454 Ga0496124_0016454_2867_3265 132
1293 3300048927 Ga0496124_0299139 Ga0496124_0299139_677_1075 132
1294 3300048928 Ga0496125_0048308 Ga0496125_0048308_2751_3149 132
1295 3300048928 Ga0496125_0060785 Ga0496125_0060785_1750_2148 132
1296 3300048929 Ga0496126_0004491 Ga0496126_0004491_2861_3274 132
1297 3300048929 Ga0496126_0013413 Ga0496126_0013413_4747_5160 132
1298 3300048929 Ga0496126_0063841 Ga0496126_0063841_2688_3086 132
1299 3300048929 Ga0496126_0115146 Ga0496126_0115146_143_541 132
1300 3300048929 Ga0496126_0129927 Ga0496126_0129927_1265_1678 132
1301 3300048929 Ga0496126_0223766 Ga0496126_0223766_34_447 132
1302 3300048929 Ga0496126_0242172 Ga0496126_0242172_656_1054 132
1303 3300048929 Ga0496126_0394707 Ga0496126_0394707_34_432 132
1304 3300048929 Ga0496126_0498782 Ga0496126_0498782_433_831 132
1305 3300048929 Ga0496126_0534124 Ga0496126_0534124_428_826 132
1306 3300048929 Ga0496126_0643537 Ga0496126_0643537_30_428 132
1307 3300049459 Ga0495678_065656 Ga0495678_065656_115_513 132
1308 3300049460 Ga0495682_0171067 Ga0495682_0171067_344_742 132
1309 3300049568 Ga0501031_0000442 Ga0501031_0000442_7277_7675 132
1310 3300049569 Ga0501032_0000773 Ga0501032_0000773_16451_16849 132
1311 3300049570 Ga0501033_0000025 Ga0501033_0000025_13960_14358 132
1312 3300049570 Ga0501033_0336470 Ga0501033_0336470_575_988 132
1313 3300049571 Ga0501034_0000021 Ga0501034_0000021_242589_242987 132
1314 3300049572 Ga0501036_0000069 Ga0501036_0000069_4202_4600 132
1315 3300049573 Ga0501037_0000034 Ga0501037_0000034_41757_42155 132
1316 3300049574 Ga0501038_0000537 Ga0501038_0000537_21368_21766 132
1317 3300049575 Ga0501039_0000198 Ga0501039_0000198_21950_22348 132
1318 3300049578 Ga0501042_0670899 Ga0501042_0670899_175_573 132
1319 3300049579 Ga0501043_0001044 Ga0501043_0001044_22623_23021 132
1320 3300049580 Ga0501046_0011176 Ga0501046_0011176_4333_4731 132
1321 3300049581 Ga0501047_0000587 Ga0501047_0000587_36336_36734 132
1322 3300049581 Ga0501047_0047916 Ga0501047_0047916_1378_1791 132
1323 3300049581 Ga0501047_0748050 Ga0501047_0748050_327_725 132
1324 3300049582 Ga0501048_0008991 Ga0501048_0008991_3116_3514 132
1325 3300049583 Ga0501067_0000331 Ga0501067_0000331_4283_4681 132
1326 3300049583 Ga0501067_0056192 Ga0501067_0056192_649_1047 132
1327 3300049584 Ga0501068_0000039 Ga0501068_0000039_18926_19324 132
1328 3300049585 Ga0501069_0000910 Ga0501069_0000910_1144_1542 132
1329 3300049585 Ga0501069_0029131 Ga0501069_0029131_277_675 132
1330 3300049585 Ga0501069_0410822 Ga0501069_0410822_214_612 132
1331 3300049586 Ga0501070_0033515 Ga0501070_0033515_2961_3359 132
1332 3300049586 Ga0501070_0140507 Ga0501070_0140507_1410_1808 132
1333 3300049586 Ga0501070_0282353 Ga0501070_0282353_940_1338 132
1334 3300049586 Ga0501070_0306690 Ga0501070_0306690_537_950 132
1335 3300049588 Ga0501072_0007314 Ga0501072_0007314_670_1068 132
1336 3300049588 Ga0501072_0250013 Ga0501072_0250013_674_1072 132
1337 3300049589 Ga0501073_0000236 Ga0501073_0000236_31184_31582 132
1338 3300049589 Ga0501073_0069491 Ga0501073_0069491_2016_2429 132
1339 3300049590 Ga0501074_0000048 Ga0501074_0000048_48606_49004 132
1340 3300049590 Ga0501074_0030647 Ga0501074_0030647_3178_3591 132
1341 3300049686 Ga0501257_204124 Ga0501257_204124_91_489 132
1342 3300049705 Ga0501225_0182944 Ga0501225_0182944_228_626 132
1343 3300049741 Ga0501079_0011390 Ga0501079_0011390_3888_4286 132
1344 3300049741 Ga0501079_0828095 Ga0501079_0828095_269_667 132
1345 3300049742 Ga0501080_0034680 Ga0501080_0034680_467_880 132
1346 3300049742 Ga0501080_0278675 Ga0501080_0278675_641_1039 132
1347 3300049742 Ga0501080_0472463 Ga0501080_0472463_453_851 132
1348 3300049743 Ga0501081_1022083 Ga0501081_1022083_163_561 132
1349 3300049744 Ga0501083_0030815 Ga0501083_0030815_2139_2537 132
1350 3300049822 Ga0501035_0000865 Ga0501035_0000865_25988_26386 132
1351 3300049823 Ga0501044_0000028 Ga0501044_0000028_16436_16834 132
1352 3300049823 Ga0501044_0070718 Ga0501044_0070718_1835_2248 132
1353 3300049823 Ga0501044_0180205 Ga0501044_0180205_1326_1724 132
1354 3300049823 Ga0501044_0777983 Ga0501044_0777983_250_648 132
1355 3300049824 Ga0501045_0191681 Ga0501045_0191681_726_1124 132
1356 3300050489 nmdc:mga03683_245279_c1 nmdc:mga03683_245279_c1_276_674 132
1357 3300050489 nmdc:mga03683_555581_c1 nmdc:mga03683_555581_c1_35_433 132
1358 3300050492 nmdc:mga0yw44_172489_c1 nmdc:mga0yw44_172489_c1_26_439 132
1359 3300050492 nmdc:mga0yw44_343361_c1 nmdc:mga0yw44_343361_c1_137_535 132
1360 3300050493 nmdc:mga0k408_184235_c2 nmdc:mga0k408_184235_c2_39_437 132
1361 3300050493 nmdc:mga0k408_29543_c1 nmdc:mga0k408_29543_c1_255_653 132
1362 3300050493 nmdc:mga0k408_611302_c1 nmdc:mga0k408_611302_c1_114_512 132
1363 3300050493 nmdc:mga0k408_695351_c1 nmdc:mga0k408_695351_c1_134_532 132
1364 3300050494 nmdc:mga06z11_191886_c1 nmdc:mga06z11_191886_c1_348_746 132
1365 3300050494 nmdc:mga06z11_298778_c1 nmdc:mga06z11_298778_c1_190_588 132
1366 3300050495 nmdc:mga04h51_171599_c1 nmdc:mga04h51_171599_c1_216_614 132
1367 3300050496 nmdc:mga07m45_103042_c1 nmdc:mga07m45_103042_c1_1162_1560 132
1368 3300050496 nmdc:mga07m45_479438_c1 nmdc:mga07m45_479438_c1_178_576 132
1369 3300050496 nmdc:mga07m45_907950_c1 nmdc:mga07m45_907950_c1_26_424 132
1370 3300050510 nmdc:mga06r32_564965_c1 nmdc:mga06r32_564965_c1_101_499 132
1371 3300050511 nmdc:mga08y16_314653_c1 nmdc:mga08y16_314653_c1_373_771 132
1372 3300050512 nmdc:mga0n895_158416_c1 nmdc:mga0n895_158416_c1_526_942 132
1373 3300050512 nmdc:mga0n895_354924_c1 nmdc:mga0n895_354924_c1_751_1149 132
1374 3300050513 nmdc:mga0rr50_700405_c1 nmdc:mga0rr50_700405_c1_144_557 132
1375 3300050514 nmdc:mga08x19_104020_c1 nmdc:mga08x19_104020_c1_806_1219 132
1376 3300050515 nmdc:mga0a205_1029238_c1 nmdc:mga0a205_1029238_c1_254_652 132
1377 3300050516 nmdc:mga0sz30_202315_c1 nmdc:mga0sz30_202315_c1_225_623 132
1378 3300050516 nmdc:mga0sz30_345707_c1 nmdc:mga0sz30_345707_c1_52_450 132
1379 3300053077 Ga0495601_0032809 Ga0495601_0032809_2072_2485 132
1380 3300053077 Ga0495601_0047559 Ga0495601_0047559_1240_1653 132
1381 3300053077 Ga0495601_0050146 Ga0495601_0050146_1124_1522 132
1382 3300053077 Ga0495601_0221914 Ga0495601_0221914_392_790 132
1383 3300053078 Ga0495612_0086620 Ga0495612_0086620_482_883 132
1384 3300053078 Ga0495612_0163605 Ga0495612_0163605_486_890 132
1385 3300053080 Ga0500635_0003272 Ga0500635_0003272_461_859 132
1386 3300053080 Ga0500635_0024104 Ga0500635_0024104_1472_1870 132
1387 3300053080 Ga0500635_0033210 Ga0500635_0033210_967_1365 132
1388 3300053083 Ga0495655_0134726 Ga0495655_0134726_176_574 132
1389 3300053084 Ga0495595_0000634 Ga0495595_0000634_6262_6660 132
1390 3300053084 Ga0495595_0096720 Ga0495595_0096720_722_1120 132
1391 3300053084 Ga0495595_0245576 Ga0495595_0245576_226_624 132
1392 3300053084 Ga0495595_0574087 Ga0495595_0574087_163_561 132
1393 3300053085 Ga0495619_0000697 Ga0495619_0000697_10755_11153 132
1394 3300053085 Ga0495619_0013615 Ga0495619_0013615_1447_1845 132
1395 3300053085 Ga0495619_0072468 Ga0495619_0072468_650_1048 132
1396 3300053085 Ga0495619_0531461 Ga0495619_0531461_122_520 132
1397 3300053085 Ga0495619_0639362 Ga0495619_0639362_227_634 132
1398 3300053086 Ga0500578_0261630 Ga0500578_0261630_475_873 132
1399 3300053086 Ga0500578_0319122 Ga0500578_0319122_429_827 132
1400 3300053091 Ga0500647_0055764 Ga0500647_0055764_1416_1814 132
1401 3300053091 Ga0500647_0291114 Ga0500647_0291114_142_540 132
1402 3300053092 Ga0500583_0073951 Ga0500583_0073951_1118_1594 132
1403 3300053092 Ga0500583_0417295 Ga0500583_0417295_177_575 132
1404 3300053093 Ga0500651_0030288 Ga0500651_0030288_137_535 132
1405 3300053093 Ga0500651_0030472 Ga0500651_0030472_1164_1562 132
1406 3300053093 Ga0500651_0156988 Ga0500651_0156988_285_683 132
1407 3300053094 Ga0500566_0000010 Ga0500566_0000010_6164_6562 132
1408 3300053094 Ga0500566_0051918 Ga0500566_0051918_1286_1684 132
1409 3300053094 Ga0500566_0490302 Ga0500566_0490302_115_513 132
1410 3300053095 Ga0500640_000055 Ga0500640_000055_6637_7035 132
1411 3300053096 Ga0500641_0093867 Ga0500641_0093867_459_857 132
1412 3300053099 Ga0500654_142441 Ga0500654_142441_262_660 132
1413 3300053102 Ga0500554_000560 Ga0500554_000560_1419_1817 132
1414 3300053102 Ga0500554_027963 Ga0500554_027963_638_1036 132
1415 3300053104 Ga0500556_0073406 Ga0500556_0073406_170_568 132
1416 3300053104 Ga0500556_0151239 Ga0500556_0151239_131_529 132
1417 3300053109 Ga0500569_006916 Ga0500569_006916_843_1241 132
1418 3300053111 Ga0500572_000088 Ga0500572_000088_10738_11139 132
1419 3300053111 Ga0500572_001292 Ga0500572_001292_635_1033 132
1420 3300053115 Ga0500591_200314 Ga0500591_200314_259_657 132
1421 3300053119 Ga0500595_000967 Ga0500595_000967_8519_8917 132
1422 3300053119 Ga0500595_001717 Ga0500595_001717_7826_8311 132
1423 3300053119 Ga0500595_002830 Ga0500595_002830_7392_7790 132
1424 3300053119 Ga0500595_006501 Ga0500595_006501_1116_1514 132
1425 3300053119 Ga0500595_008515 Ga0500595_008515_1047_1445 132
1426 3300053122 Ga0500608_061747 Ga0500608_061747_750_1148 132
1427 3300053122 Ga0500608_112922 Ga0500608_112922_543_941 132
1428 3300053123 Ga0500614_000734 Ga0500614_000734_4800_5198 132
1429 3300053133 Ga0500655_065207 Ga0500655_065207_264_662 132
1430 3300053134 Ga0500658_0069848 Ga0500658_0069848_650_1048 132
1431 3300053134 Ga0500658_0221356 Ga0500658_0221356_159_557 132
1432 3300053136 Ga0500559_0001744 Ga0500559_0001744_7917_8318 132
1433 3300053136 Ga0500559_0024871 Ga0500559_0024871_403_801 132
1434 3300053136 Ga0500559_0088109 Ga0500559_0088109_688_1086 132
1435 3300053139 Ga0500568_0023381 Ga0500568_0023381_1364_1762 132
1436 3300053139 Ga0500568_0093224 Ga0500568_0093224_698_1096 132
1437 3300053139 Ga0500568_0119209 Ga0500568_0119209_524_922 132
1438 3300053140 Ga0500573_0147868 Ga0500573_0147868_266_664 132
1439 3300053142 Ga0500577_0118571 Ga0500577_0118571_657_1055 132
1440 3300053146 Ga0500588_0017368 Ga0500588_0017368_1393_1791 132
1441 3300053147 Ga0500589_046444 Ga0500589_046444_459_857 132
1442 3300053148 Ga0500590_105444 Ga0500590_105444_483_881 132
1443 3300053148 Ga0500590_176307 Ga0500590_176307_207_605 132
1444 3300053148 Ga0500590_189746 Ga0500590_189746_311_709 132
1445 3300053150 Ga0500603_000342 Ga0500603_000342_8892_9290 132
1446 3300053150 Ga0500603_004423 Ga0500603_004423_1917_2315 132
1447 3300053150 Ga0500603_013232 Ga0500603_013232_1153_1566 132
1448 3300053150 Ga0500603_133042 Ga0500603_133042_128_526 132
1449 3300053150 Ga0500603_148305 Ga0500603_148305_38_436 132
1450 3300053151 Ga0500604_0009862 Ga0500604_0009862_381_779 132
1451 3300053154 Ga0500619_188296 Ga0500619_188296_112_510 132
1452 3300053156 Ga0500622_0074138 Ga0500622_0074138_638_1036 132
1453 3300053158 Ga0500627_0092869 Ga0500627_0092869_11_409 132
1454 3300053158 Ga0500627_0415377 Ga0500627_0415377_73_471 132
1455 3300053159 Ga0500630_003317 Ga0500630_003317_3783_4181 132
1456 3300053161 Ga0500634_0171056 Ga0500634_0171056_19_417 132
1457 3300053162 Ga0500638_000712 Ga0500638_000712_7406_7804 132
1458 3300053162 Ga0500638_093941 Ga0500638_093941_556_954 132
1459 3300053162 Ga0500638_159196 Ga0500638_159196_570_968 132
1460 3300053162 Ga0500638_162057 Ga0500638_162057_414_812 132
1461 3300053162 Ga0500638_353576 Ga0500638_353576_81_479 132
1462 3300053163 Ga0500639_000001 Ga0500639_000001_202085_202483 132
1463 3300053163 Ga0500639_056128 Ga0500639_056128_1100_1498 132
1464 3300053163 Ga0500639_057167 Ga0500639_057167_746_1147 132
1465 3300053177 Ga0500636_0078193 Ga0500636_0078193_401_799 132
1466 3300053177 Ga0500636_0091378 Ga0500636_0091378_473_871 132
1467 3300053177 Ga0500636_0194916 Ga0500636_0194916_499_897 132
1468 3300053177 Ga0500636_0303041 Ga0500636_0303041_208_606 132
1469 3300053177 Ga0500636_0398726 Ga0500636_0398726_28_426 132
1470 3300053178 Ga0500637_0002851 Ga0500637_0002851_1982_2380 132
1471 3300053178 Ga0500637_0005100 Ga0500637_0005100_2063_2461 132
1472 3300053178 Ga0500637_0035858 Ga0500637_0035858_621_1019 132
1473 3300053178 Ga0500637_0364416 Ga0500637_0364416_309_707 132
1474 3300053725 Ga0500576_254031 Ga0500576_254031_85_483 132
1475 3300053731 Ga0500609_008206 Ga0500609_008206_11_409 132
1476 3300053733 Ga0500552_006330 Ga0500552_006330_736_1134 132
1477 3300053735 Ga0500596_006761 Ga0500596_006761_1280_1678 132
1478 3300053735 Ga0500596_007614 Ga0500596_007614_234_632 132
1479 3300053737 Ga0500601_006758 Ga0500601_006758_724_1122 132
1480 3300053739 Ga0500587_017740 Ga0500587_017740_76_474 132
1481 3300054114 Ga0501084_0001432 Ga0501084_0001432_16062_16460 132
1482 3300055283 Ga0500661_000387 Ga0500661_000387_6095_6493 132
1483 3300059626 Ga0587115_088134 Ga0587115_088134_129_542 132
1484 3300060353 Ga0501082_0011376 Ga0501082_0011376_4515_4913 132
1485 3300060353 Ga0501082_0485625 Ga0501082_0485625_128_526 132
1486 3300060353 Ga0501082_1589670 Ga0501082_1589670_135_533 132
1487 3300061719 Ga0466962_0140275 Ga0466962_0140275_279_692 132
1488 iso_pu_bacteria 2513237101 2513692387 132
1489 iso_pu_bacteria 2876808645 2876809028 132
1490 iso_pu_bacteria 2879110137 2879115405 132
1491 iso_pu_bacteria 8006964411 8006965605 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

33

159

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hkk-assembly1.cif.gz_A structure of human leukotriene c4 synthase in complex with glutathione sulfonate 0.8043 3 128
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.8036 3 130
4ntb-assembly1.cif.gz_A mus musculus ltc4 synthase in gsh complex form 0.7995 3 128
4jc7-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.7947 3 128
4j7t-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.7935 3 128
ID Description Score Start End Superfamily
af_P64515_1_129_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8313 2 130 1.20.120.550
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8179 3 130 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8065 3 130 1.20.120.550
af_Q9JHF3_7_153_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8013 3 130 1.20.120.550
4jc7A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7947 3 128 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A533JAF3-F1-model_v4 deleted 0.9991 45 132
AF-A0A7S7Z5G2-F1-model_v4 MAPEG family protein 0.991 1 132 GO:0016020
AF-A0A2M8R4K8-F1-model_v4 MAPEG family protein 0.9897 1 132 GO:0016020
AF-A0A5S4X384-F1-model_v4 MAPEG family protein 0.9881 1 132 GO:0016020
AF-A0A533JAF3-F1-model_v4 deleted 0.9879 45 132

Feature Viewer

pLDDT pTM Quality
94.27 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map