F494338
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1491 | 538 | 1483 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_001717|Ga0500595_001717_7826_8311 |
| Length | 161 |
| Sequence | MVWRHSTGRRLEQRQSGLCPDFKANKEFSMTRELFWLTLTVILTGLLWVPYVLNRCQVRGLGGAMANPSRNDKPHAEWATRLMFAHDNAVENLVIFAPLVLILAEIDYSSKWTVYACAVYFWSRVAHLIVYALGLPVFRTLAFTVGFLAQAVLALGIFKIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 5 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 6 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 7 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 8 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 103 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 104 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 126 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 146 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 149 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 150 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 234 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 235 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 238 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 244 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 245 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 248 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 249 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 250 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 251 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 253 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 256 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 258 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 265 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 266 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 267 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 268 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 269 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 284 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 290 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 292 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 293 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 294 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 295 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 296 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 298 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 300 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 301 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 302 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 303 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 304 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 305 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 306 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 307 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 308 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 309 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 310 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 319 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 320 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 321 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 322 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 323 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 324 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 325 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 326 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 327 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 328 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 329 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 332 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 420 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 421 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 422 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 423 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 424 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 425 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 428 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 429 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 430 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 431 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 432 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 433 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 434 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 435 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 436 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 437 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 438 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 439 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 440 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 463 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 464 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 473 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 474 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 475 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 476 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 477 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 484 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 487 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 491 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 492 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 493 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 494 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 495 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 496 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 497 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 499 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 500 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 501 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 502 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 503 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 504 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 505 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 506 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 507 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 509 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 510 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 511 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 512 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 513 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 514 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 515 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 516 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 517 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 518 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 519 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 521 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 522 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 523 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 524 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 525 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 526 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 527 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 528 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 529 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 530 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 531 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 532 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 534 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 537 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 538 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.79 |
| Metatranscriptomes | 0.67 |
| Isolates | 0.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.65 |
| Nodule | 0.94 |
| Rhizoplane | 6.57 |
| Rhizosphere | 77.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1006151 | 3300000549 | Bacteria | 1502 |
| 2 | JGI24736J21556_1019063 | 3300001904 | Bacteria | 1085 |
| 3 | JGI24739J22299_10029071 | 3300001989 | Bacteria | 1925 |
| 4 | JGI24737J22298_10026448 | 3300001990 | Bacteria | 1832 |
| 5 | JGI24735J21928_10036631 | 3300002067 | Bacteria | 1439 |
| 6 | JGI24735J21928_10069308 | 3300002067 | Bacteria | 1011 |
| 7 | JGI24748J21848_1054316 | 3300002074 | Bacteria | 527 |
| 8 | JGI24744J21845_10024791 | 3300002077 | Bacteria | 1172 |
| 9 | JGI25406J46586_10020393 | 3300003203 | Bacteria | 2681 |
| 10 | JGI25406J46586_10143480 | 3300003203 | Bacteria | 698 |
| 11 | JGI25406J46586_10151684 | 3300003203 | Bacteria | 676 |
| 12 | JGI25153J46596_10001436 | 3300003215 | Bacteria | 14265 |
| 13 | rootH2_10047101 | 3300003320 | Bacteria | 1830 |
| 14 | JGI25404J52841_10002090 | 3300003659 | Bacteria | 3703 |
| 15 | JGI25404J52841_10004756 | 3300003659 | Bacteria | 2774 |
| 16 | JGI25404J52841_10019050 | 3300003659 | Bacteria | 1487 |
| 17 | JGI25404J52841_10087493 | 3300003659 | Bacteria | 651 |
| 18 | JGI25405J52794_10049357 | 3300003911 | Bacteria | 900 |
| 19 | Ga0070658_10019300 | 3300005327 | Bacteria | 5460 |
| 20 | Ga0070683_100005606 | 3300005329 | Bacteria | 10489 |
| 21 | Ga0070683_100045273 | 3300005329 | Bacteria | 4061 |
| 22 | Ga0070683_100198250 | 3300005329 | Bacteria | 1906 |
| 23 | Ga0070683_100565967 | 3300005329 | Bacteria | 1087 |
| 24 | Ga0070683_100689860 | 3300005329 | Bacteria | 978 |
| 25 | Ga0070690_100395641 | 3300005330 | Bacteria | 1013 |
| 26 | Ga0068869_100216002 | 3300005334 | Bacteria | 1518 |
| 27 | Ga0070680_100015488 | 3300005336 | Bacteria | 5980 |
| 28 | Ga0070680_100021554 | 3300005336 | Bacteria | 5122 |
| 29 | Ga0070680_100147196 | 3300005336 | Bacteria | 1976 |
| 30 | Ga0070680_100224979 | 3300005336 | Bacteria | 1584 |
| 31 | Ga0070682_100073268 | 3300005337 | Bacteria | 2197 |
| 32 | Ga0070682_100151081 | 3300005337 | Bacteria | 1594 |
| 33 | Ga0068868_100014248 | 3300005338 | Bacteria | 5855 |
| 34 | Ga0068868_100354073 | 3300005338 | Bacteria | 1258 |
| 35 | Ga0070660_100062081 | 3300005339 | Bacteria | 2902 |
| 36 | Ga0070660_100265903 | 3300005339 | Bacteria | 1401 |
| 37 | Ga0070660_100587922 | 3300005339 | Bacteria | 930 |
| 38 | Ga0070660_101004132 | 3300005339 | Bacteria | 705 |
| 39 | Ga0070691_10086951 | 3300005341 | Bacteria | 1537 |
| 40 | Ga0070691_10509905 | 3300005341 | Bacteria | 697 |
| 41 | Ga0070661_100014484 | 3300005344 | Bacteria | 5555 |
| 42 | Ga0070661_100462185 | 3300005344 | Bacteria | 1011 |
| 43 | Ga0070661_100611875 | 3300005344 | Bacteria | 882 |
| 44 | Ga0070668_100024739 | 3300005347 | Bacteria | 4551 |
| 45 | Ga0070668_100191433 | 3300005347 | Bacteria | 1675 |
| 46 | Ga0070668_100288894 | 3300005347 | Bacteria | 1372 |
| 47 | Ga0070668_100819924 | 3300005347 | Bacteria | 828 |
| 48 | Ga0070668_101286160 | 3300005347 | Bacteria | 664 |
| 49 | Ga0070675_101004799 | 3300005354 | Bacteria | 766 |
| 50 | Ga0070671_101279121 | 3300005355 | Bacteria | 647 |
| 51 | Ga0070674_100047261 | 3300005356 | Bacteria | 2947 |
| 52 | Ga0070674_100940775 | 3300005356 | Bacteria | 755 |
| 53 | Ga0070673_100285973 | 3300005364 | Bacteria | 1448 |
| 54 | Ga0070688_100121601 | 3300005365 | Bacteria | 1750 |
| 55 | Ga0070688_100484082 | 3300005365 | Bacteria | 931 |
| 56 | Ga0070688_101100318 | 3300005365 | Bacteria | 635 |
| 57 | Ga0070659_100368928 | 3300005366 | Bacteria | 1207 |
| 58 | Ga0070659_100503508 | 3300005366 | Bacteria | 1032 |
| 59 | Ga0070659_101753354 | 3300005366 | Bacteria | 556 |
| 60 | Ga0070667_100435563 | 3300005367 | Bacteria | 1197 |
| 61 | Ga0070667_100731178 | 3300005367 | Bacteria | 917 |
| 62 | Ga0070667_101284482 | 3300005367 | Bacteria | 686 |
| 63 | Ga0070703_10231566 | 3300005406 | Bacteria | 740 |
| 64 | Ga0070709_10000102 | 3300005434 | Bacteria | 60511 |
| 65 | Ga0070709_10005140 | 3300005434 | Bacteria | 7079 |
| 66 | Ga0070709_10195133 | 3300005434 | Bacteria | 1431 |
| 67 | Ga0070709_10311965 | 3300005434 | Bacteria | 1152 |
| 68 | Ga0070709_10492366 | 3300005434 | Bacteria | 930 |
| 69 | Ga0070709_10599692 | 3300005434 | Bacteria | 848 |
| 70 | Ga0070709_10706596 | 3300005434 | Bacteria | 785 |
| 71 | Ga0070714_100001753 | 3300005435 | Bacteria | 15824 |
| 72 | Ga0070714_100022895 | 3300005435 | Bacteria | 5126 |
| 73 | Ga0070714_100030514 | 3300005435 | Bacteria | 4487 |
| 74 | Ga0070714_100036394 | 3300005435 | Bacteria | 4129 |
| 75 | Ga0070714_100148831 | 3300005435 | Bacteria | 2108 |
| 76 | Ga0070714_100877368 | 3300005435 | Bacteria | 871 |
| 77 | Ga0070714_101566761 | 3300005435 | Bacteria | 644 |
| 78 | Ga0070713_100002970 | 3300005436 | Bacteria | 11136 |
| 79 | Ga0070713_100005921 | 3300005436 | Bacteria | 8407 |
| 80 | Ga0070713_100015544 | 3300005436 | Bacteria | 5698 |
| 81 | Ga0070713_100045016 | 3300005436 | Bacteria | 3614 |
| 82 | Ga0070713_100140491 | 3300005436 | Bacteria | 2139 |
| 83 | Ga0070713_100258975 | 3300005436 | Bacteria | 1589 |
| 84 | Ga0070713_100956802 | 3300005436 | Bacteria | 825 |
| 85 | Ga0070710_10000526 | 3300005437 | Bacteria | 18024 |
| 86 | Ga0070710_10019960 | 3300005437 | Bacteria | 3471 |
| 87 | Ga0070710_10052085 | 3300005437 | Bacteria | 2301 |
| 88 | Ga0070710_10202213 | 3300005437 | Bacteria | 1255 |
| 89 | Ga0070710_10286858 | 3300005437 | Bacteria | 1070 |
| 90 | Ga0070701_10369705 | 3300005438 | Bacteria | 901 |
| 91 | Ga0070711_100002160 | 3300005439 | Bacteria | 11157 |
| 92 | Ga0070711_100009157 | 3300005439 | Bacteria | 6085 |
| 93 | Ga0070711_100021560 | 3300005439 | Bacteria | 4168 |
| 94 | Ga0070711_100091166 | 3300005439 | Bacteria | 2196 |
| 95 | Ga0070711_100224437 | 3300005439 | Bacteria | 1462 |
| 96 | Ga0070711_100341792 | 3300005439 | Bacteria | 1201 |
| 97 | Ga0070711_100963038 | 3300005439 | Bacteria | 731 |
| 98 | Ga0070705_100201702 | 3300005440 | Bacteria | 1364 |
| 99 | Ga0070705_100673025 | 3300005440 | Bacteria | 810 |
| 100 | Ga0070700_100093566 | 3300005441 | Bacteria | 1966 |
| 101 | Ga0070708_100098711 | 3300005445 | Bacteria | 2671 |
| 102 | Ga0070663_100038273 | 3300005455 | Bacteria | 3345 |
| 103 | Ga0070663_100056577 | 3300005455 | Bacteria | 2811 |
| 104 | Ga0070663_100248007 | 3300005455 | Bacteria | 1408 |
| 105 | Ga0070663_100284375 | 3300005455 | Bacteria | 1319 |
| 106 | Ga0070663_100461541 | 3300005455 | Bacteria | 1049 |
| 107 | Ga0070678_100070698 | 3300005456 | Bacteria | 2611 |
| 108 | Ga0070678_100122013 | 3300005456 | Bacteria | 2056 |
| 109 | Ga0070678_101595481 | 3300005456 | Bacteria | 612 |
| 110 | Ga0070662_100022874 | 3300005457 | Bacteria | 4286 |
| 111 | Ga0070662_100103986 | 3300005457 | Bacteria | 2154 |
| 112 | Ga0070662_100364458 | 3300005457 | Bacteria | 1186 |
| 113 | Ga0070662_100483133 | 3300005457 | Bacteria | 1031 |
| 114 | Ga0070681_10023500 | 3300005458 | Bacteria | 6201 |
| 115 | Ga0070681_10032157 | 3300005458 | Bacteria | 5266 |
| 116 | Ga0070681_10058028 | 3300005458 | Bacteria | 3851 |
| 117 | Ga0070681_10084358 | 3300005458 | Bacteria | 3129 |
| 118 | Ga0070681_10570220 | 3300005458 | Bacteria | 1046 |
| 119 | Ga0070681_10845435 | 3300005458 | Bacteria | 833 |
| 120 | Ga0070685_10661708 | 3300005466 | Bacteria | 758 |
| 121 | Ga0070706_100500165 | 3300005467 | Bacteria | 1131 |
| 122 | Ga0070706_100777464 | 3300005467 | Bacteria | 887 |
| 123 | Ga0070707_100062447 | 3300005468 | Bacteria | 3574 |
| 124 | Ga0070707_100183859 | 3300005468 | Bacteria | 2038 |
| 125 | Ga0070707_101990451 | 3300005468 | Bacteria | 548 |
| 126 | Ga0070698_100220036 | 3300005471 | Bacteria | 1832 |
| 127 | Ga0070699_100501396 | 3300005518 | Bacteria | 1103 |
| 128 | Ga0070699_101198594 | 3300005518 | Bacteria | 696 |
| 129 | Ga0070679_100013119 | 3300005530 | Bacteria | 7935 |
| 130 | Ga0070679_100026603 | 3300005530 | Bacteria | 5687 |
| 131 | Ga0070679_100069248 | 3300005530 | Bacteria | 3519 |
| 132 | Ga0070679_100104027 | 3300005530 | Bacteria | 2826 |
| 133 | Ga0070679_100135854 | 3300005530 | Bacteria | 2440 |
| 134 | Ga0070679_100536659 | 3300005530 | Bacteria | 1114 |
| 135 | Ga0070679_101205562 | 3300005530 | Bacteria | 702 |
| 136 | Ga0070684_100013256 | 3300005535 | Bacteria | 6641 |
| 137 | Ga0070684_100024555 | 3300005535 | Bacteria | 5057 |
| 138 | Ga0070684_100326270 | 3300005535 | Bacteria | 1410 |
| 139 | Ga0070697_100091314 | 3300005536 | Bacteria | 2518 |
| 140 | Ga0070697_100446253 | 3300005536 | Bacteria | 1127 |
| 141 | Ga0068853_100010809 | 3300005539 | Bacteria | 7394 |
| 142 | Ga0068853_100015334 | 3300005539 | Bacteria | 6297 |
| 143 | Ga0068853_100751722 | 3300005539 | Bacteria | 932 |
| 144 | Ga0068853_101244637 | 3300005539 | Bacteria | 719 |
| 145 | Ga0068853_101941198 | 3300005539 | Bacteria | 571 |
| 146 | Ga0070672_100264678 | 3300005543 | Bacteria | 1451 |
| 147 | Ga0070672_100435239 | 3300005543 | Bacteria | 1128 |
| 148 | Ga0070672_100674309 | 3300005543 | Bacteria | 904 |
| 149 | Ga0070686_101525500 | 3300005544 | Bacteria | 564 |
| 150 | Ga0070695_101049690 | 3300005545 | Bacteria | 665 |
| 151 | Ga0070693_100149715 | 3300005547 | Bacteria | 1477 |
| 152 | Ga0070665_100067345 | 3300005548 | Bacteria | 3590 |
| 153 | Ga0070665_100232545 | 3300005548 | Bacteria | 1843 |
| 154 | Ga0070665_100633109 | 3300005548 | Bacteria | 1083 |
| 155 | Ga0070665_100752588 | 3300005548 | Bacteria | 987 |
| 156 | Ga0070665_100803270 | 3300005548 | Bacteria | 954 |
| 157 | Ga0070704_100975041 | 3300005549 | Bacteria | 766 |
| 158 | Ga0068855_100013700 | 3300005563 | Bacteria | 9779 |
| 159 | Ga0068855_100014164 | 3300005563 | Bacteria | 9608 |
| 160 | Ga0068855_100033333 | 3300005563 | Bacteria | 6147 |
| 161 | Ga0068855_100221967 | 3300005563 | Bacteria | 2118 |
| 162 | Ga0068855_100750342 | 3300005563 | Bacteria | 1041 |
| 163 | Ga0068855_100850357 | 3300005563 | Bacteria | 967 |
| 164 | Ga0068855_101088469 | 3300005563 | Bacteria | 836 |
| 165 | Ga0068855_101123183 | 3300005563 | Bacteria | 821 |
| 166 | Ga0068855_101554138 | 3300005563 | Bacteria | 678 |
| 167 | Ga0068855_102398272 | 3300005563 | Bacteria | 526 |
| 168 | Ga0070664_100662320 | 3300005564 | Bacteria | 971 |
| 169 | Ga0068857_100004954 | 3300005577 | Bacteria | 11311 |
| 170 | Ga0068857_100025795 | 3300005577 | Bacteria | 5175 |
| 171 | Ga0068857_100038647 | 3300005577 | Bacteria | 4226 |
| 172 | Ga0068857_100153608 | 3300005577 | Bacteria | 2086 |
| 173 | Ga0068857_100838610 | 3300005577 | Bacteria | 879 |
| 174 | Ga0068857_101369238 | 3300005577 | Bacteria | 688 |
| 175 | Ga0068854_100026378 | 3300005578 | Bacteria | 3993 |
| 176 | Ga0068854_100631408 | 3300005578 | Bacteria | 918 |
| 177 | Ga0068856_100000451 | 3300005614 | Bacteria | 45442 |
| 178 | Ga0068856_100000659 | 3300005614 | Bacteria | 37359 |
| 179 | Ga0068856_100012689 | 3300005614 | Bacteria | 8158 |
| 180 | Ga0068856_100521784 | 3300005614 | Bacteria | 1209 |
| 181 | Ga0068856_100884698 | 3300005614 | Bacteria | 912 |
| 182 | Ga0068856_101305904 | 3300005614 | Bacteria | 741 |
| 183 | Ga0070702_100124167 | 3300005615 | Bacteria | 1620 |
| 184 | Ga0070702_101135733 | 3300005615 | Bacteria | 626 |
| 185 | Ga0068852_100071562 | 3300005616 | Bacteria | 3045 |
| 186 | Ga0068852_100139508 | 3300005616 | Bacteria | 2242 |
| 187 | Ga0068852_100268538 | 3300005616 | Bacteria | 1641 |
| 188 | Ga0068852_100427848 | 3300005616 | Bacteria | 1307 |
| 189 | Ga0068852_100507167 | 3300005616 | Bacteria | 1202 |
| 190 | Ga0068852_102437874 | 3300005616 | Bacteria | 544 |
| 191 | Ga0068859_100420450 | 3300005617 | Bacteria | 1433 |
| 192 | Ga0068859_100737395 | 3300005617 | Bacteria | 1074 |
| 193 | Ga0068864_100027097 | 3300005618 | Bacteria | 4836 |
| 194 | Ga0068864_100289129 | 3300005618 | Bacteria | 1532 |
| 195 | Ga0068864_100708627 | 3300005618 | Bacteria | 984 |
| 196 | Ga0068866_10212862 | 3300005718 | Bacteria | 1162 |
| 197 | Ga0068866_10217413 | 3300005718 | Bacteria | 1151 |
| 198 | Ga0068861_100202126 | 3300005719 | Bacteria | 1668 |
| 199 | Ga0068861_100588907 | 3300005719 | Bacteria | 1019 |
| 200 | Ga0068851_10044153 | 3300005834 | Bacteria | 2248 |
| 201 | Ga0068851_10045043 | 3300005834 | Bacteria | 2229 |
| 202 | Ga0068851_10057892 | 3300005834 | Bacteria | 1979 |
| 203 | Ga0068851_10571996 | 3300005834 | Bacteria | 685 |
| 204 | Ga0068863_100592395 | 3300005841 | Bacteria | 1097 |
| 205 | Ga0068858_100084248 | 3300005842 | Bacteria | 2957 |
| 206 | Ga0068858_100196916 | 3300005842 | Bacteria | 1904 |
| 207 | Ga0068858_100428840 | 3300005842 | Bacteria | 1272 |
| 208 | Ga0068858_100638292 | 3300005842 | Bacteria | 1034 |
| 209 | Ga0068860_100008418 | 3300005843 | Bacteria | 10274 |
| 210 | Ga0068860_100360322 | 3300005843 | Bacteria | 1432 |
| 211 | Ga0068860_100677982 | 3300005843 | Bacteria | 1040 |
| 212 | Ga0068862_100158586 | 3300005844 | Bacteria | 2018 |
| 213 | Ga0068862_100174424 | 3300005844 | Bacteria | 1926 |
| 214 | Ga0068862_100325654 | 3300005844 | Bacteria | 1419 |
| 215 | Ga0068862_101177839 | 3300005844 | Bacteria | 764 |
| 216 | Ga0081455_10003511 | 3300005937 | Bacteria | 18010 |
| 217 | Ga0081455_10007726 | 3300005937 | Bacteria | 11281 |
| 218 | Ga0081455_10012558 | 3300005937 | Bacteria | 8448 |
| 219 | Ga0081455_10021916 | 3300005937 | Bacteria | 5984 |
| 220 | Ga0081455_10025903 | 3300005937 | Bacteria | 5405 |
| 221 | Ga0081455_10037165 | 3300005937 | Bacteria | 4328 |
| 222 | Ga0081455_10496219 | 3300005937 | Bacteria | 821 |
| 223 | Ga0081538_10016160 | 3300005981 | Bacteria | 5738 |
| 224 | Ga0081540_1001538 | 3300005983 | Bacteria | 19791 |
| 225 | Ga0081540_1002078 | 3300005983 | Bacteria | 16705 |
| 226 | Ga0081540_1003660 | 3300005983 | Bacteria | 12052 |
| 227 | Ga0081540_1008178 | 3300005983 | Bacteria | 7331 |
| 228 | Ga0081540_1008898 | 3300005983 | Bacteria | 6964 |
| 229 | Ga0081540_1014574 | 3300005983 | Bacteria | 5027 |
| 230 | Ga0081540_1032957 | 3300005983 | Bacteria | 2820 |
| 231 | Ga0081540_1086701 | 3300005983 | Bacteria | 1390 |
| 232 | Ga0081540_1134711 | 3300005983 | Bacteria | 1002 |
| 233 | Ga0081540_1305108 | 3300005983 | Bacteria | 547 |
| 234 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 235 | Ga0081539_10000498 | 3300005985 | Bacteria | 82216 |
| 236 | Ga0081539_10011910 | 3300005985 | Bacteria | 6791 |
| 237 | Ga0081539_10028294 | 3300005985 | Bacteria | 3527 |
| 238 | Ga0081539_10071100 | 3300005985 | Bacteria | 1865 |
| 239 | Ga0081539_10194479 | 3300005985 | Bacteria | 942 |
| 240 | Ga0070717_10010508 | 3300006028 | Bacteria | 6993 |
| 241 | Ga0070717_10018723 | 3300006028 | Bacteria | 5415 |
| 242 | Ga0070717_10046983 | 3300006028 | Bacteria | 3535 |
| 243 | Ga0070717_10053340 | 3300006028 | Bacteria | 3333 |
| 244 | Ga0070717_10333654 | 3300006028 | Bacteria | 1353 |
| 245 | Ga0070717_10445232 | 3300006028 | Bacteria | 1167 |
| 246 | Ga0070717_11002044 | 3300006028 | Bacteria | 761 |
| 247 | Ga0075365_10021569 | 3300006038 | Bacteria | 4020 |
| 248 | Ga0075365_10176696 | 3300006038 | Bacteria | 1492 |
| 249 | Ga0075365_10379106 | 3300006038 | Bacteria | 998 |
| 250 | Ga0075368_10247084 | 3300006042 | Bacteria | 762 |
| 251 | Ga0075363_100357461 | 3300006048 | Bacteria | 854 |
| 252 | Ga0075363_100497625 | 3300006048 | Bacteria | 724 |
| 253 | Ga0070716_100001641 | 3300006173 | Bacteria | 10099 |
| 254 | Ga0070716_100002831 | 3300006173 | Bacteria | 8072 |
| 255 | Ga0070716_100665850 | 3300006173 | Bacteria | 791 |
| 256 | Ga0070716_100844507 | 3300006173 | Bacteria | 712 |
| 257 | Ga0070716_101609299 | 3300006173 | Bacteria | 534 |
| 258 | Ga0070712_100026574 | 3300006175 | Bacteria | 3857 |
| 259 | Ga0070712_100153424 | 3300006175 | Bacteria | 1771 |
| 260 | Ga0070712_101414810 | 3300006175 | Bacteria | 607 |
| 261 | Ga0075362_10187526 | 3300006177 | Bacteria | 1004 |
| 262 | Ga0075362_10195509 | 3300006177 | Bacteria | 983 |
| 263 | Ga0075367_10023235 | 3300006178 | Bacteria | 3486 |
| 264 | Ga0075367_10373781 | 3300006178 | Bacteria | 900 |
| 265 | Ga0075367_10437006 | 3300006178 | Bacteria | 829 |
| 266 | Ga0075367_10440525 | 3300006178 | Bacteria | 825 |
| 267 | Ga0075366_10165600 | 3300006195 | Bacteria | 1340 |
| 268 | Ga0075366_10243110 | 3300006195 | Bacteria | 1097 |
| 269 | Ga0075366_10837026 | 3300006195 | Bacteria | 573 |
| 270 | Ga0075366_10977563 | 3300006195 | Bacteria | 528 |
| 271 | Ga0097621_100061477 | 3300006237 | Bacteria | 3081 |
| 272 | Ga0097621_100196156 | 3300006237 | Bacteria | 1751 |
| 273 | Ga0097621_100205780 | 3300006237 | Bacteria | 1710 |
| 274 | Ga0097621_101842056 | 3300006237 | Bacteria | 577 |
| 275 | Ga0097621_101889315 | 3300006237 | Bacteria | 570 |
| 276 | Ga0075370_10362605 | 3300006353 | Bacteria | 867 |
| 277 | Ga0068871_100305229 | 3300006358 | Bacteria | 1398 |
| 278 | Ga0068871_100704021 | 3300006358 | Bacteria | 925 |
| 279 | Ga0068871_100857972 | 3300006358 | Bacteria | 840 |
| 280 | Ga0068871_100949221 | 3300006358 | Bacteria | 799 |
| 281 | Ga0075434_100452156 | 3300006871 | Bacteria | 1306 |
| 282 | Ga0075429_100897583 | 3300006880 | Bacteria | 776 |
| 283 | Ga0068865_100050924 | 3300006881 | Bacteria | 2863 |
| 284 | Ga0068865_100180232 | 3300006881 | Bacteria | 1626 |
| 285 | Ga0097620_100420422 | 3300006931 | Bacteria | 1433 |
| 286 | Ga0097620_100737365 | 3300006931 | Bacteria | 1074 |
| 287 | Ga0099825_1039359 | 3300006941 | Bacteria | 1456 |
| 288 | Ga0099824_1006683 | 3300006942 | Bacteria | 15693 |
| 289 | Ga0099822_1000418 | 3300006943 | Bacteria | 38171 |
| 290 | Ga0075435_100724066 | 3300007076 | Bacteria | 865 |
| 291 | Ga0099794_10029452 | 3300007265 | Bacteria | 2558 |
| 292 | Ga0099794_10111805 | 3300007265 | Bacteria | 1369 |
| 293 | Ga0099794_10128782 | 3300007265 | Bacteria | 1277 |
| 294 | Ga0099794_10458609 | 3300007265 | Bacteria | 669 |
| 295 | Ga0099794_10474923 | 3300007265 | Bacteria | 657 |
| 296 | Ga0099795_10080174 | 3300007788 | Bacteria | 1248 |
| 297 | Ga0099795_10096198 | 3300007788 | Bacteria | 1155 |
| 298 | Ga0099795_10128064 | 3300007788 | Bacteria | 1021 |
| 299 | Ga0099795_10308116 | 3300007788 | Bacteria | 698 |
| 300 | Ga0099795_10335215 | 3300007788 | Bacteria | 673 |
| 301 | Ga0099795_10385831 | 3300007788 | Bacteria | 633 |
| 302 | Ga0105251_10560716 | 3300009011 | Bacteria | 539 |
| 303 | Ga0105244_10421508 | 3300009036 | Bacteria | 614 |
| 304 | Ga0105250_10018383 | 3300009092 | Bacteria | 2831 |
| 305 | Ga0105240_10010878 | 3300009093 | Bacteria | 12743 |
| 306 | Ga0105240_10026626 | 3300009093 | Bacteria | 7588 |
| 307 | Ga0105240_10097500 | 3300009093 | Bacteria | 3582 |
| 308 | Ga0105240_10155163 | 3300009093 | Bacteria | 2724 |
| 309 | Ga0105240_10236739 | 3300009093 | Bacteria | 2119 |
| 310 | Ga0105240_10427922 | 3300009093 | Bacteria | 1486 |
| 311 | Ga0105240_10608267 | 3300009093 | Bacteria | 1202 |
| 312 | Ga0111539_10174814 | 3300009094 | Bacteria | 2508 |
| 313 | Ga0111539_10439612 | 3300009094 | Bacteria | 1519 |
| 314 | Ga0105245_10026065 | 3300009098 | Bacteria | 5144 |
| 315 | Ga0105245_11121040 | 3300009098 | Bacteria | 833 |
| 316 | Ga0105247_10044664 | 3300009101 | Bacteria | 2718 |
| 317 | Ga0105247_10144089 | 3300009101 | Bacteria | 1564 |
| 318 | Ga0105247_10203570 | 3300009101 | Bacteria | 1331 |
| 319 | Ga0105247_10867839 | 3300009101 | Bacteria | 694 |
| 320 | Ga0105247_11646848 | 3300009101 | Bacteria | 529 |
| 321 | Ga0105243_10059410 | 3300009148 | Bacteria | 3051 |
| 322 | Ga0105243_10659051 | 3300009148 | Bacteria | 1015 |
| 323 | Ga0105241_10000375 | 3300009174 | Bacteria | 34023 |
| 324 | Ga0105241_10237331 | 3300009174 | Bacteria | 1540 |
| 325 | Ga0105241_10565195 | 3300009174 | Bacteria | 1023 |
| 326 | Ga0105241_11255179 | 3300009174 | Bacteria | 704 |
| 327 | Ga0105242_10093388 | 3300009176 | Bacteria | 2536 |
| 328 | Ga0105242_10248578 | 3300009176 | Bacteria | 1602 |
| 329 | Ga0105242_10381833 | 3300009176 | Bacteria | 1310 |
| 330 | Ga0105242_10477824 | 3300009176 | Bacteria | 1180 |
| 331 | Ga0105242_10791971 | 3300009176 | Bacteria | 937 |
| 332 | Ga0105248_10049495 | 3300009177 | Bacteria | 4713 |
| 333 | Ga0105237_10006382 | 3300009545 | Bacteria | 13085 |
| 334 | Ga0105237_10008299 | 3300009545 | Bacteria | 11270 |
| 335 | Ga0105237_10024116 | 3300009545 | Bacteria | 6224 |
| 336 | Ga0105237_10080055 | 3300009545 | Bacteria | 3257 |
| 337 | Ga0105237_10101460 | 3300009545 | Bacteria | 2870 |
| 338 | Ga0105237_10148579 | 3300009545 | Bacteria | 2339 |
| 339 | Ga0105237_10211233 | 3300009545 | Bacteria | 1941 |
| 340 | Ga0105237_10219117 | 3300009545 | Bacteria | 1903 |
| 341 | Ga0105237_10251855 | 3300009545 | Bacteria | 1768 |
| 342 | Ga0105237_10644966 | 3300009545 | Bacteria | 1066 |
| 343 | Ga0105237_11559825 | 3300009545 | Bacteria | 667 |
| 344 | Ga0105237_11821153 | 3300009545 | Bacteria | 616 |
| 345 | Ga0105238_10000885 | 3300009551 | Bacteria | 30833 |
| 346 | Ga0105238_10005609 | 3300009551 | Bacteria | 12405 |
| 347 | Ga0105238_10006417 | 3300009551 | Bacteria | 11705 |
| 348 | Ga0105238_10091024 | 3300009551 | Bacteria | 3038 |
| 349 | Ga0105238_10620117 | 3300009551 | Bacteria | 1090 |
| 350 | Ga0105238_10982261 | 3300009551 | Bacteria | 865 |
| 351 | Ga0105238_11066667 | 3300009551 | Bacteria | 830 |
| 352 | Ga0105238_11231957 | 3300009551 | Bacteria | 773 |
| 353 | Ga0105238_11351498 | 3300009551 | Bacteria | 739 |
| 354 | Ga0105249_10079454 | 3300009553 | Bacteria | 3045 |
| 355 | Ga0105249_10682842 | 3300009553 | Bacteria | 1086 |
| 356 | Ga0105249_11678457 | 3300009553 | Bacteria | 708 |
| 357 | Ga0105249_12466770 | 3300009553 | Bacteria | 592 |
| 358 | Ga0099796_10008097 | 3300010159 | Bacteria | 2786 |
| 359 | Ga0099796_10127663 | 3300010159 | Bacteria | 983 |
| 360 | Ga0105239_10011070 | 3300010375 | Bacteria | 10068 |
| 361 | Ga0105239_10020488 | 3300010375 | Bacteria | 7294 |
| 362 | Ga0105239_10024299 | 3300010375 | Bacteria | 6674 |
| 363 | Ga0105239_10132834 | 3300010375 | Bacteria | 2770 |
| 364 | Ga0105239_10407574 | 3300010375 | Bacteria | 1539 |
| 365 | Ga0105239_10537658 | 3300010375 | Bacteria | 1330 |
| 366 | Ga0105239_10547699 | 3300010375 | Bacteria | 1317 |
| 367 | Ga0105239_10573942 | 3300010375 | Bacteria | 1285 |
| 368 | Ga0105239_10628018 | 3300010375 | Bacteria | 1226 |
| 369 | Ga0105239_10686103 | 3300010375 | Bacteria | 1171 |
| 370 | Ga0105246_10118216 | 3300011119 | Bacteria | 1960 |
| 371 | Ga0105246_10512111 | 3300011119 | Bacteria | 1021 |
| 372 | Ga0105246_10953329 | 3300011119 | Bacteria | 773 |
| 373 | Ga0105246_11725248 | 3300011119 | Bacteria | 596 |
| 374 | Ga0157337_1021823 | 3300012483 | Bacteria | 597 |
| 375 | Ga0157338_1069532 | 3300012515 | Bacteria | 547 |
| 376 | Ga0157373_10438767 | 3300013100 | Bacteria | 939 |
| 377 | Ga0157371_10080655 | 3300013102 | Bacteria | 2304 |
| 378 | Ga0157370_10163226 | 3300013104 | Bacteria | 2073 |
| 379 | Ga0157370_10231909 | 3300013104 | Bacteria | 1708 |
| 380 | Ga0157370_10270046 | 3300013104 | Bacteria | 1571 |
| 381 | Ga0157370_10441653 | 3300013104 | Bacteria | 1196 |
| 382 | Ga0157370_11983552 | 3300013104 | Bacteria | 522 |
| 383 | Ga0157369_10003699 | 3300013105 | Bacteria | 18177 |
| 384 | Ga0157369_10011122 | 3300013105 | Bacteria | 10232 |
| 385 | Ga0157369_10016823 | 3300013105 | Bacteria | 8219 |
| 386 | Ga0157369_10685838 | 3300013105 | Bacteria | 1055 |
| 387 | Ga0157369_10715551 | 3300013105 | Bacteria | 1031 |
| 388 | Ga0157374_10071289 | 3300013296 | Bacteria | 3276 |
| 389 | Ga0157374_10290805 | 3300013296 | Bacteria | 1615 |
| 390 | Ga0157374_10581877 | 3300013296 | Bacteria | 1129 |
| 391 | Ga0157378_10529471 | 3300013297 | Bacteria | 1181 |
| 392 | Ga0157378_10808792 | 3300013297 | Bacteria | 963 |
| 393 | Ga0157378_11035404 | 3300013297 | Bacteria | 856 |
| 394 | Ga0157378_13056578 | 3300013297 | Bacteria | 519 |
| 395 | Ga0163162_10104898 | 3300013306 | Bacteria | 2921 |
| 396 | Ga0163162_10132431 | 3300013306 | Bacteria | 2602 |
| 397 | Ga0163162_10195168 | 3300013306 | Bacteria | 2153 |
| 398 | Ga0163162_10355076 | 3300013306 | Bacteria | 1598 |
| 399 | Ga0163162_13197226 | 3300013306 | Bacteria | 526 |
| 400 | Ga0157372_10371500 | 3300013307 | Bacteria | 1666 |
| 401 | Ga0157372_10616929 | 3300013307 | Bacteria | 1264 |
| 402 | Ga0157372_10662518 | 3300013307 | Bacteria | 1215 |
| 403 | Ga0157372_10821001 | 3300013307 | Bacteria | 1080 |
| 404 | Ga0157372_11039526 | 3300013307 | Bacteria | 948 |
| 405 | Ga0157372_11828009 | 3300013307 | Bacteria | 699 |
| 406 | Ga0157375_10078938 | 3300013308 | Bacteria | 3326 |
| 407 | Ga0157375_10097357 | 3300013308 | Bacteria | 3016 |
| 408 | Ga0157375_10123103 | 3300013308 | Bacteria | 2706 |
| 409 | Ga0157375_12341988 | 3300013308 | Bacteria | 637 |
| 410 | Ga0157375_13145741 | 3300013308 | Bacteria | 551 |
| 411 | Ga0163163_10019375 | 3300014325 | Bacteria | 6390 |
| 412 | Ga0163163_10140744 | 3300014325 | Bacteria | 2455 |
| 413 | Ga0163163_10294331 | 3300014325 | Bacteria | 1676 |
| 414 | Ga0163163_10522793 | 3300014325 | Bacteria | 1249 |
| 415 | Ga0157380_10967694 | 3300014326 | Bacteria | 882 |
| 416 | Ga0157380_11005044 | 3300014326 | Bacteria | 868 |
| 417 | Ga0157380_12459464 | 3300014326 | Bacteria | 586 |
| 418 | Ga0182008_10151999 | 3300014497 | Bacteria | 1161 |
| 419 | Ga0182008_10447148 | 3300014497 | Bacteria | 702 |
| 420 | Ga0157379_10072179 | 3300014968 | Bacteria | 3088 |
| 421 | Ga0157379_10128607 | 3300014968 | Bacteria | 2279 |
| 422 | Ga0157379_10309838 | 3300014968 | Bacteria | 1440 |
| 423 | Ga0157379_10865094 | 3300014968 | Bacteria | 856 |
| 424 | Ga0157376_10264396 | 3300014969 | Bacteria | 1613 |
| 425 | Ga0157376_11237193 | 3300014969 | Bacteria | 775 |
| 426 | Ga0206356_10824015 | 3300020070 | Bacteria | 1604 |
| 427 | Ga0206355_1375172 | 3300020076 | Bacteria | 906 |
| 428 | Ga0206350_10271927 | 3300020080 | Bacteria | 993 |
| 429 | Ga0206354_10310108 | 3300020081 | Bacteria | 2400 |
| 430 | Ga0213873_10086560 | 3300021358 | Bacteria | 884 |
| 431 | Ga0213873_10107998 | 3300021358 | Bacteria | 806 |
| 432 | Ga0213874_10110235 | 3300021377 | Bacteria | 925 |
| 433 | Ga0213874_10138265 | 3300021377 | Bacteria | 842 |
| 434 | Ga0213876_10018891 | 3300021384 | Bacteria | 3640 |
| 435 | Ga0213876_10108795 | 3300021384 | Bacteria | 1471 |
| 436 | Ga0213876_10118908 | 3300021384 | Bacteria | 1403 |
| 437 | Ga0213876_10203730 | 3300021384 | Bacteria | 1052 |
| 438 | Ga0213876_10701295 | 3300021384 | Bacteria | 538 |
| 439 | Ga0213875_10069234 | 3300021388 | Bacteria | 1648 |
| 440 | Ga0213871_10008840 | 3300021441 | Bacteria | 2235 |
| 441 | Ga0213871_10110776 | 3300021441 | Bacteria | 811 |
| 442 | Ga0224712_10110279 | 3300022467 | Bacteria | 1179 |
| 443 | Ga0209148_1010916 | 3300025254 | Bacteria | 1704 |
| 444 | Ga0209233_1006072 | 3300025261 | Bacteria | 3931 |
| 445 | Ga0209455_1007118 | 3300025272 | Bacteria | 3200 |
| 446 | Ga0209455_1014353 | 3300025272 | Bacteria | 1795 |
| 447 | Ga0209758_1002215 | 3300025297 | Bacteria | 20262 |
| 448 | Ga0209758_1032638 | 3300025297 | Bacteria | 2108 |
| 449 | Ga0209758_1071592 | 3300025297 | Bacteria | 1088 |
| 450 | Ga0207697_10027916 | 3300025315 | Bacteria | 2307 |
| 451 | Ga0207656_10056016 | 3300025321 | Bacteria | 1717 |
| 452 | Ga0207656_10072434 | 3300025321 | Bacteria | 1534 |
| 453 | Ga0207656_10076710 | 3300025321 | Bacteria | 1495 |
| 454 | Ga0207696_1032698 | 3300025711 | Bacteria | 1564 |
| 455 | Ga0207653_10017200 | 3300025885 | Bacteria | 2274 |
| 456 | Ga0207692_10000386 | 3300025898 | Bacteria | 15209 |
| 457 | Ga0207692_10176207 | 3300025898 | Bacteria | 1243 |
| 458 | Ga0207692_10370189 | 3300025898 | Bacteria | 887 |
| 459 | Ga0207692_10769614 | 3300025898 | Bacteria | 628 |
| 460 | Ga0207642_10090211 | 3300025899 | Bacteria | 1512 |
| 461 | Ga0207642_10234165 | 3300025899 | Bacteria | 1033 |
| 462 | Ga0207710_10043541 | 3300025900 | Bacteria | 1997 |
| 463 | Ga0207710_10060054 | 3300025900 | Bacteria | 1722 |
| 464 | Ga0207710_10199320 | 3300025900 | Bacteria | 988 |
| 465 | Ga0207710_10491124 | 3300025900 | Bacteria | 636 |
| 466 | Ga0207688_10013695 | 3300025901 | Bacteria | 4408 |
| 467 | Ga0207688_10102252 | 3300025901 | Bacteria | 1656 |
| 468 | Ga0207688_10364613 | 3300025901 | Bacteria | 892 |
| 469 | Ga0207647_10015721 | 3300025904 | Bacteria | 5182 |
| 470 | Ga0207647_10251620 | 3300025904 | Bacteria | 1013 |
| 471 | Ga0207685_10002099 | 3300025905 | Bacteria | 4460 |
| 472 | Ga0207699_10000411 | 3300025906 | Bacteria | 21990 |
| 473 | Ga0207699_10003008 | 3300025906 | Bacteria | 8013 |
| 474 | Ga0207699_10072963 | 3300025906 | Bacteria | 2104 |
| 475 | Ga0207699_10243468 | 3300025906 | Bacteria | 1237 |
| 476 | Ga0207699_10482407 | 3300025906 | Bacteria | 893 |
| 477 | Ga0207699_10615968 | 3300025906 | Bacteria | 791 |
| 478 | Ga0207699_10861262 | 3300025906 | Bacteria | 668 |
| 479 | Ga0207645_10600053 | 3300025907 | Bacteria | 747 |
| 480 | Ga0207705_10049208 | 3300025909 | Bacteria | 3034 |
| 481 | Ga0207705_11462528 | 3300025909 | Bacteria | 518 |
| 482 | Ga0207684_10420975 | 3300025910 | Bacteria | 1148 |
| 483 | Ga0207684_10689409 | 3300025910 | Bacteria | 869 |
| 484 | Ga0207684_10879702 | 3300025910 | Bacteria | 754 |
| 485 | Ga0207654_10000629 | 3300025911 | Bacteria | 19897 |
| 486 | Ga0207654_10061939 | 3300025911 | Bacteria | 2190 |
| 487 | Ga0207654_10787675 | 3300025911 | Bacteria | 686 |
| 488 | Ga0207654_10853485 | 3300025911 | Bacteria | 659 |
| 489 | Ga0207707_10001473 | 3300025912 | Bacteria | 21780 |
| 490 | Ga0207707_10013690 | 3300025912 | Bacteria | 7074 |
| 491 | Ga0207707_10015990 | 3300025912 | Bacteria | 6544 |
| 492 | Ga0207707_10097004 | 3300025912 | Bacteria | 2576 |
| 493 | Ga0207707_10118392 | 3300025912 | Bacteria | 2315 |
| 494 | Ga0207707_10132231 | 3300025912 | Bacteria | 2182 |
| 495 | Ga0207707_10154042 | 3300025912 | Bacteria | 2010 |
| 496 | Ga0207707_10262126 | 3300025912 | Bacteria | 1500 |
| 497 | Ga0207695_10001265 | 3300025913 | Bacteria | 42969 |
| 498 | Ga0207695_10039200 | 3300025913 | Bacteria | 5093 |
| 499 | Ga0207695_10039689 | 3300025913 | Bacteria | 5057 |
| 500 | Ga0207695_10149556 | 3300025913 | Bacteria | 2275 |
| 501 | Ga0207695_10177166 | 3300025913 | Bacteria | 2054 |
| 502 | Ga0207695_10226999 | 3300025913 | Bacteria | 1773 |
| 503 | Ga0207671_10005731 | 3300025914 | Bacteria | 11325 |
| 504 | Ga0207671_10015794 | 3300025914 | Bacteria | 5893 |
| 505 | Ga0207671_10094235 | 3300025914 | Bacteria | 2260 |
| 506 | Ga0207671_10101843 | 3300025914 | Bacteria | 2176 |
| 507 | Ga0207671_10153115 | 3300025914 | Bacteria | 1782 |
| 508 | Ga0207671_10194177 | 3300025914 | Bacteria | 1584 |
| 509 | Ga0207671_10360592 | 3300025914 | Bacteria | 1153 |
| 510 | Ga0207671_10418282 | 3300025914 | Bacteria | 1066 |
| 511 | Ga0207671_10438451 | 3300025914 | Bacteria | 1040 |
| 512 | Ga0207671_10656257 | 3300025914 | Bacteria | 835 |
| 513 | Ga0207671_11154680 | 3300025914 | Bacteria | 607 |
| 514 | Ga0207671_11180234 | 3300025914 | Bacteria | 599 |
| 515 | Ga0207693_10003644 | 3300025915 | Bacteria | 13157 |
| 516 | Ga0207693_10039807 | 3300025915 | Bacteria | 3701 |
| 517 | Ga0207693_10092044 | 3300025915 | Bacteria | 2377 |
| 518 | Ga0207663_10000897 | 3300025916 | Bacteria | 13571 |
| 519 | Ga0207663_10010802 | 3300025916 | Bacteria | 4875 |
| 520 | Ga0207663_10053778 | 3300025916 | Bacteria | 2517 |
| 521 | Ga0207663_10154973 | 3300025916 | Bacteria | 1610 |
| 522 | Ga0207663_10171764 | 3300025916 | Bacteria | 1540 |
| 523 | Ga0207663_10694508 | 3300025916 | Bacteria | 805 |
| 524 | Ga0207660_10003205 | 3300025917 | Bacteria | 10703 |
| 525 | Ga0207660_10022034 | 3300025917 | Bacteria | 4290 |
| 526 | Ga0207660_10158340 | 3300025917 | Bacteria | 1745 |
| 527 | Ga0207660_10633529 | 3300025917 | Bacteria | 871 |
| 528 | Ga0207657_10011790 | 3300025919 | Bacteria | 8655 |
| 529 | Ga0207657_10318372 | 3300025919 | Bacteria | 1230 |
| 530 | Ga0207657_11231774 | 3300025919 | Bacteria | 568 |
| 531 | Ga0207649_10595718 | 3300025920 | Bacteria | 850 |
| 532 | Ga0207652_10006959 | 3300025921 | Bacteria | 9111 |
| 533 | Ga0207652_10012754 | 3300025921 | Bacteria | 6794 |
| 534 | Ga0207652_10038366 | 3300025921 | Bacteria | 4061 |
| 535 | Ga0207652_10129055 | 3300025921 | Bacteria | 2254 |
| 536 | Ga0207652_10325541 | 3300025921 | Bacteria | 1388 |
| 537 | Ga0207652_11025320 | 3300025921 | Bacteria | 724 |
| 538 | Ga0207646_10077709 | 3300025922 | Bacteria | 2966 |
| 539 | Ga0207646_11560447 | 3300025922 | Bacteria | 570 |
| 540 | Ga0207681_10050253 | 3300025923 | Bacteria | 2821 |
| 541 | Ga0207694_10000082 | 3300025924 | Bacteria | 109787 |
| 542 | Ga0207694_10025115 | 3300025924 | Bacteria | 4527 |
| 543 | Ga0207694_10031933 | 3300025924 | Bacteria | 4026 |
| 544 | Ga0207694_10032555 | 3300025924 | Bacteria | 3991 |
| 545 | Ga0207694_10161959 | 3300025924 | Bacteria | 1807 |
| 546 | Ga0207694_10706418 | 3300025924 | Bacteria | 850 |
| 547 | Ga0207694_11325223 | 3300025924 | Bacteria | 609 |
| 548 | Ga0207694_11390093 | 3300025924 | Bacteria | 593 |
| 549 | Ga0207650_10247985 | 3300025925 | Bacteria | 1441 |
| 550 | Ga0207687_10029908 | 3300025927 | Bacteria | 3667 |
| 551 | Ga0207687_10105185 | 3300025927 | Bacteria | 2085 |
| 552 | Ga0207687_10918961 | 3300025927 | Bacteria | 749 |
| 553 | Ga0207700_10003087 | 3300025928 | Bacteria | 9611 |
| 554 | Ga0207700_10006990 | 3300025928 | Bacteria | 6867 |
| 555 | Ga0207700_10010852 | 3300025928 | Bacteria | 5779 |
| 556 | Ga0207700_10011089 | 3300025928 | Bacteria | 5731 |
| 557 | Ga0207700_10021835 | 3300025928 | Bacteria | 4380 |
| 558 | Ga0207700_10029340 | 3300025928 | Bacteria | 3880 |
| 559 | Ga0207700_10102684 | 3300025928 | Bacteria | 2284 |
| 560 | Ga0207700_10613897 | 3300025928 | Bacteria | 968 |
| 561 | Ga0207700_10862135 | 3300025928 | Bacteria | 810 |
| 562 | Ga0207664_10004435 | 3300025929 | Bacteria | 9504 |
| 563 | Ga0207664_10070887 | 3300025929 | Bacteria | 2806 |
| 564 | Ga0207664_10140973 | 3300025929 | Bacteria | 2039 |
| 565 | Ga0207664_10271666 | 3300025929 | Bacteria | 1485 |
| 566 | Ga0207664_10553805 | 3300025929 | Bacteria | 1032 |
| 567 | Ga0207664_10705276 | 3300025929 | Bacteria | 907 |
| 568 | Ga0207664_11206854 | 3300025929 | Bacteria | 675 |
| 569 | Ga0207690_10945993 | 3300025932 | Bacteria | 716 |
| 570 | Ga0207706_10080562 | 3300025933 | Bacteria | 2863 |
| 571 | Ga0207706_10098139 | 3300025933 | Bacteria | 2577 |
| 572 | Ga0207706_10171143 | 3300025933 | Bacteria | 1908 |
| 573 | Ga0207706_10460652 | 3300025933 | Bacteria | 1099 |
| 574 | Ga0207686_10065126 | 3300025934 | Bacteria | 2323 |
| 575 | Ga0207686_10675169 | 3300025934 | Bacteria | 819 |
| 576 | Ga0207709_10065212 | 3300025935 | Bacteria | 2289 |
| 577 | Ga0207709_10471578 | 3300025935 | Bacteria | 974 |
| 578 | Ga0207670_10187476 | 3300025936 | Bacteria | 1563 |
| 579 | Ga0207670_10771539 | 3300025936 | Bacteria | 800 |
| 580 | Ga0207669_10032231 | 3300025937 | Bacteria | 2940 |
| 581 | Ga0207669_10579773 | 3300025937 | Bacteria | 909 |
| 582 | Ga0207669_10719273 | 3300025937 | Bacteria | 822 |
| 583 | Ga0207704_10330524 | 3300025938 | Bacteria | 1179 |
| 584 | Ga0207665_10001244 | 3300025939 | Bacteria | 17182 |
| 585 | Ga0207665_10003077 | 3300025939 | Bacteria | 11195 |
| 586 | Ga0207665_10129259 | 3300025939 | Bacteria | 1791 |
| 587 | Ga0207665_10287312 | 3300025939 | Bacteria | 1226 |
| 588 | Ga0207665_10689963 | 3300025939 | Bacteria | 802 |
| 589 | Ga0207691_10273607 | 3300025940 | Bacteria | 1454 |
| 590 | Ga0207691_10610493 | 3300025940 | Bacteria | 923 |
| 591 | Ga0207711_10468581 | 3300025941 | Bacteria | 1173 |
| 592 | Ga0207711_10501381 | 3300025941 | Bacteria | 1131 |
| 593 | Ga0207661_10003495 | 3300025944 | Bacteria | 10912 |
| 594 | Ga0207661_10010884 | 3300025944 | Bacteria | 6566 |
| 595 | Ga0207661_10100708 | 3300025944 | Bacteria | 2425 |
| 596 | Ga0207661_10956302 | 3300025944 | Bacteria | 789 |
| 597 | Ga0207679_10461889 | 3300025945 | Bacteria | 1127 |
| 598 | Ga0207667_10006677 | 3300025949 | Bacteria | 13949 |
| 599 | Ga0207667_10008474 | 3300025949 | Bacteria | 12209 |
| 600 | Ga0207667_10009542 | 3300025949 | Bacteria | 11419 |
| 601 | Ga0207667_10109324 | 3300025949 | Bacteria | 2851 |
| 602 | Ga0207667_10120372 | 3300025949 | Bacteria | 2705 |
| 603 | Ga0207667_10261496 | 3300025949 | Bacteria | 1770 |
| 604 | Ga0207667_10324817 | 3300025949 | Bacteria | 1571 |
| 605 | Ga0207667_10513264 | 3300025949 | Bacteria | 1215 |
| 606 | Ga0207667_10557116 | 3300025949 | Bacteria | 1159 |
| 607 | Ga0207667_10559959 | 3300025949 | Bacteria | 1156 |
| 608 | Ga0207667_11554073 | 3300025949 | Bacteria | 631 |
| 609 | Ga0207651_10284249 | 3300025960 | Bacteria | 1369 |
| 610 | Ga0207651_10297316 | 3300025960 | Bacteria | 1341 |
| 611 | Ga0207712_10534468 | 3300025961 | Bacteria | 1006 |
| 612 | Ga0207712_10654023 | 3300025961 | Bacteria | 914 |
| 613 | Ga0207712_11556679 | 3300025961 | Bacteria | 592 |
| 614 | Ga0207668_10062419 | 3300025972 | Bacteria | 2623 |
| 615 | Ga0207668_10377764 | 3300025972 | Bacteria | 1192 |
| 616 | Ga0207668_10405016 | 3300025972 | Bacteria | 1154 |
| 617 | Ga0207640_10023703 | 3300025981 | Bacteria | 3692 |
| 618 | Ga0207640_10956990 | 3300025981 | Bacteria | 751 |
| 619 | Ga0207640_11103959 | 3300025981 | Bacteria | 702 |
| 620 | Ga0207658_10453227 | 3300025986 | Bacteria | 1136 |
| 621 | Ga0207658_10643294 | 3300025986 | Bacteria | 955 |
| 622 | Ga0207658_11865055 | 3300025986 | Bacteria | 548 |
| 623 | Ga0207677_10196330 | 3300026023 | Bacteria | 1600 |
| 624 | Ga0207677_10323936 | 3300026023 | Bacteria | 1282 |
| 625 | Ga0207703_10155612 | 3300026035 | Bacteria | 1997 |
| 626 | Ga0207703_10201766 | 3300026035 | Bacteria | 1768 |
| 627 | Ga0207703_10306009 | 3300026035 | Bacteria | 1451 |
| 628 | Ga0207703_10401115 | 3300026035 | Bacteria | 1272 |
| 629 | Ga0207703_11665711 | 3300026035 | Bacteria | 614 |
| 630 | Ga0207703_12296747 | 3300026035 | Bacteria | 515 |
| 631 | Ga0207639_10003792 | 3300026041 | Bacteria | 10175 |
| 632 | Ga0207639_10171290 | 3300026041 | Bacteria | 1839 |
| 633 | Ga0207639_10183444 | 3300026041 | Bacteria | 1782 |
| 634 | Ga0207639_10443502 | 3300026041 | Bacteria | 1177 |
| 635 | Ga0207639_10465134 | 3300026041 | Bacteria | 1150 |
| 636 | Ga0207639_10651857 | 3300026041 | Bacteria | 974 |
| 637 | Ga0207639_11205679 | 3300026041 | Bacteria | 710 |
| 638 | Ga0207639_11437911 | 3300026041 | Bacteria | 647 |
| 639 | Ga0207678_10113995 | 3300026067 | Bacteria | 2306 |
| 640 | Ga0207678_10200272 | 3300026067 | Bacteria | 1707 |
| 641 | Ga0207678_10219791 | 3300026067 | Bacteria | 1626 |
| 642 | Ga0207678_10322042 | 3300026067 | Bacteria | 1330 |
| 643 | Ga0207708_10104541 | 3300026075 | Bacteria | 2194 |
| 644 | Ga0207708_10175317 | 3300026075 | Bacteria | 1700 |
| 645 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 646 | Ga0207702_10000478 | 3300026078 | Bacteria | 44978 |
| 647 | Ga0207702_10061546 | 3300026078 | Bacteria | 3202 |
| 648 | Ga0207702_10195697 | 3300026078 | Bacteria | 1871 |
| 649 | Ga0207702_10391416 | 3300026078 | Bacteria | 1338 |
| 650 | Ga0207702_10990687 | 3300026078 | Bacteria | 834 |
| 651 | Ga0207702_11263645 | 3300026078 | Bacteria | 732 |
| 652 | Ga0207641_10896810 | 3300026088 | Bacteria | 880 |
| 653 | Ga0207641_11050143 | 3300026088 | Bacteria | 812 |
| 654 | Ga0207648_10021511 | 3300026089 | Bacteria | 5798 |
| 655 | Ga0207648_10995497 | 3300026089 | Bacteria | 785 |
| 656 | Ga0207676_10089392 | 3300026095 | Bacteria | 2524 |
| 657 | Ga0207676_10116170 | 3300026095 | Bacteria | 2248 |
| 658 | Ga0207676_10849018 | 3300026095 | Bacteria | 893 |
| 659 | Ga0207676_12492721 | 3300026095 | Bacteria | 514 |
| 660 | Ga0207674_10007536 | 3300026116 | Bacteria | 12680 |
| 661 | Ga0207674_10011165 | 3300026116 | Bacteria | 10100 |
| 662 | Ga0207674_10028212 | 3300026116 | Bacteria | 5927 |
| 663 | Ga0207674_10034482 | 3300026116 | Bacteria | 5290 |
| 664 | Ga0207674_10103770 | 3300026116 | Bacteria | 2822 |
| 665 | Ga0207674_10648307 | 3300026116 | Bacteria | 1020 |
| 666 | Ga0207675_100404646 | 3300026118 | Bacteria | 1345 |
| 667 | Ga0207675_101322776 | 3300026118 | Bacteria | 741 |
| 668 | Ga0207683_10104603 | 3300026121 | Bacteria | 2530 |
| 669 | Ga0207683_10198179 | 3300026121 | Bacteria | 1825 |
| 670 | Ga0207683_10365184 | 3300026121 | Bacteria | 1326 |
| 671 | Ga0207683_10783150 | 3300026121 | Bacteria | 885 |
| 672 | Ga0207683_10960871 | 3300026121 | Bacteria | 793 |
| 673 | Ga0207698_10122325 | 3300026142 | Bacteria | 2205 |
| 674 | Ga0207698_10225106 | 3300026142 | Bacteria | 1698 |
| 675 | Ga0207698_10417946 | 3300026142 | Bacteria | 1286 |
| 676 | Ga0207698_10505617 | 3300026142 | Bacteria | 1177 |
| 677 | Ga0207698_10535508 | 3300026142 | Bacteria | 1145 |
| 678 | Ga0207698_10777761 | 3300026142 | Bacteria | 958 |
| 679 | Ga0207698_10909777 | 3300026142 | Bacteria | 887 |
| 680 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 681 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 682 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 683 | Ga0209179_1033288 | 3300027512 | Bacteria | 1065 |
| 684 | Ga0209179_1067049 | 3300027512 | Bacteria | 783 |
| 685 | Ga0209179_1089564 | 3300027512 | Bacteria | 682 |
| 686 | Ga0209179_1133571 | 3300027512 | Bacteria | 555 |
| 687 | Ga0209588_1023809 | 3300027671 | Bacteria | 1932 |
| 688 | Ga0209813_10177077 | 3300027866 | Bacteria | 778 |
| 689 | Ga0268266_10162678 | 3300028379 | Bacteria | 2020 |
| 690 | Ga0268266_10215025 | 3300028379 | Bacteria | 1764 |
| 691 | Ga0268266_10264045 | 3300028379 | Bacteria | 1596 |
| 692 | Ga0268266_10726009 | 3300028379 | Bacteria | 958 |
| 693 | Ga0268266_10744311 | 3300028379 | Bacteria | 946 |
| 694 | Ga0268266_11606005 | 3300028379 | Bacteria | 626 |
| 695 | Ga0268266_11809873 | 3300028379 | Bacteria | 585 |
| 696 | Ga0268265_10517250 | 3300028380 | Bacteria | 1127 |
| 697 | Ga0268265_10587354 | 3300028380 | Bacteria | 1062 |
| 698 | Ga0268265_10701635 | 3300028380 | Bacteria | 978 |
| 699 | Ga0268264_10000043 | 3300028381 | Bacteria | 371761 |
| 700 | Ga0268264_10497575 | 3300028381 | Bacteria | 1188 |
| 701 | Ga0265337_1018947 | 3300028556 | Bacteria | 2177 |
| 702 | Ga0265319_1012285 | 3300028563 | Bacteria | 3469 |
| 703 | Ga0265334_10023180 | 3300028573 | Bacteria | 2525 |
| 704 | Ga0265334_10086784 | 3300028573 | Bacteria | 1146 |
| 705 | Ga0265318_10003124 | 3300028577 | Bacteria | 8474 |
| 706 | Ga0265323_10001316 | 3300028653 | Bacteria | 12360 |
| 707 | Ga0265322_10003976 | 3300028654 | Bacteria | 4428 |
| 708 | Ga0265336_10000579 | 3300028666 | Bacteria | 20640 |
| 709 | Ga0307517_10215992 | 3300028786 | Bacteria | 1173 |
| 710 | Ga0307515_10055010 | 3300028794 | Bacteria | 5827 |
| 711 | Ga0265338_10001398 | 3300028800 | Bacteria | 39299 |
| 712 | Ga0265324_10010613 | 3300029957 | Bacteria | 3543 |
| 713 | Ga0307511_10101511 | 3300030521 | Bacteria | 1885 |
| 714 | Ga0307511_10119276 | 3300030521 | Bacteria | 1640 |
| 715 | Ga0265762_1068277 | 3300030760 | Bacteria | 742 |
| 716 | Ga0265763_1017816 | 3300030763 | Bacteria | 723 |
| 717 | Ga0265770_1083041 | 3300030878 | Bacteria | 629 |
| 718 | Ga0265330_10021534 | 3300031235 | Bacteria | 2940 |
| 719 | Ga0265330_10029380 | 3300031235 | Bacteria | 2473 |
| 720 | Ga0265332_10043626 | 3300031238 | Bacteria | 1936 |
| 721 | Ga0265332_10087499 | 3300031238 | Bacteria | 1319 |
| 722 | Ga0265325_10029462 | 3300031241 | Bacteria | 2950 |
| 723 | Ga0265340_10002366 | 3300031247 | Bacteria | 10731 |
| 724 | Ga0265339_10009369 | 3300031249 | Bacteria | 6160 |
| 725 | Ga0265339_10019907 | 3300031249 | Bacteria | 3929 |
| 726 | Ga0265339_10119706 | 3300031249 | Bacteria | 1355 |
| 727 | Ga0265339_10325624 | 3300031249 | Bacteria | 728 |
| 728 | Ga0265339_10539454 | 3300031249 | Bacteria | 537 |
| 729 | Ga0265331_10038825 | 3300031250 | Bacteria | 2325 |
| 730 | Ga0265331_10112707 | 3300031250 | Bacteria | 1247 |
| 731 | Ga0265316_10090463 | 3300031344 | Bacteria | 2335 |
| 732 | Ga0265316_10182294 | 3300031344 | Bacteria | 1563 |
| 733 | Ga0307513_10462563 | 3300031456 | Bacteria | 991 |
| 734 | Ga0307513_10547481 | 3300031456 | Bacteria | 870 |
| 735 | Ga0307513_11044200 | 3300031456 | Bacteria | 528 |
| 736 | Ga0307509_10224089 | 3300031507 | Bacteria | 1689 |
| 737 | Ga0307509_10233876 | 3300031507 | Bacteria | 1637 |
| 738 | Ga0307509_10264488 | 3300031507 | Bacteria | 1492 |
| 739 | Ga0307509_10510776 | 3300031507 | Bacteria | 884 |
| 740 | Ga0307509_10744184 | 3300031507 | Bacteria | 646 |
| 741 | Ga0307408_100878894 | 3300031548 | Bacteria | 819 |
| 742 | Ga0265313_10126662 | 3300031595 | Bacteria | 1110 |
| 743 | Ga0265313_10284172 | 3300031595 | Bacteria | 668 |
| 744 | Ga0307508_10001059 | 3300031616 | Bacteria | 31801 |
| 745 | Ga0307508_10007228 | 3300031616 | Bacteria | 10340 |
| 746 | Ga0307508_10060565 | 3300031616 | Bacteria | 3346 |
| 747 | Ga0307508_10351820 | 3300031616 | Bacteria | 1065 |
| 748 | Ga0265314_10008943 | 3300031711 | Bacteria | 8530 |
| 749 | Ga0265342_10002731 | 3300031712 | Bacteria | 15016 |
| 750 | Ga0265342_10031442 | 3300031712 | Bacteria | 3282 |
| 751 | Ga0265342_10216379 | 3300031712 | Bacteria | 1034 |
| 752 | Ga0307516_10015493 | 3300031730 | Bacteria | 8019 |
| 753 | Ga0307516_10063699 | 3300031730 | Bacteria | 3568 |
| 754 | Ga0307516_10096643 | 3300031730 | Bacteria | 2774 |
| 755 | Ga0307516_10135644 | 3300031730 | Bacteria | 2236 |
| 756 | Ga0307516_10145136 | 3300031730 | Bacteria | 2139 |
| 757 | Ga0307516_10152987 | 3300031730 | Bacteria | 2065 |
| 758 | Ga0307516_10176035 | 3300031730 | Bacteria | 1876 |
| 759 | Ga0307516_10252540 | 3300031730 | Bacteria | 1457 |
| 760 | Ga0307516_10547677 | 3300031730 | Bacteria | 811 |
| 761 | Ga0307405_10745487 | 3300031731 | Bacteria | 815 |
| 762 | Ga0307406_10829845 | 3300031901 | Bacteria | 782 |
| 763 | Ga0307412_10235492 | 3300031911 | Bacteria | 1413 |
| 764 | Ga0307409_100308665 | 3300031995 | Bacteria | 1475 |
| 765 | Ga0307409_101601930 | 3300031995 | Bacteria | 679 |
| 766 | Ga0307416_100901219 | 3300032002 | Bacteria | 984 |
| 767 | Ga0307416_100987456 | 3300032002 | Bacteria | 945 |
| 768 | Ga0307414_10389249 | 3300032004 | Bacteria | 1208 |
| 769 | Ga0307411_11280264 | 3300032005 | Bacteria | 667 |
| 770 | Ga0307415_100980503 | 3300032126 | Bacteria | 784 |
| 771 | Ga0307507_10088859 | 3300033179 | Bacteria | 2663 |
| 772 | Ga0307510_10010241 | 3300033180 | Bacteria | 11147 |
| 773 | Ga0307510_10019329 | 3300033180 | Bacteria | 7992 |
| 774 | Ga0307510_10109337 | 3300033180 | Bacteria | 2514 |
| 775 | Ga0307510_10230706 | 3300033180 | Bacteria | 1354 |
| 776 | Ga0307510_10340909 | 3300033180 | Bacteria | 951 |
| 777 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 778 | Ga0316215_1000526 | 3300033544 | Bacteria | 4216 |
| 779 | Ga0373926_0003514 | 3300035083 | Bacteria | 5070 |
| 780 | Ga0373928_0002944 | 3300035084 | Bacteria | 3282 |
| 781 | Ga0373929_0198895 | 3300035085 | Bacteria | 561 |
| 782 | Ga0373934_0012801 | 3300035086 | Bacteria | 3169 |
| 783 | Ga0373934_0018581 | 3300035086 | Bacteria | 2661 |
| 784 | Ga0373934_0278486 | 3300035086 | Bacteria | 693 |
| 785 | Ga0373940_0114722 | 3300035088 | Bacteria | 830 |
| 786 | Ga0373944_0200611 | 3300035089 | Bacteria | 722 |
| 787 | Ga0373949_0310641 | 3300035090 | Bacteria | 503 |
| 788 | Ga0373952_0180603 | 3300035092 | Bacteria | 608 |
| 789 | Ga0373923_0001405 | 3300035111 | Bacteria | 6867 |
| 790 | Ga0373923_0033984 | 3300035111 | Bacteria | 2067 |
| 791 | Ga0373932_0113753 | 3300035112 | Bacteria | 895 |
| 792 | Ga0373936_0011153 | 3300035113 | Bacteria | 3396 |
| 793 | Ga0373936_0014114 | 3300035113 | Bacteria | 3052 |
| 794 | Ga0373936_0021286 | 3300035113 | Bacteria | 2521 |
| 795 | Ga0373936_0255164 | 3300035113 | Bacteria | 784 |
| 796 | Ga0373941_0177706 | 3300035115 | Bacteria | 797 |
| 797 | Ga0373953_0001516 | 3300035117 | Bacteria | 6744 |
| 798 | Ga0373953_0042708 | 3300035117 | Bacteria | 1808 |
| 799 | Ga0373953_0046928 | 3300035117 | Bacteria | 1736 |
| 800 | Ga0373953_0135714 | 3300035117 | Bacteria | 1051 |
| 801 | Ga0373953_0178273 | 3300035117 | Bacteria | 916 |
| 802 | Ga0373953_0267192 | 3300035117 | Bacteria | 745 |
| 803 | Ga0373954_0000132 | 3300035118 | Bacteria | 25640 |
| 804 | Ga0373954_0012512 | 3300035118 | Bacteria | 3773 |
| 805 | Ga0373954_0120546 | 3300035118 | Bacteria | 1273 |
| 806 | Ga0373954_0165687 | 3300035118 | Bacteria | 1082 |
| 807 | Ga0373956_0041475 | 3300035119 | Bacteria | 2043 |
| 808 | Ga0373956_0417455 | 3300035119 | Bacteria | 640 |
| 809 | Ga0373957_0000168 | 3300035120 | Bacteria | 16641 |
| 810 | Ga0373957_0024164 | 3300035120 | Bacteria | 2180 |
| 811 | Ga0373957_0115560 | 3300035120 | Bacteria | 1083 |
| 812 | Ga0373960_0116131 | 3300035121 | Bacteria | 884 |
| 813 | Ga0373960_0347968 | 3300035121 | Bacteria | 561 |
| 814 | Ga0373943_0033585 | 3300035170 | Bacteria | 2445 |
| 815 | Ga0373943_0053207 | 3300035170 | Bacteria | 1998 |
| 816 | Ga0373943_0121474 | 3300035170 | Bacteria | 1388 |
| 817 | Ga0373943_0407583 | 3300035170 | Bacteria | 785 |
| 818 | Ga0373946_0003228 | 3300035171 | Bacteria | 5789 |
| 819 | Ga0373946_0074634 | 3300035171 | Bacteria | 1472 |
| 820 | Ga0373946_0078850 | 3300035171 | Bacteria | 1438 |
| 821 | Ga0373955_0001612 | 3300035172 | Bacteria | 9670 |
| 822 | Ga0373955_0007649 | 3300035172 | Bacteria | 4978 |
| 823 | Ga0373955_0055600 | 3300035172 | Bacteria | 2168 |
| 824 | Ga0373955_0304498 | 3300035172 | Bacteria | 961 |
| 825 | Ga0373942_0008063 | 3300035207 | Bacteria | 2450 |
| 826 | Ga0373962_0303142 | 3300035242 | Bacteria | 567 |
| 827 | Ga0373924_0006263 | 3300035410 | Bacteria | 4256 |
| 828 | Ga0373924_0017596 | 3300035410 | Bacteria | 2744 |
| 829 | Ga0373924_0047743 | 3300035410 | Bacteria | 1767 |
| 830 | Ga0373924_0203407 | 3300035410 | Bacteria | 874 |
| 831 | Ga0373931_0004299 | 3300035691 | Bacteria | 6490 |
| 832 | Ga0373931_0063897 | 3300035691 | Bacteria | 1991 |
| 833 | Ga0373935_0000435 | 3300035692 | Bacteria | 21766 |
| 834 | Ga0373935_0019538 | 3300035692 | Bacteria | 4132 |
| 835 | Ga0373935_0391622 | 3300035692 | Bacteria | 996 |
| 836 | Ga0373935_0585129 | 3300035692 | Bacteria | 815 |
| 837 | Ga0373935_0770135 | 3300035692 | Bacteria | 710 |
| 838 | Ga0373927_0002587 | 3300035695 | Bacteria | 13194 |
| 839 | Ga0373927_0008673 | 3300035695 | Bacteria | 6833 |
| 840 | Ga0373927_0010027 | 3300035695 | Bacteria | 6346 |
| 841 | Ga0373927_0027124 | 3300035695 | Bacteria | 3742 |
| 842 | Ga0373927_0106796 | 3300035695 | Bacteria | 1823 |
| 843 | Ga0373927_0462735 | 3300035695 | Bacteria | 838 |
| 844 | Ga0373927_0493178 | 3300035695 | Bacteria | 809 |
| 845 | Ga0373927_0575714 | 3300035695 | Bacteria | 744 |
| 846 | Ga0373927_0661197 | 3300035695 | Bacteria | 690 |
| 847 | Ga0373927_0832459 | 3300035695 | Bacteria | 609 |
| 848 | Ga0373933_0000243 | 3300035724 | Bacteria | 35861 |
| 849 | Ga0373933_0069361 | 3300035724 | Bacteria | 2143 |
| 850 | Ga0373933_0218792 | 3300035724 | Bacteria | 1221 |
| 851 | Ga0373947_0007586 | 3300035725 | Bacteria | 6278 |
| 852 | Ga0373947_0012060 | 3300035725 | Bacteria | 4949 |
| 853 | Ga0373947_0024670 | 3300035725 | Bacteria | 3505 |
| 854 | Ga0373947_0038731 | 3300035725 | Bacteria | 2834 |
| 855 | Ga0373947_0186019 | 3300035725 | Bacteria | 1354 |
| 856 | Ga0373947_0355932 | 3300035725 | Bacteria | 983 |
| 857 | Ga0373947_0436874 | 3300035725 | Bacteria | 886 |
| 858 | Ga0373947_0608518 | 3300035725 | Bacteria | 745 |
| 859 | Ga0373947_1198408 | 3300035725 | Bacteria | 517 |
| 860 | Ga0373937_0039688 | 3300036401 | Bacteria | 4290 |
| 861 | Ga0373937_0196956 | 3300036401 | Bacteria | 1893 |
| 862 | Ga0373937_0244436 | 3300036401 | Bacteria | 1691 |
| 863 | Ga0373937_0667895 | 3300036401 | Bacteria | 985 |
| 864 | Ga0373937_0728048 | 3300036401 | Bacteria | 939 |
| 865 | Ga0310109_054355 | 3300036534 | Bacteria | 514 |
| 866 | Ga0373925_0001774 | 3300037068 | Bacteria | 18013 |
| 867 | Ga0373925_0045958 | 3300037068 | Bacteria | 3245 |
| 868 | Ga0373925_0054102 | 3300037068 | Bacteria | 3001 |
| 869 | Ga0373925_0067551 | 3300037068 | Bacteria | 2697 |
| 870 | Ga0373925_0483407 | 3300037068 | Bacteria | 1016 |
| 871 | Ga0373925_0593208 | 3300037068 | Bacteria | 912 |
| 872 | Ga0373925_0807177 | 3300037068 | Bacteria | 774 |
| 873 | Ga0373925_0943314 | 3300037068 | Bacteria | 711 |
| 874 | Ga0395900_0072533 | 3300037418 | Bacteria | 3540 |
| 875 | Ga0395900_0809546 | 3300037418 | Bacteria | 864 |
| 876 | Ga0395898_1678239 | 3300037466 | Bacteria | 558 |
| 877 | Ga0395905_0022828 | 3300037471 | Bacteria | 5915 |
| 878 | Ga0395905_1235047 | 3300037471 | Bacteria | 651 |
| 879 | Ga0436364_0235897 | 3300037853 | Bacteria | 1865 |
| 880 | Ga0436364_0740920 | 3300037853 | Bacteria | 1150 |
| 881 | Ga0436364_1140579 | 3300037853 | Bacteria | 2910 |
| 882 | Ga0395901_0797843 | 3300038443 | Bacteria | 933 |
| 883 | Ga0395901_0997229 | 3300038443 | Bacteria | 814 |
| 884 | Ga0436365_0090210 | 3300039437 | Bacteria | 695 |
| 885 | Ga0436365_0136317 | 3300039437 | Bacteria | 1400 |
| 886 | Ga0436365_0186711 | 3300039437 | Bacteria | 9695 |
| 887 | Ga0436365_0482256 | 3300039437 | Bacteria | 5841 |
| 888 | Ga0436365_0948552 | 3300039437 | Bacteria | 536 |
| 889 | Ga0436365_0996952 | 3300039437 | Bacteria | 554 |
| 890 | Ga0436365_1250872 | 3300039437 | Bacteria | 1039 |
| 891 | Ga0436365_1444108 | 3300039437 | Bacteria | 949 |
| 892 | Ga0436365_1455192 | 3300039437 | Bacteria | 969 |
| 893 | Ga0436365_1458230 | 3300039437 | Bacteria | 513 |
| 894 | Ga0436360_0485622 | 3300039438 | Bacteria | 4101 |
| 895 | Ga0436360_0577390 | 3300039438 | Bacteria | 611 |
| 896 | Ga0436360_0979855 | 3300039438 | Bacteria | 1072 |
| 897 | Ga0436360_1055908 | 3300039438 | Bacteria | 610 |
| 898 | Ga0436360_1355672 | 3300039438 | Bacteria | 1307 |
| 899 | Ga0436361_0350312 | 3300039447 | Bacteria | 1229 |
| 900 | Ga0436361_0886899 | 3300039447 | Bacteria | 1688 |
| 901 | Ga0436361_0915746 | 3300039447 | Bacteria | 1009 |
| 902 | Ga0436361_0924062 | 3300039447 | Bacteria | 1326 |
| 903 | Ga0436361_1001085 | 3300039447 | Bacteria | 1420 |
| 904 | Ga0436361_1175390 | 3300039447 | Bacteria | 638 |
| 905 | Ga0436363_1278748 | 3300039450 | Bacteria | 680 |
| 906 | Ga0436363_1347498 | 3300039450 | Bacteria | 5320 |
| 907 | Ga0436362_0377775 | 3300039453 | Bacteria | 2257 |
| 908 | Ga0436362_0382758 | 3300039453 | Bacteria | 507 |
| 909 | Ga0436362_0610597 | 3300039453 | Bacteria | 1147 |
| 910 | Ga0436362_1238292 | 3300039453 | Bacteria | 1159 |
| 911 | Ga0439465_0103614 | 3300041413 | Bacteria | 984 |
| 912 | Ga0451791_1702097 | 3300041451 | Bacteria | 938 |
| 913 | Ga0451793_0207987 | 3300041452 | Bacteria | 1263 |
| 914 | Ga0451797_1118947 | 3300041453 | Bacteria | 674 |
| 915 | Ga0451795_0620610 | 3300041456 | Bacteria | 732 |
| 916 | Ga0451798_0117060 | 3300041458 | Bacteria | 1076 |
| 917 | Ga0451800_1531708 | 3300041459 | Bacteria | 694 |
| 918 | Ga0451802_1867047 | 3300041460 | Bacteria | 552 |
| 919 | Ga0451807_0039385 | 3300041486 | Bacteria | 607 |
| 920 | Ga0451807_1920733 | 3300041486 | Bacteria | 629 |
| 921 | Ga0451841_1263376 | 3300041498 | Bacteria | 612 |
| 922 | Ga0451851_0996538 | 3300041507 | Bacteria | 696 |
| 923 | Ga0451855_0429867 | 3300041511 | Bacteria | 608 |
| 924 | Ga0451853_3357421 | 3300041512 | Bacteria | 690 |
| 925 | Ga0451853_3867451 | 3300041512 | Bacteria | 870 |
| 926 | Ga0466966_0094483 | 3300044684 | Bacteria | 1853 |
| 927 | Ga0466966_0099429 | 3300044684 | Bacteria | 1800 |
| 928 | Ga0466961_0898865 | 3300044693 | Bacteria | 527 |
| 929 | Ga0466963_0306964 | 3300044694 | Bacteria | 1116 |
| 930 | Ga0466963_0362647 | 3300044694 | Bacteria | 1021 |
| 931 | Ga0466963_0915584 | 3300044694 | Bacteria | 618 |
| 932 | Ga0466964_0096969 | 3300044706 | Bacteria | 1293 |
| 933 | Ga0466971_0147944 | 3300044719 | Bacteria | 1096 |
| 934 | Ga0466968_0284005 | 3300044735 | Bacteria | 793 |
| 935 | Ga0466970_0086575 | 3300044765 | Bacteria | 1698 |
| 936 | Ga0466957_0297805 | 3300044842 | Bacteria | 1083 |
| 937 | Ga0466957_0407907 | 3300044842 | Bacteria | 930 |
| 938 | Ga0466957_1375010 | 3300044842 | Bacteria | 513 |
| 939 | Ga0466959_0011001 | 3300045049 | Bacteria | 6494 |
| 940 | Ga0466967_0093443 | 3300045976 | Bacteria | 2737 |
| 941 | Ga0466967_0139617 | 3300045976 | Bacteria | 2256 |
| 942 | Ga0466967_0154900 | 3300045976 | Bacteria | 2145 |
| 943 | Ga0466967_0272497 | 3300045976 | Bacteria | 1622 |
| 944 | Ga0466967_1731067 | 3300045976 | Bacteria | 622 |
| 945 | Ga0466967_2361388 | 3300045976 | Bacteria | 527 |
| 946 | Ga0495617_175702 | 3300046452 | Bacteria | 675 |
| 947 | Ga0495627_162677 | 3300046453 | Bacteria | 621 |
| 948 | Ga0495592_0000316 | 3300046454 | Bacteria | 40498 |
| 949 | Ga0495592_0047468 | 3300046454 | Bacteria | 3198 |
| 950 | Ga0495592_0049440 | 3300046454 | Bacteria | 3126 |
| 951 | Ga0495592_0181288 | 3300046454 | Bacteria | 1434 |
| 952 | Ga0495603_0001446 | 3300046455 | Bacteria | 13824 |
| 953 | Ga0495603_0022841 | 3300046455 | Bacteria | 3785 |
| 954 | Ga0495603_0048318 | 3300046455 | Bacteria | 2533 |
| 955 | Ga0495603_0145569 | 3300046455 | Bacteria | 1377 |
| 956 | Ga0495603_0195978 | 3300046455 | Bacteria | 1168 |
| 957 | Ga0495603_0501199 | 3300046455 | Bacteria | 695 |
| 958 | Ga0495629_0000176 | 3300046459 | Bacteria | 56922 |
| 959 | Ga0495629_0008069 | 3300046459 | Bacteria | 7750 |
| 960 | Ga0495629_0115694 | 3300046459 | Bacteria | 1869 |
| 961 | Ga0495638_0161606 | 3300046460 | Bacteria | 1292 |
| 962 | Ga0495638_0167148 | 3300046460 | Bacteria | 1264 |
| 963 | Ga0495641_0007242 | 3300046461 | Bacteria | 6978 |
| 964 | Ga0495641_0246112 | 3300046461 | Bacteria | 804 |
| 965 | Ga0495651_0002336 | 3300046462 | Bacteria | 14646 |
| 966 | Ga0495651_0034663 | 3300046462 | Bacteria | 3934 |
| 967 | Ga0495651_0036289 | 3300046462 | Bacteria | 3837 |
| 968 | Ga0495651_0133363 | 3300046462 | Bacteria | 1811 |
| 969 | Ga0495653_0002333 | 3300046463 | Bacteria | 15062 |
| 970 | Ga0495653_0048677 | 3300046463 | Bacteria | 3271 |
| 971 | Ga0495653_0677016 | 3300046463 | Bacteria | 628 |
| 972 | Ga0495650_0114507 | 3300046471 | Bacteria | 998 |
| 973 | Ga0495580_0001310 | 3300046472 | Bacteria | 21988 |
| 974 | Ga0495580_0026506 | 3300046472 | Bacteria | 4225 |
| 975 | Ga0495580_0241022 | 3300046472 | Bacteria | 1240 |
| 976 | Ga0495580_0433341 | 3300046472 | Bacteria | 883 |
| 977 | Ga0495582_0000545 | 3300046473 | Bacteria | 20797 |
| 978 | Ga0495582_0019184 | 3300046473 | Bacteria | 3741 |
| 979 | Ga0495582_0325338 | 3300046473 | Bacteria | 885 |
| 980 | Ga0495605_0328411 | 3300046474 | Bacteria | 644 |
| 981 | Ga0495639_0010592 | 3300046475 | Bacteria | 3970 |
| 982 | Ga0495639_0089834 | 3300046475 | Bacteria | 1440 |
| 983 | Ga0495639_0103776 | 3300046475 | Bacteria | 1344 |
| 984 | Ga0495639_0272352 | 3300046475 | Bacteria | 840 |
| 985 | Ga0495662_0003999 | 3300046476 | Bacteria | 7428 |
| 986 | Ga0495662_0171896 | 3300046476 | Bacteria | 1068 |
| 987 | Ga0495664_0016518 | 3300046477 | Bacteria | 4207 |
| 988 | Ga0495664_0022116 | 3300046477 | Bacteria | 3681 |
| 989 | Ga0495664_0112353 | 3300046477 | Bacteria | 1645 |
| 990 | Ga0495664_0123109 | 3300046477 | Bacteria | 1568 |
| 991 | Ga0495664_0140249 | 3300046477 | Bacteria | 1465 |
| 992 | Ga0495664_0267503 | 3300046477 | Bacteria | 1033 |
| 993 | Ga0495664_0761221 | 3300046477 | Bacteria | 570 |
| 994 | Ga0495584_0493114 | 3300046491 | Bacteria | 624 |
| 995 | Ga0495585_0035267 | 3300046492 | Bacteria | 2828 |
| 996 | Ga0495585_0180295 | 3300046492 | Bacteria | 1086 |
| 997 | Ga0495585_0279772 | 3300046492 | Bacteria | 825 |
| 998 | Ga0495594_0000020 | 3300046499 | Bacteria | 80534 |
| 999 | Ga0495594_0087977 | 3300046499 | Bacteria | 1739 |
| 1000 | Ga0495594_0249012 | 3300046499 | Bacteria | 1012 |
| 1001 | Ga0495594_0313122 | 3300046499 | Bacteria | 894 |
| 1002 | Ga0495594_0511637 | 3300046499 | Bacteria | 682 |
| 1003 | Ga0495594_0536512 | 3300046499 | Bacteria | 664 |
| 1004 | Ga0495583_0212960 | 3300046506 | Bacteria | 783 |
| 1005 | Ga0495606_0003820 | 3300046507 | Bacteria | 15624 |
| 1006 | Ga0495606_0320351 | 3300046507 | Bacteria | 833 |
| 1007 | Ga0495606_0328870 | 3300046507 | Bacteria | 818 |
| 1008 | Ga0495606_0402991 | 3300046507 | Bacteria | 712 |
| 1009 | Ga0495608_0005003 | 3300046511 | Bacteria | 9486 |
| 1010 | Ga0495608_0076801 | 3300046511 | Bacteria | 2174 |
| 1011 | Ga0495610_0070605 | 3300046512 | Bacteria | 1630 |
| 1012 | Ga0495610_0181975 | 3300046512 | Bacteria | 873 |
| 1013 | Ga0495616_0060187 | 3300046513 | Bacteria | 1866 |
| 1014 | Ga0495618_0078963 | 3300046514 | Bacteria | 2098 |
| 1015 | Ga0495618_0125439 | 3300046514 | Bacteria | 1644 |
| 1016 | Ga0495618_0174603 | 3300046514 | Bacteria | 1366 |
| 1017 | Ga0495618_0324373 | 3300046514 | Bacteria | 953 |
| 1018 | Ga0495620_0251452 | 3300046515 | Bacteria | 674 |
| 1019 | Ga0495620_0256667 | 3300046515 | Bacteria | 666 |
| 1020 | Ga0495628_0010144 | 3300046516 | Bacteria | 8010 |
| 1021 | Ga0495628_0058137 | 3300046516 | Bacteria | 3040 |
| 1022 | Ga0495628_0075750 | 3300046516 | Bacteria | 2620 |
| 1023 | Ga0495628_1190507 | 3300046516 | Bacteria | 517 |
| 1024 | Ga0495630_0044087 | 3300046517 | Bacteria | 3333 |
| 1025 | Ga0495630_0274763 | 3300046517 | Bacteria | 1287 |
| 1026 | Ga0495630_0904493 | 3300046517 | Bacteria | 672 |
| 1027 | Ga0495630_1100710 | 3300046517 | Bacteria | 602 |
| 1028 | Ga0495631_0025372 | 3300046518 | Bacteria | 2730 |
| 1029 | Ga0495631_0162612 | 3300046518 | Bacteria | 958 |
| 1030 | Ga0495631_0363391 | 3300046518 | Bacteria | 616 |
| 1031 | Ga0495632_0138676 | 3300046519 | Bacteria | 1129 |
| 1032 | Ga0495632_0150187 | 3300046519 | Bacteria | 1077 |
| 1033 | Ga0495632_0296297 | 3300046519 | Bacteria | 718 |
| 1034 | Ga0495637_0336925 | 3300046520 | Bacteria | 531 |
| 1035 | Ga0495644_0078643 | 3300046523 | Bacteria | 1242 |
| 1036 | Ga0495644_0318893 | 3300046523 | Bacteria | 610 |
| 1037 | Ga0495644_0430845 | 3300046523 | Bacteria | 524 |
| 1038 | Ga0495648_0028869 | 3300046524 | Bacteria | 3688 |
| 1039 | Ga0495648_0093578 | 3300046524 | Bacteria | 1676 |
| 1040 | Ga0495666_0010941 | 3300046526 | Bacteria | 4525 |
| 1041 | Ga0495652_0004857 | 3300046529 | Bacteria | 12762 |
| 1042 | Ga0495652_0047989 | 3300046529 | Bacteria | 3661 |
| 1043 | Ga0495652_0355006 | 3300046529 | Bacteria | 1049 |
| 1044 | Ga0495652_0979629 | 3300046529 | Bacteria | 554 |
| 1045 | Ga0495654_0090172 | 3300046530 | Bacteria | 1424 |
| 1046 | Ga0495665_0000170 | 3300046531 | Bacteria | 32921 |
| 1047 | Ga0495665_0137466 | 3300046531 | Bacteria | 1278 |
| 1048 | Ga0495640_0002547 | 3300046533 | Bacteria | 14649 |
| 1049 | Ga0495640_0010374 | 3300046533 | Bacteria | 7205 |
| 1050 | Ga0495640_0094459 | 3300046533 | Bacteria | 1969 |
| 1051 | Ga0495640_0593690 | 3300046533 | Bacteria | 669 |
| 1052 | Ga0495640_0856612 | 3300046533 | Bacteria | 540 |
| 1053 | Ga0495587_0001071 | 3300046536 | Bacteria | 17994 |
| 1054 | Ga0495587_0031364 | 3300046536 | Bacteria | 3218 |
| 1055 | Ga0495587_0602018 | 3300046536 | Bacteria | 605 |
| 1056 | Ga0495598_0013908 | 3300046537 | Bacteria | 2004 |
| 1057 | Ga0495609_0309606 | 3300046538 | Bacteria | 642 |
| 1058 | Ga0495609_0427873 | 3300046538 | Bacteria | 528 |
| 1059 | Ga0495621_0043795 | 3300046539 | Bacteria | 1580 |
| 1060 | Ga0495645_0003790 | 3300046543 | Bacteria | 10277 |
| 1061 | Ga0495645_0011662 | 3300046543 | Bacteria | 6188 |
| 1062 | Ga0495622_0002079 | 3300046557 | Bacteria | 9785 |
| 1063 | Ga0495622_0028006 | 3300046557 | Bacteria | 2630 |
| 1064 | Ga0495622_0229126 | 3300046557 | Bacteria | 821 |
| 1065 | Ga0495667_0007097 | 3300046559 | Bacteria | 7598 |
| 1066 | Ga0495667_0046148 | 3300046559 | Bacteria | 2882 |
| 1067 | Ga0495667_0558964 | 3300046559 | Bacteria | 714 |
| 1068 | Ga0495656_0050030 | 3300046615 | Bacteria | 1782 |
| 1069 | Ga0495656_0114997 | 3300046615 | Bacteria | 1263 |
| 1070 | Ga0495668_0041329 | 3300046616 | Bacteria | 2568 |
| 1071 | Ga0495668_0250745 | 3300046616 | Bacteria | 969 |
| 1072 | Ga0495668_0304781 | 3300046616 | Bacteria | 873 |
| 1073 | Ga0495668_0439123 | 3300046616 | Bacteria | 718 |
| 1074 | Ga0495634_0000998 | 3300046642 | Bacteria | 26678 |
| 1075 | Ga0495634_0019197 | 3300046642 | Bacteria | 4859 |
| 1076 | Ga0495634_0111197 | 3300046642 | Bacteria | 1761 |
| 1077 | Ga0495634_0402870 | 3300046642 | Bacteria | 812 |
| 1078 | Ga0495611_0040906 | 3300046648 | Bacteria | 2067 |
| 1079 | Ga0495611_0379933 | 3300046648 | Bacteria | 647 |
| 1080 | Ga0495625_0260674 | 3300046660 | Bacteria | 1122 |
| 1081 | Ga0495625_0400839 | 3300046660 | Bacteria | 857 |
| 1082 | Ga0495635_0000040 | 3300046663 | Bacteria | 86519 |
| 1083 | Ga0495635_0030879 | 3300046663 | Bacteria | 3722 |
| 1084 | Ga0495635_0084818 | 3300046663 | Bacteria | 2167 |
| 1085 | Ga0495635_0177498 | 3300046663 | Bacteria | 1448 |
| 1086 | Ga0495659_0031086 | 3300046664 | Bacteria | 1861 |
| 1087 | Ga0495659_0049398 | 3300046664 | Bacteria | 1527 |
| 1088 | Ga0495661_0108816 | 3300046665 | Bacteria | 1548 |
| 1089 | Ga0495588_0010035 | 3300046674 | Bacteria | 4389 |
| 1090 | Ga0495588_0063546 | 3300046674 | Bacteria | 1914 |
| 1091 | Ga0495588_0257880 | 3300046674 | Bacteria | 919 |
| 1092 | Ga0495657_0000218 | 3300046675 | Bacteria | 51627 |
| 1093 | Ga0495657_0204325 | 3300046675 | Bacteria | 1203 |
| 1094 | Ga0495657_0460422 | 3300046675 | Bacteria | 744 |
| 1095 | Ga0495657_0640031 | 3300046675 | Bacteria | 614 |
| 1096 | Ga0495599_0000256 | 3300046678 | Bacteria | 33627 |
| 1097 | Ga0495599_0044271 | 3300046678 | Bacteria | 2792 |
| 1098 | Ga0495599_0049469 | 3300046678 | Bacteria | 2635 |
| 1099 | Ga0495599_0097164 | 3300046678 | Bacteria | 1836 |
| 1100 | Ga0495623_0013540 | 3300046679 | Bacteria | 5288 |
| 1101 | Ga0495623_0085754 | 3300046679 | Bacteria | 1942 |
| 1102 | Ga0495623_0422695 | 3300046679 | Bacteria | 714 |
| 1103 | Ga0495623_0597224 | 3300046679 | Bacteria | 574 |
| 1104 | Ga0495646_0003573 | 3300046680 | Bacteria | 9701 |
| 1105 | Ga0495646_0083110 | 3300046680 | Bacteria | 1862 |
| 1106 | Ga0495646_0534592 | 3300046680 | Bacteria | 600 |
| 1107 | Ga0495647_0001303 | 3300046681 | Bacteria | 7665 |
| 1108 | Ga0495647_0065497 | 3300046681 | Bacteria | 1443 |
| 1109 | Ga0495647_0128312 | 3300046681 | Bacteria | 1072 |
| 1110 | Ga0495647_0218145 | 3300046681 | Bacteria | 841 |
| 1111 | Ga0495658_0002344 | 3300046683 | Bacteria | 9568 |
| 1112 | Ga0495669_0004164 | 3300046684 | Bacteria | 5947 |
| 1113 | Ga0495669_0052804 | 3300046684 | Bacteria | 1827 |
| 1114 | Ga0495669_0101358 | 3300046684 | Bacteria | 1337 |
| 1115 | Ga0495669_0210326 | 3300046684 | Bacteria | 931 |
| 1116 | Ga0495669_0274305 | 3300046684 | Bacteria | 811 |
| 1117 | Ga0495669_0393434 | 3300046684 | Bacteria | 671 |
| 1118 | Ga0495613_0017244 | 3300046689 | Bacteria | 5380 |
| 1119 | Ga0495613_0148878 | 3300046689 | Bacteria | 1670 |
| 1120 | Ga0495613_0276398 | 3300046689 | Bacteria | 1167 |
| 1121 | Ga0495613_0759863 | 3300046689 | Bacteria | 635 |
| 1122 | Ga0495624_0009089 | 3300046690 | Bacteria | 6894 |
| 1123 | Ga0495624_0037826 | 3300046690 | Bacteria | 3103 |
| 1124 | Ga0495624_0295698 | 3300046690 | Bacteria | 977 |
| 1125 | Ga0495624_0523356 | 3300046690 | Bacteria | 709 |
| 1126 | Ga0495670_0082771 | 3300046691 | Bacteria | 1636 |
| 1127 | Ga0495670_0170470 | 3300046691 | Bacteria | 1146 |
| 1128 | Ga0495671_0074187 | 3300046692 | Bacteria | 1669 |
| 1129 | Ga0495671_0153623 | 3300046692 | Bacteria | 1120 |
| 1130 | Ga0495649_0276088 | 3300046694 | Bacteria | 859 |
| 1131 | Ga0495589_0243042 | 3300046794 | Bacteria | 842 |
| 1132 | Ga0495589_0381400 | 3300046794 | Bacteria | 648 |
| 1133 | Ga0495600_0000541 | 3300046809 | Bacteria | 19518 |
| 1134 | Ga0495600_0067787 | 3300046809 | Bacteria | 2332 |
| 1135 | Ga0495600_0086718 | 3300046809 | Bacteria | 2042 |
| 1136 | Ga0495581_0003140 | 3300047315 | Bacteria | 9453 |
| 1137 | Ga0495581_0023393 | 3300047315 | Bacteria | 3580 |
| 1138 | Ga0495581_0061621 | 3300047315 | Bacteria | 2168 |
| 1139 | Ga0495581_0066144 | 3300047315 | Bacteria | 2090 |
| 1140 | Ga0495581_0623858 | 3300047315 | Bacteria | 624 |
| 1141 | Ga0495604_0001811 | 3300047317 | Bacteria | 17417 |
| 1142 | Ga0495604_0343396 | 3300047317 | Bacteria | 993 |
| 1143 | Ga0495604_0402588 | 3300047317 | Bacteria | 901 |
| 1144 | Ga0495604_0521387 | 3300047317 | Bacteria | 769 |
| 1145 | Ga0495604_0594829 | 3300047317 | Bacteria | 710 |
| 1146 | Ga0495636_0464653 | 3300047318 | Bacteria | 609 |
| 1147 | Ga0495674_0000600 | 3300047319 | Bacteria | 33795 |
| 1148 | Ga0495674_0077886 | 3300047319 | Bacteria | 2850 |
| 1149 | Ga0495674_0634500 | 3300047319 | Bacteria | 843 |
| 1150 | Ga0495674_0750856 | 3300047319 | Bacteria | 762 |
| 1151 | Ga0495672_0007934 | 3300047320 | Bacteria | 7915 |
| 1152 | Ga0495672_0200728 | 3300047320 | Bacteria | 997 |
| 1153 | Ga0495672_0260818 | 3300047320 | Bacteria | 836 |
| 1154 | Ga0495676_0037688 | 3300047321 | Bacteria | 4021 |
| 1155 | Ga0495676_0046483 | 3300047321 | Bacteria | 3522 |
| 1156 | Ga0495676_0049266 | 3300047321 | Bacteria | 3389 |
| 1157 | Ga0495676_0320194 | 3300047321 | Bacteria | 1042 |
| 1158 | Ga0495680_0011919 | 3300047322 | Bacteria | 7672 |
| 1159 | Ga0495680_0059137 | 3300047322 | Bacteria | 2960 |
| 1160 | Ga0495680_0080401 | 3300047322 | Bacteria | 2463 |
| 1161 | Ga0495680_0396202 | 3300047322 | Bacteria | 954 |
| 1162 | Ga0495680_0433135 | 3300047322 | Bacteria | 903 |
| 1163 | Ga0495680_0501396 | 3300047322 | Bacteria | 824 |
| 1164 | Ga0495683_0058376 | 3300047323 | Bacteria | 1917 |
| 1165 | Ga0495683_0088393 | 3300047323 | Bacteria | 1504 |
| 1166 | Ga0495683_0158602 | 3300047323 | Bacteria | 1048 |
| 1167 | Ga0495675_0055004 | 3300047444 | Bacteria | 2524 |
| 1168 | Ga0495677_0123238 | 3300047445 | Bacteria | 989 |
| 1169 | Ga0495677_0362708 | 3300047445 | Bacteria | 572 |
| 1170 | Ga0495679_050073 | 3300047446 | Bacteria | 1258 |
| 1171 | Ga0495685_282846 | 3300047447 | Bacteria | 523 |
| 1172 | Ga0495673_0064876 | 3300047469 | Bacteria | 1552 |
| 1173 | Ga0495673_0091021 | 3300047469 | Bacteria | 1246 |
| 1174 | Ga0495673_0260515 | 3300047469 | Bacteria | 631 |
| 1175 | Ga0495684_0000023 | 3300047471 | Bacteria | 133626 |
| 1176 | Ga0495684_0035362 | 3300047471 | Bacteria | 3831 |
| 1177 | Ga0495684_0041506 | 3300047471 | Bacteria | 3526 |
| 1178 | Ga0495593_0003332 | 3300047673 | Bacteria | 9624 |
| 1179 | Ga0495593_0005773 | 3300047673 | Bacteria | 7300 |
| 1180 | Ga0495593_0086730 | 3300047673 | Bacteria | 1614 |
| 1181 | Ga0495602_0008270 | 3300048088 | Bacteria | 10865 |
| 1182 | Ga0495602_0079174 | 3300048088 | Bacteria | 2773 |
| 1183 | Ga0495602_0222208 | 3300048088 | Bacteria | 1425 |
| 1184 | Ga0495602_0480250 | 3300048088 | Bacteria | 872 |
| 1185 | Ga0495614_0513275 | 3300048089 | Bacteria | 571 |
| 1186 | Ga0496100_0005982 | 3300048903 | Bacteria | 6600 |
| 1187 | Ga0496100_0162736 | 3300048903 | Bacteria | 1601 |
| 1188 | Ga0496100_0386942 | 3300048903 | Bacteria | 1063 |
| 1189 | Ga0496101_0025777 | 3300048904 | Bacteria | 4081 |
| 1190 | Ga0496101_0038511 | 3300048904 | Bacteria | 3396 |
| 1191 | Ga0496101_0224261 | 3300048904 | Bacteria | 1459 |
| 1192 | Ga0496101_0637589 | 3300048904 | Bacteria | 842 |
| 1193 | Ga0496102_0008125 | 3300048905 | Bacteria | 8979 |
| 1194 | Ga0496102_0156905 | 3300048905 | Bacteria | 2139 |
| 1195 | Ga0496102_0275430 | 3300048905 | Bacteria | 1586 |
| 1196 | Ga0496102_0311979 | 3300048905 | Bacteria | 1482 |
| 1197 | Ga0496102_0558399 | 3300048905 | Bacteria | 1068 |
| 1198 | Ga0496103_0042708 | 3300048906 | Bacteria | 2791 |
| 1199 | Ga0496103_0126537 | 3300048906 | Bacteria | 1630 |
| 1200 | Ga0496104_0020842 | 3300048907 | Bacteria | 6011 |
| 1201 | Ga0496104_0029258 | 3300048907 | Bacteria | 5109 |
| 1202 | Ga0496104_0075547 | 3300048907 | Bacteria | 3208 |
| 1203 | Ga0496104_0370557 | 3300048907 | Bacteria | 1345 |
| 1204 | Ga0496104_0393197 | 3300048907 | Bacteria | 1298 |
| 1205 | Ga0496105_0008473 | 3300048908 | Bacteria | 7989 |
| 1206 | Ga0496105_0054973 | 3300048908 | Bacteria | 3287 |
| 1207 | Ga0496105_0255995 | 3300048908 | Bacteria | 1417 |
| 1208 | Ga0496105_0275710 | 3300048908 | Bacteria | 1357 |
| 1209 | Ga0496105_0320305 | 3300048908 | Bacteria | 1243 |
| 1210 | Ga0496105_0805733 | 3300048908 | Bacteria | 714 |
| 1211 | Ga0496106_0008202 | 3300048909 | Bacteria | 7720 |
| 1212 | Ga0496106_0041693 | 3300048909 | Bacteria | 3440 |
| 1213 | Ga0496106_0046901 | 3300048909 | Bacteria | 3250 |
| 1214 | Ga0496106_0050608 | 3300048909 | Bacteria | 3131 |
| 1215 | Ga0496106_0061464 | 3300048909 | Bacteria | 2850 |
| 1216 | Ga0496106_0075215 | 3300048909 | Bacteria | 2587 |
| 1217 | Ga0496106_1198276 | 3300048909 | Bacteria | 592 |
| 1218 | Ga0496107_0022899 | 3300048910 | Bacteria | 4416 |
| 1219 | Ga0496107_0035705 | 3300048910 | Bacteria | 3564 |
| 1220 | Ga0496107_0065602 | 3300048910 | Bacteria | 2632 |
| 1221 | Ga0496107_0168783 | 3300048910 | Bacteria | 1623 |
| 1222 | Ga0496107_0176583 | 3300048910 | Bacteria | 1586 |
| 1223 | Ga0496107_0216401 | 3300048910 | Bacteria | 1425 |
| 1224 | Ga0496107_0612891 | 3300048910 | Bacteria | 804 |
| 1225 | Ga0496107_0636235 | 3300048910 | Bacteria | 787 |
| 1226 | Ga0496108_0003213 | 3300048911 | Bacteria | 13143 |
| 1227 | Ga0496108_0010940 | 3300048911 | Bacteria | 7368 |
| 1228 | Ga0496108_0012155 | 3300048911 | Bacteria | 7001 |
| 1229 | Ga0496108_0039596 | 3300048911 | Bacteria | 3928 |
| 1230 | Ga0496108_0053217 | 3300048911 | Bacteria | 3394 |
| 1231 | Ga0496108_1352100 | 3300048911 | Bacteria | 597 |
| 1232 | Ga0496109_0002585 | 3300048912 | Bacteria | 15162 |
| 1233 | Ga0496109_0016135 | 3300048912 | Bacteria | 6528 |
| 1234 | Ga0496109_0025566 | 3300048912 | Bacteria | 5263 |
| 1235 | Ga0496109_0260761 | 3300048912 | Bacteria | 1632 |
| 1236 | Ga0496109_0507382 | 3300048912 | Bacteria | 1138 |
| 1237 | Ga0496109_1310615 | 3300048912 | Bacteria | 660 |
| 1238 | Ga0496110_0005094 | 3300048913 | Bacteria | 10266 |
| 1239 | Ga0496110_0009693 | 3300048913 | Bacteria | 7800 |
| 1240 | Ga0496110_0011502 | 3300048913 | Bacteria | 7245 |
| 1241 | Ga0496110_0090813 | 3300048913 | Bacteria | 2731 |
| 1242 | Ga0496110_0109266 | 3300048913 | Bacteria | 2483 |
| 1243 | Ga0496110_0215738 | 3300048913 | Bacteria | 1745 |
| 1244 | Ga0496110_0298264 | 3300048913 | Bacteria | 1468 |
| 1245 | Ga0496110_1152860 | 3300048913 | Bacteria | 684 |
| 1246 | Ga0496111_0041081 | 3300048914 | Bacteria | 3318 |
| 1247 | Ga0496111_0152865 | 3300048914 | Bacteria | 1712 |
| 1248 | Ga0496111_0164446 | 3300048914 | Bacteria | 1648 |
| 1249 | Ga0496111_0165666 | 3300048914 | Bacteria | 1641 |
| 1250 | Ga0496111_0204773 | 3300048914 | Bacteria | 1466 |
| 1251 | Ga0496111_0266366 | 3300048914 | Bacteria | 1271 |
| 1252 | Ga0496112_0000031 | 3300048915 | Bacteria | 120022 |
| 1253 | Ga0496112_0002881 | 3300048915 | Bacteria | 13996 |
| 1254 | Ga0496112_0055524 | 3300048915 | Bacteria | 3894 |
| 1255 | Ga0496112_0118015 | 3300048915 | Bacteria | 2623 |
| 1256 | Ga0496112_0189893 | 3300048915 | Bacteria | 2016 |
| 1257 | Ga0496112_0366845 | 3300048915 | Bacteria | 1381 |
| 1258 | Ga0496113_0006041 | 3300048916 | Bacteria | 7629 |
| 1259 | Ga0496113_0014440 | 3300048916 | Bacteria | 5387 |
| 1260 | Ga0496113_0039454 | 3300048916 | Bacteria | 3475 |
| 1261 | Ga0496113_1074691 | 3300048916 | Bacteria | 632 |
| 1262 | Ga0496114_0028470 | 3300048917 | Bacteria | 4586 |
| 1263 | Ga0496114_0090800 | 3300048917 | Bacteria | 2593 |
| 1264 | Ga0496114_0271973 | 3300048917 | Bacteria | 1493 |
| 1265 | Ga0496114_0631052 | 3300048917 | Bacteria | 944 |
| 1266 | Ga0496114_1571325 | 3300048917 | Bacteria | 546 |
| 1267 | Ga0496115_0010614 | 3300048918 | Bacteria | 6888 |
| 1268 | Ga0496115_0038527 | 3300048918 | Bacteria | 3793 |
| 1269 | Ga0496115_0068732 | 3300048918 | Bacteria | 2868 |
| 1270 | Ga0496115_0138134 | 3300048918 | Bacteria | 2010 |
| 1271 | Ga0496115_0158378 | 3300048918 | Bacteria | 1871 |
| 1272 | Ga0496115_0172524 | 3300048918 | Bacteria | 1788 |
| 1273 | Ga0496115_0234195 | 3300048918 | Bacteria | 1514 |
| 1274 | Ga0496115_0616443 | 3300048918 | Bacteria | 861 |
| 1275 | Ga0496118_0001670 | 3300048921 | Bacteria | 32550 |
| 1276 | Ga0496118_0043015 | 3300048921 | Bacteria | 3556 |
| 1277 | Ga0496119_0064309 | 3300048922 | Bacteria | 2179 |
| 1278 | Ga0496119_0405635 | 3300048922 | Bacteria | 649 |
| 1279 | Ga0496120_0093413 | 3300048923 | Bacteria | 1603 |
| 1280 | Ga0496120_0129130 | 3300048923 | Bacteria | 1297 |
| 1281 | Ga0496121_0000183 | 3300048924 | Bacteria | 139168 |
| 1282 | Ga0496121_0001473 | 3300048924 | Bacteria | 39642 |
| 1283 | Ga0496121_0002518 | 3300048924 | Bacteria | 27800 |
| 1284 | Ga0496121_0157177 | 3300048924 | Bacteria | 1667 |
| 1285 | Ga0496121_0219605 | 3300048924 | Bacteria | 1340 |
| 1286 | Ga0496121_0381970 | 3300048924 | Bacteria | 928 |
| 1287 | Ga0496124_0001382 | 3300048927 | Bacteria | 36359 |
| 1288 | Ga0496124_0016454 | 3300048927 | Bacteria | 7028 |
| 1289 | Ga0496124_0299139 | 3300048927 | Bacteria | 1163 |
| 1290 | Ga0496125_0048308 | 3300048928 | Bacteria | 3550 |
| 1291 | Ga0496125_0060785 | 3300048928 | Bacteria | 3034 |
| 1292 | Ga0496126_0004491 | 3300048929 | Bacteria | 16643 |
| 1293 | Ga0496126_0013413 | 3300048929 | Bacteria | 8338 |
| 1294 | Ga0496126_0063841 | 3300048929 | Bacteria | 3300 |
| 1295 | Ga0496126_0115146 | 3300048929 | Bacteria | 2338 |
| 1296 | Ga0496126_0129927 | 3300048929 | Bacteria | 2177 |
| 1297 | Ga0496126_0223766 | 3300048929 | Bacteria | 1579 |
| 1298 | Ga0496126_0242172 | 3300048929 | Bacteria | 1506 |
| 1299 | Ga0496126_0394707 | 3300048929 | Bacteria | 1123 |
| 1300 | Ga0496126_0498782 | 3300048929 | Bacteria | 973 |
| 1301 | Ga0496126_0534124 | 3300048929 | Bacteria | 933 |
| 1302 | Ga0496126_0643537 | 3300048929 | Bacteria | 830 |
| 1303 | Ga0495678_065656 | 3300049459 | Bacteria | 1346 |
| 1304 | Ga0495682_0171067 | 3300049460 | Bacteria | 773 |
| 1305 | Ga0501031_0000442 | 3300049568 | Bacteria | 23895 |
| 1306 | Ga0501032_0000773 | 3300049569 | Bacteria | 25943 |
| 1307 | Ga0501033_0000025 | 3300049570 | Bacteria | 173634 |
| 1308 | Ga0501033_0336470 | 3300049570 | Bacteria | 1059 |
| 1309 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 1310 | Ga0501036_0000069 | 3300049572 | Bacteria | 64331 |
| 1311 | Ga0501037_0000034 | 3300049573 | Bacteria | 126321 |
| 1312 | Ga0501038_0000537 | 3300049574 | Bacteria | 33396 |
| 1313 | Ga0501039_0000198 | 3300049575 | Bacteria | 43456 |
| 1314 | Ga0501042_0670899 | 3300049578 | Bacteria | 754 |
| 1315 | Ga0501043_0001044 | 3300049579 | Bacteria | 24351 |
| 1316 | Ga0501046_0011176 | 3300049580 | Bacteria | 7691 |
| 1317 | Ga0501047_0000587 | 3300049581 | Bacteria | 38665 |
| 1318 | Ga0501047_0047916 | 3300049581 | Bacteria | 4128 |
| 1319 | Ga0501047_0748050 | 3300049581 | Bacteria | 794 |
| 1320 | Ga0501048_0008991 | 3300049582 | Bacteria | 7520 |
| 1321 | Ga0501067_0000331 | 3300049583 | Bacteria | 25804 |
| 1322 | Ga0501067_0056192 | 3300049583 | Bacteria | 2181 |
| 1323 | Ga0501068_0000039 | 3300049584 | Bacteria | 48466 |
| 1324 | Ga0501069_0000910 | 3300049585 | Bacteria | 14124 |
| 1325 | Ga0501069_0029131 | 3300049585 | Bacteria | 3030 |
| 1326 | Ga0501069_0410822 | 3300049585 | Bacteria | 802 |
| 1327 | Ga0501070_0033515 | 3300049586 | Bacteria | 4298 |
| 1328 | Ga0501070_0140507 | 3300049586 | Bacteria | 1994 |
| 1329 | Ga0501070_0282353 | 3300049586 | Bacteria | 1354 |
| 1330 | Ga0501070_0306690 | 3300049586 | Bacteria | 1292 |
| 1331 | Ga0501072_0007314 | 3300049588 | Bacteria | 8375 |
| 1332 | Ga0501072_0250013 | 3300049588 | Bacteria | 1412 |
| 1333 | Ga0501073_0000236 | 3300049589 | Bacteria | 36413 |
| 1334 | Ga0501073_0069491 | 3300049589 | Bacteria | 2454 |
| 1335 | Ga0501074_0000048 | 3300049590 | Bacteria | 56982 |
| 1336 | Ga0501074_0030647 | 3300049590 | Bacteria | 3898 |
| 1337 | Ga0501257_204124 | 3300049686 | Bacteria | 569 |
| 1338 | Ga0501225_0182944 | 3300049705 | Bacteria | 656 |
| 1339 | Ga0501079_0011390 | 3300049741 | Bacteria | 6788 |
| 1340 | Ga0501079_0828095 | 3300049741 | Bacteria | 729 |
| 1341 | Ga0501080_0034680 | 3300049742 | Bacteria | 4712 |
| 1342 | Ga0501080_0278675 | 3300049742 | Bacteria | 1520 |
| 1343 | Ga0501080_0472463 | 3300049742 | Bacteria | 1122 |
| 1344 | Ga0501081_1022083 | 3300049743 | Bacteria | 625 |
| 1345 | Ga0501083_0030815 | 3300049744 | Bacteria | 3681 |
| 1346 | Ga0501035_0000865 | 3300049822 | Bacteria | 32300 |
| 1347 | Ga0501044_0000028 | 3300049823 | Bacteria | 179203 |
| 1348 | Ga0501044_0070718 | 3300049823 | Bacteria | 3549 |
| 1349 | Ga0501044_0180205 | 3300049823 | Bacteria | 2080 |
| 1350 | Ga0501044_0777983 | 3300049823 | Bacteria | 838 |
| 1351 | Ga0501045_0191681 | 3300049824 | Bacteria | 1523 |
| 1352 | nmdc:mga03683_245279_c1 | 3300050489 | Bacteria | 831 |
| 1353 | nmdc:mga03683_555581_c1 | 3300050489 | Bacteria | 559 |
| 1354 | nmdc:mga0yw44_172489_c1 | 3300050492 | Bacteria | 552 |
| 1355 | nmdc:mga0yw44_343361_c1 | 3300050492 | Bacteria | 1004 |
| 1356 | nmdc:mga0k408_184235_c2 | 3300050493 | Bacteria | 502 |
| 1357 | nmdc:mga0k408_29543_c1 | 3300050493 | Bacteria | 3121 |
| 1358 | nmdc:mga0k408_611302_c1 | 3300050493 | Bacteria | 642 |
| 1359 | nmdc:mga0k408_695351_c1 | 3300050493 | Bacteria | 596 |
| 1360 | nmdc:mga06z11_191886_c1 | 3300050494 | Bacteria | 1183 |
| 1361 | nmdc:mga06z11_298778_c1 | 3300050494 | Bacteria | 957 |
| 1362 | nmdc:mga04h51_171599_c1 | 3300050495 | Bacteria | 840 |
| 1363 | nmdc:mga07m45_103042_c1 | 3300050496 | Bacteria | 1640 |
| 1364 | nmdc:mga07m45_479438_c1 | 3300050496 | Bacteria | 721 |
| 1365 | nmdc:mga07m45_907950_c1 | 3300050496 | Bacteria | 504 |
| 1366 | nmdc:mga06r32_564965_c1 | 3300050510 | Bacteria | 1110 |
| 1367 | nmdc:mga08y16_314653_c1 | 3300050511 | Bacteria | 1612 |
| 1368 | nmdc:mga0n895_158416_c1 | 3300050512 | Bacteria | 2295 |
| 1369 | nmdc:mga0n895_354924_c1 | 3300050512 | Bacteria | 1485 |
| 1370 | nmdc:mga0rr50_700405_c1 | 3300050513 | Bacteria | 864 |
| 1371 | nmdc:mga08x19_104020_c1 | 3300050514 | Bacteria | 1886 |
| 1372 | nmdc:mga0a205_1029238_c1 | 3300050515 | Bacteria | 670 |
| 1373 | nmdc:mga0sz30_202315_c1 | 3300050516 | Bacteria | 882 |
| 1374 | nmdc:mga0sz30_345707_c1 | 3300050516 | Bacteria | 664 |
| 1375 | Ga0495601_0032809 | 3300053077 | Bacteria | 3234 |
| 1376 | Ga0495601_0047559 | 3300053077 | Bacteria | 2701 |
| 1377 | Ga0495601_0050146 | 3300053077 | Bacteria | 2632 |
| 1378 | Ga0495601_0221914 | 3300053077 | Bacteria | 1235 |
| 1379 | Ga0495612_0086620 | 3300053078 | Bacteria | 1321 |
| 1380 | Ga0495612_0163605 | 3300053078 | Bacteria | 972 |
| 1381 | Ga0500635_0003272 | 3300053080 | Bacteria | 4065 |
| 1382 | Ga0500635_0024104 | 3300053080 | Bacteria | 1905 |
| 1383 | Ga0500635_0033210 | 3300053080 | Bacteria | 1682 |
| 1384 | Ga0495655_0134726 | 3300053083 | Bacteria | 764 |
| 1385 | Ga0495595_0000634 | 3300053084 | Bacteria | 13368 |
| 1386 | Ga0495595_0096720 | 3300053084 | Bacteria | 1422 |
| 1387 | Ga0495595_0245576 | 3300053084 | Bacteria | 896 |
| 1388 | Ga0495595_0574087 | 3300053084 | Bacteria | 576 |
| 1389 | Ga0495619_0000697 | 3300053085 | Bacteria | 21975 |
| 1390 | Ga0495619_0013615 | 3300053085 | Bacteria | 5126 |
| 1391 | Ga0495619_0072468 | 3300053085 | Bacteria | 2307 |
| 1392 | Ga0495619_0531461 | 3300053085 | Bacteria | 808 |
| 1393 | Ga0495619_0639362 | 3300053085 | Bacteria | 726 |
| 1394 | Ga0500578_0261630 | 3300053086 | Bacteria | 1039 |
| 1395 | Ga0500578_0319122 | 3300053086 | Bacteria | 916 |
| 1396 | Ga0500647_0055764 | 3300053091 | Bacteria | 1901 |
| 1397 | Ga0500647_0291114 | 3300053091 | Bacteria | 702 |
| 1398 | Ga0500583_0073951 | 3300053092 | Bacteria | 1635 |
| 1399 | Ga0500583_0417295 | 3300053092 | Bacteria | 641 |
| 1400 | Ga0500651_0030288 | 3300053093 | Bacteria | 3404 |
| 1401 | Ga0500651_0030472 | 3300053093 | Bacteria | 3394 |
| 1402 | Ga0500651_0156988 | 3300053093 | Bacteria | 1362 |
| 1403 | Ga0500566_0000010 | 3300053094 | Bacteria | 119976 |
| 1404 | Ga0500566_0051918 | 3300053094 | Bacteria | 2344 |
| 1405 | Ga0500566_0490302 | 3300053094 | Bacteria | 531 |
| 1406 | Ga0500640_000055 | 3300053095 | Bacteria | 17705 |
| 1407 | Ga0500641_0093867 | 3300053096 | Bacteria | 1282 |
| 1408 | Ga0500654_142441 | 3300053099 | Bacteria | 869 |
| 1409 | Ga0500554_000560 | 3300053102 | Bacteria | 7634 |
| 1410 | Ga0500554_027963 | 3300053102 | Bacteria | 1635 |
| 1411 | Ga0500556_0073406 | 3300053104 | Bacteria | 1281 |
| 1412 | Ga0500556_0151239 | 3300053104 | Bacteria | 915 |
| 1413 | Ga0500569_006916 | 3300053109 | Bacteria | 2517 |
| 1414 | Ga0500572_000088 | 3300053111 | Bacteria | 29518 |
| 1415 | Ga0500572_001292 | 3300053111 | Bacteria | 6993 |
| 1416 | Ga0500591_200314 | 3300053115 | Bacteria | 691 |
| 1417 | Ga0500595_000967 | 3300053119 | Bacteria | 16141 |
| 1418 | Ga0500595_001717 | 3300053119 | Bacteria | 11435 |
| 1419 | Ga0500595_002830 | 3300053119 | Bacteria | 8341 |
| 1420 | Ga0500595_006501 | 3300053119 | Bacteria | 4949 |
| 1421 | Ga0500595_008515 | 3300053119 | Bacteria | 4186 |
| 1422 | Ga0500608_061747 | 3300053122 | Bacteria | 1790 |
| 1423 | Ga0500608_112922 | 3300053122 | Bacteria | 1243 |
| 1424 | Ga0500614_000734 | 3300053123 | Bacteria | 8346 |
| 1425 | Ga0500655_065207 | 3300053133 | Bacteria | 737 |
| 1426 | Ga0500658_0069848 | 3300053134 | Bacteria | 1479 |
| 1427 | Ga0500658_0221356 | 3300053134 | Bacteria | 868 |
| 1428 | Ga0500559_0001744 | 3300053136 | Bacteria | 11938 |
| 1429 | Ga0500559_0024871 | 3300053136 | Bacteria | 2548 |
| 1430 | Ga0500559_0088109 | 3300053136 | Bacteria | 1418 |
| 1431 | Ga0500568_0023381 | 3300053139 | Bacteria | 2629 |
| 1432 | Ga0500568_0093224 | 3300053139 | Bacteria | 1135 |
| 1433 | Ga0500568_0119209 | 3300053139 | Bacteria | 984 |
| 1434 | Ga0500573_0147868 | 3300053140 | Bacteria | 1288 |
| 1435 | Ga0500577_0118571 | 3300053142 | Bacteria | 1099 |
| 1436 | Ga0500588_0017368 | 3300053146 | Bacteria | 1877 |
| 1437 | Ga0500589_046444 | 3300053147 | Bacteria | 2022 |
| 1438 | Ga0500590_105444 | 3300053148 | Bacteria | 1346 |
| 1439 | Ga0500590_176307 | 3300053148 | Bacteria | 934 |
| 1440 | Ga0500590_189746 | 3300053148 | Bacteria | 882 |
| 1441 | Ga0500603_000342 | 3300053150 | Bacteria | 12168 |
| 1442 | Ga0500603_004423 | 3300053150 | Bacteria | 3008 |
| 1443 | Ga0500603_013232 | 3300053150 | Bacteria | 1910 |
| 1444 | Ga0500603_133042 | 3300053150 | Bacteria | 761 |
| 1445 | Ga0500603_148305 | 3300053150 | Bacteria | 726 |
| 1446 | Ga0500604_0009862 | 3300053151 | Bacteria | 2547 |
| 1447 | Ga0500619_188296 | 3300053154 | Bacteria | 695 |
| 1448 | Ga0500622_0074138 | 3300053156 | Bacteria | 1715 |
| 1449 | Ga0500627_0092869 | 3300053158 | Bacteria | 1351 |
| 1450 | Ga0500627_0415377 | 3300053158 | Bacteria | 571 |
| 1451 | Ga0500630_003317 | 3300053159 | Bacteria | 7798 |
| 1452 | Ga0500634_0171056 | 3300053161 | Bacteria | 989 |
| 1453 | Ga0500638_000712 | 3300053162 | Bacteria | 8912 |
| 1454 | Ga0500638_093941 | 3300053162 | Bacteria | 1408 |
| 1455 | Ga0500638_159196 | 3300053162 | Bacteria | 996 |
| 1456 | Ga0500638_162057 | 3300053162 | Bacteria | 983 |
| 1457 | Ga0500638_353576 | 3300053162 | Bacteria | 544 |
| 1458 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 1459 | Ga0500639_056128 | 3300053163 | Bacteria | 2040 |
| 1460 | Ga0500639_057167 | 3300053163 | Bacteria | 2018 |
| 1461 | Ga0500636_0078193 | 3300053177 | Bacteria | 1909 |
| 1462 | Ga0500636_0091378 | 3300053177 | Bacteria | 1743 |
| 1463 | Ga0500636_0194916 | 3300053177 | Bacteria | 1076 |
| 1464 | Ga0500636_0303041 | 3300053177 | Bacteria | 785 |
| 1465 | Ga0500636_0398726 | 3300053177 | Bacteria | 639 |
| 1466 | Ga0500637_0002851 | 3300053178 | Bacteria | 7795 |
| 1467 | Ga0500637_0005100 | 3300053178 | Bacteria | 6325 |
| 1468 | Ga0500637_0035858 | 3300053178 | Bacteria | 2783 |
| 1469 | Ga0500637_0364416 | 3300053178 | Bacteria | 763 |
| 1470 | Ga0500576_254031 | 3300053725 | Bacteria | 544 |
| 1471 | Ga0500609_008206 | 3300053731 | Bacteria | 1409 |
| 1472 | Ga0500552_006330 | 3300053733 | Bacteria | 1325 |
| 1473 | Ga0500596_006761 | 3300053735 | Bacteria | 1918 |
| 1474 | Ga0500596_007614 | 3300053735 | Bacteria | 1763 |
| 1475 | Ga0500601_006758 | 3300053737 | Bacteria | 1267 |
| 1476 | Ga0500587_017740 | 3300053739 | Bacteria | 914 |
| 1477 | Ga0501084_0001432 | 3300054114 | Bacteria | 18932 |
| 1478 | Ga0500661_000387 | 3300055283 | Bacteria | 8106 |
| 1479 | Ga0587115_088134 | 3300059626 | Bacteria | 560 |
| 1480 | Ga0501082_0011376 | 3300060353 | Bacteria | 7654 |
| 1481 | Ga0501082_0485625 | 3300060353 | Bacteria | 1080 |
| 1482 | Ga0501082_1589670 | 3300060353 | Bacteria | 571 |
| 1483 | Ga0466962_0140275 | 3300061719 | Bacteria | 1171 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025929 | Ga0207664_10140973 | Ga0207664_101409732 | 130 |
| 2 | 3300039437 | Ga0436365_1458230 | Ga0436365_1458230_11_412 | 130 |
| 3 | 3300039450 | Ga0436363_1278748 | Ga0436363_1278748_208_606 | 130 |
| 4 | 3300044694 | Ga0466963_0915584 | Ga0466963_0915584_155_553 | 130 |
| 5 | iso_pu_bacteria | 2508501128 | 2509150379 | 130 |
| 6 | iso_pu_bacteria | 2513237141 | 2513893561 | 130 |
| 7 | iso_pu_bacteria | 2922386360 | 2922390852 | 130 |
| 8 | iso_pu_bacteria | 8056673599 | 8056673996 | 130 |
| 9 | 3300000549 | LJQas_1006151 | LJQas_10061512 | 132 |
| 10 | 3300001904 | JGI24736J21556_1019063 | JGI24736J21556_10190632 | 132 |
| 11 | 3300001989 | JGI24739J22299_10029071 | JGI24739J22299_100290712 | 132 |
| 12 | 3300001990 | JGI24737J22298_10026448 | JGI24737J22298_100264482 | 132 |
| 13 | 3300002067 | JGI24735J21928_10036631 | JGI24735J21928_100366312 | 132 |
| 14 | 3300002067 | JGI24735J21928_10069308 | JGI24735J21928_100693082 | 132 |
| 15 | 3300002074 | JGI24748J21848_1054316 | JGI24748J21848_10543161 | 132 |
| 16 | 3300002077 | JGI24744J21845_10024791 | JGI24744J21845_100247912 | 132 |
| 17 | 3300003203 | JGI25406J46586_10020393 | JGI25406J46586_100203932 | 132 |
| 18 | 3300003203 | JGI25406J46586_10143480 | JGI25406J46586_101434801 | 132 |
| 19 | 3300003203 | JGI25406J46586_10151684 | JGI25406J46586_101516841 | 132 |
| 20 | 3300003215 | JGI25153J46596_10001436 | JGI25153J46596_1000143611 | 132 |
| 21 | 3300003320 | rootH2_10047101 | rootH2_100471012 | 132 |
| 22 | 3300003659 | JGI25404J52841_10002090 | JGI25404J52841_100020902 | 132 |
| 23 | 3300003659 | JGI25404J52841_10004756 | JGI25404J52841_100047564 | 132 |
| 24 | 3300003659 | JGI25404J52841_10019050 | JGI25404J52841_100190502 | 132 |
| 25 | 3300003659 | JGI25404J52841_10087493 | JGI25404J52841_100874932 | 132 |
| 26 | 3300003911 | JGI25405J52794_10049357 | JGI25405J52794_100493572 | 132 |
| 27 | 3300005327 | Ga0070658_10019300 | Ga0070658_100193005 | 132 |
| 28 | 3300005329 | Ga0070683_100005606 | Ga0070683_1000056069 | 132 |
| 29 | 3300005329 | Ga0070683_100045273 | Ga0070683_1000452733 | 132 |
| 30 | 3300005329 | Ga0070683_100198250 | Ga0070683_1001982503 | 132 |
| 31 | 3300005329 | Ga0070683_100565967 | Ga0070683_1005659672 | 132 |
| 32 | 3300005329 | Ga0070683_100689860 | Ga0070683_1006898602 | 132 |
| 33 | 3300005330 | Ga0070690_100395641 | Ga0070690_1003956412 | 132 |
| 34 | 3300005334 | Ga0068869_100216002 | Ga0068869_1002160022 | 132 |
| 35 | 3300005336 | Ga0070680_100015488 | Ga0070680_1000154884 | 132 |
| 36 | 3300005336 | Ga0070680_100021554 | Ga0070680_1000215544 | 132 |
| 37 | 3300005336 | Ga0070680_100147196 | Ga0070680_1001471962 | 132 |
| 38 | 3300005336 | Ga0070680_100224979 | Ga0070680_1002249791 | 132 |
| 39 | 3300005337 | Ga0070682_100073268 | Ga0070682_1000732682 | 132 |
| 40 | 3300005337 | Ga0070682_100151081 | Ga0070682_1001510812 | 132 |
| 41 | 3300005338 | Ga0068868_100014248 | Ga0068868_1000142482 | 132 |
| 42 | 3300005338 | Ga0068868_100354073 | Ga0068868_1003540732 | 132 |
| 43 | 3300005339 | Ga0070660_100062081 | Ga0070660_1000620814 | 132 |
| 44 | 3300005339 | Ga0070660_100265903 | Ga0070660_1002659031 | 132 |
| 45 | 3300005339 | Ga0070660_100587922 | Ga0070660_1005879222 | 132 |
| 46 | 3300005339 | Ga0070660_101004132 | Ga0070660_1010041321 | 132 |
| 47 | 3300005341 | Ga0070691_10086951 | Ga0070691_100869512 | 132 |
| 48 | 3300005341 | Ga0070691_10509905 | Ga0070691_105099052 | 132 |
| 49 | 3300005344 | Ga0070661_100014484 | Ga0070661_1000144843 | 132 |
| 50 | 3300005344 | Ga0070661_100462185 | Ga0070661_1004621851 | 132 |
| 51 | 3300005344 | Ga0070661_100611875 | Ga0070661_1006118752 | 132 |
| 52 | 3300005347 | Ga0070668_100024739 | Ga0070668_1000247394 | 132 |
| 53 | 3300005347 | Ga0070668_100191433 | Ga0070668_1001914331 | 132 |
| 54 | 3300005347 | Ga0070668_100288894 | Ga0070668_1002888942 | 132 |
| 55 | 3300005347 | Ga0070668_100819924 | Ga0070668_1008199242 | 132 |
| 56 | 3300005347 | Ga0070668_101286160 | Ga0070668_1012861601 | 132 |
| 57 | 3300005354 | Ga0070675_101004799 | Ga0070675_1010047992 | 132 |
| 58 | 3300005355 | Ga0070671_101279121 | Ga0070671_1012791211 | 132 |
| 59 | 3300005356 | Ga0070674_100047261 | Ga0070674_1000472614 | 132 |
| 60 | 3300005356 | Ga0070674_100940775 | Ga0070674_1009407752 | 132 |
| 61 | 3300005364 | Ga0070673_100285973 | Ga0070673_1002859731 | 132 |
| 62 | 3300005365 | Ga0070688_100121601 | Ga0070688_1001216012 | 132 |
| 63 | 3300005365 | Ga0070688_100484082 | Ga0070688_1004840821 | 132 |
| 64 | 3300005365 | Ga0070688_101100318 | Ga0070688_1011003181 | 132 |
| 65 | 3300005366 | Ga0070659_100368928 | Ga0070659_1003689282 | 132 |
| 66 | 3300005366 | Ga0070659_100503508 | Ga0070659_1005035082 | 132 |
| 67 | 3300005366 | Ga0070659_101753354 | Ga0070659_1017533541 | 132 |
| 68 | 3300005367 | Ga0070667_100435563 | Ga0070667_1004355632 | 132 |
| 69 | 3300005367 | Ga0070667_100731178 | Ga0070667_1007311781 | 132 |
| 70 | 3300005367 | Ga0070667_101284482 | Ga0070667_1012844822 | 132 |
| 71 | 3300005406 | Ga0070703_10231566 | Ga0070703_102315662 | 132 |
| 72 | 3300005434 | Ga0070709_10000102 | Ga0070709_1000010211 | 132 |
| 73 | 3300005434 | Ga0070709_10005140 | Ga0070709_100051402 | 132 |
| 74 | 3300005434 | Ga0070709_10195133 | Ga0070709_101951331 | 132 |
| 75 | 3300005434 | Ga0070709_10311965 | Ga0070709_103119652 | 132 |
| 76 | 3300005434 | Ga0070709_10492366 | Ga0070709_104923662 | 132 |
| 77 | 3300005434 | Ga0070709_10599692 | Ga0070709_105996922 | 132 |
| 78 | 3300005434 | Ga0070709_10706596 | Ga0070709_107065962 | 132 |
| 79 | 3300005435 | Ga0070714_100001753 | Ga0070714_1000017539 | 132 |
| 80 | 3300005435 | Ga0070714_100022895 | Ga0070714_1000228953 | 132 |
| 81 | 3300005435 | Ga0070714_100030514 | Ga0070714_1000305146 | 132 |
| 82 | 3300005435 | Ga0070714_100036394 | Ga0070714_1000363942 | 132 |
| 83 | 3300005435 | Ga0070714_100148831 | Ga0070714_1001488313 | 132 |
| 84 | 3300005435 | Ga0070714_100877368 | Ga0070714_1008773681 | 132 |
| 85 | 3300005435 | Ga0070714_101566761 | Ga0070714_1015667611 | 132 |
| 86 | 3300005436 | Ga0070713_100002970 | Ga0070713_1000029703 | 132 |
| 87 | 3300005436 | Ga0070713_100005921 | Ga0070713_1000059214 | 132 |
| 88 | 3300005436 | Ga0070713_100015544 | Ga0070713_1000155443 | 132 |
| 89 | 3300005436 | Ga0070713_100045016 | Ga0070713_1000450163 | 132 |
| 90 | 3300005436 | Ga0070713_100140491 | Ga0070713_1001404913 | 132 |
| 91 | 3300005436 | Ga0070713_100258975 | Ga0070713_1002589752 | 132 |
| 92 | 3300005436 | Ga0070713_100956802 | Ga0070713_1009568022 | 132 |
| 93 | 3300005437 | Ga0070710_10000526 | Ga0070710_100005265 | 132 |
| 94 | 3300005437 | Ga0070710_10019960 | Ga0070710_100199602 | 132 |
| 95 | 3300005437 | Ga0070710_10052085 | Ga0070710_100520854 | 132 |
| 96 | 3300005437 | Ga0070710_10202213 | Ga0070710_102022132 | 132 |
| 97 | 3300005437 | Ga0070710_10286858 | Ga0070710_102868582 | 132 |
| 98 | 3300005438 | Ga0070701_10369705 | Ga0070701_103697052 | 132 |
| 99 | 3300005439 | Ga0070711_100002160 | Ga0070711_1000021608 | 132 |
| 100 | 3300005439 | Ga0070711_100009157 | Ga0070711_1000091573 | 132 |
| 101 | 3300005439 | Ga0070711_100021560 | Ga0070711_1000215603 | 132 |
| 102 | 3300005439 | Ga0070711_100091166 | Ga0070711_1000911662 | 132 |
| 103 | 3300005439 | Ga0070711_100224437 | Ga0070711_1002244372 | 132 |
| 104 | 3300005439 | Ga0070711_100341792 | Ga0070711_1003417922 | 132 |
| 105 | 3300005439 | Ga0070711_100963038 | Ga0070711_1009630382 | 132 |
| 106 | 3300005440 | Ga0070705_100201702 | Ga0070705_1002017022 | 132 |
| 107 | 3300005440 | Ga0070705_100673025 | Ga0070705_1006730252 | 132 |
| 108 | 3300005441 | Ga0070700_100093566 | Ga0070700_1000935662 | 132 |
| 109 | 3300005445 | Ga0070708_100098711 | Ga0070708_1000987112 | 132 |
| 110 | 3300005455 | Ga0070663_100038273 | Ga0070663_1000382732 | 132 |
| 111 | 3300005455 | Ga0070663_100056577 | Ga0070663_1000565772 | 132 |
| 112 | 3300005455 | Ga0070663_100248007 | Ga0070663_1002480072 | 132 |
| 113 | 3300005455 | Ga0070663_100284375 | Ga0070663_1002843752 | 132 |
| 114 | 3300005455 | Ga0070663_100461541 | Ga0070663_1004615412 | 132 |
| 115 | 3300005456 | Ga0070678_100070698 | Ga0070678_1000706984 | 132 |
| 116 | 3300005456 | Ga0070678_100122013 | Ga0070678_1001220133 | 132 |
| 117 | 3300005456 | Ga0070678_101595481 | Ga0070678_1015954811 | 132 |
| 118 | 3300005457 | Ga0070662_100022874 | Ga0070662_1000228744 | 132 |
| 119 | 3300005457 | Ga0070662_100103986 | Ga0070662_1001039862 | 132 |
| 120 | 3300005457 | Ga0070662_100364458 | Ga0070662_1003644582 | 132 |
| 121 | 3300005457 | Ga0070662_100483133 | Ga0070662_1004831332 | 132 |
| 122 | 3300005458 | Ga0070681_10023500 | Ga0070681_100235003 | 132 |
| 123 | 3300005458 | Ga0070681_10032157 | Ga0070681_100321574 | 132 |
| 124 | 3300005458 | Ga0070681_10058028 | Ga0070681_100580282 | 132 |
| 125 | 3300005458 | Ga0070681_10084358 | Ga0070681_100843584 | 132 |
| 126 | 3300005458 | Ga0070681_10570220 | Ga0070681_105702201 | 132 |
| 127 | 3300005458 | Ga0070681_10845435 | Ga0070681_108454352 | 132 |
| 128 | 3300005466 | Ga0070685_10661708 | Ga0070685_106617082 | 132 |
| 129 | 3300005467 | Ga0070706_100500165 | Ga0070706_1005001652 | 132 |
| 130 | 3300005467 | Ga0070706_100777464 | Ga0070706_1007774642 | 132 |
| 131 | 3300005468 | Ga0070707_100062447 | Ga0070707_1000624473 | 132 |
| 132 | 3300005468 | Ga0070707_100183859 | Ga0070707_1001838593 | 132 |
| 133 | 3300005468 | Ga0070707_101990451 | Ga0070707_1019904511 | 132 |
| 134 | 3300005471 | Ga0070698_100220036 | Ga0070698_1002200362 | 132 |
| 135 | 3300005518 | Ga0070699_100501396 | Ga0070699_1005013961 | 132 |
| 136 | 3300005518 | Ga0070699_101198594 | Ga0070699_1011985941 | 132 |
| 137 | 3300005530 | Ga0070679_100013119 | Ga0070679_1000131192 | 132 |
| 138 | 3300005530 | Ga0070679_100026603 | Ga0070679_1000266032 | 132 |
| 139 | 3300005530 | Ga0070679_100069248 | Ga0070679_1000692482 | 132 |
| 140 | 3300005530 | Ga0070679_100104027 | Ga0070679_1001040272 | 132 |
| 141 | 3300005530 | Ga0070679_100135854 | Ga0070679_1001358541 | 132 |
| 142 | 3300005530 | Ga0070679_100536659 | Ga0070679_1005366591 | 132 |
| 143 | 3300005530 | Ga0070679_101205562 | Ga0070679_1012055621 | 132 |
| 144 | 3300005535 | Ga0070684_100013256 | Ga0070684_1000132567 | 132 |
| 145 | 3300005535 | Ga0070684_100024555 | Ga0070684_1000245553 | 132 |
| 146 | 3300005535 | Ga0070684_100326270 | Ga0070684_1003262702 | 132 |
| 147 | 3300005536 | Ga0070697_100091314 | Ga0070697_1000913142 | 132 |
| 148 | 3300005536 | Ga0070697_100446253 | Ga0070697_1004462532 | 132 |
| 149 | 3300005539 | Ga0068853_100010809 | Ga0068853_1000108095 | 132 |
| 150 | 3300005539 | Ga0068853_100015334 | Ga0068853_1000153345 | 132 |
| 151 | 3300005539 | Ga0068853_100751722 | Ga0068853_1007517222 | 132 |
| 152 | 3300005539 | Ga0068853_101244637 | Ga0068853_1012446372 | 132 |
| 153 | 3300005539 | Ga0068853_101941198 | Ga0068853_1019411981 | 132 |
| 154 | 3300005543 | Ga0070672_100264678 | Ga0070672_1002646782 | 132 |
| 155 | 3300005543 | Ga0070672_100435239 | Ga0070672_1004352392 | 132 |
| 156 | 3300005543 | Ga0070672_100674309 | Ga0070672_1006743091 | 132 |
| 157 | 3300005544 | Ga0070686_101525500 | Ga0070686_1015255001 | 132 |
| 158 | 3300005545 | Ga0070695_101049690 | Ga0070695_1010496901 | 132 |
| 159 | 3300005547 | Ga0070693_100149715 | Ga0070693_1001497152 | 132 |
| 160 | 3300005548 | Ga0070665_100067345 | Ga0070665_1000673454 | 132 |
| 161 | 3300005548 | Ga0070665_100232545 | Ga0070665_1002325452 | 132 |
| 162 | 3300005548 | Ga0070665_100633109 | Ga0070665_1006331092 | 132 |
| 163 | 3300005548 | Ga0070665_100752588 | Ga0070665_1007525882 | 132 |
| 164 | 3300005548 | Ga0070665_100803270 | Ga0070665_1008032702 | 132 |
| 165 | 3300005549 | Ga0070704_100975041 | Ga0070704_1009750412 | 132 |
| 166 | 3300005563 | Ga0068855_100013700 | Ga0068855_1000137008 | 132 |
| 167 | 3300005563 | Ga0068855_100014164 | Ga0068855_1000141642 | 132 |
| 168 | 3300005563 | Ga0068855_100033333 | Ga0068855_1000333335 | 132 |
| 169 | 3300005563 | Ga0068855_100221967 | Ga0068855_1002219672 | 132 |
| 170 | 3300005563 | Ga0068855_100750342 | Ga0068855_1007503422 | 132 |
| 171 | 3300005563 | Ga0068855_100850357 | Ga0068855_1008503572 | 132 |
| 172 | 3300005563 | Ga0068855_101088469 | Ga0068855_1010884692 | 132 |
| 173 | 3300005563 | Ga0068855_101123183 | Ga0068855_1011231831 | 132 |
| 174 | 3300005563 | Ga0068855_101554138 | Ga0068855_1015541382 | 132 |
| 175 | 3300005563 | Ga0068855_102398272 | Ga0068855_1023982721 | 132 |
| 176 | 3300005564 | Ga0070664_100662320 | Ga0070664_1006623202 | 132 |
| 177 | 3300005577 | Ga0068857_100004954 | Ga0068857_1000049549 | 132 |
| 178 | 3300005577 | Ga0068857_100025795 | Ga0068857_1000257952 | 132 |
| 179 | 3300005577 | Ga0068857_100038647 | Ga0068857_1000386474 | 132 |
| 180 | 3300005577 | Ga0068857_100153608 | Ga0068857_1001536082 | 132 |
| 181 | 3300005577 | Ga0068857_100838610 | Ga0068857_1008386102 | 132 |
| 182 | 3300005577 | Ga0068857_101369238 | Ga0068857_1013692382 | 132 |
| 183 | 3300005578 | Ga0068854_100026378 | Ga0068854_1000263782 | 132 |
| 184 | 3300005578 | Ga0068854_100631408 | Ga0068854_1006314082 | 132 |
| 185 | 3300005614 | Ga0068856_100000451 | Ga0068856_10000045131 | 132 |
| 186 | 3300005614 | Ga0068856_100000659 | Ga0068856_10000065928 | 132 |
| 187 | 3300005614 | Ga0068856_100012689 | Ga0068856_1000126892 | 132 |
| 188 | 3300005614 | Ga0068856_100521784 | Ga0068856_1005217842 | 132 |
| 189 | 3300005614 | Ga0068856_100884698 | Ga0068856_1008846982 | 132 |
| 190 | 3300005614 | Ga0068856_101305904 | Ga0068856_1013059042 | 132 |
| 191 | 3300005615 | Ga0070702_100124167 | Ga0070702_1001241672 | 132 |
| 192 | 3300005615 | Ga0070702_101135733 | Ga0070702_1011357332 | 132 |
| 193 | 3300005616 | Ga0068852_100071562 | Ga0068852_1000715623 | 132 |
| 194 | 3300005616 | Ga0068852_100139508 | Ga0068852_1001395083 | 132 |
| 195 | 3300005616 | Ga0068852_100268538 | Ga0068852_1002685383 | 132 |
| 196 | 3300005616 | Ga0068852_100427848 | Ga0068852_1004278482 | 132 |
| 197 | 3300005616 | Ga0068852_100507167 | Ga0068852_1005071672 | 132 |
| 198 | 3300005616 | Ga0068852_102437874 | Ga0068852_1024378741 | 132 |
| 199 | 3300005617 | Ga0068859_100420450 | Ga0068859_1004204502 | 132 |
| 200 | 3300005617 | Ga0068859_100737395 | Ga0068859_1007373952 | 132 |
| 201 | 3300005618 | Ga0068864_100027097 | Ga0068864_1000270977 | 132 |
| 202 | 3300005618 | Ga0068864_100289129 | Ga0068864_1002891292 | 132 |
| 203 | 3300005618 | Ga0068864_100708627 | Ga0068864_1007086272 | 132 |
| 204 | 3300005718 | Ga0068866_10212862 | Ga0068866_102128622 | 132 |
| 205 | 3300005718 | Ga0068866_10217413 | Ga0068866_102174132 | 132 |
| 206 | 3300005719 | Ga0068861_100202126 | Ga0068861_1002021261 | 132 |
| 207 | 3300005719 | Ga0068861_100588907 | Ga0068861_1005889072 | 132 |
| 208 | 3300005834 | Ga0068851_10044153 | Ga0068851_100441532 | 132 |
| 209 | 3300005834 | Ga0068851_10045043 | Ga0068851_100450434 | 132 |
| 210 | 3300005834 | Ga0068851_10057892 | Ga0068851_100578922 | 132 |
| 211 | 3300005834 | Ga0068851_10571996 | Ga0068851_105719962 | 132 |
| 212 | 3300005841 | Ga0068863_100592395 | Ga0068863_1005923951 | 132 |
| 213 | 3300005842 | Ga0068858_100084248 | Ga0068858_1000842483 | 132 |
| 214 | 3300005842 | Ga0068858_100196916 | Ga0068858_1001969162 | 132 |
| 215 | 3300005842 | Ga0068858_100428840 | Ga0068858_1004288402 | 132 |
| 216 | 3300005842 | Ga0068858_100638292 | Ga0068858_1006382922 | 132 |
| 217 | 3300005843 | Ga0068860_100008418 | Ga0068860_1000084187 | 132 |
| 218 | 3300005843 | Ga0068860_100360322 | Ga0068860_1003603222 | 132 |
| 219 | 3300005843 | Ga0068860_100677982 | Ga0068860_1006779822 | 132 |
| 220 | 3300005844 | Ga0068862_100158586 | Ga0068862_1001585862 | 132 |
| 221 | 3300005844 | Ga0068862_100174424 | Ga0068862_1001744242 | 132 |
| 222 | 3300005844 | Ga0068862_100325654 | Ga0068862_1003256542 | 132 |
| 223 | 3300005844 | Ga0068862_101177839 | Ga0068862_1011778392 | 132 |
| 224 | 3300005937 | Ga0081455_10003511 | Ga0081455_1000351115 | 132 |
| 225 | 3300005937 | Ga0081455_10007726 | Ga0081455_100077269 | 132 |
| 226 | 3300005937 | Ga0081455_10012558 | Ga0081455_100125582 | 132 |
| 227 | 3300005937 | Ga0081455_10021916 | Ga0081455_100219164 | 132 |
| 228 | 3300005937 | Ga0081455_10025903 | Ga0081455_100259032 | 132 |
| 229 | 3300005937 | Ga0081455_10037165 | Ga0081455_100371657 | 132 |
| 230 | 3300005937 | Ga0081455_10496219 | Ga0081455_104962192 | 132 |
| 231 | 3300005981 | Ga0081538_10016160 | Ga0081538_100161606 | 132 |
| 232 | 3300005983 | Ga0081540_1001538 | Ga0081540_100153813 | 132 |
| 233 | 3300005983 | Ga0081540_1002078 | Ga0081540_100207816 | 132 |
| 234 | 3300005983 | Ga0081540_1003660 | Ga0081540_10036606 | 132 |
| 235 | 3300005983 | Ga0081540_1008178 | Ga0081540_10081786 | 132 |
| 236 | 3300005983 | Ga0081540_1008898 | Ga0081540_10088984 | 132 |
| 237 | 3300005983 | Ga0081540_1014574 | Ga0081540_10145746 | 132 |
| 238 | 3300005983 | Ga0081540_1032957 | Ga0081540_10329573 | 132 |
| 239 | 3300005983 | Ga0081540_1086701 | Ga0081540_10867011 | 132 |
| 240 | 3300005983 | Ga0081540_1134711 | Ga0081540_11347112 | 132 |
| 241 | 3300005983 | Ga0081540_1305108 | Ga0081540_13051082 | 132 |
| 242 | 3300005985 | Ga0081539_10000080 | Ga0081539_10000080195 | 132 |
| 243 | 3300005985 | Ga0081539_10000498 | Ga0081539_1000049828 | 132 |
| 244 | 3300005985 | Ga0081539_10011910 | Ga0081539_100119104 | 132 |
| 245 | 3300005985 | Ga0081539_10028294 | Ga0081539_100282944 | 132 |
| 246 | 3300005985 | Ga0081539_10071100 | Ga0081539_100711002 | 132 |
| 247 | 3300005985 | Ga0081539_10194479 | Ga0081539_101944792 | 132 |
| 248 | 3300006028 | Ga0070717_10010508 | Ga0070717_100105084 | 132 |
| 249 | 3300006028 | Ga0070717_10018723 | Ga0070717_100187232 | 132 |
| 250 | 3300006028 | Ga0070717_10046983 | Ga0070717_100469832 | 132 |
| 251 | 3300006028 | Ga0070717_10053340 | Ga0070717_100533404 | 132 |
| 252 | 3300006028 | Ga0070717_10333654 | Ga0070717_103336542 | 132 |
| 253 | 3300006028 | Ga0070717_10445232 | Ga0070717_104452322 | 132 |
| 254 | 3300006028 | Ga0070717_11002044 | Ga0070717_110020441 | 132 |
| 255 | 3300006038 | Ga0075365_10021569 | Ga0075365_100215694 | 132 |
| 256 | 3300006038 | Ga0075365_10176696 | Ga0075365_101766962 | 132 |
| 257 | 3300006038 | Ga0075365_10379106 | Ga0075365_103791062 | 132 |
| 258 | 3300006042 | Ga0075368_10247084 | Ga0075368_102470841 | 132 |
| 259 | 3300006048 | Ga0075363_100357461 | Ga0075363_1003574611 | 132 |
| 260 | 3300006048 | Ga0075363_100497625 | Ga0075363_1004976252 | 132 |
| 261 | 3300006173 | Ga0070716_100001641 | Ga0070716_1000016414 | 132 |
| 262 | 3300006173 | Ga0070716_100002831 | Ga0070716_1000028314 | 132 |
| 263 | 3300006173 | Ga0070716_100665850 | Ga0070716_1006658502 | 132 |
| 264 | 3300006173 | Ga0070716_100844507 | Ga0070716_1008445072 | 132 |
| 265 | 3300006173 | Ga0070716_101609299 | Ga0070716_1016092991 | 132 |
| 266 | 3300006175 | Ga0070712_100026574 | Ga0070712_1000265743 | 132 |
| 267 | 3300006175 | Ga0070712_100153424 | Ga0070712_1001534242 | 132 |
| 268 | 3300006175 | Ga0070712_101414810 | Ga0070712_1014148101 | 132 |
| 269 | 3300006177 | Ga0075362_10187526 | Ga0075362_101875262 | 132 |
| 270 | 3300006177 | Ga0075362_10195509 | Ga0075362_101955092 | 132 |
| 271 | 3300006178 | Ga0075367_10023235 | Ga0075367_100232354 | 132 |
| 272 | 3300006178 | Ga0075367_10373781 | Ga0075367_103737812 | 132 |
| 273 | 3300006178 | Ga0075367_10437006 | Ga0075367_104370062 | 132 |
| 274 | 3300006178 | Ga0075367_10440525 | Ga0075367_104405251 | 132 |
| 275 | 3300006195 | Ga0075366_10165600 | Ga0075366_101656002 | 132 |
| 276 | 3300006195 | Ga0075366_10243110 | Ga0075366_102431102 | 132 |
| 277 | 3300006195 | Ga0075366_10837026 | Ga0075366_108370262 | 132 |
| 278 | 3300006195 | Ga0075366_10977563 | Ga0075366_109775631 | 132 |
| 279 | 3300006237 | Ga0097621_100061477 | Ga0097621_1000614773 | 132 |
| 280 | 3300006237 | Ga0097621_100196156 | Ga0097621_1001961562 | 132 |
| 281 | 3300006237 | Ga0097621_100205780 | Ga0097621_1002057802 | 132 |
| 282 | 3300006237 | Ga0097621_101842056 | Ga0097621_1018420561 | 132 |
| 283 | 3300006237 | Ga0097621_101889315 | Ga0097621_1018893151 | 132 |
| 284 | 3300006353 | Ga0075370_10362605 | Ga0075370_103626051 | 132 |
| 285 | 3300006358 | Ga0068871_100305229 | Ga0068871_1003052293 | 132 |
| 286 | 3300006358 | Ga0068871_100704021 | Ga0068871_1007040212 | 132 |
| 287 | 3300006358 | Ga0068871_100857972 | Ga0068871_1008579722 | 132 |
| 288 | 3300006358 | Ga0068871_100949221 | Ga0068871_1009492212 | 132 |
| 289 | 3300006871 | Ga0075434_100452156 | Ga0075434_1004521562 | 132 |
| 290 | 3300006880 | Ga0075429_100897583 | Ga0075429_1008975831 | 132 |
| 291 | 3300006881 | Ga0068865_100050924 | Ga0068865_1000509242 | 132 |
| 292 | 3300006881 | Ga0068865_100180232 | Ga0068865_1001802322 | 132 |
| 293 | 3300006931 | Ga0097620_100420422 | Ga0097620_1004204222 | 132 |
| 294 | 3300006931 | Ga0097620_100737365 | Ga0097620_1007373651 | 132 |
| 295 | 3300006941 | Ga0099825_1039359 | Ga0099825_10393592 | 132 |
| 296 | 3300006942 | Ga0099824_1006683 | Ga0099824_10066837 | 132 |
| 297 | 3300006943 | Ga0099822_1000418 | Ga0099822_100041815 | 132 |
| 298 | 3300007076 | Ga0075435_100724066 | Ga0075435_1007240661 | 132 |
| 299 | 3300007265 | Ga0099794_10029452 | Ga0099794_100294524 | 132 |
| 300 | 3300007265 | Ga0099794_10111805 | Ga0099794_101118052 | 132 |
| 301 | 3300007265 | Ga0099794_10128782 | Ga0099794_101287822 | 132 |
| 302 | 3300007265 | Ga0099794_10458609 | Ga0099794_104586091 | 132 |
| 303 | 3300007265 | Ga0099794_10474923 | Ga0099794_104749231 | 132 |
| 304 | 3300007788 | Ga0099795_10080174 | Ga0099795_100801742 | 132 |
| 305 | 3300007788 | Ga0099795_10096198 | Ga0099795_100961981 | 132 |
| 306 | 3300007788 | Ga0099795_10128064 | Ga0099795_101280641 | 132 |
| 307 | 3300007788 | Ga0099795_10308116 | Ga0099795_103081162 | 132 |
| 308 | 3300007788 | Ga0099795_10335215 | Ga0099795_103352152 | 132 |
| 309 | 3300007788 | Ga0099795_10385831 | Ga0099795_103858312 | 132 |
| 310 | 3300009011 | Ga0105251_10560716 | Ga0105251_105607161 | 132 |
| 311 | 3300009036 | Ga0105244_10421508 | Ga0105244_104215082 | 132 |
| 312 | 3300009092 | Ga0105250_10018383 | Ga0105250_100183832 | 132 |
| 313 | 3300009093 | Ga0105240_10010878 | Ga0105240_100108785 | 132 |
| 314 | 3300009093 | Ga0105240_10026626 | Ga0105240_100266264 | 132 |
| 315 | 3300009093 | Ga0105240_10097500 | Ga0105240_100975004 | 132 |
| 316 | 3300009093 | Ga0105240_10155163 | Ga0105240_101551632 | 132 |
| 317 | 3300009093 | Ga0105240_10236739 | Ga0105240_102367392 | 132 |
| 318 | 3300009093 | Ga0105240_10427922 | Ga0105240_104279222 | 132 |
| 319 | 3300009093 | Ga0105240_10608267 | Ga0105240_106082672 | 132 |
| 320 | 3300009094 | Ga0111539_10174814 | Ga0111539_101748142 | 132 |
| 321 | 3300009094 | Ga0111539_10439612 | Ga0111539_104396122 | 132 |
| 322 | 3300009098 | Ga0105245_10026065 | Ga0105245_100260653 | 132 |
| 323 | 3300009098 | Ga0105245_11121040 | Ga0105245_111210402 | 132 |
| 324 | 3300009101 | Ga0105247_10044664 | Ga0105247_100446641 | 132 |
| 325 | 3300009101 | Ga0105247_10144089 | Ga0105247_101440893 | 132 |
| 326 | 3300009101 | Ga0105247_10203570 | Ga0105247_102035702 | 132 |
| 327 | 3300009101 | Ga0105247_10867839 | Ga0105247_108678391 | 132 |
| 328 | 3300009101 | Ga0105247_11646848 | Ga0105247_116468481 | 132 |
| 329 | 3300009148 | Ga0105243_10059410 | Ga0105243_100594104 | 132 |
| 330 | 3300009148 | Ga0105243_10659051 | Ga0105243_106590512 | 132 |
| 331 | 3300009174 | Ga0105241_10000375 | Ga0105241_100003755 | 132 |
| 332 | 3300009174 | Ga0105241_10237331 | Ga0105241_102373312 | 132 |
| 333 | 3300009174 | Ga0105241_10565195 | Ga0105241_105651951 | 132 |
| 334 | 3300009174 | Ga0105241_11255179 | Ga0105241_112551791 | 132 |
| 335 | 3300009176 | Ga0105242_10093388 | Ga0105242_100933883 | 132 |
| 336 | 3300009176 | Ga0105242_10248578 | Ga0105242_102485782 | 132 |
| 337 | 3300009176 | Ga0105242_10381833 | Ga0105242_103818332 | 132 |
| 338 | 3300009176 | Ga0105242_10477824 | Ga0105242_104778242 | 132 |
| 339 | 3300009176 | Ga0105242_10791971 | Ga0105242_107919712 | 132 |
| 340 | 3300009177 | Ga0105248_10049495 | Ga0105248_100494952 | 132 |
| 341 | 3300009545 | Ga0105237_10006382 | Ga0105237_100063825 | 132 |
| 342 | 3300009545 | Ga0105237_10008299 | Ga0105237_100082998 | 132 |
| 343 | 3300009545 | Ga0105237_10024116 | Ga0105237_100241164 | 132 |
| 344 | 3300009545 | Ga0105237_10080055 | Ga0105237_100800554 | 132 |
| 345 | 3300009545 | Ga0105237_10101460 | Ga0105237_101014604 | 132 |
| 346 | 3300009545 | Ga0105237_10148579 | Ga0105237_101485792 | 132 |
| 347 | 3300009545 | Ga0105237_10211233 | Ga0105237_102112332 | 132 |
| 348 | 3300009545 | Ga0105237_10219117 | Ga0105237_102191172 | 132 |
| 349 | 3300009545 | Ga0105237_10251855 | Ga0105237_102518552 | 132 |
| 350 | 3300009545 | Ga0105237_10644966 | Ga0105237_106449662 | 132 |
| 351 | 3300009545 | Ga0105237_11559825 | Ga0105237_115598251 | 132 |
| 352 | 3300009545 | Ga0105237_11821153 | Ga0105237_118211531 | 132 |
| 353 | 3300009551 | Ga0105238_10000885 | Ga0105238_1000088526 | 132 |
| 354 | 3300009551 | Ga0105238_10005609 | Ga0105238_1000560910 | 132 |
| 355 | 3300009551 | Ga0105238_10006417 | Ga0105238_100064176 | 132 |
| 356 | 3300009551 | Ga0105238_10091024 | Ga0105238_100910242 | 132 |
| 357 | 3300009551 | Ga0105238_10620117 | Ga0105238_106201171 | 132 |
| 358 | 3300009551 | Ga0105238_10982261 | Ga0105238_109822611 | 132 |
| 359 | 3300009551 | Ga0105238_11066667 | Ga0105238_110666672 | 132 |
| 360 | 3300009551 | Ga0105238_11231957 | Ga0105238_112319572 | 132 |
| 361 | 3300009551 | Ga0105238_11351498 | Ga0105238_113514981 | 132 |
| 362 | 3300009553 | Ga0105249_10079454 | Ga0105249_100794541 | 132 |
| 363 | 3300009553 | Ga0105249_10682842 | Ga0105249_106828422 | 132 |
| 364 | 3300009553 | Ga0105249_11678457 | Ga0105249_116784572 | 132 |
| 365 | 3300009553 | Ga0105249_12466770 | Ga0105249_124667701 | 132 |
| 366 | 3300010159 | Ga0099796_10008097 | Ga0099796_100080974 | 132 |
| 367 | 3300010159 | Ga0099796_10127663 | Ga0099796_101276632 | 132 |
| 368 | 3300010375 | Ga0105239_10011070 | Ga0105239_100110706 | 132 |
| 369 | 3300010375 | Ga0105239_10020488 | Ga0105239_100204888 | 132 |
| 370 | 3300010375 | Ga0105239_10024299 | Ga0105239_100242994 | 132 |
| 371 | 3300010375 | Ga0105239_10132834 | Ga0105239_101328342 | 132 |
| 372 | 3300010375 | Ga0105239_10407574 | Ga0105239_104075741 | 132 |
| 373 | 3300010375 | Ga0105239_10537658 | Ga0105239_105376582 | 132 |
| 374 | 3300010375 | Ga0105239_10547699 | Ga0105239_105476992 | 132 |
| 375 | 3300010375 | Ga0105239_10573942 | Ga0105239_105739422 | 132 |
| 376 | 3300010375 | Ga0105239_10628018 | Ga0105239_106280181 | 132 |
| 377 | 3300010375 | Ga0105239_10686103 | Ga0105239_106861032 | 132 |
| 378 | 3300011119 | Ga0105246_10118216 | Ga0105246_101182163 | 132 |
| 379 | 3300011119 | Ga0105246_10512111 | Ga0105246_105121112 | 132 |
| 380 | 3300011119 | Ga0105246_10953329 | Ga0105246_109533292 | 132 |
| 381 | 3300011119 | Ga0105246_11725248 | Ga0105246_117252481 | 132 |
| 382 | 3300012483 | Ga0157337_1021823 | Ga0157337_10218231 | 132 |
| 383 | 3300012515 | Ga0157338_1069532 | Ga0157338_10695321 | 132 |
| 384 | 3300013100 | Ga0157373_10438767 | Ga0157373_104387671 | 132 |
| 385 | 3300013102 | Ga0157371_10080655 | Ga0157371_100806552 | 132 |
| 386 | 3300013104 | Ga0157370_10163226 | Ga0157370_101632262 | 132 |
| 387 | 3300013104 | Ga0157370_10231909 | Ga0157370_102319092 | 132 |
| 388 | 3300013104 | Ga0157370_10270046 | Ga0157370_102700462 | 132 |
| 389 | 3300013104 | Ga0157370_10441653 | Ga0157370_104416532 | 132 |
| 390 | 3300013104 | Ga0157370_11983552 | Ga0157370_119835521 | 132 |
| 391 | 3300013105 | Ga0157369_10003699 | Ga0157369_1000369910 | 132 |
| 392 | 3300013105 | Ga0157369_10011122 | Ga0157369_100111227 | 132 |
| 393 | 3300013105 | Ga0157369_10016823 | Ga0157369_100168239 | 132 |
| 394 | 3300013105 | Ga0157369_10685838 | Ga0157369_106858382 | 132 |
| 395 | 3300013105 | Ga0157369_10715551 | Ga0157369_107155512 | 132 |
| 396 | 3300013296 | Ga0157374_10071289 | Ga0157374_100712893 | 132 |
| 397 | 3300013296 | Ga0157374_10290805 | Ga0157374_102908051 | 132 |
| 398 | 3300013296 | Ga0157374_10581877 | Ga0157374_105818772 | 132 |
| 399 | 3300013297 | Ga0157378_10529471 | Ga0157378_105294712 | 132 |
| 400 | 3300013297 | Ga0157378_10808792 | Ga0157378_108087922 | 132 |
| 401 | 3300013297 | Ga0157378_11035404 | Ga0157378_110354042 | 132 |
| 402 | 3300013297 | Ga0157378_13056578 | Ga0157378_130565781 | 132 |
| 403 | 3300013306 | Ga0163162_10104898 | Ga0163162_101048983 | 132 |
| 404 | 3300013306 | Ga0163162_10132431 | Ga0163162_101324315 | 132 |
| 405 | 3300013306 | Ga0163162_10195168 | Ga0163162_101951682 | 132 |
| 406 | 3300013306 | Ga0163162_10355076 | Ga0163162_103550762 | 132 |
| 407 | 3300013306 | Ga0163162_13197226 | Ga0163162_131972261 | 132 |
| 408 | 3300013307 | Ga0157372_10371500 | Ga0157372_103715002 | 132 |
| 409 | 3300013307 | Ga0157372_10616929 | Ga0157372_106169292 | 132 |
| 410 | 3300013307 | Ga0157372_10662518 | Ga0157372_106625181 | 132 |
| 411 | 3300013307 | Ga0157372_10821001 | Ga0157372_108210012 | 132 |
| 412 | 3300013307 | Ga0157372_11039526 | Ga0157372_110395261 | 132 |
| 413 | 3300013307 | Ga0157372_11828009 | Ga0157372_118280091 | 132 |
| 414 | 3300013308 | Ga0157375_10078938 | Ga0157375_100789386 | 132 |
| 415 | 3300013308 | Ga0157375_10097357 | Ga0157375_100973572 | 132 |
| 416 | 3300013308 | Ga0157375_10123103 | Ga0157375_101231032 | 132 |
| 417 | 3300013308 | Ga0157375_12341988 | Ga0157375_123419881 | 132 |
| 418 | 3300013308 | Ga0157375_13145741 | Ga0157375_131457411 | 132 |
| 419 | 3300014325 | Ga0163163_10019375 | Ga0163163_100193757 | 132 |
| 420 | 3300014325 | Ga0163163_10140744 | Ga0163163_101407443 | 132 |
| 421 | 3300014325 | Ga0163163_10294331 | Ga0163163_102943311 | 132 |
| 422 | 3300014325 | Ga0163163_10522793 | Ga0163163_105227932 | 132 |
| 423 | 3300014326 | Ga0157380_10967694 | Ga0157380_109676942 | 132 |
| 424 | 3300014326 | Ga0157380_11005044 | Ga0157380_110050442 | 132 |
| 425 | 3300014326 | Ga0157380_12459464 | Ga0157380_124594641 | 132 |
| 426 | 3300014497 | Ga0182008_10151999 | Ga0182008_101519992 | 132 |
| 427 | 3300014497 | Ga0182008_10447148 | Ga0182008_104471482 | 132 |
| 428 | 3300014968 | Ga0157379_10072179 | Ga0157379_100721792 | 132 |
| 429 | 3300014968 | Ga0157379_10128607 | Ga0157379_101286071 | 132 |
| 430 | 3300014968 | Ga0157379_10309838 | Ga0157379_103098382 | 132 |
| 431 | 3300014968 | Ga0157379_10865094 | Ga0157379_108650942 | 132 |
| 432 | 3300014969 | Ga0157376_10264396 | Ga0157376_102643962 | 132 |
| 433 | 3300014969 | Ga0157376_11237193 | Ga0157376_112371932 | 132 |
| 434 | 3300020070 | Ga0206356_10824015 | Ga0206356_108240152 | 132 |
| 435 | 3300020076 | Ga0206355_1375172 | Ga0206355_13751722 | 132 |
| 436 | 3300020080 | Ga0206350_10271927 | Ga0206350_102719272 | 132 |
| 437 | 3300020081 | Ga0206354_10310108 | Ga0206354_103101083 | 132 |
| 438 | 3300021358 | Ga0213873_10086560 | Ga0213873_100865602 | 132 |
| 439 | 3300021358 | Ga0213873_10107998 | Ga0213873_101079981 | 132 |
| 440 | 3300021377 | Ga0213874_10110235 | Ga0213874_101102352 | 132 |
| 441 | 3300021377 | Ga0213874_10138265 | Ga0213874_101382652 | 132 |
| 442 | 3300021384 | Ga0213876_10018891 | Ga0213876_100188913 | 132 |
| 443 | 3300021384 | Ga0213876_10108795 | Ga0213876_101087952 | 132 |
| 444 | 3300021384 | Ga0213876_10118908 | Ga0213876_101189081 | 132 |
| 445 | 3300021384 | Ga0213876_10203730 | Ga0213876_102037302 | 132 |
| 446 | 3300021384 | Ga0213876_10701295 | Ga0213876_107012951 | 132 |
| 447 | 3300021388 | Ga0213875_10069234 | Ga0213875_100692343 | 132 |
| 448 | 3300021441 | Ga0213871_10008840 | Ga0213871_100088402 | 132 |
| 449 | 3300021441 | Ga0213871_10110776 | Ga0213871_101107762 | 132 |
| 450 | 3300022467 | Ga0224712_10110279 | Ga0224712_101102792 | 132 |
| 451 | 3300025254 | Ga0209148_1010916 | Ga0209148_10109162 | 132 |
| 452 | 3300025261 | Ga0209233_1006072 | Ga0209233_10060724 | 132 |
| 453 | 3300025272 | Ga0209455_1007118 | Ga0209455_10071183 | 132 |
| 454 | 3300025272 | Ga0209455_1014353 | Ga0209455_10143532 | 132 |
| 455 | 3300025297 | Ga0209758_1002215 | Ga0209758_10022155 | 132 |
| 456 | 3300025297 | Ga0209758_1032638 | Ga0209758_10326383 | 132 |
| 457 | 3300025297 | Ga0209758_1071592 | Ga0209758_10715921 | 132 |
| 458 | 3300025315 | Ga0207697_10027916 | Ga0207697_100279162 | 132 |
| 459 | 3300025321 | Ga0207656_10056016 | Ga0207656_100560162 | 132 |
| 460 | 3300025321 | Ga0207656_10072434 | Ga0207656_100724342 | 132 |
| 461 | 3300025321 | Ga0207656_10076710 | Ga0207656_100767102 | 132 |
| 462 | 3300025711 | Ga0207696_1032698 | Ga0207696_10326981 | 132 |
| 463 | 3300025885 | Ga0207653_10017200 | Ga0207653_100172001 | 132 |
| 464 | 3300025898 | Ga0207692_10000386 | Ga0207692_100003866 | 132 |
| 465 | 3300025898 | Ga0207692_10176207 | Ga0207692_101762072 | 132 |
| 466 | 3300025898 | Ga0207692_10370189 | Ga0207692_103701892 | 132 |
| 467 | 3300025898 | Ga0207692_10769614 | Ga0207692_107696142 | 132 |
| 468 | 3300025899 | Ga0207642_10090211 | Ga0207642_100902112 | 132 |
| 469 | 3300025899 | Ga0207642_10234165 | Ga0207642_102341652 | 132 |
| 470 | 3300025900 | Ga0207710_10043541 | Ga0207710_100435413 | 132 |
| 471 | 3300025900 | Ga0207710_10060054 | Ga0207710_100600542 | 132 |
| 472 | 3300025900 | Ga0207710_10199320 | Ga0207710_101993202 | 132 |
| 473 | 3300025900 | Ga0207710_10491124 | Ga0207710_104911242 | 132 |
| 474 | 3300025901 | Ga0207688_10013695 | Ga0207688_100136952 | 132 |
| 475 | 3300025901 | Ga0207688_10102252 | Ga0207688_101022523 | 132 |
| 476 | 3300025901 | Ga0207688_10364613 | Ga0207688_103646132 | 132 |
| 477 | 3300025904 | Ga0207647_10015721 | Ga0207647_100157218 | 132 |
| 478 | 3300025904 | Ga0207647_10251620 | Ga0207647_102516202 | 132 |
| 479 | 3300025905 | Ga0207685_10002099 | Ga0207685_100020991 | 132 |
| 480 | 3300025906 | Ga0207699_10000411 | Ga0207699_1000041117 | 132 |
| 481 | 3300025906 | Ga0207699_10003008 | Ga0207699_100030082 | 132 |
| 482 | 3300025906 | Ga0207699_10072963 | Ga0207699_100729632 | 132 |
| 483 | 3300025906 | Ga0207699_10243468 | Ga0207699_102434682 | 132 |
| 484 | 3300025906 | Ga0207699_10482407 | Ga0207699_104824071 | 132 |
| 485 | 3300025906 | Ga0207699_10615968 | Ga0207699_106159682 | 132 |
| 486 | 3300025906 | Ga0207699_10861262 | Ga0207699_108612622 | 132 |
| 487 | 3300025907 | Ga0207645_10600053 | Ga0207645_106000532 | 132 |
| 488 | 3300025909 | Ga0207705_10049208 | Ga0207705_100492083 | 132 |
| 489 | 3300025909 | Ga0207705_11462528 | Ga0207705_114625281 | 132 |
| 490 | 3300025910 | Ga0207684_10420975 | Ga0207684_104209752 | 132 |
| 491 | 3300025910 | Ga0207684_10689409 | Ga0207684_106894092 | 132 |
| 492 | 3300025910 | Ga0207684_10879702 | Ga0207684_108797021 | 132 |
| 493 | 3300025911 | Ga0207654_10000629 | Ga0207654_1000062910 | 132 |
| 494 | 3300025911 | Ga0207654_10061939 | Ga0207654_100619392 | 132 |
| 495 | 3300025911 | Ga0207654_10787675 | Ga0207654_107876751 | 132 |
| 496 | 3300025911 | Ga0207654_10853485 | Ga0207654_108534851 | 132 |
| 497 | 3300025912 | Ga0207707_10001473 | Ga0207707_1000147316 | 132 |
| 498 | 3300025912 | Ga0207707_10013690 | Ga0207707_100136903 | 132 |
| 499 | 3300025912 | Ga0207707_10015990 | Ga0207707_100159906 | 132 |
| 500 | 3300025912 | Ga0207707_10097004 | Ga0207707_100970042 | 132 |
| 501 | 3300025912 | Ga0207707_10118392 | Ga0207707_101183922 | 132 |
| 502 | 3300025912 | Ga0207707_10132231 | Ga0207707_101322312 | 132 |
| 503 | 3300025912 | Ga0207707_10154042 | Ga0207707_101540423 | 132 |
| 504 | 3300025912 | Ga0207707_10262126 | Ga0207707_102621262 | 132 |
| 505 | 3300025913 | Ga0207695_10001265 | Ga0207695_1000126527 | 132 |
| 506 | 3300025913 | Ga0207695_10039200 | Ga0207695_100392009 | 132 |
| 507 | 3300025913 | Ga0207695_10039689 | Ga0207695_100396892 | 132 |
| 508 | 3300025913 | Ga0207695_10149556 | Ga0207695_101495563 | 132 |
| 509 | 3300025913 | Ga0207695_10177166 | Ga0207695_101771663 | 132 |
| 510 | 3300025913 | Ga0207695_10226999 | Ga0207695_102269993 | 132 |
| 511 | 3300025914 | Ga0207671_10005731 | Ga0207671_100057317 | 132 |
| 512 | 3300025914 | Ga0207671_10015794 | Ga0207671_100157944 | 132 |
| 513 | 3300025914 | Ga0207671_10094235 | Ga0207671_100942352 | 132 |
| 514 | 3300025914 | Ga0207671_10101843 | Ga0207671_101018432 | 132 |
| 515 | 3300025914 | Ga0207671_10153115 | Ga0207671_101531151 | 132 |
| 516 | 3300025914 | Ga0207671_10194177 | Ga0207671_101941772 | 132 |
| 517 | 3300025914 | Ga0207671_10360592 | Ga0207671_103605922 | 132 |
| 518 | 3300025914 | Ga0207671_10418282 | Ga0207671_104182822 | 132 |
| 519 | 3300025914 | Ga0207671_10438451 | Ga0207671_104384512 | 132 |
| 520 | 3300025914 | Ga0207671_10656257 | Ga0207671_106562572 | 132 |
| 521 | 3300025914 | Ga0207671_11154680 | Ga0207671_111546802 | 132 |
| 522 | 3300025914 | Ga0207671_11180234 | Ga0207671_111802341 | 132 |
| 523 | 3300025915 | Ga0207693_10003644 | Ga0207693_100036447 | 132 |
| 524 | 3300025915 | Ga0207693_10039807 | Ga0207693_100398074 | 132 |
| 525 | 3300025915 | Ga0207693_10092044 | Ga0207693_100920442 | 132 |
| 526 | 3300025916 | Ga0207663_10000897 | Ga0207663_100008975 | 132 |
| 527 | 3300025916 | Ga0207663_10010802 | Ga0207663_100108022 | 132 |
| 528 | 3300025916 | Ga0207663_10053778 | Ga0207663_100537783 | 132 |
| 529 | 3300025916 | Ga0207663_10154973 | Ga0207663_101549732 | 132 |
| 530 | 3300025916 | Ga0207663_10171764 | Ga0207663_101717642 | 132 |
| 531 | 3300025916 | Ga0207663_10694508 | Ga0207663_106945082 | 132 |
| 532 | 3300025917 | Ga0207660_10003205 | Ga0207660_100032058 | 132 |
| 533 | 3300025917 | Ga0207660_10022034 | Ga0207660_100220342 | 132 |
| 534 | 3300025917 | Ga0207660_10158340 | Ga0207660_101583402 | 132 |
| 535 | 3300025917 | Ga0207660_10633529 | Ga0207660_106335292 | 132 |
| 536 | 3300025919 | Ga0207657_10011790 | Ga0207657_100117906 | 132 |
| 537 | 3300025919 | Ga0207657_10318372 | Ga0207657_103183722 | 132 |
| 538 | 3300025919 | Ga0207657_11231774 | Ga0207657_112317741 | 132 |
| 539 | 3300025920 | Ga0207649_10595718 | Ga0207649_105957181 | 132 |
| 540 | 3300025921 | Ga0207652_10006959 | Ga0207652_100069597 | 132 |
| 541 | 3300025921 | Ga0207652_10012754 | Ga0207652_100127543 | 132 |
| 542 | 3300025921 | Ga0207652_10038366 | Ga0207652_100383663 | 132 |
| 543 | 3300025921 | Ga0207652_10129055 | Ga0207652_101290552 | 132 |
| 544 | 3300025921 | Ga0207652_10325541 | Ga0207652_103255412 | 132 |
| 545 | 3300025921 | Ga0207652_11025320 | Ga0207652_110253202 | 132 |
| 546 | 3300025922 | Ga0207646_10077709 | Ga0207646_100777093 | 132 |
| 547 | 3300025922 | Ga0207646_11560447 | Ga0207646_115604471 | 132 |
| 548 | 3300025923 | Ga0207681_10050253 | Ga0207681_100502533 | 132 |
| 549 | 3300025924 | Ga0207694_10000082 | Ga0207694_100000825 | 132 |
| 550 | 3300025924 | Ga0207694_10025115 | Ga0207694_100251153 | 132 |
| 551 | 3300025924 | Ga0207694_10031933 | Ga0207694_100319334 | 132 |
| 552 | 3300025924 | Ga0207694_10032555 | Ga0207694_100325554 | 132 |
| 553 | 3300025924 | Ga0207694_10161959 | Ga0207694_101619592 | 132 |
| 554 | 3300025924 | Ga0207694_10706418 | Ga0207694_107064181 | 132 |
| 555 | 3300025924 | Ga0207694_11325223 | Ga0207694_113252231 | 132 |
| 556 | 3300025924 | Ga0207694_11390093 | Ga0207694_113900931 | 132 |
| 557 | 3300025925 | Ga0207650_10247985 | Ga0207650_102479852 | 132 |
| 558 | 3300025927 | Ga0207687_10029908 | Ga0207687_100299083 | 132 |
| 559 | 3300025927 | Ga0207687_10105185 | Ga0207687_101051852 | 132 |
| 560 | 3300025927 | Ga0207687_10918961 | Ga0207687_109189612 | 132 |
| 561 | 3300025928 | Ga0207700_10003087 | Ga0207700_100030876 | 132 |
| 562 | 3300025928 | Ga0207700_10006990 | Ga0207700_100069905 | 132 |
| 563 | 3300025928 | Ga0207700_10010852 | Ga0207700_100108523 | 132 |
| 564 | 3300025928 | Ga0207700_10011089 | Ga0207700_100110893 | 132 |
| 565 | 3300025928 | Ga0207700_10021835 | Ga0207700_100218352 | 132 |
| 566 | 3300025928 | Ga0207700_10029340 | Ga0207700_100293403 | 132 |
| 567 | 3300025928 | Ga0207700_10102684 | Ga0207700_101026842 | 132 |
| 568 | 3300025928 | Ga0207700_10613897 | Ga0207700_106138972 | 132 |
| 569 | 3300025928 | Ga0207700_10862135 | Ga0207700_108621352 | 132 |
| 570 | 3300025929 | Ga0207664_10004435 | Ga0207664_100044355 | 132 |
| 571 | 3300025929 | Ga0207664_10070887 | Ga0207664_100708874 | 132 |
| 572 | 3300025929 | Ga0207664_10271666 | Ga0207664_102716661 | 132 |
| 573 | 3300025929 | Ga0207664_10553805 | Ga0207664_105538051 | 132 |
| 574 | 3300025929 | Ga0207664_10705276 | Ga0207664_107052762 | 132 |
| 575 | 3300025929 | Ga0207664_11206854 | Ga0207664_112068541 | 132 |
| 576 | 3300025932 | Ga0207690_10945993 | Ga0207690_109459932 | 132 |
| 577 | 3300025933 | Ga0207706_10080562 | Ga0207706_100805622 | 132 |
| 578 | 3300025933 | Ga0207706_10098139 | Ga0207706_100981394 | 132 |
| 579 | 3300025933 | Ga0207706_10171143 | Ga0207706_101711432 | 132 |
| 580 | 3300025933 | Ga0207706_10460652 | Ga0207706_104606522 | 132 |
| 581 | 3300025934 | Ga0207686_10065126 | Ga0207686_100651262 | 132 |
| 582 | 3300025934 | Ga0207686_10675169 | Ga0207686_106751691 | 132 |
| 583 | 3300025935 | Ga0207709_10065212 | Ga0207709_100652122 | 132 |
| 584 | 3300025935 | Ga0207709_10471578 | Ga0207709_104715782 | 132 |
| 585 | 3300025936 | Ga0207670_10187476 | Ga0207670_101874762 | 132 |
| 586 | 3300025936 | Ga0207670_10771539 | Ga0207670_107715392 | 132 |
| 587 | 3300025937 | Ga0207669_10032231 | Ga0207669_100322314 | 132 |
| 588 | 3300025937 | Ga0207669_10579773 | Ga0207669_105797732 | 132 |
| 589 | 3300025937 | Ga0207669_10719273 | Ga0207669_107192732 | 132 |
| 590 | 3300025938 | Ga0207704_10330524 | Ga0207704_103305242 | 132 |
| 591 | 3300025939 | Ga0207665_10001244 | Ga0207665_100012449 | 132 |
| 592 | 3300025939 | Ga0207665_10003077 | Ga0207665_100030779 | 132 |
| 593 | 3300025939 | Ga0207665_10129259 | Ga0207665_101292592 | 132 |
| 594 | 3300025939 | Ga0207665_10287312 | Ga0207665_102873122 | 132 |
| 595 | 3300025939 | Ga0207665_10689963 | Ga0207665_106899631 | 132 |
| 596 | 3300025940 | Ga0207691_10273607 | Ga0207691_102736072 | 132 |
| 597 | 3300025940 | Ga0207691_10610493 | Ga0207691_106104931 | 132 |
| 598 | 3300025941 | Ga0207711_10468581 | Ga0207711_104685812 | 132 |
| 599 | 3300025941 | Ga0207711_10501381 | Ga0207711_105013812 | 132 |
| 600 | 3300025944 | Ga0207661_10003495 | Ga0207661_100034956 | 132 |
| 601 | 3300025944 | Ga0207661_10010884 | Ga0207661_100108846 | 132 |
| 602 | 3300025944 | Ga0207661_10100708 | Ga0207661_101007081 | 132 |
| 603 | 3300025944 | Ga0207661_10956302 | Ga0207661_109563021 | 132 |
| 604 | 3300025945 | Ga0207679_10461889 | Ga0207679_104618892 | 132 |
| 605 | 3300025949 | Ga0207667_10006677 | Ga0207667_100066776 | 132 |
| 606 | 3300025949 | Ga0207667_10008474 | Ga0207667_1000847411 | 132 |
| 607 | 3300025949 | Ga0207667_10009542 | Ga0207667_100095427 | 132 |
| 608 | 3300025949 | Ga0207667_10109324 | Ga0207667_101093242 | 132 |
| 609 | 3300025949 | Ga0207667_10120372 | Ga0207667_101203723 | 132 |
| 610 | 3300025949 | Ga0207667_10261496 | Ga0207667_102614963 | 132 |
| 611 | 3300025949 | Ga0207667_10324817 | Ga0207667_103248172 | 132 |
| 612 | 3300025949 | Ga0207667_10513264 | Ga0207667_105132642 | 132 |
| 613 | 3300025949 | Ga0207667_10557116 | Ga0207667_105571162 | 132 |
| 614 | 3300025949 | Ga0207667_10559959 | Ga0207667_105599592 | 132 |
| 615 | 3300025949 | Ga0207667_11554073 | Ga0207667_115540731 | 132 |
| 616 | 3300025960 | Ga0207651_10284249 | Ga0207651_102842492 | 132 |
| 617 | 3300025960 | Ga0207651_10297316 | Ga0207651_102973162 | 132 |
| 618 | 3300025961 | Ga0207712_10534468 | Ga0207712_105344682 | 132 |
| 619 | 3300025961 | Ga0207712_10654023 | Ga0207712_106540232 | 132 |
| 620 | 3300025961 | Ga0207712_11556679 | Ga0207712_115566791 | 132 |
| 621 | 3300025972 | Ga0207668_10062419 | Ga0207668_100624192 | 132 |
| 622 | 3300025972 | Ga0207668_10377764 | Ga0207668_103777642 | 132 |
| 623 | 3300025972 | Ga0207668_10405016 | Ga0207668_104050163 | 132 |
| 624 | 3300025981 | Ga0207640_10023703 | Ga0207640_100237033 | 132 |
| 625 | 3300025981 | Ga0207640_10956990 | Ga0207640_109569901 | 132 |
| 626 | 3300025981 | Ga0207640_11103959 | Ga0207640_111039591 | 132 |
| 627 | 3300025986 | Ga0207658_10453227 | Ga0207658_104532272 | 132 |
| 628 | 3300025986 | Ga0207658_10643294 | Ga0207658_106432942 | 132 |
| 629 | 3300025986 | Ga0207658_11865055 | Ga0207658_118650551 | 132 |
| 630 | 3300026023 | Ga0207677_10196330 | Ga0207677_101963302 | 132 |
| 631 | 3300026023 | Ga0207677_10323936 | Ga0207677_103239362 | 132 |
| 632 | 3300026035 | Ga0207703_10155612 | Ga0207703_101556122 | 132 |
| 633 | 3300026035 | Ga0207703_10201766 | Ga0207703_102017662 | 132 |
| 634 | 3300026035 | Ga0207703_10306009 | Ga0207703_103060092 | 132 |
| 635 | 3300026035 | Ga0207703_10401115 | Ga0207703_104011152 | 132 |
| 636 | 3300026035 | Ga0207703_11665711 | Ga0207703_116657111 | 132 |
| 637 | 3300026035 | Ga0207703_12296747 | Ga0207703_122967471 | 132 |
| 638 | 3300026041 | Ga0207639_10003792 | Ga0207639_100037925 | 132 |
| 639 | 3300026041 | Ga0207639_10171290 | Ga0207639_101712903 | 132 |
| 640 | 3300026041 | Ga0207639_10183444 | Ga0207639_101834442 | 132 |
| 641 | 3300026041 | Ga0207639_10443502 | Ga0207639_104435021 | 132 |
| 642 | 3300026041 | Ga0207639_10465134 | Ga0207639_104651342 | 132 |
| 643 | 3300026041 | Ga0207639_10651857 | Ga0207639_106518571 | 132 |
| 644 | 3300026041 | Ga0207639_11205679 | Ga0207639_112056791 | 132 |
| 645 | 3300026041 | Ga0207639_11437911 | Ga0207639_114379111 | 132 |
| 646 | 3300026067 | Ga0207678_10113995 | Ga0207678_101139952 | 132 |
| 647 | 3300026067 | Ga0207678_10200272 | Ga0207678_102002722 | 132 |
| 648 | 3300026067 | Ga0207678_10219791 | Ga0207678_102197912 | 132 |
| 649 | 3300026067 | Ga0207678_10322042 | Ga0207678_103220422 | 132 |
| 650 | 3300026075 | Ga0207708_10104541 | Ga0207708_101045413 | 132 |
| 651 | 3300026075 | Ga0207708_10175317 | Ga0207708_101753172 | 132 |
| 652 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002415 | 132 |
| 653 | 3300026078 | Ga0207702_10000478 | Ga0207702_1000047831 | 132 |
| 654 | 3300026078 | Ga0207702_10061546 | Ga0207702_100615463 | 132 |
| 655 | 3300026078 | Ga0207702_10195697 | Ga0207702_101956972 | 132 |
| 656 | 3300026078 | Ga0207702_10391416 | Ga0207702_103914162 | 132 |
| 657 | 3300026078 | Ga0207702_10990687 | Ga0207702_109906872 | 132 |
| 658 | 3300026078 | Ga0207702_11263645 | Ga0207702_112636451 | 132 |
| 659 | 3300026088 | Ga0207641_10896810 | Ga0207641_108968102 | 132 |
| 660 | 3300026088 | Ga0207641_11050143 | Ga0207641_110501431 | 132 |
| 661 | 3300026089 | Ga0207648_10021511 | Ga0207648_100215112 | 132 |
| 662 | 3300026089 | Ga0207648_10995497 | Ga0207648_109954971 | 132 |
| 663 | 3300026095 | Ga0207676_10089392 | Ga0207676_100893922 | 132 |
| 664 | 3300026095 | Ga0207676_10116170 | Ga0207676_101161702 | 132 |
| 665 | 3300026095 | Ga0207676_10849018 | Ga0207676_108490182 | 132 |
| 666 | 3300026095 | Ga0207676_12492721 | Ga0207676_124927211 | 132 |
| 667 | 3300026116 | Ga0207674_10007536 | Ga0207674_100075369 | 132 |
| 668 | 3300026116 | Ga0207674_10011165 | Ga0207674_100111655 | 132 |
| 669 | 3300026116 | Ga0207674_10028212 | Ga0207674_100282123 | 132 |
| 670 | 3300026116 | Ga0207674_10034482 | Ga0207674_100344824 | 132 |
| 671 | 3300026116 | Ga0207674_10103770 | Ga0207674_101037702 | 132 |
| 672 | 3300026116 | Ga0207674_10648307 | Ga0207674_106483072 | 132 |
| 673 | 3300026118 | Ga0207675_100404646 | Ga0207675_1004046462 | 132 |
| 674 | 3300026118 | Ga0207675_101322776 | Ga0207675_1013227762 | 132 |
| 675 | 3300026121 | Ga0207683_10104603 | Ga0207683_101046031 | 132 |
| 676 | 3300026121 | Ga0207683_10198179 | Ga0207683_101981792 | 132 |
| 677 | 3300026121 | Ga0207683_10365184 | Ga0207683_103651842 | 132 |
| 678 | 3300026121 | Ga0207683_10783150 | Ga0207683_107831502 | 132 |
| 679 | 3300026121 | Ga0207683_10960871 | Ga0207683_109608712 | 132 |
| 680 | 3300026142 | Ga0207698_10122325 | Ga0207698_101223252 | 132 |
| 681 | 3300026142 | Ga0207698_10225106 | Ga0207698_102251062 | 132 |
| 682 | 3300026142 | Ga0207698_10417946 | Ga0207698_104179462 | 132 |
| 683 | 3300026142 | Ga0207698_10505617 | Ga0207698_105056173 | 132 |
| 684 | 3300026142 | Ga0207698_10535508 | Ga0207698_105355082 | 132 |
| 685 | 3300026142 | Ga0207698_10777761 | Ga0207698_107777612 | 132 |
| 686 | 3300026142 | Ga0207698_10909777 | Ga0207698_109097772 | 132 |
| 687 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003462 | 132 |
| 688 | 3300027361 | Ga0209489_100003 | Ga0209489_100003513 | 132 |
| 689 | 3300027363 | Ga0209700_100003 | Ga0209700_100003513 | 132 |
| 690 | 3300027512 | Ga0209179_1033288 | Ga0209179_10332882 | 132 |
| 691 | 3300027512 | Ga0209179_1067049 | Ga0209179_10670491 | 132 |
| 692 | 3300027512 | Ga0209179_1089564 | Ga0209179_10895642 | 132 |
| 693 | 3300027512 | Ga0209179_1133571 | Ga0209179_11335711 | 132 |
| 694 | 3300027671 | Ga0209588_1023809 | Ga0209588_10238093 | 132 |
| 695 | 3300027866 | Ga0209813_10177077 | Ga0209813_101770772 | 132 |
| 696 | 3300028379 | Ga0268266_10162678 | Ga0268266_101626782 | 132 |
| 697 | 3300028379 | Ga0268266_10215025 | Ga0268266_102150252 | 132 |
| 698 | 3300028379 | Ga0268266_10264045 | Ga0268266_102640452 | 132 |
| 699 | 3300028379 | Ga0268266_10726009 | Ga0268266_107260092 | 132 |
| 700 | 3300028379 | Ga0268266_10744311 | Ga0268266_107443112 | 132 |
| 701 | 3300028379 | Ga0268266_11606005 | Ga0268266_116060052 | 132 |
| 702 | 3300028379 | Ga0268266_11809873 | Ga0268266_118098732 | 132 |
| 703 | 3300028380 | Ga0268265_10517250 | Ga0268265_105172502 | 132 |
| 704 | 3300028380 | Ga0268265_10587354 | Ga0268265_105873542 | 132 |
| 705 | 3300028380 | Ga0268265_10701635 | Ga0268265_107016352 | 132 |
| 706 | 3300028381 | Ga0268264_10000043 | Ga0268264_10000043124 | 132 |
| 707 | 3300028381 | Ga0268264_10497575 | Ga0268264_104975751 | 132 |
| 708 | 3300028556 | Ga0265337_1018947 | Ga0265337_10189472 | 132 |
| 709 | 3300028563 | Ga0265319_1012285 | Ga0265319_10122852 | 132 |
| 710 | 3300028573 | Ga0265334_10023180 | Ga0265334_100231802 | 132 |
| 711 | 3300028573 | Ga0265334_10086784 | Ga0265334_100867841 | 132 |
| 712 | 3300028577 | Ga0265318_10003124 | Ga0265318_100031242 | 132 |
| 713 | 3300028653 | Ga0265323_10001316 | Ga0265323_100013165 | 132 |
| 714 | 3300028654 | Ga0265322_10003976 | Ga0265322_100039762 | 132 |
| 715 | 3300028666 | Ga0265336_10000579 | Ga0265336_1000057911 | 132 |
| 716 | 3300028786 | Ga0307517_10215992 | Ga0307517_102159921 | 132 |
| 717 | 3300028794 | Ga0307515_10055010 | Ga0307515_100550101 | 132 |
| 718 | 3300028800 | Ga0265338_10001398 | Ga0265338_1000139810 | 132 |
| 719 | 3300029957 | Ga0265324_10010613 | Ga0265324_100106132 | 132 |
| 720 | 3300030521 | Ga0307511_10101511 | Ga0307511_101015112 | 132 |
| 721 | 3300030521 | Ga0307511_10119276 | Ga0307511_101192762 | 132 |
| 722 | 3300030760 | Ga0265762_1068277 | Ga0265762_10682771 | 132 |
| 723 | 3300030763 | Ga0265763_1017816 | Ga0265763_10178161 | 132 |
| 724 | 3300030878 | Ga0265770_1083041 | Ga0265770_10830412 | 132 |
| 725 | 3300031235 | Ga0265330_10021534 | Ga0265330_100215342 | 132 |
| 726 | 3300031235 | Ga0265330_10029380 | Ga0265330_100293804 | 132 |
| 727 | 3300031238 | Ga0265332_10043626 | Ga0265332_100436263 | 132 |
| 728 | 3300031238 | Ga0265332_10087499 | Ga0265332_100874991 | 132 |
| 729 | 3300031241 | Ga0265325_10029462 | Ga0265325_100294624 | 132 |
| 730 | 3300031247 | Ga0265340_10002366 | Ga0265340_100023662 | 132 |
| 731 | 3300031249 | Ga0265339_10009369 | Ga0265339_100093695 | 132 |
| 732 | 3300031249 | Ga0265339_10019907 | Ga0265339_100199074 | 132 |
| 733 | 3300031249 | Ga0265339_10119706 | Ga0265339_101197062 | 132 |
| 734 | 3300031249 | Ga0265339_10325624 | Ga0265339_103256241 | 132 |
| 735 | 3300031249 | Ga0265339_10539454 | Ga0265339_105394541 | 132 |
| 736 | 3300031250 | Ga0265331_10038825 | Ga0265331_100388251 | 132 |
| 737 | 3300031250 | Ga0265331_10112707 | Ga0265331_101127072 | 132 |
| 738 | 3300031344 | Ga0265316_10090463 | Ga0265316_100904632 | 132 |
| 739 | 3300031344 | Ga0265316_10182294 | Ga0265316_101822941 | 132 |
| 740 | 3300031456 | Ga0307513_10462563 | Ga0307513_104625632 | 132 |
| 741 | 3300031456 | Ga0307513_10547481 | Ga0307513_105474812 | 132 |
| 742 | 3300031456 | Ga0307513_11044200 | Ga0307513_110442001 | 132 |
| 743 | 3300031507 | Ga0307509_10224089 | Ga0307509_102240893 | 132 |
| 744 | 3300031507 | Ga0307509_10233876 | Ga0307509_102338763 | 132 |
| 745 | 3300031507 | Ga0307509_10264488 | Ga0307509_102644882 | 132 |
| 746 | 3300031507 | Ga0307509_10510776 | Ga0307509_105107761 | 132 |
| 747 | 3300031507 | Ga0307509_10744184 | Ga0307509_107441841 | 132 |
| 748 | 3300031548 | Ga0307408_100878894 | Ga0307408_1008788941 | 132 |
| 749 | 3300031595 | Ga0265313_10126662 | Ga0265313_101266622 | 132 |
| 750 | 3300031595 | Ga0265313_10284172 | Ga0265313_102841721 | 132 |
| 751 | 3300031616 | Ga0307508_10001059 | Ga0307508_1000105918 | 132 |
| 752 | 3300031616 | Ga0307508_10007228 | Ga0307508_100072282 | 132 |
| 753 | 3300031616 | Ga0307508_10060565 | Ga0307508_100605652 | 132 |
| 754 | 3300031616 | Ga0307508_10351820 | Ga0307508_103518202 | 132 |
| 755 | 3300031711 | Ga0265314_10008943 | Ga0265314_100089433 | 132 |
| 756 | 3300031712 | Ga0265342_10002731 | Ga0265342_100027319 | 132 |
| 757 | 3300031712 | Ga0265342_10031442 | Ga0265342_100314425 | 132 |
| 758 | 3300031712 | Ga0265342_10216379 | Ga0265342_102163791 | 132 |
| 759 | 3300031730 | Ga0307516_10015493 | Ga0307516_100154938 | 132 |
| 760 | 3300031730 | Ga0307516_10063699 | Ga0307516_100636994 | 132 |
| 761 | 3300031730 | Ga0307516_10096643 | Ga0307516_100966432 | 132 |
| 762 | 3300031730 | Ga0307516_10135644 | Ga0307516_101356441 | 132 |
| 763 | 3300031730 | Ga0307516_10145136 | Ga0307516_101451363 | 132 |
| 764 | 3300031730 | Ga0307516_10152987 | Ga0307516_101529872 | 132 |
| 765 | 3300031730 | Ga0307516_10176035 | Ga0307516_101760352 | 132 |
| 766 | 3300031730 | Ga0307516_10252540 | Ga0307516_102525401 | 132 |
| 767 | 3300031730 | Ga0307516_10547677 | Ga0307516_105476772 | 132 |
| 768 | 3300031731 | Ga0307405_10745487 | Ga0307405_107454872 | 132 |
| 769 | 3300031901 | Ga0307406_10829845 | Ga0307406_108298452 | 132 |
| 770 | 3300031911 | Ga0307412_10235492 | Ga0307412_102354922 | 132 |
| 771 | 3300031995 | Ga0307409_100308665 | Ga0307409_1003086652 | 132 |
| 772 | 3300031995 | Ga0307409_101601930 | Ga0307409_1016019301 | 132 |
| 773 | 3300032002 | Ga0307416_100901219 | Ga0307416_1009012192 | 132 |
| 774 | 3300032002 | Ga0307416_100987456 | Ga0307416_1009874562 | 132 |
| 775 | 3300032004 | Ga0307414_10389249 | Ga0307414_103892491 | 132 |
| 776 | 3300032005 | Ga0307411_11280264 | Ga0307411_112802641 | 132 |
| 777 | 3300032126 | Ga0307415_100980503 | Ga0307415_1009805032 | 132 |
| 778 | 3300033179 | Ga0307507_10088859 | Ga0307507_100888593 | 132 |
| 779 | 3300033180 | Ga0307510_10010241 | Ga0307510_1001024110 | 132 |
| 780 | 3300033180 | Ga0307510_10019329 | Ga0307510_100193292 | 132 |
| 781 | 3300033180 | Ga0307510_10109337 | Ga0307510_101093372 | 132 |
| 782 | 3300033180 | Ga0307510_10230706 | Ga0307510_102307062 | 132 |
| 783 | 3300033180 | Ga0307510_10340909 | Ga0307510_103409092 | 132 |
| 784 | 3300033442 | Ga0315911_1000001 | Ga0315911_1000001268 | 132 |
| 785 | 3300033544 | Ga0316215_1000526 | Ga0316215_10005264 | 132 |
| 786 | 3300035083 | Ga0373926_0003514 | Ga0373926_0003514_15_428 | 132 |
| 787 | 3300035084 | Ga0373928_0002944 | Ga0373928_0002944_2238_2636 | 132 |
| 788 | 3300035085 | Ga0373929_0198895 | Ga0373929_0198895_26_424 | 132 |
| 789 | 3300035086 | Ga0373934_0012801 | Ga0373934_0012801_1456_1857 | 132 |
| 790 | 3300035086 | Ga0373934_0018581 | Ga0373934_0018581_1165_1563 | 132 |
| 791 | 3300035086 | Ga0373934_0278486 | Ga0373934_0278486_171_569 | 132 |
| 792 | 3300035088 | Ga0373940_0114722 | Ga0373940_0114722_27_425 | 132 |
| 793 | 3300035089 | Ga0373944_0200611 | Ga0373944_0200611_252_650 | 132 |
| 794 | 3300035090 | Ga0373949_0310641 | Ga0373949_0310641_83_481 | 132 |
| 795 | 3300035092 | Ga0373952_0180603 | Ga0373952_0180603_64_462 | 132 |
| 796 | 3300035111 | Ga0373923_0001405 | Ga0373923_0001405_1638_2036 | 132 |
| 797 | 3300035111 | Ga0373923_0033984 | Ga0373923_0033984_299_712 | 132 |
| 798 | 3300035112 | Ga0373932_0113753 | Ga0373932_0113753_81_479 | 132 |
| 799 | 3300035113 | Ga0373936_0011153 | Ga0373936_0011153_2837_3235 | 132 |
| 800 | 3300035113 | Ga0373936_0014114 | Ga0373936_0014114_82_480 | 132 |
| 801 | 3300035113 | Ga0373936_0021286 | Ga0373936_0021286_1450_1863 | 132 |
| 802 | 3300035113 | Ga0373936_0255164 | Ga0373936_0255164_364_771 | 132 |
| 803 | 3300035115 | Ga0373941_0177706 | Ga0373941_0177706_295_708 | 132 |
| 804 | 3300035117 | Ga0373953_0001516 | Ga0373953_0001516_6097_6495 | 132 |
| 805 | 3300035117 | Ga0373953_0042708 | Ga0373953_0042708_832_1245 | 132 |
| 806 | 3300035117 | Ga0373953_0046928 | Ga0373953_0046928_128_529 | 132 |
| 807 | 3300035117 | Ga0373953_0135714 | Ga0373953_0135714_483_896 | 132 |
| 808 | 3300035117 | Ga0373953_0178273 | Ga0373953_0178273_484_882 | 132 |
| 809 | 3300035117 | Ga0373953_0267192 | Ga0373953_0267192_33_431 | 132 |
| 810 | 3300035118 | Ga0373954_0000132 | Ga0373954_0000132_23634_24032 | 132 |
| 811 | 3300035118 | Ga0373954_0012512 | Ga0373954_0012512_2116_2529 | 132 |
| 812 | 3300035118 | Ga0373954_0120546 | Ga0373954_0120546_412_810 | 132 |
| 813 | 3300035118 | Ga0373954_0165687 | Ga0373954_0165687_519_962 | 132 |
| 814 | 3300035119 | Ga0373956_0041475 | Ga0373956_0041475_680_1078 | 132 |
| 815 | 3300035119 | Ga0373956_0417455 | Ga0373956_0417455_166_579 | 132 |
| 816 | 3300035120 | Ga0373957_0000168 | Ga0373957_0000168_5422_5820 | 132 |
| 817 | 3300035120 | Ga0373957_0024164 | Ga0373957_0024164_299_712 | 132 |
| 818 | 3300035120 | Ga0373957_0115560 | Ga0373957_0115560_353_754 | 132 |
| 819 | 3300035121 | Ga0373960_0116131 | Ga0373960_0116131_317_715 | 132 |
| 820 | 3300035121 | Ga0373960_0347968 | Ga0373960_0347968_93_491 | 132 |
| 821 | 3300035170 | Ga0373943_0033585 | Ga0373943_0033585_1564_1962 | 132 |
| 822 | 3300035170 | Ga0373943_0053207 | Ga0373943_0053207_1524_1937 | 132 |
| 823 | 3300035170 | Ga0373943_0121474 | Ga0373943_0121474_154_552 | 132 |
| 824 | 3300035170 | Ga0373943_0407583 | Ga0373943_0407583_93_491 | 132 |
| 825 | 3300035171 | Ga0373946_0003228 | Ga0373946_0003228_4277_4675 | 132 |
| 826 | 3300035171 | Ga0373946_0074634 | Ga0373946_0074634_900_1313 | 132 |
| 827 | 3300035171 | Ga0373946_0078850 | Ga0373946_0078850_36_434 | 132 |
| 828 | 3300035172 | Ga0373955_0001612 | Ga0373955_0001612_1562_1960 | 132 |
| 829 | 3300035172 | Ga0373955_0007649 | Ga0373955_0007649_1388_1789 | 132 |
| 830 | 3300035172 | Ga0373955_0055600 | Ga0373955_0055600_473_886 | 132 |
| 831 | 3300035172 | Ga0373955_0304498 | Ga0373955_0304498_292_735 | 132 |
| 832 | 3300035207 | Ga0373942_0008063 | Ga0373942_0008063_131_529 | 132 |
| 833 | 3300035242 | Ga0373962_0303142 | Ga0373962_0303142_27_425 | 132 |
| 834 | 3300035410 | Ga0373924_0006263 | Ga0373924_0006263_3199_3612 | 132 |
| 835 | 3300035410 | Ga0373924_0017596 | Ga0373924_0017596_26_424 | 132 |
| 836 | 3300035410 | Ga0373924_0047743 | Ga0373924_0047743_1087_1488 | 132 |
| 837 | 3300035410 | Ga0373924_0203407 | Ga0373924_0203407_437_835 | 132 |
| 838 | 3300035691 | Ga0373931_0004299 | Ga0373931_0004299_2789_3187 | 132 |
| 839 | 3300035691 | Ga0373931_0063897 | Ga0373931_0063897_1581_1979 | 132 |
| 840 | 3300035692 | Ga0373935_0000435 | Ga0373935_0000435_2314_2712 | 132 |
| 841 | 3300035692 | Ga0373935_0019538 | Ga0373935_0019538_2821_3222 | 132 |
| 842 | 3300035692 | Ga0373935_0391622 | Ga0373935_0391622_310_708 | 132 |
| 843 | 3300035692 | Ga0373935_0585129 | Ga0373935_0585129_207_605 | 132 |
| 844 | 3300035692 | Ga0373935_0770135 | Ga0373935_0770135_296_694 | 132 |
| 845 | 3300035695 | Ga0373927_0002587 | Ga0373927_0002587_10697_11095 | 132 |
| 846 | 3300035695 | Ga0373927_0008673 | Ga0373927_0008673_3422_3820 | 132 |
| 847 | 3300035695 | Ga0373927_0010027 | Ga0373927_0010027_1557_1955 | 132 |
| 848 | 3300035695 | Ga0373927_0027124 | Ga0373927_0027124_167_565 | 132 |
| 849 | 3300035695 | Ga0373927_0106796 | Ga0373927_0106796_730_1128 | 132 |
| 850 | 3300035695 | Ga0373927_0462735 | Ga0373927_0462735_137_550 | 132 |
| 851 | 3300035695 | Ga0373927_0493178 | Ga0373927_0493178_19_453 | 132 |
| 852 | 3300035695 | Ga0373927_0575714 | Ga0373927_0575714_97_504 | 132 |
| 853 | 3300035695 | Ga0373927_0661197 | Ga0373927_0661197_34_432 | 132 |
| 854 | 3300035695 | Ga0373927_0832459 | Ga0373927_0832459_111_509 | 132 |
| 855 | 3300035724 | Ga0373933_0000243 | Ga0373933_0000243_16761_17159 | 132 |
| 856 | 3300035724 | Ga0373933_0069361 | Ga0373933_0069361_840_1238 | 132 |
| 857 | 3300035724 | Ga0373933_0218792 | Ga0373933_0218792_514_957 | 132 |
| 858 | 3300035725 | Ga0373947_0007586 | Ga0373947_0007586_957_1370 | 132 |
| 859 | 3300035725 | Ga0373947_0012060 | Ga0373947_0012060_392_790 | 132 |
| 860 | 3300035725 | Ga0373947_0024670 | Ga0373947_0024670_1546_1944 | 132 |
| 861 | 3300035725 | Ga0373947_0038731 | Ga0373947_0038731_412_810 | 132 |
| 862 | 3300035725 | Ga0373947_0186019 | Ga0373947_0186019_735_1133 | 132 |
| 863 | 3300035725 | Ga0373947_0355932 | Ga0373947_0355932_215_613 | 132 |
| 864 | 3300035725 | Ga0373947_0436874 | Ga0373947_0436874_438_839 | 132 |
| 865 | 3300035725 | Ga0373947_0608518 | Ga0373947_0608518_17_415 | 132 |
| 866 | 3300035725 | Ga0373947_1198408 | Ga0373947_1198408_22_435 | 132 |
| 867 | 3300036401 | Ga0373937_0039688 | Ga0373937_0039688_3732_4130 | 132 |
| 868 | 3300036401 | Ga0373937_0196956 | Ga0373937_0196956_1292_1693 | 132 |
| 869 | 3300036401 | Ga0373937_0244436 | Ga0373937_0244436_797_1195 | 132 |
| 870 | 3300036401 | Ga0373937_0667895 | Ga0373937_0667895_338_751 | 132 |
| 871 | 3300036401 | Ga0373937_0728048 | Ga0373937_0728048_490_888 | 132 |
| 872 | 3300036534 | Ga0310109_054355 | Ga0310109_054355_74_490 | 132 |
| 873 | 3300037068 | Ga0373925_0001774 | Ga0373925_0001774_6114_6512 | 132 |
| 874 | 3300037068 | Ga0373925_0045958 | Ga0373925_0045958_1620_2018 | 132 |
| 875 | 3300037068 | Ga0373925_0054102 | Ga0373925_0054102_437_850 | 132 |
| 876 | 3300037068 | Ga0373925_0067551 | Ga0373925_0067551_1128_1526 | 132 |
| 877 | 3300037068 | Ga0373925_0483407 | Ga0373925_0483407_310_717 | 132 |
| 878 | 3300037068 | Ga0373925_0593208 | Ga0373925_0593208_439_837 | 132 |
| 879 | 3300037068 | Ga0373925_0807177 | Ga0373925_0807177_309_710 | 132 |
| 880 | 3300037068 | Ga0373925_0943314 | Ga0373925_0943314_30_443 | 132 |
| 881 | 3300037418 | Ga0395900_0072533 | Ga0395900_0072533_2943_3356 | 132 |
| 882 | 3300037418 | Ga0395900_0809546 | Ga0395900_0809546_57_455 | 132 |
| 883 | 3300037466 | Ga0395898_1678239 | Ga0395898_1678239_100_498 | 132 |
| 884 | 3300037471 | Ga0395905_0022828 | Ga0395905_0022828_4584_4982 | 132 |
| 885 | 3300037471 | Ga0395905_1235047 | Ga0395905_1235047_111_509 | 132 |
| 886 | 3300037853 | Ga0436364_0235897 | Ga0436364_0235897_1301_1714 | 132 |
| 887 | 3300037853 | Ga0436364_0740920 | Ga0436364_0740920_71_484 | 132 |
| 888 | 3300037853 | Ga0436364_1140579 | Ga0436364_1140579_2005_2418 | 132 |
| 889 | 3300038443 | Ga0395901_0797843 | Ga0395901_0797843_494_892 | 132 |
| 890 | 3300038443 | Ga0395901_0997229 | Ga0395901_0997229_175_573 | 132 |
| 891 | 3300039437 | Ga0436365_0090210 | Ga0436365_0090210_122_535 | 132 |
| 892 | 3300039437 | Ga0436365_0136317 | Ga0436365_0136317_742_1155 | 132 |
| 893 | 3300039437 | Ga0436365_0186711 | Ga0436365_0186711_2655_3053 | 132 |
| 894 | 3300039437 | Ga0436365_0482256 | Ga0436365_0482256_258_671 | 132 |
| 895 | 3300039437 | Ga0436365_0948552 | Ga0436365_0948552_85_483 | 132 |
| 896 | 3300039437 | Ga0436365_0996952 | Ga0436365_0996952_31_429 | 132 |
| 897 | 3300039437 | Ga0436365_1250872 | Ga0436365_1250872_603_1016 | 132 |
| 898 | 3300039437 | Ga0436365_1444108 | Ga0436365_1444108_356_769 | 132 |
| 899 | 3300039437 | Ga0436365_1455192 | Ga0436365_1455192_40_453 | 132 |
| 900 | 3300039438 | Ga0436360_0485622 | Ga0436360_0485622_1332_1745 | 132 |
| 901 | 3300039438 | Ga0436360_0577390 | Ga0436360_0577390_11_409 | 132 |
| 902 | 3300039438 | Ga0436360_0979855 | Ga0436360_0979855_307_723 | 132 |
| 903 | 3300039438 | Ga0436360_1055908 | Ga0436360_1055908_27_440 | 132 |
| 904 | 3300039438 | Ga0436360_1355672 | Ga0436360_1355672_655_1068 | 132 |
| 905 | 3300039447 | Ga0436361_0350312 | Ga0436361_0350312_577_990 | 132 |
| 906 | 3300039447 | Ga0436361_0886899 | Ga0436361_0886899_127_540 | 132 |
| 907 | 3300039447 | Ga0436361_0915746 | Ga0436361_0915746_118_531 | 132 |
| 908 | 3300039447 | Ga0436361_0924062 | Ga0436361_0924062_586_999 | 132 |
| 909 | 3300039447 | Ga0436361_1001085 | Ga0436361_1001085_837_1250 | 132 |
| 910 | 3300039447 | Ga0436361_1175390 | Ga0436361_1175390_229_627 | 132 |
| 911 | 3300039450 | Ga0436363_1347498 | Ga0436363_1347498_2832_3245 | 132 |
| 912 | 3300039453 | Ga0436362_0377775 | Ga0436362_0377775_1797_2195 | 132 |
| 913 | 3300039453 | Ga0436362_0382758 | Ga0436362_0382758_84_482 | 132 |
| 914 | 3300039453 | Ga0436362_0610597 | Ga0436362_0610597_81_494 | 132 |
| 915 | 3300039453 | Ga0436362_1238292 | Ga0436362_1238292_349_762 | 132 |
| 916 | 3300041413 | Ga0439465_0103614 | Ga0439465_0103614_428_826 | 132 |
| 917 | 3300041451 | Ga0451791_1702097 | Ga0451791_1702097_38_451 | 132 |
| 918 | 3300041452 | Ga0451793_0207987 | Ga0451793_0207987_840_1238 | 132 |
| 919 | 3300041453 | Ga0451797_1118947 | Ga0451797_1118947_259_657 | 132 |
| 920 | 3300041456 | Ga0451795_0620610 | Ga0451795_0620610_150_548 | 132 |
| 921 | 3300041458 | Ga0451798_0117060 | Ga0451798_0117060_172_570 | 132 |
| 922 | 3300041459 | Ga0451800_1531708 | Ga0451800_1531708_133_531 | 132 |
| 923 | 3300041460 | Ga0451802_1867047 | Ga0451802_1867047_20_418 | 132 |
| 924 | 3300041486 | Ga0451807_0039385 | Ga0451807_0039385_140_538 | 132 |
| 925 | 3300041486 | Ga0451807_1920733 | Ga0451807_1920733_192_590 | 132 |
| 926 | 3300041498 | Ga0451841_1263376 | Ga0451841_1263376_41_439 | 132 |
| 927 | 3300041507 | Ga0451851_0996538 | Ga0451851_0996538_34_432 | 132 |
| 928 | 3300041511 | Ga0451855_0429867 | Ga0451855_0429867_66_464 | 132 |
| 929 | 3300041512 | Ga0451853_3357421 | Ga0451853_3357421_150_548 | 132 |
| 930 | 3300041512 | Ga0451853_3867451 | Ga0451853_3867451_140_538 | 132 |
| 931 | 3300044684 | Ga0466966_0094483 | Ga0466966_0094483_1019_1432 | 132 |
| 932 | 3300044684 | Ga0466966_0099429 | Ga0466966_0099429_552_965 | 132 |
| 933 | 3300044693 | Ga0466961_0898865 | Ga0466961_0898865_15_428 | 132 |
| 934 | 3300044694 | Ga0466963_0306964 | Ga0466963_0306964_252_656 | 132 |
| 935 | 3300044694 | Ga0466963_0362647 | Ga0466963_0362647_77_490 | 132 |
| 936 | 3300044706 | Ga0466964_0096969 | Ga0466964_0096969_655_1053 | 132 |
| 937 | 3300044719 | Ga0466971_0147944 | Ga0466971_0147944_262_660 | 132 |
| 938 | 3300044735 | Ga0466968_0284005 | Ga0466968_0284005_369_782 | 132 |
| 939 | 3300044765 | Ga0466970_0086575 | Ga0466970_0086575_682_1095 | 132 |
| 940 | 3300044842 | Ga0466957_0297805 | Ga0466957_0297805_487_885 | 132 |
| 941 | 3300044842 | Ga0466957_0407907 | Ga0466957_0407907_13_426 | 132 |
| 942 | 3300044842 | Ga0466957_1375010 | Ga0466957_1375010_75_488 | 132 |
| 943 | 3300045049 | Ga0466959_0011001 | Ga0466959_0011001_5417_5830 | 132 |
| 944 | 3300045976 | Ga0466967_0093443 | Ga0466967_0093443_398_796 | 132 |
| 945 | 3300045976 | Ga0466967_0139617 | Ga0466967_0139617_1150_1554 | 132 |
| 946 | 3300045976 | Ga0466967_0154900 | Ga0466967_0154900_472_885 | 132 |
| 947 | 3300045976 | Ga0466967_0272497 | Ga0466967_0272497_952_1365 | 132 |
| 948 | 3300045976 | Ga0466967_1731067 | Ga0466967_1731067_194_607 | 132 |
| 949 | 3300045976 | Ga0466967_2361388 | Ga0466967_2361388_97_495 | 132 |
| 950 | 3300046452 | Ga0495617_175702 | Ga0495617_175702_96_494 | 132 |
| 951 | 3300046453 | Ga0495627_162677 | Ga0495627_162677_42_440 | 132 |
| 952 | 3300046454 | Ga0495592_0000316 | Ga0495592_0000316_778_1176 | 132 |
| 953 | 3300046454 | Ga0495592_0047468 | Ga0495592_0047468_444_842 | 132 |
| 954 | 3300046454 | Ga0495592_0049440 | Ga0495592_0049440_2325_2738 | 132 |
| 955 | 3300046454 | Ga0495592_0181288 | Ga0495592_0181288_906_1307 | 132 |
| 956 | 3300046455 | Ga0495603_0001446 | Ga0495603_0001446_12175_12573 | 132 |
| 957 | 3300046455 | Ga0495603_0022841 | Ga0495603_0022841_2852_3250 | 132 |
| 958 | 3300046455 | Ga0495603_0048318 | Ga0495603_0048318_1772_2170 | 132 |
| 959 | 3300046455 | Ga0495603_0145569 | Ga0495603_0145569_482_880 | 132 |
| 960 | 3300046455 | Ga0495603_0195978 | Ga0495603_0195978_445_843 | 132 |
| 961 | 3300046455 | Ga0495603_0501199 | Ga0495603_0501199_115_528 | 132 |
| 962 | 3300046459 | Ga0495629_0000176 | Ga0495629_0000176_51977_52375 | 132 |
| 963 | 3300046459 | Ga0495629_0008069 | Ga0495629_0008069_4425_4823 | 132 |
| 964 | 3300046459 | Ga0495629_0115694 | Ga0495629_0115694_1071_1469 | 132 |
| 965 | 3300046460 | Ga0495638_0161606 | Ga0495638_0161606_770_1168 | 132 |
| 966 | 3300046460 | Ga0495638_0167148 | Ga0495638_0167148_739_1137 | 132 |
| 967 | 3300046461 | Ga0495641_0007242 | Ga0495641_0007242_2158_2556 | 132 |
| 968 | 3300046461 | Ga0495641_0246112 | Ga0495641_0246112_104_502 | 132 |
| 969 | 3300046462 | Ga0495651_0002336 | Ga0495651_0002336_1533_1931 | 132 |
| 970 | 3300046462 | Ga0495651_0034663 | Ga0495651_0034663_141_554 | 132 |
| 971 | 3300046462 | Ga0495651_0036289 | Ga0495651_0036289_2342_2743 | 132 |
| 972 | 3300046462 | Ga0495651_0133363 | Ga0495651_0133363_1118_1516 | 132 |
| 973 | 3300046463 | Ga0495653_0002333 | Ga0495653_0002333_12716_13114 | 132 |
| 974 | 3300046463 | Ga0495653_0048677 | Ga0495653_0048677_2231_2632 | 132 |
| 975 | 3300046463 | Ga0495653_0677016 | Ga0495653_0677016_134_532 | 132 |
| 976 | 3300046471 | Ga0495650_0114507 | Ga0495650_0114507_169_567 | 132 |
| 977 | 3300046472 | Ga0495580_0001310 | Ga0495580_0001310_2534_2932 | 132 |
| 978 | 3300046472 | Ga0495580_0026506 | Ga0495580_0026506_2980_3393 | 132 |
| 979 | 3300046472 | Ga0495580_0241022 | Ga0495580_0241022_317_715 | 132 |
| 980 | 3300046472 | Ga0495580_0433341 | Ga0495580_0433341_345_743 | 132 |
| 981 | 3300046473 | Ga0495582_0000545 | Ga0495582_0000545_6312_6710 | 132 |
| 982 | 3300046473 | Ga0495582_0019184 | Ga0495582_0019184_379_777 | 132 |
| 983 | 3300046473 | Ga0495582_0325338 | Ga0495582_0325338_403_801 | 132 |
| 984 | 3300046474 | Ga0495605_0328411 | Ga0495605_0328411_89_487 | 132 |
| 985 | 3300046475 | Ga0495639_0010592 | Ga0495639_0010592_2195_2593 | 132 |
| 986 | 3300046475 | Ga0495639_0089834 | Ga0495639_0089834_533_931 | 132 |
| 987 | 3300046475 | Ga0495639_0103776 | Ga0495639_0103776_875_1288 | 132 |
| 988 | 3300046475 | Ga0495639_0272352 | Ga0495639_0272352_307_705 | 132 |
| 989 | 3300046476 | Ga0495662_0003999 | Ga0495662_0003999_148_546 | 132 |
| 990 | 3300046476 | Ga0495662_0171896 | Ga0495662_0171896_67_465 | 132 |
| 991 | 3300046477 | Ga0495664_0016518 | Ga0495664_0016518_1619_2020 | 132 |
| 992 | 3300046477 | Ga0495664_0022116 | Ga0495664_0022116_2126_2539 | 132 |
| 993 | 3300046477 | Ga0495664_0112353 | Ga0495664_0112353_247_645 | 132 |
| 994 | 3300046477 | Ga0495664_0123109 | Ga0495664_0123109_1100_1498 | 132 |
| 995 | 3300046477 | Ga0495664_0140249 | Ga0495664_0140249_272_685 | 132 |
| 996 | 3300046477 | Ga0495664_0267503 | Ga0495664_0267503_31_429 | 132 |
| 997 | 3300046477 | Ga0495664_0761221 | Ga0495664_0761221_28_441 | 132 |
| 998 | 3300046491 | Ga0495584_0493114 | Ga0495584_0493114_92_490 | 132 |
| 999 | 3300046492 | Ga0495585_0035267 | Ga0495585_0035267_2204_2602 | 132 |
| 1000 | 3300046492 | Ga0495585_0180295 | Ga0495585_0180295_429_827 | 132 |
| 1001 | 3300046492 | Ga0495585_0279772 | Ga0495585_0279772_413_811 | 132 |
| 1002 | 3300046499 | Ga0495594_0000020 | Ga0495594_0000020_77943_78341 | 132 |
| 1003 | 3300046499 | Ga0495594_0087977 | Ga0495594_0087977_271_669 | 132 |
| 1004 | 3300046499 | Ga0495594_0249012 | Ga0495594_0249012_591_989 | 132 |
| 1005 | 3300046499 | Ga0495594_0313122 | Ga0495594_0313122_335_733 | 132 |
| 1006 | 3300046499 | Ga0495594_0511637 | Ga0495594_0511637_13_447 | 132 |
| 1007 | 3300046499 | Ga0495594_0536512 | Ga0495594_0536512_130_528 | 132 |
| 1008 | 3300046506 | Ga0495583_0212960 | Ga0495583_0212960_333_731 | 132 |
| 1009 | 3300046507 | Ga0495606_0003820 | Ga0495606_0003820_775_1173 | 132 |
| 1010 | 3300046507 | Ga0495606_0320351 | Ga0495606_0320351_66_464 | 132 |
| 1011 | 3300046507 | Ga0495606_0328870 | Ga0495606_0328870_229_627 | 132 |
| 1012 | 3300046507 | Ga0495606_0402991 | Ga0495606_0402991_148_546 | 132 |
| 1013 | 3300046511 | Ga0495608_0005003 | Ga0495608_0005003_3837_4235 | 132 |
| 1014 | 3300046511 | Ga0495608_0076801 | Ga0495608_0076801_317_718 | 132 |
| 1015 | 3300046512 | Ga0495610_0070605 | Ga0495610_0070605_772_1170 | 132 |
| 1016 | 3300046512 | Ga0495610_0181975 | Ga0495610_0181975_410_808 | 132 |
| 1017 | 3300046513 | Ga0495616_0060187 | Ga0495616_0060187_532_930 | 132 |
| 1018 | 3300046514 | Ga0495618_0078963 | Ga0495618_0078963_821_1222 | 132 |
| 1019 | 3300046514 | Ga0495618_0125439 | Ga0495618_0125439_1138_1536 | 132 |
| 1020 | 3300046514 | Ga0495618_0174603 | Ga0495618_0174603_376_789 | 132 |
| 1021 | 3300046514 | Ga0495618_0324373 | Ga0495618_0324373_306_704 | 132 |
| 1022 | 3300046515 | Ga0495620_0251452 | Ga0495620_0251452_64_462 | 132 |
| 1023 | 3300046515 | Ga0495620_0256667 | Ga0495620_0256667_37_435 | 132 |
| 1024 | 3300046516 | Ga0495628_0010144 | Ga0495628_0010144_3582_3980 | 132 |
| 1025 | 3300046516 | Ga0495628_0058137 | Ga0495628_0058137_918_1319 | 132 |
| 1026 | 3300046516 | Ga0495628_0075750 | Ga0495628_0075750_281_694 | 132 |
| 1027 | 3300046516 | Ga0495628_1190507 | Ga0495628_1190507_108_506 | 132 |
| 1028 | 3300046517 | Ga0495630_0044087 | Ga0495630_0044087_2735_3148 | 132 |
| 1029 | 3300046517 | Ga0495630_0274763 | Ga0495630_0274763_820_1221 | 132 |
| 1030 | 3300046517 | Ga0495630_0904493 | Ga0495630_0904493_193_591 | 132 |
| 1031 | 3300046517 | Ga0495630_1100710 | Ga0495630_1100710_61_459 | 132 |
| 1032 | 3300046518 | Ga0495631_0025372 | Ga0495631_0025372_1864_2262 | 132 |
| 1033 | 3300046518 | Ga0495631_0162612 | Ga0495631_0162612_346_744 | 132 |
| 1034 | 3300046518 | Ga0495631_0363391 | Ga0495631_0363391_121_519 | 132 |
| 1035 | 3300046519 | Ga0495632_0138676 | Ga0495632_0138676_54_452 | 132 |
| 1036 | 3300046519 | Ga0495632_0150187 | Ga0495632_0150187_444_842 | 132 |
| 1037 | 3300046519 | Ga0495632_0296297 | Ga0495632_0296297_293_691 | 132 |
| 1038 | 3300046520 | Ga0495637_0336925 | Ga0495637_0336925_22_420 | 132 |
| 1039 | 3300046523 | Ga0495644_0078643 | Ga0495644_0078643_266_664 | 132 |
| 1040 | 3300046523 | Ga0495644_0318893 | Ga0495644_0318893_23_421 | 132 |
| 1041 | 3300046523 | Ga0495644_0430845 | Ga0495644_0430845_71_469 | 132 |
| 1042 | 3300046524 | Ga0495648_0028869 | Ga0495648_0028869_2906_3304 | 132 |
| 1043 | 3300046524 | Ga0495648_0093578 | Ga0495648_0093578_1170_1568 | 132 |
| 1044 | 3300046526 | Ga0495666_0010941 | Ga0495666_0010941_2749_3147 | 132 |
| 1045 | 3300046529 | Ga0495652_0004857 | Ga0495652_0004857_10823_11221 | 132 |
| 1046 | 3300046529 | Ga0495652_0047989 | Ga0495652_0047989_2240_2641 | 132 |
| 1047 | 3300046529 | Ga0495652_0355006 | Ga0495652_0355006_586_984 | 132 |
| 1048 | 3300046529 | Ga0495652_0979629 | Ga0495652_0979629_90_488 | 132 |
| 1049 | 3300046530 | Ga0495654_0090172 | Ga0495654_0090172_431_829 | 132 |
| 1050 | 3300046531 | Ga0495665_0000170 | Ga0495665_0000170_2195_2593 | 132 |
| 1051 | 3300046531 | Ga0495665_0137466 | Ga0495665_0137466_66_479 | 132 |
| 1052 | 3300046533 | Ga0495640_0002547 | Ga0495640_0002547_11836_12234 | 132 |
| 1053 | 3300046533 | Ga0495640_0010374 | Ga0495640_0010374_6485_6886 | 132 |
| 1054 | 3300046533 | Ga0495640_0094459 | Ga0495640_0094459_1532_1930 | 132 |
| 1055 | 3300046533 | Ga0495640_0593690 | Ga0495640_0593690_156_554 | 132 |
| 1056 | 3300046533 | Ga0495640_0856612 | Ga0495640_0856612_33_431 | 132 |
| 1057 | 3300046536 | Ga0495587_0001071 | Ga0495587_0001071_5252_5650 | 132 |
| 1058 | 3300046536 | Ga0495587_0031364 | Ga0495587_0031364_705_1106 | 132 |
| 1059 | 3300046536 | Ga0495587_0602018 | Ga0495587_0602018_165_563 | 132 |
| 1060 | 3300046537 | Ga0495598_0013908 | Ga0495598_0013908_1591_1989 | 132 |
| 1061 | 3300046538 | Ga0495609_0309606 | Ga0495609_0309606_190_588 | 132 |
| 1062 | 3300046538 | Ga0495609_0427873 | Ga0495609_0427873_109_507 | 132 |
| 1063 | 3300046539 | Ga0495621_0043795 | Ga0495621_0043795_222_620 | 132 |
| 1064 | 3300046543 | Ga0495645_0003790 | Ga0495645_0003790_1306_1719 | 132 |
| 1065 | 3300046543 | Ga0495645_0011662 | Ga0495645_0011662_5293_5691 | 132 |
| 1066 | 3300046557 | Ga0495622_0002079 | Ga0495622_0002079_2581_2979 | 132 |
| 1067 | 3300046557 | Ga0495622_0028006 | Ga0495622_0028006_738_1136 | 132 |
| 1068 | 3300046557 | Ga0495622_0229126 | Ga0495622_0229126_373_771 | 132 |
| 1069 | 3300046559 | Ga0495667_0007097 | Ga0495667_0007097_1949_2347 | 132 |
| 1070 | 3300046559 | Ga0495667_0046148 | Ga0495667_0046148_552_965 | 132 |
| 1071 | 3300046559 | Ga0495667_0558964 | Ga0495667_0558964_264_665 | 132 |
| 1072 | 3300046615 | Ga0495656_0050030 | Ga0495656_0050030_1144_1542 | 132 |
| 1073 | 3300046615 | Ga0495656_0114997 | Ga0495656_0114997_801_1199 | 132 |
| 1074 | 3300046616 | Ga0495668_0041329 | Ga0495668_0041329_1724_2122 | 132 |
| 1075 | 3300046616 | Ga0495668_0250745 | Ga0495668_0250745_186_584 | 132 |
| 1076 | 3300046616 | Ga0495668_0304781 | Ga0495668_0304781_287_685 | 132 |
| 1077 | 3300046616 | Ga0495668_0439123 | Ga0495668_0439123_204_602 | 132 |
| 1078 | 3300046642 | Ga0495634_0000998 | Ga0495634_0000998_3911_4309 | 132 |
| 1079 | 3300046642 | Ga0495634_0019197 | Ga0495634_0019197_1471_1884 | 132 |
| 1080 | 3300046642 | Ga0495634_0111197 | Ga0495634_0111197_175_573 | 132 |
| 1081 | 3300046642 | Ga0495634_0402870 | Ga0495634_0402870_84_485 | 132 |
| 1082 | 3300046648 | Ga0495611_0040906 | Ga0495611_0040906_184_582 | 132 |
| 1083 | 3300046648 | Ga0495611_0379933 | Ga0495611_0379933_48_446 | 132 |
| 1084 | 3300046660 | Ga0495625_0260674 | Ga0495625_0260674_421_819 | 132 |
| 1085 | 3300046660 | Ga0495625_0400839 | Ga0495625_0400839_416_814 | 132 |
| 1086 | 3300046663 | Ga0495635_0000040 | Ga0495635_0000040_12422_12820 | 132 |
| 1087 | 3300046663 | Ga0495635_0030879 | Ga0495635_0030879_604_1002 | 132 |
| 1088 | 3300046663 | Ga0495635_0084818 | Ga0495635_0084818_463_864 | 132 |
| 1089 | 3300046663 | Ga0495635_0177498 | Ga0495635_0177498_921_1319 | 132 |
| 1090 | 3300046664 | Ga0495659_0031086 | Ga0495659_0031086_945_1343 | 132 |
| 1091 | 3300046664 | Ga0495659_0049398 | Ga0495659_0049398_953_1351 | 132 |
| 1092 | 3300046665 | Ga0495661_0108816 | Ga0495661_0108816_540_938 | 132 |
| 1093 | 3300046674 | Ga0495588_0010035 | Ga0495588_0010035_3915_4313 | 132 |
| 1094 | 3300046674 | Ga0495588_0063546 | Ga0495588_0063546_1377_1775 | 132 |
| 1095 | 3300046674 | Ga0495588_0257880 | Ga0495588_0257880_507_905 | 132 |
| 1096 | 3300046675 | Ga0495657_0000218 | Ga0495657_0000218_38642_39040 | 132 |
| 1097 | 3300046675 | Ga0495657_0204325 | Ga0495657_0204325_382_795 | 132 |
| 1098 | 3300046675 | Ga0495657_0460422 | Ga0495657_0460422_77_475 | 132 |
| 1099 | 3300046675 | Ga0495657_0640031 | Ga0495657_0640031_43_441 | 132 |
| 1100 | 3300046678 | Ga0495599_0000256 | Ga0495599_0000256_8459_8857 | 132 |
| 1101 | 3300046678 | Ga0495599_0044271 | Ga0495599_0044271_734_1147 | 132 |
| 1102 | 3300046678 | Ga0495599_0049469 | Ga0495599_0049469_222_620 | 132 |
| 1103 | 3300046678 | Ga0495599_0097164 | Ga0495599_0097164_181_582 | 132 |
| 1104 | 3300046679 | Ga0495623_0013540 | Ga0495623_0013540_1141_1542 | 132 |
| 1105 | 3300046679 | Ga0495623_0085754 | Ga0495623_0085754_417_815 | 132 |
| 1106 | 3300046679 | Ga0495623_0422695 | Ga0495623_0422695_213_611 | 132 |
| 1107 | 3300046679 | Ga0495623_0597224 | Ga0495623_0597224_101_499 | 132 |
| 1108 | 3300046680 | Ga0495646_0003573 | Ga0495646_0003573_2927_3325 | 132 |
| 1109 | 3300046680 | Ga0495646_0083110 | Ga0495646_0083110_584_985 | 132 |
| 1110 | 3300046680 | Ga0495646_0534592 | Ga0495646_0534592_180_578 | 132 |
| 1111 | 3300046681 | Ga0495647_0001303 | Ga0495647_0001303_2135_2533 | 132 |
| 1112 | 3300046681 | Ga0495647_0065497 | Ga0495647_0065497_21_434 | 132 |
| 1113 | 3300046681 | Ga0495647_0128312 | Ga0495647_0128312_188_586 | 132 |
| 1114 | 3300046681 | Ga0495647_0218145 | Ga0495647_0218145_429_827 | 132 |
| 1115 | 3300046683 | Ga0495658_0002344 | Ga0495658_0002344_2953_3351 | 132 |
| 1116 | 3300046684 | Ga0495669_0004164 | Ga0495669_0004164_4442_4840 | 132 |
| 1117 | 3300046684 | Ga0495669_0052804 | Ga0495669_0052804_426_824 | 132 |
| 1118 | 3300046684 | Ga0495669_0101358 | Ga0495669_0101358_100_498 | 132 |
| 1119 | 3300046684 | Ga0495669_0210326 | Ga0495669_0210326_323_721 | 132 |
| 1120 | 3300046684 | Ga0495669_0274305 | Ga0495669_0274305_340_738 | 132 |
| 1121 | 3300046684 | Ga0495669_0393434 | Ga0495669_0393434_52_450 | 132 |
| 1122 | 3300046689 | Ga0495613_0017244 | Ga0495613_0017244_675_1073 | 132 |
| 1123 | 3300046689 | Ga0495613_0148878 | Ga0495613_0148878_798_1196 | 132 |
| 1124 | 3300046689 | Ga0495613_0276398 | Ga0495613_0276398_105_503 | 132 |
| 1125 | 3300046689 | Ga0495613_0759863 | Ga0495613_0759863_40_474 | 132 |
| 1126 | 3300046690 | Ga0495624_0009089 | Ga0495624_0009089_3866_4264 | 132 |
| 1127 | 3300046690 | Ga0495624_0037826 | Ga0495624_0037826_371_784 | 132 |
| 1128 | 3300046690 | Ga0495624_0295698 | Ga0495624_0295698_87_488 | 132 |
| 1129 | 3300046690 | Ga0495624_0523356 | Ga0495624_0523356_25_423 | 132 |
| 1130 | 3300046691 | Ga0495670_0082771 | Ga0495670_0082771_554_952 | 132 |
| 1131 | 3300046691 | Ga0495670_0170470 | Ga0495670_0170470_265_663 | 132 |
| 1132 | 3300046692 | Ga0495671_0074187 | Ga0495671_0074187_341_739 | 132 |
| 1133 | 3300046692 | Ga0495671_0153623 | Ga0495671_0153623_40_438 | 132 |
| 1134 | 3300046694 | Ga0495649_0276088 | Ga0495649_0276088_60_458 | 132 |
| 1135 | 3300046794 | Ga0495589_0243042 | Ga0495589_0243042_354_752 | 132 |
| 1136 | 3300046794 | Ga0495589_0381400 | Ga0495589_0381400_238_636 | 132 |
| 1137 | 3300046809 | Ga0495600_0000541 | Ga0495600_0000541_9046_9444 | 132 |
| 1138 | 3300046809 | Ga0495600_0067787 | Ga0495600_0067787_274_672 | 132 |
| 1139 | 3300046809 | Ga0495600_0086718 | Ga0495600_0086718_312_713 | 132 |
| 1140 | 3300047315 | Ga0495581_0003140 | Ga0495581_0003140_2195_2593 | 132 |
| 1141 | 3300047315 | Ga0495581_0023393 | Ga0495581_0023393_2541_2954 | 132 |
| 1142 | 3300047315 | Ga0495581_0061621 | Ga0495581_0061621_1482_1916 | 132 |
| 1143 | 3300047315 | Ga0495581_0066144 | Ga0495581_0066144_11_409 | 132 |
| 1144 | 3300047315 | Ga0495581_0623858 | Ga0495581_0623858_113_511 | 132 |
| 1145 | 3300047317 | Ga0495604_0001811 | Ga0495604_0001811_10659_11057 | 132 |
| 1146 | 3300047317 | Ga0495604_0343396 | Ga0495604_0343396_389_802 | 132 |
| 1147 | 3300047317 | Ga0495604_0402588 | Ga0495604_0402588_74_472 | 132 |
| 1148 | 3300047317 | Ga0495604_0521387 | Ga0495604_0521387_228_626 | 132 |
| 1149 | 3300047317 | Ga0495604_0594829 | Ga0495604_0594829_282_680 | 132 |
| 1150 | 3300047318 | Ga0495636_0464653 | Ga0495636_0464653_108_506 | 132 |
| 1151 | 3300047319 | Ga0495674_0000600 | Ga0495674_0000600_7400_7798 | 132 |
| 1152 | 3300047319 | Ga0495674_0077886 | Ga0495674_0077886_95_508 | 132 |
| 1153 | 3300047319 | Ga0495674_0634500 | Ga0495674_0634500_256_657 | 132 |
| 1154 | 3300047319 | Ga0495674_0750856 | Ga0495674_0750856_145_543 | 132 |
| 1155 | 3300047320 | Ga0495672_0007934 | Ga0495672_0007934_5765_6163 | 132 |
| 1156 | 3300047320 | Ga0495672_0200728 | Ga0495672_0200728_364_762 | 132 |
| 1157 | 3300047320 | Ga0495672_0260818 | Ga0495672_0260818_378_776 | 132 |
| 1158 | 3300047321 | Ga0495676_0037688 | Ga0495676_0037688_458_856 | 132 |
| 1159 | 3300047321 | Ga0495676_0046483 | Ga0495676_0046483_241_639 | 132 |
| 1160 | 3300047321 | Ga0495676_0049266 | Ga0495676_0049266_1435_1833 | 132 |
| 1161 | 3300047321 | Ga0495676_0320194 | Ga0495676_0320194_209_622 | 132 |
| 1162 | 3300047322 | Ga0495680_0011919 | Ga0495680_0011919_3860_4258 | 132 |
| 1163 | 3300047322 | Ga0495680_0059137 | Ga0495680_0059137_42_440 | 132 |
| 1164 | 3300047322 | Ga0495680_0080401 | Ga0495680_0080401_1292_1693 | 132 |
| 1165 | 3300047322 | Ga0495680_0396202 | Ga0495680_0396202_520_933 | 132 |
| 1166 | 3300047322 | Ga0495680_0433135 | Ga0495680_0433135_173_571 | 132 |
| 1167 | 3300047322 | Ga0495680_0501396 | Ga0495680_0501396_316_714 | 132 |
| 1168 | 3300047323 | Ga0495683_0058376 | Ga0495683_0058376_1508_1906 | 132 |
| 1169 | 3300047323 | Ga0495683_0088393 | Ga0495683_0088393_380_778 | 132 |
| 1170 | 3300047323 | Ga0495683_0158602 | Ga0495683_0158602_201_599 | 132 |
| 1171 | 3300047444 | Ga0495675_0055004 | Ga0495675_0055004_1048_1449 | 132 |
| 1172 | 3300047445 | Ga0495677_0123238 | Ga0495677_0123238_502_900 | 132 |
| 1173 | 3300047445 | Ga0495677_0362708 | Ga0495677_0362708_100_498 | 132 |
| 1174 | 3300047446 | Ga0495679_050073 | Ga0495679_050073_577_975 | 132 |
| 1175 | 3300047447 | Ga0495685_282846 | Ga0495685_282846_53_451 | 132 |
| 1176 | 3300047469 | Ga0495673_0064876 | Ga0495673_0064876_1023_1421 | 132 |
| 1177 | 3300047469 | Ga0495673_0091021 | Ga0495673_0091021_94_492 | 132 |
| 1178 | 3300047469 | Ga0495673_0260515 | Ga0495673_0260515_192_590 | 132 |
| 1179 | 3300047471 | Ga0495684_0000023 | Ga0495684_0000023_39452_39850 | 132 |
| 1180 | 3300047471 | Ga0495684_0035362 | Ga0495684_0035362_210_623 | 132 |
| 1181 | 3300047471 | Ga0495684_0041506 | Ga0495684_0041506_589_987 | 132 |
| 1182 | 3300047673 | Ga0495593_0003332 | Ga0495593_0003332_2584_2982 | 132 |
| 1183 | 3300047673 | Ga0495593_0005773 | Ga0495593_0005773_3199_3597 | 132 |
| 1184 | 3300047673 | Ga0495593_0086730 | Ga0495593_0086730_187_600 | 132 |
| 1185 | 3300048088 | Ga0495602_0008270 | Ga0495602_0008270_4396_4794 | 132 |
| 1186 | 3300048088 | Ga0495602_0079174 | Ga0495602_0079174_1619_2020 | 132 |
| 1187 | 3300048088 | Ga0495602_0222208 | Ga0495602_0222208_844_1257 | 132 |
| 1188 | 3300048088 | Ga0495602_0480250 | Ga0495602_0480250_14_412 | 132 |
| 1189 | 3300048089 | Ga0495614_0513275 | Ga0495614_0513275_118_516 | 132 |
| 1190 | 3300048903 | Ga0496100_0005982 | Ga0496100_0005982_4876_5274 | 132 |
| 1191 | 3300048903 | Ga0496100_0162736 | Ga0496100_0162736_438_866 | 132 |
| 1192 | 3300048903 | Ga0496100_0386942 | Ga0496100_0386942_544_942 | 132 |
| 1193 | 3300048904 | Ga0496101_0025777 | Ga0496101_0025777_1290_1688 | 132 |
| 1194 | 3300048904 | Ga0496101_0038511 | Ga0496101_0038511_1693_2091 | 132 |
| 1195 | 3300048904 | Ga0496101_0224261 | Ga0496101_0224261_494_892 | 132 |
| 1196 | 3300048904 | Ga0496101_0637589 | Ga0496101_0637589_304_717 | 132 |
| 1197 | 3300048905 | Ga0496102_0008125 | Ga0496102_0008125_1595_1993 | 132 |
| 1198 | 3300048905 | Ga0496102_0156905 | Ga0496102_0156905_1185_1583 | 132 |
| 1199 | 3300048905 | Ga0496102_0275430 | Ga0496102_0275430_102_500 | 132 |
| 1200 | 3300048905 | Ga0496102_0311979 | Ga0496102_0311979_644_1072 | 132 |
| 1201 | 3300048905 | Ga0496102_0558399 | Ga0496102_0558399_97_495 | 132 |
| 1202 | 3300048906 | Ga0496103_0042708 | Ga0496103_0042708_1560_1958 | 132 |
| 1203 | 3300048906 | Ga0496103_0126537 | Ga0496103_0126537_944_1342 | 132 |
| 1204 | 3300048907 | Ga0496104_0020842 | Ga0496104_0020842_2126_2524 | 132 |
| 1205 | 3300048907 | Ga0496104_0029258 | Ga0496104_0029258_1462_1890 | 132 |
| 1206 | 3300048907 | Ga0496104_0075547 | Ga0496104_0075547_2595_2993 | 132 |
| 1207 | 3300048907 | Ga0496104_0370557 | Ga0496104_0370557_545_958 | 132 |
| 1208 | 3300048907 | Ga0496104_0393197 | Ga0496104_0393197_830_1228 | 132 |
| 1209 | 3300048908 | Ga0496105_0008473 | Ga0496105_0008473_2530_2928 | 132 |
| 1210 | 3300048908 | Ga0496105_0054973 | Ga0496105_0054973_2640_3038 | 132 |
| 1211 | 3300048908 | Ga0496105_0255995 | Ga0496105_0255995_732_1160 | 132 |
| 1212 | 3300048908 | Ga0496105_0275710 | Ga0496105_0275710_550_948 | 132 |
| 1213 | 3300048908 | Ga0496105_0320305 | Ga0496105_0320305_50_448 | 132 |
| 1214 | 3300048908 | Ga0496105_0805733 | Ga0496105_0805733_217_615 | 132 |
| 1215 | 3300048909 | Ga0496106_0008202 | Ga0496106_0008202_715_1113 | 132 |
| 1216 | 3300048909 | Ga0496106_0041693 | Ga0496106_0041693_1823_2221 | 132 |
| 1217 | 3300048909 | Ga0496106_0046901 | Ga0496106_0046901_2017_2415 | 132 |
| 1218 | 3300048909 | Ga0496106_0050608 | Ga0496106_0050608_845_1243 | 132 |
| 1219 | 3300048909 | Ga0496106_0061464 | Ga0496106_0061464_209_637 | 132 |
| 1220 | 3300048909 | Ga0496106_0075215 | Ga0496106_0075215_1568_1966 | 132 |
| 1221 | 3300048909 | Ga0496106_1198276 | Ga0496106_1198276_22_435 | 132 |
| 1222 | 3300048910 | Ga0496107_0022899 | Ga0496107_0022899_2794_3192 | 132 |
| 1223 | 3300048910 | Ga0496107_0035705 | Ga0496107_0035705_1137_1535 | 132 |
| 1224 | 3300048910 | Ga0496107_0065602 | Ga0496107_0065602_1930_2328 | 132 |
| 1225 | 3300048910 | Ga0496107_0168783 | Ga0496107_0168783_802_1200 | 132 |
| 1226 | 3300048910 | Ga0496107_0176583 | Ga0496107_0176583_453_851 | 132 |
| 1227 | 3300048910 | Ga0496107_0216401 | Ga0496107_0216401_701_1099 | 132 |
| 1228 | 3300048910 | Ga0496107_0612891 | Ga0496107_0612891_97_495 | 132 |
| 1229 | 3300048910 | Ga0496107_0636235 | Ga0496107_0636235_80_508 | 132 |
| 1230 | 3300048911 | Ga0496108_0003213 | Ga0496108_0003213_6657_7055 | 132 |
| 1231 | 3300048911 | Ga0496108_0010940 | Ga0496108_0010940_235_633 | 132 |
| 1232 | 3300048911 | Ga0496108_0012155 | Ga0496108_0012155_5901_6299 | 132 |
| 1233 | 3300048911 | Ga0496108_0039596 | Ga0496108_0039596_1396_1794 | 132 |
| 1234 | 3300048911 | Ga0496108_0053217 | Ga0496108_0053217_2706_3134 | 132 |
| 1235 | 3300048911 | Ga0496108_1352100 | Ga0496108_1352100_172_570 | 132 |
| 1236 | 3300048912 | Ga0496109_0002585 | Ga0496109_0002585_7483_7881 | 132 |
| 1237 | 3300048912 | Ga0496109_0016135 | Ga0496109_0016135_5042_5440 | 132 |
| 1238 | 3300048912 | Ga0496109_0025566 | Ga0496109_0025566_4445_4873 | 132 |
| 1239 | 3300048912 | Ga0496109_0260761 | Ga0496109_0260761_923_1321 | 132 |
| 1240 | 3300048912 | Ga0496109_0507382 | Ga0496109_0507382_175_573 | 132 |
| 1241 | 3300048912 | Ga0496109_1310615 | Ga0496109_1310615_105_503 | 132 |
| 1242 | 3300048913 | Ga0496110_0005094 | Ga0496110_0005094_5902_6330 | 132 |
| 1243 | 3300048913 | Ga0496110_0009693 | Ga0496110_0009693_1474_1872 | 132 |
| 1244 | 3300048913 | Ga0496110_0011502 | Ga0496110_0011502_4348_4746 | 132 |
| 1245 | 3300048913 | Ga0496110_0090813 | Ga0496110_0090813_230_628 | 132 |
| 1246 | 3300048913 | Ga0496110_0109266 | Ga0496110_0109266_36_434 | 132 |
| 1247 | 3300048913 | Ga0496110_0215738 | Ga0496110_0215738_959_1357 | 132 |
| 1248 | 3300048913 | Ga0496110_0298264 | Ga0496110_0298264_792_1190 | 132 |
| 1249 | 3300048913 | Ga0496110_1152860 | Ga0496110_1152860_245_643 | 132 |
| 1250 | 3300048914 | Ga0496111_0041081 | Ga0496111_0041081_100_498 | 132 |
| 1251 | 3300048914 | Ga0496111_0152865 | Ga0496111_0152865_179_577 | 132 |
| 1252 | 3300048914 | Ga0496111_0164446 | Ga0496111_0164446_672_1085 | 132 |
| 1253 | 3300048914 | Ga0496111_0165666 | Ga0496111_0165666_586_984 | 132 |
| 1254 | 3300048914 | Ga0496111_0204773 | Ga0496111_0204773_213_611 | 132 |
| 1255 | 3300048914 | Ga0496111_0266366 | Ga0496111_0266366_824_1222 | 132 |
| 1256 | 3300048915 | Ga0496112_0000031 | Ga0496112_0000031_71560_71958 | 132 |
| 1257 | 3300048915 | Ga0496112_0002881 | Ga0496112_0002881_4805_5203 | 132 |
| 1258 | 3300048915 | Ga0496112_0055524 | Ga0496112_0055524_3445_3858 | 132 |
| 1259 | 3300048915 | Ga0496112_0118015 | Ga0496112_0118015_1673_2071 | 132 |
| 1260 | 3300048915 | Ga0496112_0189893 | Ga0496112_0189893_1151_1579 | 132 |
| 1261 | 3300048915 | Ga0496112_0366845 | Ga0496112_0366845_703_1101 | 132 |
| 1262 | 3300048916 | Ga0496113_0006041 | Ga0496113_0006041_2448_2846 | 132 |
| 1263 | 3300048916 | Ga0496113_0014440 | Ga0496113_0014440_2671_3069 | 132 |
| 1264 | 3300048916 | Ga0496113_0039454 | Ga0496113_0039454_2830_3228 | 132 |
| 1265 | 3300048916 | Ga0496113_1074691 | Ga0496113_1074691_165_578 | 132 |
| 1266 | 3300048917 | Ga0496114_0028470 | Ga0496114_0028470_1156_1554 | 132 |
| 1267 | 3300048917 | Ga0496114_0090800 | Ga0496114_0090800_1286_1684 | 132 |
| 1268 | 3300048917 | Ga0496114_0271973 | Ga0496114_0271973_274_687 | 132 |
| 1269 | 3300048917 | Ga0496114_0631052 | Ga0496114_0631052_92_490 | 132 |
| 1270 | 3300048917 | Ga0496114_1571325 | Ga0496114_1571325_119_532 | 132 |
| 1271 | 3300048918 | Ga0496115_0010614 | Ga0496115_0010614_6293_6691 | 132 |
| 1272 | 3300048918 | Ga0496115_0038527 | Ga0496115_0038527_1598_1996 | 132 |
| 1273 | 3300048918 | Ga0496115_0068732 | Ga0496115_0068732_1280_1693 | 132 |
| 1274 | 3300048918 | Ga0496115_0138134 | Ga0496115_0138134_835_1263 | 132 |
| 1275 | 3300048918 | Ga0496115_0158378 | Ga0496115_0158378_1413_1811 | 132 |
| 1276 | 3300048918 | Ga0496115_0172524 | Ga0496115_0172524_186_584 | 132 |
| 1277 | 3300048918 | Ga0496115_0234195 | Ga0496115_0234195_1046_1444 | 132 |
| 1278 | 3300048918 | Ga0496115_0616443 | Ga0496115_0616443_257_670 | 132 |
| 1279 | 3300048921 | Ga0496118_0001670 | Ga0496118_0001670_18830_19228 | 132 |
| 1280 | 3300048921 | Ga0496118_0043015 | Ga0496118_0043015_1431_1829 | 132 |
| 1281 | 3300048922 | Ga0496119_0064309 | Ga0496119_0064309_775_1173 | 132 |
| 1282 | 3300048922 | Ga0496119_0405635 | Ga0496119_0405635_44_442 | 132 |
| 1283 | 3300048923 | Ga0496120_0093413 | Ga0496120_0093413_40_438 | 132 |
| 1284 | 3300048923 | Ga0496120_0129130 | Ga0496120_0129130_693_1091 | 132 |
| 1285 | 3300048924 | Ga0496121_0000183 | Ga0496121_0000183_36564_36962 | 132 |
| 1286 | 3300048924 | Ga0496121_0001473 | Ga0496121_0001473_28129_28527 | 132 |
| 1287 | 3300048924 | Ga0496121_0002518 | Ga0496121_0002518_19650_20048 | 132 |
| 1288 | 3300048924 | Ga0496121_0157177 | Ga0496121_0157177_38_451 | 132 |
| 1289 | 3300048924 | Ga0496121_0219605 | Ga0496121_0219605_911_1309 | 132 |
| 1290 | 3300048924 | Ga0496121_0381970 | Ga0496121_0381970_49_447 | 132 |
| 1291 | 3300048927 | Ga0496124_0001382 | Ga0496124_0001382_20897_21295 | 132 |
| 1292 | 3300048927 | Ga0496124_0016454 | Ga0496124_0016454_2867_3265 | 132 |
| 1293 | 3300048927 | Ga0496124_0299139 | Ga0496124_0299139_677_1075 | 132 |
| 1294 | 3300048928 | Ga0496125_0048308 | Ga0496125_0048308_2751_3149 | 132 |
| 1295 | 3300048928 | Ga0496125_0060785 | Ga0496125_0060785_1750_2148 | 132 |
| 1296 | 3300048929 | Ga0496126_0004491 | Ga0496126_0004491_2861_3274 | 132 |
| 1297 | 3300048929 | Ga0496126_0013413 | Ga0496126_0013413_4747_5160 | 132 |
| 1298 | 3300048929 | Ga0496126_0063841 | Ga0496126_0063841_2688_3086 | 132 |
| 1299 | 3300048929 | Ga0496126_0115146 | Ga0496126_0115146_143_541 | 132 |
| 1300 | 3300048929 | Ga0496126_0129927 | Ga0496126_0129927_1265_1678 | 132 |
| 1301 | 3300048929 | Ga0496126_0223766 | Ga0496126_0223766_34_447 | 132 |
| 1302 | 3300048929 | Ga0496126_0242172 | Ga0496126_0242172_656_1054 | 132 |
| 1303 | 3300048929 | Ga0496126_0394707 | Ga0496126_0394707_34_432 | 132 |
| 1304 | 3300048929 | Ga0496126_0498782 | Ga0496126_0498782_433_831 | 132 |
| 1305 | 3300048929 | Ga0496126_0534124 | Ga0496126_0534124_428_826 | 132 |
| 1306 | 3300048929 | Ga0496126_0643537 | Ga0496126_0643537_30_428 | 132 |
| 1307 | 3300049459 | Ga0495678_065656 | Ga0495678_065656_115_513 | 132 |
| 1308 | 3300049460 | Ga0495682_0171067 | Ga0495682_0171067_344_742 | 132 |
| 1309 | 3300049568 | Ga0501031_0000442 | Ga0501031_0000442_7277_7675 | 132 |
| 1310 | 3300049569 | Ga0501032_0000773 | Ga0501032_0000773_16451_16849 | 132 |
| 1311 | 3300049570 | Ga0501033_0000025 | Ga0501033_0000025_13960_14358 | 132 |
| 1312 | 3300049570 | Ga0501033_0336470 | Ga0501033_0336470_575_988 | 132 |
| 1313 | 3300049571 | Ga0501034_0000021 | Ga0501034_0000021_242589_242987 | 132 |
| 1314 | 3300049572 | Ga0501036_0000069 | Ga0501036_0000069_4202_4600 | 132 |
| 1315 | 3300049573 | Ga0501037_0000034 | Ga0501037_0000034_41757_42155 | 132 |
| 1316 | 3300049574 | Ga0501038_0000537 | Ga0501038_0000537_21368_21766 | 132 |
| 1317 | 3300049575 | Ga0501039_0000198 | Ga0501039_0000198_21950_22348 | 132 |
| 1318 | 3300049578 | Ga0501042_0670899 | Ga0501042_0670899_175_573 | 132 |
| 1319 | 3300049579 | Ga0501043_0001044 | Ga0501043_0001044_22623_23021 | 132 |
| 1320 | 3300049580 | Ga0501046_0011176 | Ga0501046_0011176_4333_4731 | 132 |
| 1321 | 3300049581 | Ga0501047_0000587 | Ga0501047_0000587_36336_36734 | 132 |
| 1322 | 3300049581 | Ga0501047_0047916 | Ga0501047_0047916_1378_1791 | 132 |
| 1323 | 3300049581 | Ga0501047_0748050 | Ga0501047_0748050_327_725 | 132 |
| 1324 | 3300049582 | Ga0501048_0008991 | Ga0501048_0008991_3116_3514 | 132 |
| 1325 | 3300049583 | Ga0501067_0000331 | Ga0501067_0000331_4283_4681 | 132 |
| 1326 | 3300049583 | Ga0501067_0056192 | Ga0501067_0056192_649_1047 | 132 |
| 1327 | 3300049584 | Ga0501068_0000039 | Ga0501068_0000039_18926_19324 | 132 |
| 1328 | 3300049585 | Ga0501069_0000910 | Ga0501069_0000910_1144_1542 | 132 |
| 1329 | 3300049585 | Ga0501069_0029131 | Ga0501069_0029131_277_675 | 132 |
| 1330 | 3300049585 | Ga0501069_0410822 | Ga0501069_0410822_214_612 | 132 |
| 1331 | 3300049586 | Ga0501070_0033515 | Ga0501070_0033515_2961_3359 | 132 |
| 1332 | 3300049586 | Ga0501070_0140507 | Ga0501070_0140507_1410_1808 | 132 |
| 1333 | 3300049586 | Ga0501070_0282353 | Ga0501070_0282353_940_1338 | 132 |
| 1334 | 3300049586 | Ga0501070_0306690 | Ga0501070_0306690_537_950 | 132 |
| 1335 | 3300049588 | Ga0501072_0007314 | Ga0501072_0007314_670_1068 | 132 |
| 1336 | 3300049588 | Ga0501072_0250013 | Ga0501072_0250013_674_1072 | 132 |
| 1337 | 3300049589 | Ga0501073_0000236 | Ga0501073_0000236_31184_31582 | 132 |
| 1338 | 3300049589 | Ga0501073_0069491 | Ga0501073_0069491_2016_2429 | 132 |
| 1339 | 3300049590 | Ga0501074_0000048 | Ga0501074_0000048_48606_49004 | 132 |
| 1340 | 3300049590 | Ga0501074_0030647 | Ga0501074_0030647_3178_3591 | 132 |
| 1341 | 3300049686 | Ga0501257_204124 | Ga0501257_204124_91_489 | 132 |
| 1342 | 3300049705 | Ga0501225_0182944 | Ga0501225_0182944_228_626 | 132 |
| 1343 | 3300049741 | Ga0501079_0011390 | Ga0501079_0011390_3888_4286 | 132 |
| 1344 | 3300049741 | Ga0501079_0828095 | Ga0501079_0828095_269_667 | 132 |
| 1345 | 3300049742 | Ga0501080_0034680 | Ga0501080_0034680_467_880 | 132 |
| 1346 | 3300049742 | Ga0501080_0278675 | Ga0501080_0278675_641_1039 | 132 |
| 1347 | 3300049742 | Ga0501080_0472463 | Ga0501080_0472463_453_851 | 132 |
| 1348 | 3300049743 | Ga0501081_1022083 | Ga0501081_1022083_163_561 | 132 |
| 1349 | 3300049744 | Ga0501083_0030815 | Ga0501083_0030815_2139_2537 | 132 |
| 1350 | 3300049822 | Ga0501035_0000865 | Ga0501035_0000865_25988_26386 | 132 |
| 1351 | 3300049823 | Ga0501044_0000028 | Ga0501044_0000028_16436_16834 | 132 |
| 1352 | 3300049823 | Ga0501044_0070718 | Ga0501044_0070718_1835_2248 | 132 |
| 1353 | 3300049823 | Ga0501044_0180205 | Ga0501044_0180205_1326_1724 | 132 |
| 1354 | 3300049823 | Ga0501044_0777983 | Ga0501044_0777983_250_648 | 132 |
| 1355 | 3300049824 | Ga0501045_0191681 | Ga0501045_0191681_726_1124 | 132 |
| 1356 | 3300050489 | nmdc:mga03683_245279_c1 | nmdc:mga03683_245279_c1_276_674 | 132 |
| 1357 | 3300050489 | nmdc:mga03683_555581_c1 | nmdc:mga03683_555581_c1_35_433 | 132 |
| 1358 | 3300050492 | nmdc:mga0yw44_172489_c1 | nmdc:mga0yw44_172489_c1_26_439 | 132 |
| 1359 | 3300050492 | nmdc:mga0yw44_343361_c1 | nmdc:mga0yw44_343361_c1_137_535 | 132 |
| 1360 | 3300050493 | nmdc:mga0k408_184235_c2 | nmdc:mga0k408_184235_c2_39_437 | 132 |
| 1361 | 3300050493 | nmdc:mga0k408_29543_c1 | nmdc:mga0k408_29543_c1_255_653 | 132 |
| 1362 | 3300050493 | nmdc:mga0k408_611302_c1 | nmdc:mga0k408_611302_c1_114_512 | 132 |
| 1363 | 3300050493 | nmdc:mga0k408_695351_c1 | nmdc:mga0k408_695351_c1_134_532 | 132 |
| 1364 | 3300050494 | nmdc:mga06z11_191886_c1 | nmdc:mga06z11_191886_c1_348_746 | 132 |
| 1365 | 3300050494 | nmdc:mga06z11_298778_c1 | nmdc:mga06z11_298778_c1_190_588 | 132 |
| 1366 | 3300050495 | nmdc:mga04h51_171599_c1 | nmdc:mga04h51_171599_c1_216_614 | 132 |
| 1367 | 3300050496 | nmdc:mga07m45_103042_c1 | nmdc:mga07m45_103042_c1_1162_1560 | 132 |
| 1368 | 3300050496 | nmdc:mga07m45_479438_c1 | nmdc:mga07m45_479438_c1_178_576 | 132 |
| 1369 | 3300050496 | nmdc:mga07m45_907950_c1 | nmdc:mga07m45_907950_c1_26_424 | 132 |
| 1370 | 3300050510 | nmdc:mga06r32_564965_c1 | nmdc:mga06r32_564965_c1_101_499 | 132 |
| 1371 | 3300050511 | nmdc:mga08y16_314653_c1 | nmdc:mga08y16_314653_c1_373_771 | 132 |
| 1372 | 3300050512 | nmdc:mga0n895_158416_c1 | nmdc:mga0n895_158416_c1_526_942 | 132 |
| 1373 | 3300050512 | nmdc:mga0n895_354924_c1 | nmdc:mga0n895_354924_c1_751_1149 | 132 |
| 1374 | 3300050513 | nmdc:mga0rr50_700405_c1 | nmdc:mga0rr50_700405_c1_144_557 | 132 |
| 1375 | 3300050514 | nmdc:mga08x19_104020_c1 | nmdc:mga08x19_104020_c1_806_1219 | 132 |
| 1376 | 3300050515 | nmdc:mga0a205_1029238_c1 | nmdc:mga0a205_1029238_c1_254_652 | 132 |
| 1377 | 3300050516 | nmdc:mga0sz30_202315_c1 | nmdc:mga0sz30_202315_c1_225_623 | 132 |
| 1378 | 3300050516 | nmdc:mga0sz30_345707_c1 | nmdc:mga0sz30_345707_c1_52_450 | 132 |
| 1379 | 3300053077 | Ga0495601_0032809 | Ga0495601_0032809_2072_2485 | 132 |
| 1380 | 3300053077 | Ga0495601_0047559 | Ga0495601_0047559_1240_1653 | 132 |
| 1381 | 3300053077 | Ga0495601_0050146 | Ga0495601_0050146_1124_1522 | 132 |
| 1382 | 3300053077 | Ga0495601_0221914 | Ga0495601_0221914_392_790 | 132 |
| 1383 | 3300053078 | Ga0495612_0086620 | Ga0495612_0086620_482_883 | 132 |
| 1384 | 3300053078 | Ga0495612_0163605 | Ga0495612_0163605_486_890 | 132 |
| 1385 | 3300053080 | Ga0500635_0003272 | Ga0500635_0003272_461_859 | 132 |
| 1386 | 3300053080 | Ga0500635_0024104 | Ga0500635_0024104_1472_1870 | 132 |
| 1387 | 3300053080 | Ga0500635_0033210 | Ga0500635_0033210_967_1365 | 132 |
| 1388 | 3300053083 | Ga0495655_0134726 | Ga0495655_0134726_176_574 | 132 |
| 1389 | 3300053084 | Ga0495595_0000634 | Ga0495595_0000634_6262_6660 | 132 |
| 1390 | 3300053084 | Ga0495595_0096720 | Ga0495595_0096720_722_1120 | 132 |
| 1391 | 3300053084 | Ga0495595_0245576 | Ga0495595_0245576_226_624 | 132 |
| 1392 | 3300053084 | Ga0495595_0574087 | Ga0495595_0574087_163_561 | 132 |
| 1393 | 3300053085 | Ga0495619_0000697 | Ga0495619_0000697_10755_11153 | 132 |
| 1394 | 3300053085 | Ga0495619_0013615 | Ga0495619_0013615_1447_1845 | 132 |
| 1395 | 3300053085 | Ga0495619_0072468 | Ga0495619_0072468_650_1048 | 132 |
| 1396 | 3300053085 | Ga0495619_0531461 | Ga0495619_0531461_122_520 | 132 |
| 1397 | 3300053085 | Ga0495619_0639362 | Ga0495619_0639362_227_634 | 132 |
| 1398 | 3300053086 | Ga0500578_0261630 | Ga0500578_0261630_475_873 | 132 |
| 1399 | 3300053086 | Ga0500578_0319122 | Ga0500578_0319122_429_827 | 132 |
| 1400 | 3300053091 | Ga0500647_0055764 | Ga0500647_0055764_1416_1814 | 132 |
| 1401 | 3300053091 | Ga0500647_0291114 | Ga0500647_0291114_142_540 | 132 |
| 1402 | 3300053092 | Ga0500583_0073951 | Ga0500583_0073951_1118_1594 | 132 |
| 1403 | 3300053092 | Ga0500583_0417295 | Ga0500583_0417295_177_575 | 132 |
| 1404 | 3300053093 | Ga0500651_0030288 | Ga0500651_0030288_137_535 | 132 |
| 1405 | 3300053093 | Ga0500651_0030472 | Ga0500651_0030472_1164_1562 | 132 |
| 1406 | 3300053093 | Ga0500651_0156988 | Ga0500651_0156988_285_683 | 132 |
| 1407 | 3300053094 | Ga0500566_0000010 | Ga0500566_0000010_6164_6562 | 132 |
| 1408 | 3300053094 | Ga0500566_0051918 | Ga0500566_0051918_1286_1684 | 132 |
| 1409 | 3300053094 | Ga0500566_0490302 | Ga0500566_0490302_115_513 | 132 |
| 1410 | 3300053095 | Ga0500640_000055 | Ga0500640_000055_6637_7035 | 132 |
| 1411 | 3300053096 | Ga0500641_0093867 | Ga0500641_0093867_459_857 | 132 |
| 1412 | 3300053099 | Ga0500654_142441 | Ga0500654_142441_262_660 | 132 |
| 1413 | 3300053102 | Ga0500554_000560 | Ga0500554_000560_1419_1817 | 132 |
| 1414 | 3300053102 | Ga0500554_027963 | Ga0500554_027963_638_1036 | 132 |
| 1415 | 3300053104 | Ga0500556_0073406 | Ga0500556_0073406_170_568 | 132 |
| 1416 | 3300053104 | Ga0500556_0151239 | Ga0500556_0151239_131_529 | 132 |
| 1417 | 3300053109 | Ga0500569_006916 | Ga0500569_006916_843_1241 | 132 |
| 1418 | 3300053111 | Ga0500572_000088 | Ga0500572_000088_10738_11139 | 132 |
| 1419 | 3300053111 | Ga0500572_001292 | Ga0500572_001292_635_1033 | 132 |
| 1420 | 3300053115 | Ga0500591_200314 | Ga0500591_200314_259_657 | 132 |
| 1421 | 3300053119 | Ga0500595_000967 | Ga0500595_000967_8519_8917 | 132 |
| 1422 | 3300053119 | Ga0500595_001717 | Ga0500595_001717_7826_8311 | 132 |
| 1423 | 3300053119 | Ga0500595_002830 | Ga0500595_002830_7392_7790 | 132 |
| 1424 | 3300053119 | Ga0500595_006501 | Ga0500595_006501_1116_1514 | 132 |
| 1425 | 3300053119 | Ga0500595_008515 | Ga0500595_008515_1047_1445 | 132 |
| 1426 | 3300053122 | Ga0500608_061747 | Ga0500608_061747_750_1148 | 132 |
| 1427 | 3300053122 | Ga0500608_112922 | Ga0500608_112922_543_941 | 132 |
| 1428 | 3300053123 | Ga0500614_000734 | Ga0500614_000734_4800_5198 | 132 |
| 1429 | 3300053133 | Ga0500655_065207 | Ga0500655_065207_264_662 | 132 |
| 1430 | 3300053134 | Ga0500658_0069848 | Ga0500658_0069848_650_1048 | 132 |
| 1431 | 3300053134 | Ga0500658_0221356 | Ga0500658_0221356_159_557 | 132 |
| 1432 | 3300053136 | Ga0500559_0001744 | Ga0500559_0001744_7917_8318 | 132 |
| 1433 | 3300053136 | Ga0500559_0024871 | Ga0500559_0024871_403_801 | 132 |
| 1434 | 3300053136 | Ga0500559_0088109 | Ga0500559_0088109_688_1086 | 132 |
| 1435 | 3300053139 | Ga0500568_0023381 | Ga0500568_0023381_1364_1762 | 132 |
| 1436 | 3300053139 | Ga0500568_0093224 | Ga0500568_0093224_698_1096 | 132 |
| 1437 | 3300053139 | Ga0500568_0119209 | Ga0500568_0119209_524_922 | 132 |
| 1438 | 3300053140 | Ga0500573_0147868 | Ga0500573_0147868_266_664 | 132 |
| 1439 | 3300053142 | Ga0500577_0118571 | Ga0500577_0118571_657_1055 | 132 |
| 1440 | 3300053146 | Ga0500588_0017368 | Ga0500588_0017368_1393_1791 | 132 |
| 1441 | 3300053147 | Ga0500589_046444 | Ga0500589_046444_459_857 | 132 |
| 1442 | 3300053148 | Ga0500590_105444 | Ga0500590_105444_483_881 | 132 |
| 1443 | 3300053148 | Ga0500590_176307 | Ga0500590_176307_207_605 | 132 |
| 1444 | 3300053148 | Ga0500590_189746 | Ga0500590_189746_311_709 | 132 |
| 1445 | 3300053150 | Ga0500603_000342 | Ga0500603_000342_8892_9290 | 132 |
| 1446 | 3300053150 | Ga0500603_004423 | Ga0500603_004423_1917_2315 | 132 |
| 1447 | 3300053150 | Ga0500603_013232 | Ga0500603_013232_1153_1566 | 132 |
| 1448 | 3300053150 | Ga0500603_133042 | Ga0500603_133042_128_526 | 132 |
| 1449 | 3300053150 | Ga0500603_148305 | Ga0500603_148305_38_436 | 132 |
| 1450 | 3300053151 | Ga0500604_0009862 | Ga0500604_0009862_381_779 | 132 |
| 1451 | 3300053154 | Ga0500619_188296 | Ga0500619_188296_112_510 | 132 |
| 1452 | 3300053156 | Ga0500622_0074138 | Ga0500622_0074138_638_1036 | 132 |
| 1453 | 3300053158 | Ga0500627_0092869 | Ga0500627_0092869_11_409 | 132 |
| 1454 | 3300053158 | Ga0500627_0415377 | Ga0500627_0415377_73_471 | 132 |
| 1455 | 3300053159 | Ga0500630_003317 | Ga0500630_003317_3783_4181 | 132 |
| 1456 | 3300053161 | Ga0500634_0171056 | Ga0500634_0171056_19_417 | 132 |
| 1457 | 3300053162 | Ga0500638_000712 | Ga0500638_000712_7406_7804 | 132 |
| 1458 | 3300053162 | Ga0500638_093941 | Ga0500638_093941_556_954 | 132 |
| 1459 | 3300053162 | Ga0500638_159196 | Ga0500638_159196_570_968 | 132 |
| 1460 | 3300053162 | Ga0500638_162057 | Ga0500638_162057_414_812 | 132 |
| 1461 | 3300053162 | Ga0500638_353576 | Ga0500638_353576_81_479 | 132 |
| 1462 | 3300053163 | Ga0500639_000001 | Ga0500639_000001_202085_202483 | 132 |
| 1463 | 3300053163 | Ga0500639_056128 | Ga0500639_056128_1100_1498 | 132 |
| 1464 | 3300053163 | Ga0500639_057167 | Ga0500639_057167_746_1147 | 132 |
| 1465 | 3300053177 | Ga0500636_0078193 | Ga0500636_0078193_401_799 | 132 |
| 1466 | 3300053177 | Ga0500636_0091378 | Ga0500636_0091378_473_871 | 132 |
| 1467 | 3300053177 | Ga0500636_0194916 | Ga0500636_0194916_499_897 | 132 |
| 1468 | 3300053177 | Ga0500636_0303041 | Ga0500636_0303041_208_606 | 132 |
| 1469 | 3300053177 | Ga0500636_0398726 | Ga0500636_0398726_28_426 | 132 |
| 1470 | 3300053178 | Ga0500637_0002851 | Ga0500637_0002851_1982_2380 | 132 |
| 1471 | 3300053178 | Ga0500637_0005100 | Ga0500637_0005100_2063_2461 | 132 |
| 1472 | 3300053178 | Ga0500637_0035858 | Ga0500637_0035858_621_1019 | 132 |
| 1473 | 3300053178 | Ga0500637_0364416 | Ga0500637_0364416_309_707 | 132 |
| 1474 | 3300053725 | Ga0500576_254031 | Ga0500576_254031_85_483 | 132 |
| 1475 | 3300053731 | Ga0500609_008206 | Ga0500609_008206_11_409 | 132 |
| 1476 | 3300053733 | Ga0500552_006330 | Ga0500552_006330_736_1134 | 132 |
| 1477 | 3300053735 | Ga0500596_006761 | Ga0500596_006761_1280_1678 | 132 |
| 1478 | 3300053735 | Ga0500596_007614 | Ga0500596_007614_234_632 | 132 |
| 1479 | 3300053737 | Ga0500601_006758 | Ga0500601_006758_724_1122 | 132 |
| 1480 | 3300053739 | Ga0500587_017740 | Ga0500587_017740_76_474 | 132 |
| 1481 | 3300054114 | Ga0501084_0001432 | Ga0501084_0001432_16062_16460 | 132 |
| 1482 | 3300055283 | Ga0500661_000387 | Ga0500661_000387_6095_6493 | 132 |
| 1483 | 3300059626 | Ga0587115_088134 | Ga0587115_088134_129_542 | 132 |
| 1484 | 3300060353 | Ga0501082_0011376 | Ga0501082_0011376_4515_4913 | 132 |
| 1485 | 3300060353 | Ga0501082_0485625 | Ga0501082_0485625_128_526 | 132 |
| 1486 | 3300060353 | Ga0501082_1589670 | Ga0501082_1589670_135_533 | 132 |
| 1487 | 3300061719 | Ga0466962_0140275 | Ga0466962_0140275_279_692 | 132 |
| 1488 | iso_pu_bacteria | 2513237101 | 2513692387 | 132 |
| 1489 | iso_pu_bacteria | 2876808645 | 2876809028 | 132 |
| 1490 | iso_pu_bacteria | 2879110137 | 2879115405 | 132 |
| 1491 | iso_pu_bacteria | 8006964411 | 8006965605 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hkk-assembly1.cif.gz_A | structure of human leukotriene c4 synthase in complex with glutathione sulfonate | 0.8043 | 3 | 128 |
| 4bpm-assembly1.cif.gz_A | crystal structure of a human integral membrane enzyme | 0.8036 | 3 | 130 |
| 4ntb-assembly1.cif.gz_A | mus musculus ltc4 synthase in gsh complex form | 0.7995 | 3 | 128 |
| 4jc7-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.7947 | 3 | 128 |
| 4j7t-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.7935 | 3 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P64515_1_129_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8313 | 2 | 130 | 1.20.120.550 |
| af_B0R1E9_1_152_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8179 | 3 | 130 | 1.20.120.550 |
| af_P10620_2_155_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8065 | 3 | 130 | 1.20.120.550 |
| af_Q9JHF3_7_153_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8013 | 3 | 130 | 1.20.120.550 |
| 4jc7A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7947 | 3 | 128 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533JAF3-F1-model_v4 | deleted | 0.9991 | 45 | 132 |
|
| AF-A0A7S7Z5G2-F1-model_v4 | MAPEG family protein | 0.991 | 1 | 132 |
GO:0016020
|
| AF-A0A2M8R4K8-F1-model_v4 | MAPEG family protein | 0.9897 | 1 | 132 |
GO:0016020
|
| AF-A0A5S4X384-F1-model_v4 | MAPEG family protein | 0.9881 | 1 | 132 |
GO:0016020
|
| AF-A0A533JAF3-F1-model_v4 | deleted | 0.9879 | 45 | 132 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar