F494336

General Info

Members Datasets Scaffolds Average Seq Length
1491 719 1269 232

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0005063|Ga0373923_0005063_64_867
Length 267
Sequence MFVVAMRGEERQRALPLSYPPRRMGPGVRRDDGESTMKPRPRPFSHVDTWVFDLDNTLYPHHVNLWQQVDARIGEFVSAWLKVSAQQARVIQKDYYRRYGTTMRGMMTEHGVRADDYLAYVHQIDHSPLEPNPAMGAAIARLPGRKLILTNGSTDHADKVLQRLGIGVHFEAVFDIIAAELEPKPAPQTYRKFLRDHAVNPKTSAMFEDLARNLVVPHQLGMTTVLVVPDGSKEVVREDWELEGRDAAHVDHVTDDLTGFLERVATG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
18 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
19 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
30 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
31 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
35 2791355199
36 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
37 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
38 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
39 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
40 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
41 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
42 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
43 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
44 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
49 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
50 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
51 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
54 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
55 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
56 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
57 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
64 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
65 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
66 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
67 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
68 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
69 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
70 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
71 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
72 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
75 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
76 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
77 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
78 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
79 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
80 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
81 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
82 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
83 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
84 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
85 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
86 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
87 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
88 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
89 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
90 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
91 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
92 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
93 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
94 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
95 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
96 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
97 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
98 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
99 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
100 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
101 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
102 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
103 2904699407
104 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
105 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
106 2906610324
107 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
108 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
109 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
110 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
111 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
112 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
113 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
114 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
115 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
116 2922368715
117 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
118 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
119 2922425934
120 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
121 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
122 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
123 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
124 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
125 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
126 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
127 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
128 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
129 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
130 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
131 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
132 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
133 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
134 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
135 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
136 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
137 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
138 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
139 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
140 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
141 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
142 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
143 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
144 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
145 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
146 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
147 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
148 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
149 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
150 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
151 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
152 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
153 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
154 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
155 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
156 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
157 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
158 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
159 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
160 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
161 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
162 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
163 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
164 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
165 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
166 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
167 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
168 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
169 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
170 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
171 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
172 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
173 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
174 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
175 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
176 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
177 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
178 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
179 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
180 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
181 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
182 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
183 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
184 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
185 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
186 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
187 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
188 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
189 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
190 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
191 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
192 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
193 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
194 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
195 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
196 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
197 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
198 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
199 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
202 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
203 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
204 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
205 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
206 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
207 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
208 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
209 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
210 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
211 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
212 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
213 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
214 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
215 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
216 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
217 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
218 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
219 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
220 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
221 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
222 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
223 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
224 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
225 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
226 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
227 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
228 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
229 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
230 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
231 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
232 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
233 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
234 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
235 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
236 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
237 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
238 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
239 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
240 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
241 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
242 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
243 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
244 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
245 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
246 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
247 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
248 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
249 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
250 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
251 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
252 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
253 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
254 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
255 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
256 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
257 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
258 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
259 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
260 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
261 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
262 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
263 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
264 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
265 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
266 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
267 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
268 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
269 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
270 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
271 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
272 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
273 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
274 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
275 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
276 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
277 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
278 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
279 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
280 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
281 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
282 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
283 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
284 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
285 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
286 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
287 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
288 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
289 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
290 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
291 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
292 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
293 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
294 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
295 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
296 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
297 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
298 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
299 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
300 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
301 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
302 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
303 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
304 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
305 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
306 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
307 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
308 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
309 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
310 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
311 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
312 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
313 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
314 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
315 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
316 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
317 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
318 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
319 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
320 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
323 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
325 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
327 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
329 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
386 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
387 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
388 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
389 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
390 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
394 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
395 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
396 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
397 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
398 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
399 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
400 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
401 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
402 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
403 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
404 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
405 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
406 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
407 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
408 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
409 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
410 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
411 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
412 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
413 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
414 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
415 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
416 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
417 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
418 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
419 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
420 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
421 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
422 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
423 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
424 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
425 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
426 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
427 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
428 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
429 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
430 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
431 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
432 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
433 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
434 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
435 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
436 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
437 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
438 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
439 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
440 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
441 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
442 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
443 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
444 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
445 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
446 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
447 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
448 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
449 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
450 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
451 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
452 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
453 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
454 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
455 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
456 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
457 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
458 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
459 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
460 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
461 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
462 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
463 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
464 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
465 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
466 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
467 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
468 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
469 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
470 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
471 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
472 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
473 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
474 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
475 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
476 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
477 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
478 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
479 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
480 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
481 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
482 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
483 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
484 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
485 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
486 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
487 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
488 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
489 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
490 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
491 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
492 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
493 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
494 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
495 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
496 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
497 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
498 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
499 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
500 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
501 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
502 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
503 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
504 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
505 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
506 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
507 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
508 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
509 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
510 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
511 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
512 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
513 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
514 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
515 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
516 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
517 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
518 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
519 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
520 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
521 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
522 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
523 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
524 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
525 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
526 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
527 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
528 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
529 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
530 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
531 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
532 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
533 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
534 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
535 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
536 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
537 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
538 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
539 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
540 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
541 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
542 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
543 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
544 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
545 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
546 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
547 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
548 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
549 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
550 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
551 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
552 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
553 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
554 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
555 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
556 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
557 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
558 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
559 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
560 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
561 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
562 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
563 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
564 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
565 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
566 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
567 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
568 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
569 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
570 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
571 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
572 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
573 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
574 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
575 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
576 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
577 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
578 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
579 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
580 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
581 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
582 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
583 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
584 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
585 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
586 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
587 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
588 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
589 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
590 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
591 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
593 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
594 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
595 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
596 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
598 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
599 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
600 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
601 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
602 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
603 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
604 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
605 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
606 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
607 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
608 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
609 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
610 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
611 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
612 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
613 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
614 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
615 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
616 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
617 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
618 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
619 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
620 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
621 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
622 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
623 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
624 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
625 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
626 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
627 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
628 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
629 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
630 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
631 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
632 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
633 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
634 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
635 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
636 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
637 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
638 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
639 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
640 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
641 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
642 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
643 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
644 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
645 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
646 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
647 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
648 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
649 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
650 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
651 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
652 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
653 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
654 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
655 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
656 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
657 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
658 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
659 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
660 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
661 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
662 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
663 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
664 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
665 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
666 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
667 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
668 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
669 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
670 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
671 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
672 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
673 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
674 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
675 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
676 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
677 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
678 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
679 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
680 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
681 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
682 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
683 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
684 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
685 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
686 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
687 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
688 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
689 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
690 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
691 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
692 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
693 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
694 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
695 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
696 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
697 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
698 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
699 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
700 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
701 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
702 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
703 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
704 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
705 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
706 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
707 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
708 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
709 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
710 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
711 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
712 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
713 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
714 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
715 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
716 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
717 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
718 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
719 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.4
Metatranscriptomes 0
Isolates 14.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.88
Nodule 11.33
Rhizoplane 5.1
Rhizosphere 60.03
Stem 0
Stem Tuber 0
Unclassified 10.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C2869 2010549000 Bacteria 3128
2 JGI24740J21852_10002716 3300001979 Bacteria 7926
3 JGI24739J22299_10029161 3300001989 Bacteria 1921
4 JGI24744J21845_10030724 3300002077 Bacteria 1029
5 JGI25406J46586_10000160 3300003203 Bacteria 30150
6 JGI25406J46586_10012370 3300003203 Bacteria 3707
7 JGI25165J46597_1005725 3300003214 Bacteria 2332
8 JGI25165J46597_1006062 3300003214 Bacteria 2200
9 JGI25153J46596_10002632 3300003215 Bacteria 10264
10 JGI25153J46596_10003367 3300003215 Bacteria 8974
11 JGI25153J46596_10008346 3300003215 Bacteria 4967
12 JGI25153J46596_10014306 3300003215 Bacteria 3305
13 JGI25153J46596_10033551 3300003215 Bacteria 1693
14 JGI25160J50197_1003359 3300003354 Bacteria 7178
15 JGI25160J50197_1011680 3300003354 Bacteria 3093
16 JGI25160J50197_1027994 3300003354 Bacteria 1522
17 JGI25404J52841_10002450 3300003659 Bacteria 3514
18 JGI25404J52841_10024669 3300003659 Bacteria 1295
19 Ga0055531_10020755 3300003794 Bacteria 2582
20 Ga0055543_1004220 3300004625 Bacteria 3974
21 Ga0065165_1001384 3300005262 Bacteria 26615
22 Ga0065165_1001884 3300005262 Bacteria 20242
23 Ga0065165_1004470 3300005262 Bacteria 8633
24 Ga0065165_1073148 3300005262 Bacteria 906
25 Ga0070658_10610270 3300005327 Bacteria 946
26 Ga0070683_100110142 3300005329 Bacteria 2597
27 Ga0070683_100372464 3300005329 Bacteria 1360
28 Ga0070690_100718201 3300005330 Bacteria 769
29 Ga0070670_100288527 3300005331 Bacteria 1434
30 Ga0068869_100065680 3300005334 Bacteria 2671
31 Ga0068869_100102515 3300005334 Bacteria 2166
32 Ga0070680_100062694 3300005336 Bacteria 3044
33 Ga0070680_100089408 3300005336 Bacteria 2548
34 Ga0070680_100160108 3300005336 Bacteria 1891
35 Ga0070680_100446137 3300005336 Bacteria 1105
36 Ga0068868_100029123 3300005338 Bacteria 4228
37 Ga0068868_100033772 3300005338 Bacteria 3945
38 Ga0070660_100218007 3300005339 Bacteria 1550
39 Ga0070689_100228229 3300005340 Bacteria 1529
40 Ga0070691_10051856 3300005341 Bacteria 1961
41 Ga0070687_100482820 3300005343 Bacteria 831
42 Ga0070661_100209431 3300005344 Bacteria 1492
43 Ga0070668_100369657 3300005347 Bacteria 1218
44 Ga0070669_100331257 3300005353 Bacteria 1231
45 Ga0070669_100430164 3300005353 Bacteria 1085
46 Ga0070675_100646897 3300005354 Bacteria 961
47 Ga0070675_100756815 3300005354 Bacteria 887
48 Ga0070671_100293165 3300005355 Bacteria 1385
49 Ga0070688_100411113 3300005365 Bacteria 1004
50 Ga0070659_100043739 3300005366 Bacteria 3504
51 Ga0070659_100464942 3300005366 Bacteria 1075
52 Ga0070709_10018844 3300005434 Bacteria 3982
53 Ga0070709_10046949 3300005434 Bacteria 2688
54 Ga0070714_100059128 3300005435 Bacteria 3285
55 Ga0070714_100074644 3300005435 Bacteria 2940
56 Ga0070714_100094459 3300005435 Bacteria 2624
57 Ga0070714_100098717 3300005435 Bacteria 2569
58 Ga0070714_100333722 3300005435 Bacteria 1420
59 Ga0070713_100008592 3300005436 Bacteria 7252
60 Ga0070713_100023569 3300005436 Bacteria 4779
61 Ga0070713_100052194 3300005436 Bacteria 3384
62 Ga0070713_100099028 3300005436 Bacteria 2522
63 Ga0070713_100234675 3300005436 Bacteria 1669
64 Ga0070713_100428302 3300005436 Bacteria 1240
65 Ga0070713_100455772 3300005436 Bacteria 1202
66 Ga0070710_10000883 3300005437 Bacteria 14344
67 Ga0070710_10001420 3300005437 Bacteria 11294
68 Ga0070711_100002983 3300005439 Bacteria 9773
69 Ga0070711_100012546 3300005439 Bacteria 5296
70 Ga0070711_100021714 3300005439 Bacteria 4153
71 Ga0070711_100190470 3300005439 Bacteria 1576
72 Ga0070705_100448181 3300005440 Bacteria 967
73 Ga0070708_100057117 3300005445 Bacteria 3473
74 Ga0070663_100007823 3300005455 Bacteria 6534
75 Ga0070663_100097162 3300005455 Bacteria 2192
76 Ga0070663_100097589 3300005455 Bacteria 2188
77 Ga0070663_100194136 3300005455 Bacteria 1581
78 Ga0070663_100203609 3300005455 Bacteria 1546
79 Ga0070663_100428110 3300005455 Bacteria 1087
80 Ga0070678_100061407 3300005456 Bacteria 2770
81 Ga0070678_100105110 3300005456 Bacteria 2197
82 Ga0070678_100145055 3300005456 Bacteria 1904
83 Ga0070678_100185267 3300005456 Bacteria 1708
84 Ga0070678_100260787 3300005456 Bacteria 1457
85 Ga0070662_100426573 3300005457 Bacteria 1098
86 Ga0070681_10075805 3300005458 Bacteria 3323
87 Ga0070681_10151763 3300005458 Bacteria 2243
88 Ga0070685_10218081 3300005466 Bacteria 1249
89 Ga0070685_10260566 3300005466 Bacteria 1153
90 Ga0070706_100527339 3300005467 Bacteria 1099
91 Ga0070707_100227591 3300005468 Bacteria 1816
92 Ga0070698_100096957 3300005471 Bacteria 2925
93 Ga0070679_100044686 3300005530 Bacteria 4413
94 Ga0070679_100124810 3300005530 Bacteria 2557
95 Ga0070679_100179414 3300005530 Bacteria 2090
96 Ga0070679_100450714 3300005530 Bacteria 1231
97 Ga0070684_100016103 3300005535 Bacteria 6108
98 Ga0070684_100414807 3300005535 Bacteria 1242
99 Ga0070697_100025792 3300005536 Bacteria 4689
100 Ga0068853_100062087 3300005539 Bacteria 3232
101 Ga0068853_100167859 3300005539 Bacteria 1984
102 Ga0068853_100201201 3300005539 Bacteria 1813
103 Ga0068853_100264761 3300005539 Bacteria 1581
104 Ga0068853_100402869 3300005539 Bacteria 1281
105 Ga0068853_100521057 3300005539 Bacteria 1124
106 Ga0070672_100066970 3300005543 Bacteria 2844
107 Ga0070686_100079501 3300005544 Bacteria 2168
108 Ga0070686_100519495 3300005544 Bacteria 927
109 Ga0070693_100239942 3300005547 Bacteria 1197
110 Ga0070665_100011529 3300005548 Bacteria 8937
111 Ga0070665_100084179 3300005548 Bacteria 3185
112 Ga0070665_100088233 3300005548 Bacteria 3107
113 Ga0070665_100248788 3300005548 Bacteria 1778
114 Ga0070665_100947156 3300005548 Bacteria 873
115 Ga0070704_100671235 3300005549 Bacteria 917
116 Ga0068855_100133882 3300005563 Bacteria 2829
117 Ga0068855_100250765 3300005563 Bacteria 1975
118 Ga0068855_100356423 3300005563 Bacteria 1610
119 Ga0068855_101086963 3300005563 Bacteria 837
120 Ga0070664_100728870 3300005564 Bacteria 925
121 Ga0068857_100013608 3300005577 Bacteria 7088
122 Ga0068857_100148651 3300005577 Bacteria 2121
123 Ga0068854_100025810 3300005578 Bacteria 4032
124 Ga0068854_100206980 3300005578 Bacteria 1545
125 Ga0068856_100003436 3300005614 Bacteria 16012
126 Ga0068856_100015417 3300005614 Bacteria 7385
127 Ga0068856_100083490 3300005614 Bacteria 3172
128 Ga0068856_100130496 3300005614 Bacteria 2518
129 Ga0068856_100286324 3300005614 Bacteria 1665
130 Ga0068856_100519611 3300005614 Bacteria 1212
131 Ga0070702_100078903 3300005615 Bacteria 1966
132 Ga0070702_100106533 3300005615 Bacteria 1729
133 Ga0068852_100063044 3300005616 Bacteria 3226
134 Ga0068852_100119103 3300005616 Bacteria 2413
135 Ga0068852_100222030 3300005616 Bacteria 1797
136 Ga0068852_100284971 3300005616 Bacteria 1594
137 Ga0068852_100337155 3300005616 Bacteria 1469
138 Ga0068852_100585806 3300005616 Bacteria 1119
139 Ga0068852_100641653 3300005616 Bacteria 1069
140 Ga0068852_100912234 3300005616 Bacteria 896
141 Ga0068859_100264445 3300005617 Bacteria 1812
142 Ga0068859_100296250 3300005617 Bacteria 1711
143 Ga0068866_10006968 3300005718 Bacteria 4723
144 Ga0068861_100022743 3300005719 Bacteria 4520
145 Ga0068861_100310536 3300005719 Bacteria 1369
146 Ga0068861_100639295 3300005719 Bacteria 981
147 Ga0068851_10001765 3300005834 Bacteria 9451
148 Ga0068851_10045623 3300005834 Bacteria 2216
149 Ga0068863_100320009 3300005841 Bacteria 1507
150 Ga0068863_100321174 3300005841 Bacteria 1504
151 Ga0068858_100157399 3300005842 Bacteria 2138
152 Ga0068860_100002621 3300005843 Bacteria 18698
153 Ga0068860_100150946 3300005843 Bacteria 2237
154 Ga0068860_100294214 3300005843 Bacteria 1589
155 Ga0068860_100643834 3300005843 Bacteria 1067
156 Ga0068862_100029193 3300005844 Bacteria 4646
157 Ga0068862_100107881 3300005844 Bacteria 2441
158 Ga0068862_100243422 3300005844 Bacteria 1636
159 Ga0068862_100380929 3300005844 Bacteria 1316
160 Ga0068862_100515955 3300005844 Bacteria 1136
161 Ga0068862_100518016 3300005844 Bacteria 1134
162 Ga0081455_10015989 3300005937 Bacteria 7260
163 Ga0081455_10051879 3300005937 Bacteria 3516
164 Ga0081538_10073012 3300005981 Bacteria 1878
165 Ga0081540_1002275 3300005983 Bacteria 15781
166 Ga0081540_1005026 3300005983 Bacteria 9930
167 Ga0081540_1035395 3300005983 Bacteria 2678
168 Ga0081540_1035915 3300005983 Bacteria 2651
169 Ga0081540_1068934 3300005983 Bacteria 1646
170 Ga0081540_1074604 3300005983 Bacteria 1553
171 Ga0081540_1085672 3300005983 Bacteria 1402
172 Ga0081540_1101551 3300005983 Bacteria 1238
173 Ga0081540_1160499 3300005983 Bacteria 873
174 Ga0081539_10000040 3300005985 Bacteria 292753
175 Ga0081539_10001394 3300005985 Bacteria 41637
176 Ga0081539_10032566 3300005985 Bacteria 3190
177 Ga0081539_10097065 3300005985 Bacteria 1510
178 Ga0070717_10015584 3300006028 Bacteria 5875
179 Ga0070717_10069573 3300006028 Bacteria 2932
180 Ga0070717_10115216 3300006028 Bacteria 2297
181 Ga0070717_10335683 3300006028 Bacteria 1349
182 Ga0070717_10534744 3300006028 Bacteria 1061
183 Ga0070717_10899516 3300006028 Bacteria 806
184 Ga0075365_10040867 3300006038 Bacteria 3026
185 Ga0075365_10066849 3300006038 Bacteria 2412
186 Ga0075365_10089169 3300006038 Bacteria 2099
187 Ga0075365_10153495 3300006038 Bacteria 1602
188 Ga0075368_10017885 3300006042 Bacteria 2657
189 Ga0075363_100002368 3300006048 Bacteria 7676
190 Ga0075363_100118266 3300006048 Bacteria 1478
191 Ga0075364_10009615 3300006051 Bacteria 5808
192 Ga0075364_10050022 3300006051 Bacteria 2727
193 Ga0075364_10115983 3300006051 Bacteria 1790
194 Ga0070715_10002422 3300006163 Bacteria 5725
195 Ga0070715_10068744 3300006163 Bacteria 1576
196 Ga0070716_100008434 3300006173 Bacteria 5112
197 Ga0070716_100011641 3300006173 Bacteria 4434
198 Ga0070712_100109785 3300006175 Bacteria 2056
199 Ga0070712_100115201 3300006175 Bacteria 2014
200 Ga0070712_100439293 3300006175 Bacteria 1085
201 Ga0070712_100508440 3300006175 Bacteria 1011
202 Ga0075362_10100366 3300006177 Bacteria 1353
203 Ga0075367_10036634 3300006178 Bacteria 2846
204 Ga0075367_10088344 3300006178 Bacteria 1883
205 Ga0075367_10136730 3300006178 Bacteria 1516
206 Ga0075367_10155520 3300006178 Bacteria 1420
207 Ga0075367_10157486 3300006178 Bacteria 1411
208 Ga0075367_10394042 3300006178 Bacteria 875
209 Ga0075367_10421840 3300006178 Bacteria 845
210 Ga0075369_10016556 3300006186 Bacteria 2977
211 Ga0075369_10072521 3300006186 Bacteria 1517
212 Ga0075366_10064541 3300006195 Bacteria 2177
213 Ga0075366_10091686 3300006195 Bacteria 1820
214 Ga0075366_10180427 3300006195 Bacteria 1282
215 Ga0097621_100173174 3300006237 Bacteria 1861
216 Ga0097621_100391615 3300006237 Bacteria 1243
217 Ga0075370_10044155 3300006353 Bacteria 2519
218 Ga0075370_10120877 3300006353 Bacteria 1525
219 Ga0075370_10140886 3300006353 Bacteria 1409
220 Ga0075370_10145316 3300006353 Bacteria 1388
221 Ga0075370_10149905 3300006353 Bacteria 1367
222 Ga0068871_100322507 3300006358 Bacteria 1361
223 Ga0068871_100673872 3300006358 Bacteria 946
224 Ga0075428_100042233 3300006844 Bacteria 5015
225 Ga0068865_100153220 3300006881 Bacteria 1751
226 Ga0097620_100264391 3300006931 Bacteria 1812
227 Ga0097620_100296269 3300006931 Bacteria 1711
228 Ga0099825_1023350 3300006941 Bacteria 3807
229 Ga0099824_1026659 3300006942 Bacteria 2933
230 Ga0099823_1035919 3300006944 Bacteria 3837
231 Ga0075435_100230907 3300007076 Bacteria 1572
232 Ga0075435_100293353 3300007076 Bacteria 1390
233 Ga0099794_10047918 3300007265 Bacteria 2050
234 Ga0099794_10274365 3300007265 Bacteria 871
235 Ga0099795_10123152 3300007788 Bacteria 1039
236 Ga0105244_10268314 3300009036 Bacteria 793
237 Ga0105240_10007060 3300009093 Bacteria 16374
238 Ga0105240_10018234 3300009093 Bacteria 9433
239 Ga0105240_10142386 3300009093 Bacteria 2865
240 Ga0111539_10206349 3300009094 Bacteria 2290
241 Ga0105245_10271868 3300009098 Bacteria 1653
242 Ga0105245_10872282 3300009098 Bacteria 941
243 Ga0105247_10025431 3300009101 Bacteria 3571
244 Ga0105247_10324635 3300009101 Bacteria 1075
245 Ga0105243_10297379 3300009148 Bacteria 1461
246 Ga0105243_10319149 3300009148 Bacteria 1415
247 Ga0105241_10006700 3300009174 Bacteria 8475
248 Ga0105241_10040543 3300009174 Bacteria 3516
249 Ga0105241_10049268 3300009174 Bacteria 3207
250 Ga0105248_11167893 3300009177 Bacteria 870
251 Ga0105237_10021872 3300009545 Bacteria 6569
252 Ga0105237_10056221 3300009545 Bacteria 3939
253 Ga0105237_10101785 3300009545 Bacteria 2864
254 Ga0105237_10112451 3300009545 Bacteria 2715
255 Ga0105237_10199326 3300009545 Bacteria 2001
256 Ga0105237_10243819 3300009545 Bacteria 1798
257 Ga0105237_10264917 3300009545 Bacteria 1721
258 Ga0105237_10764827 3300009545 Bacteria 973
259 Ga0105238_10029421 3300009551 Bacteria 5596
260 Ga0105238_10035069 3300009551 Bacteria 5103
261 Ga0105238_10134629 3300009551 Bacteria 2449
262 Ga0105238_10167493 3300009551 Bacteria 2173
263 Ga0105238_10186917 3300009551 Bacteria 2048
264 Ga0105238_10442750 3300009551 Bacteria 1296
265 Ga0105238_10496026 3300009551 Bacteria 1221
266 Ga0105238_10520535 3300009551 Bacteria 1192
267 Ga0105249_10269244 3300009553 Bacteria 1696
268 Ga0105249_10304805 3300009553 Bacteria 1599
269 Ga0105249_10495183 3300009553 Bacteria 1267
270 Ga0105239_10015859 3300010375 Bacteria 8340
271 Ga0105239_10079643 3300010375 Bacteria 3605
272 Ga0105239_10088065 3300010375 Bacteria 3423
273 Ga0105239_10138557 3300010375 Bacteria 2710
274 Ga0105239_10324060 3300010375 Bacteria 1738
275 Ga0105239_10324425 3300010375 Bacteria 1737
276 Ga0105239_10640378 3300010375 Bacteria 1214
277 Ga0105246_10009694 3300011119 Bacteria 5936
278 Ga0105246_10059677 3300011119 Bacteria 2647
279 Ga0105246_10193182 3300011119 Bacteria 1577
280 Ga0105246_10341679 3300011119 Bacteria 1224
281 Ga0157373_10153054 3300013100 Bacteria 1622
282 Ga0157371_10096483 3300013102 Bacteria 2095
283 Ga0157371_10670233 3300013102 Bacteria 775
284 Ga0157370_10062666 3300013104 Bacteria 3526
285 Ga0157370_10091902 3300013104 Bacteria 2849
286 Ga0157370_10248787 3300013104 Bacteria 1644
287 Ga0157369_10005581 3300013105 Bacteria 14608
288 Ga0157369_10019064 3300013105 Bacteria 7681
289 Ga0157369_10740703 3300013105 Bacteria 1011
290 Ga0157374_10165783 3300013296 Bacteria 2153
291 Ga0157374_10273856 3300013296 Bacteria 1665
292 Ga0157374_11048682 3300013296 Bacteria 835
293 Ga0157378_10023907 3300013297 Bacteria 5375
294 Ga0157378_10058109 3300013297 Bacteria 3449
295 Ga0163162_10161492 3300013306 Bacteria 2362
296 Ga0163162_10178412 3300013306 Bacteria 2250
297 Ga0163162_10544771 3300013306 Bacteria 1289
298 Ga0163162_10766710 3300013306 Bacteria 1083
299 Ga0157372_10218370 3300013307 Bacteria 2210
300 Ga0157372_10477917 3300013307 Bacteria 1453
301 Ga0157372_10757252 3300013307 Bacteria 1129
302 Ga0157372_11013806 3300013307 Bacteria 961
303 Ga0157375_10408730 3300013308 Bacteria 1524
304 Ga0163163_10027246 3300014325 Bacteria 5473
305 Ga0163163_10073724 3300014325 Bacteria 3404
306 Ga0163163_10180400 3300014325 Bacteria 2159
307 Ga0163163_10323220 3300014325 Bacteria 1597
308 Ga0163163_10411575 3300014325 Bacteria 1411
309 Ga0163163_10620113 3300014325 Bacteria 1145
310 Ga0157380_10197062 3300014326 Bacteria 1784
311 Ga0157380_10716133 3300014326 Bacteria 1008
312 Ga0157379_10269437 3300014968 Bacteria 1548
313 Ga0157379_10743447 3300014968 Bacteria 923
314 Ga0157376_10254582 3300014969 Bacteria 1642
315 Ga0157376_10574867 3300014969 Bacteria 1118
316 Ga0157376_10744436 3300014969 Bacteria 989
317 Ga0163161_10084320 3300017792 Bacteria 2343
318 Ga0163161_10223845 3300017792 Bacteria 1458
319 Ga0163161_10777424 3300017792 Bacteria 803
320 Ga0214544_1000007 3300021320 Bacteria 379989
321 Ga0214542_1000007 3300021321 Bacteria 291816
322 Ga0214545_1000006 3300021324 Bacteria 291693
323 Ga0214543_1000009 3300021327 Bacteria 384302
324 Ga0213874_10020651 3300021377 Bacteria 1808
325 Ga0213876_10008797 3300021384 Bacteria 5453
326 Ga0213876_10059454 3300021384 Bacteria 2017
327 Ga0213876_10094182 3300021384 Bacteria 1587
328 Ga0213876_10166085 3300021384 Bacteria 1174
329 Ga0213876_10191050 3300021384 Bacteria 1089
330 Ga0213871_10027153 3300021441 Bacteria 1468
331 Ga0209677_101800 3300025253 Bacteria 8794
332 Ga0209677_103149 3300025253 Bacteria 5594
333 Ga0209148_1000688 3300025254 Bacteria 27894
334 Ga0209233_1002001 3300025261 Bacteria 7715
335 Ga0209233_1003079 3300025261 Bacteria 5937
336 Ga0209233_1018527 3300025261 Bacteria 1871
337 Ga0209455_1002533 3300025272 Bacteria 6991
338 Ga0209130_1037253 3300025284 Bacteria 961
339 Ga0209564_1000842 3300025295 Bacteria 41342
340 Ga0209564_1004194 3300025295 Bacteria 8990
341 Ga0209564_1011852 3300025295 Bacteria 3864
342 Ga0209758_1000015 3300025297 Bacteria 851943
343 Ga0209758_1000161 3300025297 Bacteria 154278
344 Ga0209758_1001473 3300025297 Bacteria 27578
345 Ga0209758_1005779 3300025297 Bacteria 9280
346 Ga0209758_1006771 3300025297 Bacteria 8053
347 Ga0209758_1010969 3300025297 Bacteria 5325
348 Ga0209758_1015810 3300025297 Bacteria 3879
349 Ga0209256_1004114 3300025299 Bacteria 9418
350 Ga0207426_1000186 3300025302 Bacteria 154130
351 Ga0207426_1004316 3300025302 Bacteria 7005
352 Ga0207426_1004813 3300025302 Bacteria 6406
353 Ga0207426_1020280 3300025302 Bacteria 2312
354 Ga0209051_1093598 3300025303 Bacteria 828
355 Ga0209257_1002985 3300025304 Bacteria 15399
356 Ga0209257_1019262 3300025304 Bacteria 2579
357 Ga0207697_10040491 3300025315 Bacteria 1913
358 Ga0207656_10019833 3300025321 Bacteria 2663
359 Ga0207692_10000852 3300025898 Bacteria 10957
360 Ga0207692_10002369 3300025898 Bacteria 7230
361 Ga0207710_10103535 3300025900 Bacteria 1345
362 Ga0207710_10116249 3300025900 Bacteria 1274
363 Ga0207688_10204565 3300025901 Bacteria 1185
364 Ga0207680_10440173 3300025903 Bacteria 925
365 Ga0207647_10002224 3300025904 Bacteria 14780
366 Ga0207647_10163565 3300025904 Bacteria 1297
367 Ga0207685_10005460 3300025905 Bacteria 3359
368 Ga0207699_10011751 3300025906 Bacteria 4434
369 Ga0207699_10013540 3300025906 Bacteria 4178
370 Ga0207699_10025447 3300025906 Bacteria 3249
371 Ga0207699_10036285 3300025906 Bacteria 2809
372 Ga0207699_10298005 3300025906 Bacteria 1125
373 Ga0207645_10017476 3300025907 Bacteria 4734
374 Ga0207684_10640685 3300025910 Bacteria 906
375 Ga0207654_10000874 3300025911 Bacteria 16703
376 Ga0207707_10002360 3300025912 Bacteria 17009
377 Ga0207707_10018715 3300025912 Bacteria 6038
378 Ga0207707_10023081 3300025912 Bacteria 5443
379 Ga0207707_10204788 3300025912 Bacteria 1720
380 Ga0207707_10305503 3300025912 Bacteria 1375
381 Ga0207695_10000006 3300025913 Bacteria 1135309
382 Ga0207695_10001756 3300025913 Bacteria 34405
383 Ga0207695_10070740 3300025913 Bacteria 3565
384 Ga0207695_10163275 3300025913 Bacteria 2157
385 Ga0207671_10008770 3300025914 Bacteria 8517
386 Ga0207671_10019054 3300025914 Bacteria 5257
387 Ga0207671_10095343 3300025914 Bacteria 2247
388 Ga0207671_10114716 3300025914 Bacteria 2053
389 Ga0207671_10139390 3300025914 Bacteria 1868
390 Ga0207671_10169187 3300025914 Bacteria 1696
391 Ga0207671_10198075 3300025914 Bacteria 1568
392 Ga0207693_10023504 3300025915 Bacteria 4893
393 Ga0207693_10033990 3300025915 Bacteria 4022
394 Ga0207693_10047780 3300025915 Bacteria 3362
395 Ga0207693_10052774 3300025915 Bacteria 3189
396 Ga0207693_10058480 3300025915 Bacteria 3020
397 Ga0207663_10000260 3300025916 Bacteria 23036
398 Ga0207663_10011583 3300025916 Bacteria 4741
399 Ga0207663_10025039 3300025916 Bacteria 3444
400 Ga0207663_10028634 3300025916 Bacteria 3262
401 Ga0207663_10082169 3300025916 Bacteria 2112
402 Ga0207660_10044182 3300025917 Bacteria 3134
403 Ga0207660_10298211 3300025917 Bacteria 1283
404 Ga0207649_10091495 3300025920 Bacteria 1992
405 Ga0207649_10143695 3300025920 Bacteria 1636
406 Ga0207649_10226894 3300025920 Bacteria 1334
407 Ga0207652_10010155 3300025921 Bacteria 7583
408 Ga0207652_10030351 3300025921 Bacteria 4526
409 Ga0207652_10158032 3300025921 Bacteria 2031
410 Ga0207652_10213939 3300025921 Bacteria 1736
411 Ga0207652_10705412 3300025921 Bacteria 900
412 Ga0207646_10114471 3300025922 Bacteria 2422
413 Ga0207694_10000306 3300025924 Bacteria 46009
414 Ga0207694_10114401 3300025924 Bacteria 2149
415 Ga0207694_10195256 3300025924 Bacteria 1645
416 Ga0207694_10264540 3300025924 Bacteria 1409
417 Ga0207694_10318398 3300025924 Bacteria 1283
418 Ga0207694_10575585 3300025924 Bacteria 946
419 Ga0207694_10669458 3300025924 Bacteria 875
420 Ga0207659_10806764 3300025926 Bacteria 806
421 Ga0207687_10055668 3300025927 Bacteria 2772
422 Ga0207700_10014409 3300025928 Bacteria 5180
423 Ga0207700_10024741 3300025928 Bacteria 4160
424 Ga0207700_10039984 3300025928 Bacteria 3419
425 Ga0207700_10078951 3300025928 Bacteria 2562
426 Ga0207700_10274448 3300025928 Bacteria 1448
427 Ga0207700_10359152 3300025928 Bacteria 1270
428 Ga0207664_10031361 3300025929 Bacteria 4065
429 Ga0207664_10084151 3300025929 Bacteria 2594
430 Ga0207664_10210351 3300025929 Bacteria 1682
431 Ga0207664_10330114 3300025929 Bacteria 1347
432 Ga0207644_10230269 3300025931 Bacteria 1472
433 Ga0207644_10239558 3300025931 Bacteria 1444
434 Ga0207690_10039503 3300025932 Bacteria 3079
435 Ga0207706_10155026 3300025933 Bacteria 2015
436 Ga0207706_10251996 3300025933 Bacteria 1542
437 Ga0207709_10503738 3300025935 Bacteria 945
438 Ga0207670_10115185 3300025936 Bacteria 1944
439 Ga0207669_10341136 3300025937 Bacteria 1154
440 Ga0207704_10046071 3300025938 Bacteria 2596
441 Ga0207704_10102716 3300025938 Bacteria 1910
442 Ga0207665_10004492 3300025939 Bacteria 9257
443 Ga0207665_10165074 3300025939 Bacteria 1596
444 Ga0207711_10013103 3300025941 Bacteria 6887
445 Ga0207689_10190132 3300025942 Bacteria 1694
446 Ga0207689_10351771 3300025942 Bacteria 1225
447 Ga0207689_10478789 3300025942 Bacteria 1042
448 Ga0207661_10002241 3300025944 Bacteria 13339
449 Ga0207661_10054697 3300025944 Bacteria 3198
450 Ga0207661_10392113 3300025944 Bacteria 1258
451 Ga0207661_10492713 3300025944 Bacteria 1119
452 Ga0207679_10119105 3300025945 Bacteria 2098
453 Ga0207679_10467337 3300025945 Bacteria 1121
454 Ga0207667_10015657 3300025949 Bacteria 8603
455 Ga0207667_10023471 3300025949 Bacteria 6792
456 Ga0207667_10046562 3300025949 Bacteria 4592
457 Ga0207667_10366731 3300025949 Bacteria 1468
458 Ga0207667_10619978 3300025949 Bacteria 1089
459 Ga0207667_11051790 3300025949 Bacteria 799
460 Ga0207651_10111219 3300025960 Bacteria 2057
461 Ga0207668_10024883 3300025972 Bacteria 3869
462 Ga0207640_10078399 3300025981 Bacteria 2248
463 Ga0207640_10149826 3300025981 Bacteria 1712
464 Ga0207658_10570528 3300025986 Bacteria 1014
465 Ga0207658_10741236 3300025986 Bacteria 889
466 Ga0207677_10122481 3300026023 Bacteria 1959
467 Ga0207703_10599211 3300026035 Bacteria 1042
468 Ga0207639_10055566 3300026041 Bacteria 3031
469 Ga0207639_10069736 3300026041 Bacteria 2743
470 Ga0207639_10080517 3300026041 Bacteria 2577
471 Ga0207639_10103311 3300026041 Bacteria 2308
472 Ga0207639_10420441 3300026041 Bacteria 1208
473 Ga0207639_10435925 3300026041 Bacteria 1187
474 Ga0207639_10496320 3300026041 Bacteria 1114
475 Ga0207639_10501367 3300026041 Bacteria 1109
476 Ga0207639_10752375 3300026041 Bacteria 906
477 Ga0207678_10063908 3300026067 Bacteria 3162
478 Ga0207678_10140057 3300026067 Bacteria 2064
479 Ga0207678_10574833 3300026067 Bacteria 987
480 Ga0207678_11035082 3300026067 Bacteria 727
481 Ga0207702_10000101 3300026078 Bacteria 99845
482 Ga0207702_10000122 3300026078 Bacteria 91685
483 Ga0207702_10095262 3300026078 Bacteria 2615
484 Ga0207702_10115235 3300026078 Bacteria 2396
485 Ga0207641_10270349 3300026088 Bacteria 1595
486 Ga0207641_10512678 3300026088 Bacteria 1166
487 Ga0207676_10061211 3300026095 Bacteria 2980
488 Ga0207674_10014216 3300026116 Bacteria 8795
489 Ga0207674_10022648 3300026116 Bacteria 6742
490 Ga0207674_10113789 3300026116 Bacteria 2678
491 Ga0207675_100169851 3300026118 Bacteria 2084
492 Ga0207675_100185016 3300026118 Bacteria 1996
493 Ga0207683_10071845 3300026121 Bacteria 3060
494 Ga0207683_10083043 3300026121 Bacteria 2847
495 Ga0207683_10202810 3300026121 Bacteria 1803
496 Ga0207683_10270475 3300026121 Bacteria 1552
497 Ga0207698_10089140 3300026142 Bacteria 2518
498 Ga0207698_11136849 3300026142 Bacteria 794
499 Ga0209389_1000072 3300027296 Bacteria 96795
500 Ga0209389_1000187 3300027296 Bacteria 46903
501 Ga0209589_1002629 3300027357 Bacteria 31273
502 Ga0209489_100206 3300027361 Bacteria 96866
503 Ga0209489_101592 3300027361 Bacteria 46817
504 Ga0209700_100014 3300027363 Bacteria 299349
505 Ga0209813_10021561 3300027866 Bacteria 1813
506 Ga0268266_10004998 3300028379 Bacteria 12533
507 Ga0268266_10013041 3300028379 Bacteria 7166
508 Ga0268266_10181049 3300028379 Bacteria 1919
509 Ga0268266_10474762 3300028379 Bacteria 1191
510 Ga0268266_10849601 3300028379 Bacteria 882
511 Ga0268265_10426585 3300028380 Bacteria 1232
512 Ga0268264_10000187 3300028381 Bacteria 129270
513 Ga0268264_10299924 3300028381 Bacteria 1512
514 Ga0265326_10005386 3300028558 Bacteria 4033
515 Ga0265319_1032588 3300028563 Bacteria 1805
516 Ga0265334_10000741 3300028573 Bacteria 16339
517 Ga0265318_10016165 3300028577 Bacteria 3087
518 Ga0265323_10001701 3300028653 Bacteria 10499
519 Ga0265322_10011637 3300028654 Bacteria 2548
520 Ga0265336_10001237 3300028666 Bacteria 12134
521 Ga0307517_10000066 3300028786 Bacteria 141370
522 Ga0307515_10062791 3300028794 Bacteria 5236
523 Ga0265338_10000973 3300028800 Bacteria 48208
524 Ga0265324_10003799 3300029957 Bacteria 7055
525 Ga0307511_10053968 3300030521 Bacteria 3177
526 Ga0265330_10012740 3300031235 Bacteria 3926
527 Ga0265330_10019458 3300031235 Bacteria 3111
528 Ga0265330_10024564 3300031235 Bacteria 2733
529 Ga0265330_10038130 3300031235 Bacteria 2137
530 Ga0265328_10014234 3300031239 Bacteria 3135
531 Ga0265328_10056045 3300031239 Bacteria 1446
532 Ga0265325_10012522 3300031241 Bacteria 4848
533 Ga0265340_10002830 3300031247 Bacteria 9870
534 Ga0265339_10005543 3300031249 Bacteria 8388
535 Ga0265339_10007566 3300031249 Bacteria 7000
536 Ga0265339_10074780 3300031249 Bacteria 1799
537 Ga0265331_10001005 3300031250 Bacteria 22100
538 Ga0265316_10083560 3300031344 Bacteria 2446
539 Ga0265316_10090874 3300031344 Bacteria 2329
540 Ga0307513_10108299 3300031456 Bacteria 2780
541 Ga0307509_10065722 3300031507 Bacteria 3806
542 Ga0307509_10084953 3300031507 Bacteria 3259
543 Ga0307408_100329450 3300031548 Bacteria 1289
544 Ga0265313_10001357 3300031595 Bacteria 23065
545 Ga0307508_10001545 3300031616 Bacteria 25766
546 Ga0307508_10032542 3300031616 Bacteria 4711
547 Ga0307508_10423503 3300031616 Bacteria 923
548 Ga0265314_10003805 3300031711 Bacteria 14416
549 Ga0265314_10011154 3300031711 Bacteria 7447
550 Ga0265314_10193145 3300031711 Bacteria 1210
551 Ga0307516_10060446 3300031730 Bacteria 3681
552 Ga0307516_10097402 3300031730 Bacteria 2761
553 Ga0307516_10205184 3300031730 Bacteria 1688
554 Ga0307516_10344675 3300031730 Bacteria 1156
555 Ga0307413_10378884 3300031824 Bacteria 1101
556 Ga0307412_10375802 3300031911 Bacteria 1149
557 Ga0307412_10637129 3300031911 Bacteria 907
558 Ga0307416_100063629 3300032002 Bacteria 3022
559 Ga0307416_100108637 3300032002 Bacteria 2438
560 Ga0307416_100312914 3300032002 Bacteria 1568
561 Ga0307411_10280466 3300032005 Bacteria 1326
562 Ga0307415_100072687 3300032126 Bacteria 2423
563 Ga0307507_10018905 3300033179 Bacteria 7802
564 Ga0307510_10028628 3300033180 Bacteria 6360
565 Ga0307510_10061999 3300033180 Bacteria 3825
566 Ga0307510_10072661 3300033180 Bacteria 3416
567 Ga0307510_10125969 3300033180 Bacteria 2251
568 Ga0315911_1000039 3300033442 Bacteria 56060
569 Ga0316215_1001804 3300033544 Bacteria 2031
570 Ga0373926_0025759 3300035083 Bacteria 2054
571 Ga0373926_0140185 3300035083 Bacteria 918
572 Ga0373934_0002341 3300035086 Bacteria 6975
573 Ga0373923_0005063 3300035111 Bacteria 4442
574 Ga0373923_0007529 3300035111 Bacteria 3833
575 Ga0373932_0036142 3300035112 Bacteria 1401
576 Ga0373936_0004331 3300035113 Bacteria 5366
577 Ga0373936_0041581 3300035113 Bacteria 1844
578 Ga0373936_0075587 3300035113 Bacteria 1395
579 Ga0373945_0023026 3300035116 Bacteria 2150
580 Ga0373953_0030658 3300035117 Bacteria 2086
581 Ga0373953_0060834 3300035117 Bacteria 1544
582 Ga0373953_0088105 3300035117 Bacteria 1296
583 Ga0373953_0112051 3300035117 Bacteria 1154
584 Ga0373954_0000182 3300035118 Bacteria 22786
585 Ga0373954_0053063 3300035118 Bacteria 1905
586 Ga0373954_0083181 3300035118 Bacteria 1531
587 Ga0373956_0001338 3300035119 Bacteria 10168
588 Ga0373956_0091708 3300035119 Bacteria 1402
589 Ga0373957_0002101 3300035120 Bacteria 5591
590 Ga0373943_0013966 3300035170 Bacteria 3632
591 Ga0373943_0045345 3300035170 Bacteria 2142
592 Ga0373946_0002873 3300035171 Bacteria 6106
593 Ga0373946_0106711 3300035171 Bacteria 1262
594 Ga0373955_0000471 3300035172 Bacteria 16944
595 Ga0373955_0066380 3300035172 Bacteria 2005
596 Ga0373955_0319684 3300035172 Bacteria 937
597 Ga0373942_0069098 3300035207 Bacteria 1028
598 Ga0373924_0006537 3300035410 Bacteria 4180
599 Ga0373924_0013602 3300035410 Bacteria 3059
600 Ga0373931_0008813 3300035691 Bacteria 4799
601 Ga0373935_0000128 3300035692 Bacteria 34347
602 Ga0373935_0027993 3300035692 Bacteria 3483
603 Ga0373935_0196813 3300035692 Bacteria 1391
604 Ga0373935_0209753 3300035692 Bacteria 1349
605 Ga0373927_0000496 3300035695 Bacteria 29963
606 Ga0373927_0019629 3300035695 Bacteria 4431
607 Ga0373927_0088429 3300035695 Bacteria 2011
608 Ga0373927_0114199 3300035695 Bacteria 1760
609 Ga0373927_0228455 3300035695 Bacteria 1223
610 Ga0373927_0338939 3300035695 Bacteria 990
611 Ga0373933_0000163 3300035724 Bacteria 43339
612 Ga0373933_0002736 3300035724 Bacteria 9861
613 Ga0373933_0030441 3300035724 Bacteria 3125
614 Ga0373933_0281527 3300035724 Bacteria 1074
615 Ga0373947_0001955 3300035725 Bacteria 12612
616 Ga0373947_0019438 3300035725 Bacteria 3917
617 Ga0373947_0435328 3300035725 Bacteria 887
618 Ga0373937_0030048 3300036401 Bacteria 4921
619 Ga0373937_0036173 3300036401 Bacteria 4498
620 Ga0373937_0064006 3300036401 Bacteria 3382
621 Ga0373925_0006551 3300037068 Bacteria 8561
622 Ga0373925_0044113 3300037068 Bacteria 3311
623 Ga0373925_0096101 3300037068 Bacteria 2270
624 Ga0373925_0112246 3300037068 Bacteria 2107
625 Ga0373925_0146209 3300037068 Bacteria 1853
626 Ga0395899_0143787 3300037312 Bacteria 1695
627 Ga0395900_0000962 3300037418 Bacteria 37526
628 Ga0395900_0008900 3300037418 Bacteria 10303
629 Ga0395900_0097162 3300037418 Bacteria 3026
630 Ga0395900_0195574 3300037418 Bacteria 2049
631 Ga0395900_0467657 3300037418 Bacteria 1215
632 Ga0395900_0779808 3300037418 Bacteria 885
633 Ga0395898_0002601 3300037466 Bacteria 21069
634 Ga0395898_0019490 3300037466 Bacteria 6902
635 Ga0395898_0095452 3300037466 Bacteria 2857
636 Ga0395898_0162711 3300037466 Bacteria 2135
637 Ga0395898_0360651 3300037466 Bacteria 1386
638 Ga0395898_0483860 3300037466 Bacteria 1177
639 Ga0395905_0014568 3300037471 Bacteria 7501
640 Ga0395905_0049145 3300037471 Bacteria 3952
641 Ga0395905_0104291 3300037471 Bacteria 2662
642 Ga0395905_0554032 3300037471 Bacteria 1051
643 Ga0395901_0002873 3300038443 Bacteria 17387
644 Ga0395901_0016488 3300038443 Bacteria 7528
645 Ga0395901_0070062 3300038443 Bacteria 3653
646 Ga0395901_0175233 3300038443 Bacteria 2250
647 Ga0395901_0209102 3300038443 Bacteria 2043
648 Ga0395901_0445590 3300038443 Bacteria 1325
649 Ga0395901_0697039 3300038443 Bacteria 1014
650 Ga0436365_0015658 3300039437 Bacteria 1049
651 Ga0436365_0076767 3300039437 Bacteria 2835
652 Ga0436365_0351010 3300039437 Bacteria 1584
653 Ga0436365_0655011 3300039437 Bacteria 4116
654 Ga0436365_1220227 3300039437 Bacteria 1144
655 Ga0436365_1347888 3300039437 Bacteria 777
656 Ga0436365_1860217 3300039437 Bacteria 2094
657 Ga0436360_0415296 3300039438 Bacteria 1756
658 Ga0436360_0545862 3300039438 Bacteria 796
659 Ga0436360_1315230 3300039438 Bacteria 882
660 Ga0436361_0093159 3300039447 Bacteria 830
661 Ga0436361_0202497 3300039447 Bacteria 992
662 Ga0436361_0267897 3300039447 Bacteria 986
663 Ga0436363_0166451 3300039450 Bacteria 5768
664 Ga0436363_0593082 3300039450 Bacteria 1826
665 Ga0436363_0960712 3300039450 Bacteria 1032
666 Ga0436363_1716088 3300039450 Bacteria 2336
667 Ga0451793_0299829 3300041452 Bacteria 901
668 Ga0451797_0981027 3300041453 Bacteria 1177
669 Ga0451835_0124610 3300041492 Bacteria 744
670 Ga0451851_0940412 3300041507 Bacteria 853
671 Ga0466969_0251498 3300044656 Bacteria 801
672 Ga0466972_0000048 3300044658 Bacteria 119165
673 Ga0466972_0060310 3300044658 Bacteria 1820
674 Ga0466972_0144481 3300044658 Bacteria 1119
675 Ga0466966_0001085 3300044684 Bacteria 17401
676 Ga0466966_0046527 3300044684 Bacteria 2770
677 Ga0466961_0000010 3300044693 Bacteria 137550
678 Ga0466961_0214683 3300044693 Bacteria 1187
679 Ga0466964_0055814 3300044706 Bacteria 1632
680 Ga0466964_0067339 3300044706 Bacteria 1505
681 Ga0466964_0256914 3300044706 Bacteria 864
682 Ga0466968_0043032 3300044735 Bacteria 1911
683 Ga0466968_0061978 3300044735 Bacteria 1614
684 Ga0466968_0284016 3300044735 Bacteria 793
685 Ga0466970_0084965 3300044765 Bacteria 1714
686 Ga0466957_0263094 3300044842 Bacteria 1150
687 Ga0466960_0067537 3300044901 Bacteria 1771
688 Ga0466959_0002483 3300045049 Bacteria 11808
689 Ga0466959_0051087 3300045049 Bacteria 3034
690 Ga0466958_0350086 3300045836 Bacteria 951
691 Ga0466967_0124732 3300045976 Bacteria 2384
692 Ga0495617_041126 3300046452 Bacteria 1545
693 Ga0495592_0002891 3300046454 Bacteria 12215
694 Ga0495592_0020079 3300046454 Bacteria 5080
695 Ga0495592_0070573 3300046454 Bacteria 2544
696 Ga0495592_0310801 3300046454 Bacteria 1021
697 Ga0495603_0000104 3300046455 Bacteria 39821
698 Ga0495603_0007956 3300046455 Bacteria 6398
699 Ga0495603_0009775 3300046455 Bacteria 5805
700 Ga0495603_0087432 3300046455 Bacteria 1824
701 Ga0495603_0091982 3300046455 Bacteria 1773
702 Ga0495603_0209209 3300046455 Bacteria 1126
703 Ga0495603_0225994 3300046455 Bacteria 1079
704 Ga0495590_0086807 3300046457 Bacteria 1105
705 Ga0495629_0005026 3300046459 Bacteria 9912
706 Ga0495629_0008475 3300046459 Bacteria 7569
707 Ga0495629_0034540 3300046459 Bacteria 3575
708 Ga0495629_0051748 3300046459 Bacteria 2874
709 Ga0495638_0037701 3300046460 Bacteria 3074
710 Ga0495638_0047273 3300046460 Bacteria 2698
711 Ga0495638_0077571 3300046460 Bacteria 2022
712 Ga0495638_0190889 3300046460 Bacteria 1162
713 Ga0495641_0000402 3300046461 Bacteria 36037
714 Ga0495651_0005264 3300046462 Bacteria 9861
715 Ga0495651_0007958 3300046462 Bacteria 8127
716 Ga0495651_0083404 3300046462 Bacteria 2410
717 Ga0495653_0023995 3300046463 Bacteria 4920
718 Ga0495653_0058017 3300046463 Bacteria 2943
719 Ga0495653_0066480 3300046463 Bacteria 2712
720 Ga0495580_0003617 3300046472 Bacteria 13095
721 Ga0495580_0126388 3300046472 Bacteria 1774
722 Ga0495582_0000063 3300046473 Bacteria 54381
723 Ga0495582_0006668 3300046473 Bacteria 6414
724 Ga0495582_0105122 3300046473 Bacteria 1583
725 Ga0495605_0062183 3300046474 Bacteria 1784
726 Ga0495639_0000485 3300046475 Bacteria 18953
727 Ga0495662_0000297 3300046476 Bacteria 21564
728 Ga0495662_0098574 3300046476 Bacteria 1429
729 Ga0495664_0006814 3300046477 Bacteria 6322
730 Ga0495664_0011821 3300046477 Bacteria 4931
731 Ga0495664_0026353 3300046477 Bacteria 3385
732 Ga0495664_0146980 3300046477 Bacteria 1429
733 Ga0495584_0271099 3300046491 Bacteria 863
734 Ga0495585_0083823 3300046492 Bacteria 1724
735 Ga0495585_0181363 3300046492 Bacteria 1082
736 Ga0495594_0001344 3300046499 Bacteria 12765
737 Ga0495596_0167193 3300046500 Bacteria 855
738 Ga0495607_0172336 3300046501 Bacteria 1092
739 Ga0495607_0240665 3300046501 Bacteria 876
740 Ga0495583_0105995 3300046506 Bacteria 1195
741 Ga0495606_0003543 3300046507 Bacteria 16488
742 Ga0495606_0051481 3300046507 Bacteria 2685
743 Ga0495606_0055131 3300046507 Bacteria 2572
744 Ga0495608_0002114 3300046511 Bacteria 14307
745 Ga0495608_0164917 3300046511 Bacteria 1407
746 Ga0495608_0173294 3300046511 Bacteria 1367
747 Ga0495610_0055902 3300046512 Bacteria 1900
748 Ga0495610_0100423 3300046512 Bacteria 1297
749 Ga0495616_0037634 3300046513 Bacteria 2488
750 Ga0495618_0158348 3300046514 Bacteria 1444
751 Ga0495620_0183325 3300046515 Bacteria 809
752 Ga0495628_0047088 3300046516 Bacteria 3423
753 Ga0495628_0073113 3300046516 Bacteria 2671
754 Ga0495628_0113540 3300046516 Bacteria 2082
755 Ga0495628_0145841 3300046516 Bacteria 1804
756 Ga0495630_0003717 3300046517 Bacteria 10637
757 Ga0495630_0077166 3300046517 Bacteria 2511
758 Ga0495630_0205296 3300046517 Bacteria 1504
759 Ga0495631_0028024 3300046518 Bacteria 2572
760 Ga0495632_0063341 3300046519 Bacteria 1790
761 Ga0495632_0165365 3300046519 Bacteria 1018
762 Ga0495644_0015964 3300046523 Bacteria 2877
763 Ga0495648_0001804 3300046524 Bacteria 20615
764 Ga0495648_0008803 3300046524 Bacteria 7896
765 Ga0495648_0159851 3300046524 Bacteria 1166
766 Ga0495666_0075370 3300046526 Bacteria 1600
767 Ga0495666_0271840 3300046526 Bacteria 769
768 Ga0495652_0024316 3300046529 Bacteria 5363
769 Ga0495652_0028805 3300046529 Bacteria 4882
770 Ga0495652_0029863 3300046529 Bacteria 4785
771 Ga0495652_0079593 3300046529 Bacteria 2709
772 Ga0495652_0159390 3300046529 Bacteria 1754
773 Ga0495652_0407245 3300046529 Bacteria 961
774 Ga0495654_0018680 3300046530 Bacteria 3630
775 Ga0495654_0076756 3300046530 Bacteria 1574
776 Ga0495665_0000290 3300046531 Bacteria 25439
777 Ga0495665_0301470 3300046531 Bacteria 820
778 Ga0495640_0005621 3300046533 Bacteria 9972
779 Ga0495640_0072047 3300046533 Bacteria 2316
780 Ga0495640_0156522 3300046533 Bacteria 1462
781 Ga0495586_0215060 3300046535 Bacteria 1091
782 Ga0495587_0042093 3300046536 Bacteria 2724
783 Ga0495587_0054357 3300046536 Bacteria 2360
784 Ga0495598_0141351 3300046537 Bacteria 833
785 Ga0495609_0039381 3300046538 Bacteria 2128
786 Ga0495609_0109199 3300046538 Bacteria 1195
787 Ga0495597_0192786 3300046542 Bacteria 819
788 Ga0495645_0003860 3300046543 Bacteria 10202
789 Ga0495645_0004402 3300046543 Bacteria 9625
790 Ga0495645_0020509 3300046543 Bacteria 4771
791 Ga0495645_0052172 3300046543 Bacteria 2976
792 Ga0495622_0009243 3300046557 Bacteria 4561
793 Ga0495622_0034772 3300046557 Bacteria 2350
794 Ga0495622_0055664 3300046557 Bacteria 1834
795 Ga0495622_0059155 3300046557 Bacteria 1774
796 Ga0495622_0159458 3300046557 Bacteria 1018
797 Ga0495633_0090573 3300046558 Bacteria 1422
798 Ga0495667_0010602 3300046559 Bacteria 6235
799 Ga0495667_0054425 3300046559 Bacteria 2632
800 Ga0495667_0091515 3300046559 Bacteria 1970
801 Ga0495667_0143095 3300046559 Bacteria 1541
802 Ga0495656_0017449 3300046615 Bacteria 2739
803 Ga0495656_0028115 3300046615 Bacteria 2253
804 Ga0495656_0091630 3300046615 Bacteria 1391
805 Ga0495668_0066432 3300046616 Bacteria 1984
806 Ga0495634_0000645 3300046642 Bacteria 33906
807 Ga0495634_0031674 3300046642 Bacteria 3641
808 Ga0495634_0049998 3300046642 Bacteria 2809
809 Ga0495634_0121018 3300046642 Bacteria 1676
810 Ga0495625_0057521 3300046660 Bacteria 2764
811 Ga0495625_0105740 3300046660 Bacteria 1928
812 Ga0495625_0139230 3300046660 Bacteria 1638
813 Ga0495625_0149038 3300046660 Bacteria 1574
814 Ga0495625_0281832 3300046660 Bacteria 1069
815 Ga0495625_0380806 3300046660 Bacteria 885
816 Ga0495635_0007816 3300046663 Bacteria 7465
817 Ga0495635_0018102 3300046663 Bacteria 4920
818 Ga0495635_0049840 3300046663 Bacteria 2886
819 Ga0495635_0055521 3300046663 Bacteria 2728
820 Ga0495635_0073607 3300046663 Bacteria 2340
821 Ga0495661_0082848 3300046665 Bacteria 1845
822 Ga0495661_0145639 3300046665 Bacteria 1284
823 Ga0495661_0171218 3300046665 Bacteria 1158
824 Ga0495661_0236581 3300046665 Bacteria 939
825 Ga0495588_0001460 3300046674 Bacteria 10144
826 Ga0495588_0005750 3300046674 Bacteria 5538
827 Ga0495657_0005336 3300046675 Bacteria 10167
828 Ga0495657_0046640 3300046675 Bacteria 2932
829 Ga0495657_0055356 3300046675 Bacteria 2646
830 Ga0495657_0151678 3300046675 Bacteria 1438
831 Ga0495599_0002959 3300046678 Bacteria 9885
832 Ga0495599_0026678 3300046678 Bacteria 3621
833 Ga0495599_0080747 3300046678 Bacteria 2031
834 Ga0495599_0187254 3300046678 Bacteria 1274
835 Ga0495623_0003813 3300046679 Bacteria 9940
836 Ga0495623_0022363 3300046679 Bacteria 4085
837 Ga0495623_0022589 3300046679 Bacteria 4062
838 Ga0495646_0003545 3300046680 Bacteria 9724
839 Ga0495646_0132756 3300046680 Bacteria 1400
840 Ga0495646_0193637 3300046680 Bacteria 1110
841 Ga0495647_0003274 3300046681 Bacteria 5182
842 Ga0495647_0008433 3300046681 Bacteria 3467
843 Ga0495658_0000702 3300046683 Bacteria 18142
844 Ga0495658_0124749 3300046683 Bacteria 1561
845 Ga0495613_0022713 3300046689 Bacteria 4674
846 Ga0495613_0088265 3300046689 Bacteria 2247
847 Ga0495613_0100295 3300046689 Bacteria 2091
848 Ga0495613_0189412 3300046689 Bacteria 1454
849 Ga0495624_0000224 3300046690 Bacteria 44228
850 Ga0495624_0014848 3300046690 Bacteria 5275
851 Ga0495624_0296061 3300046690 Bacteria 976
852 Ga0495670_0041333 3300046691 Bacteria 2300
853 Ga0495670_0255627 3300046691 Bacteria 934
854 Ga0495671_0018783 3300046692 Bacteria 3663
855 Ga0495671_0073822 3300046692 Bacteria 1674
856 Ga0495649_0077730 3300046694 Bacteria 1776
857 Ga0495649_0161699 3300046694 Bacteria 1174
858 Ga0495600_0000221 3300046809 Bacteria 32170
859 Ga0495600_0019491 3300046809 Bacteria 4331
860 Ga0495600_0130831 3300046809 Bacteria 1631
861 Ga0495600_0141423 3300046809 Bacteria 1561
862 Ga0495581_0000168 3300047315 Bacteria 29532
863 Ga0495581_0050474 3300047315 Bacteria 2403
864 Ga0495581_0062405 3300047315 Bacteria 2153
865 Ga0495604_0023528 3300047317 Bacteria 4914
866 Ga0495604_0084649 3300047317 Bacteria 2367
867 Ga0495604_0085878 3300047317 Bacteria 2347
868 Ga0495636_0059691 3300047318 Bacteria 1610
869 Ga0495674_0005032 3300047319 Bacteria 12712
870 Ga0495674_0031903 3300047319 Bacteria 4781
871 Ga0495674_0044251 3300047319 Bacteria 3958
872 Ga0495674_0058385 3300047319 Bacteria 3373
873 Ga0495672_0010686 3300047320 Bacteria 6518
874 Ga0495672_0214739 3300047320 Bacteria 953
875 Ga0495676_0072807 3300047321 Bacteria 2637
876 Ga0495676_0092084 3300047321 Bacteria 2264
877 Ga0495676_0194010 3300047321 Bacteria 1415
878 Ga0495676_0321039 3300047321 Bacteria 1040
879 Ga0495680_0026568 3300047322 Bacteria 4770
880 Ga0495680_0110044 3300047322 Bacteria 2042
881 Ga0495675_0006791 3300047444 Bacteria 7020
882 Ga0495675_0055835 3300047444 Bacteria 2504
883 Ga0495675_0092770 3300047444 Bacteria 1894
884 Ga0495675_0170302 3300047444 Bacteria 1338
885 Ga0495685_025882 3300047447 Bacteria 2020
886 Ga0495673_0012232 3300047469 Bacteria 4566
887 Ga0495684_0002603 3300047471 Bacteria 14332
888 Ga0495684_0012173 3300047471 Bacteria 6636
889 Ga0495686_0012492 3300047472 Bacteria 5938
890 Ga0495686_0237285 3300047472 Bacteria 1030
891 Ga0495593_0000150 3300047673 Bacteria 34569
892 Ga0495593_0004768 3300047673 Bacteria 8059
893 Ga0495593_0028312 3300047673 Bacteria 3078
894 Ga0495593_0031077 3300047673 Bacteria 2919
895 Ga0495602_0000907 3300048088 Bacteria 28629
896 Ga0495602_0092951 3300048088 Bacteria 2497
897 Ga0495602_0151718 3300048088 Bacteria 1820
898 Ga0495602_0536971 3300048088 Bacteria 812
899 Ga0495626_0031034 3300048091 Bacteria 2575
900 Ga0495626_0109103 3300048091 Bacteria 1200
901 Ga0496100_0014076 3300048903 Bacteria 4636
902 Ga0496100_0125684 3300048903 Bacteria 1800
903 Ga0496100_0156532 3300048903 Bacteria 1630
904 Ga0496100_0384886 3300048903 Bacteria 1066
905 Ga0496101_0072116 3300048904 Bacteria 2534
906 Ga0496101_0231479 3300048904 Bacteria 1436
907 Ga0496101_0236995 3300048904 Bacteria 1419
908 Ga0496101_0649694 3300048904 Bacteria 833
909 Ga0496102_0073603 3300048905 Bacteria 3139
910 Ga0496102_0078329 3300048905 Bacteria 3042
911 Ga0496102_0283394 3300048905 Bacteria 1562
912 Ga0496103_0021504 3300048906 Bacteria 3882
913 Ga0496104_0016754 3300048907 Bacteria 6662
914 Ga0496104_0053542 3300048907 Bacteria 3813
915 Ga0496104_0057967 3300048907 Bacteria 3665
916 Ga0496104_0077641 3300048907 Bacteria 3164
917 Ga0496104_0093535 3300048907 Bacteria 2875
918 Ga0496104_0251678 3300048907 Bacteria 1679
919 Ga0496104_0493710 3300048907 Bacteria 1135
920 Ga0496105_0015974 3300048908 Bacteria 5988
921 Ga0496105_0024066 3300048908 Bacteria 4946
922 Ga0496105_0025636 3300048908 Bacteria 4801
923 Ga0496105_0027172 3300048908 Bacteria 4672
924 Ga0496105_0202195 3300048908 Bacteria 1621
925 Ga0496105_0597059 3300048908 Bacteria 857
926 Ga0496106_0001027 3300048909 Bacteria 20532
927 Ga0496106_0017020 3300048909 Bacteria 5380
928 Ga0496106_0024940 3300048909 Bacteria 4447
929 Ga0496106_0122950 3300048909 Bacteria 2030
930 Ga0496106_0303538 3300048909 Bacteria 1280
931 Ga0496106_0570586 3300048909 Bacteria 907
932 Ga0496107_0041793 3300048910 Bacteria 3293
933 Ga0496107_0047025 3300048910 Bacteria 3106
934 Ga0496107_0306829 3300048910 Bacteria 1181
935 Ga0496108_0000649 3300048911 Bacteria 27099
936 Ga0496108_0094402 3300048911 Bacteria 2546
937 Ga0496108_0368317 3300048911 Bacteria 1254
938 Ga0496108_0432984 3300048911 Bacteria 1149
939 Ga0496108_0565762 3300048911 Bacteria 991
940 Ga0496108_0948784 3300048911 Bacteria 737
941 Ga0496109_0000739 3300048912 Bacteria 27160
942 Ga0496109_0197544 3300048912 Bacteria 1891
943 Ga0496109_0255054 3300048912 Bacteria 1652
944 Ga0496109_0457763 3300048912 Bacteria 1205
945 Ga0496110_0005408 3300048913 Bacteria 10017
946 Ga0496110_0008268 3300048913 Bacteria 8365
947 Ga0496110_0016256 3300048913 Bacteria 6209
948 Ga0496110_0040048 3300048913 Bacteria 4083
949 Ga0496110_0063614 3300048913 Bacteria 3260
950 Ga0496111_0010567 3300048914 Bacteria 6201
951 Ga0496111_0082778 3300048914 Bacteria 2344
952 Ga0496111_0096203 3300048914 Bacteria 2173
953 Ga0496112_0000055 3300048915 Bacteria 78086
954 Ga0496112_0001001 3300048915 Bacteria 20717
955 Ga0496112_0005624 3300048915 Bacteria 10875
956 Ga0496112_0031931 3300048915 Bacteria 5110
957 Ga0496112_0032144 3300048915 Bacteria 5094
958 Ga0496112_0067561 3300048915 Bacteria 3528
959 Ga0496112_0119028 3300048915 Bacteria 2611
960 Ga0496112_0610228 3300048915 Bacteria 1022
961 Ga0496112_0769457 3300048915 Bacteria 888
962 Ga0496113_0044578 3300048916 Bacteria 3286
963 Ga0496113_0181629 3300048916 Bacteria 1668
964 Ga0496113_0233859 3300048916 Bacteria 1466
965 Ga0496113_0577817 3300048916 Bacteria 900
966 Ga0496114_0031140 3300048917 Bacteria 4388
967 Ga0496114_0087906 3300048917 Bacteria 2636
968 Ga0496115_0004434 3300048918 Bacteria 10175
969 Ga0496115_0021727 3300048918 Bacteria 4961
970 Ga0496115_0130053 3300048918 Bacteria 2075
971 Ga0496115_0279975 3300048918 Bacteria 1369
972 Ga0496115_0725312 3300048918 Bacteria 779
973 Ga0496117_0020433 3300048920 Bacteria 5398
974 Ga0496117_0069000 3300048920 Bacteria 2383
975 Ga0496117_0138041 3300048920 Bacteria 1465
976 Ga0496117_0160941 3300048920 Bacteria 1315
977 Ga0496118_0007955 3300048921 Bacteria 11090
978 Ga0496118_0027923 3300048921 Bacteria 4766
979 Ga0496118_0042878 3300048921 Bacteria 3564
980 Ga0496118_0047715 3300048921 Bacteria 3316
981 Ga0496118_0326863 3300048921 Bacteria 829
982 Ga0496119_0048531 3300048922 Bacteria 2632
983 Ga0496119_0063950 3300048922 Bacteria 2187
984 Ga0496120_0035243 3300048923 Bacteria 2991
985 Ga0496120_0048142 3300048923 Bacteria 2454
986 Ga0496120_0075864 3300048923 Bacteria 1834
987 Ga0496121_0000144 3300048924 Bacteria 156856
988 Ga0496121_0004660 3300048924 Bacteria 18214
989 Ga0496121_0005529 3300048924 Bacteria 16149
990 Ga0496121_0008147 3300048924 Bacteria 12447
991 Ga0496121_0015400 3300048924 Bacteria 8014
992 Ga0496121_0030471 3300048924 Bacteria 4954
993 Ga0496121_0031148 3300048924 Bacteria 4881
994 Ga0496121_0097514 3300048924 Bacteria 2278
995 Ga0496121_0107950 3300048924 Bacteria 2130
996 Ga0496121_0116739 3300048924 Bacteria 2023
997 Ga0496121_0133042 3300048924 Bacteria 1857
998 Ga0496121_0182258 3300048924 Bacteria 1514
999 Ga0496121_0221403 3300048924 Bacteria 1333
1000 Ga0496121_0357748 3300048924 Bacteria 970
1001 Ga0496122_0188704 3300048925 Bacteria 1219
1002 Ga0496122_0202809 3300048925 Bacteria 1158
1003 Ga0496124_0002408 3300048927 Bacteria 24540
1004 Ga0496124_0188405 3300048927 Bacteria 1581
1005 Ga0496125_0000595 3300048928 Bacteria 61641
1006 Ga0496125_0016728 3300048928 Bacteria 7033
1007 Ga0496125_0045159 3300048928 Bacteria 3713
1008 Ga0496125_0152222 3300048928 Bacteria 1586
1009 Ga0496125_0153397 3300048928 Bacteria 1578
1010 Ga0496125_0157204 3300048928 Bacteria 1551
1011 Ga0496125_0415336 3300048928 Bacteria 782
1012 Ga0496126_0006769 3300048929 Bacteria 12718
1013 Ga0496126_0008459 3300048929 Bacteria 11100
1014 Ga0496126_0018002 3300048929 Bacteria 7022
1015 Ga0496126_0028459 3300048929 Bacteria 5325
1016 Ga0496126_0031874 3300048929 Bacteria 4973
1017 Ga0496126_0045972 3300048929 Bacteria 4008
1018 Ga0496126_0075686 3300048929 Bacteria 2987
1019 Ga0496126_0098284 3300048929 Bacteria 2565
1020 Ga0496126_0117146 3300048929 Bacteria 2314
1021 Ga0496126_0147139 3300048929 Bacteria 2022
1022 Ga0496126_0156031 3300048929 Bacteria 1953
1023 Ga0496126_0203730 3300048929 Bacteria 1669
1024 Ga0496126_0205094 3300048929 Bacteria 1662
1025 Ga0496126_0214335 3300048929 Bacteria 1620
1026 Ga0496126_0536482 3300048929 Bacteria 930
1027 Ga0496126_0556622 3300048929 Bacteria 909
1028 Ga0496126_0599010 3300048929 Bacteria 868
1029 Ga0496126_0649802 3300048929 Bacteria 825
1030 Ga0495682_0047761 3300049460 Bacteria 1561
1031 Ga0501031_0000377 3300049568 Bacteria 26157
1032 Ga0501031_0006067 3300049568 Bacteria 7891
1033 Ga0501032_0000040 3300049569 Bacteria 115662
1034 Ga0501032_0003836 3300049569 Bacteria 11418
1035 Ga0501032_0077513 3300049569 Bacteria 2213
1036 Ga0501032_0099791 3300049569 Bacteria 1923
1037 Ga0501032_0398695 3300049569 Bacteria 884
1038 Ga0501032_0513354 3300049569 Bacteria 765
1039 Ga0501033_0000128 3300049570 Bacteria 73419
1040 Ga0501033_0000291 3300049570 Bacteria 48207
1041 Ga0501033_0140680 3300049570 Bacteria 1744
1042 Ga0501033_0460506 3300049570 Bacteria 882
1043 Ga0501034_0000254 3300049571 Bacteria 97896
1044 Ga0501034_0014046 3300049571 Bacteria 8248
1045 Ga0501034_0075462 3300049571 Bacteria 3379
1046 Ga0501034_0170155 3300049571 Bacteria 2146
1047 Ga0501034_0195466 3300049571 Bacteria 1983
1048 Ga0501034_0715413 3300049571 Bacteria 899
1049 Ga0501034_0745947 3300049571 Bacteria 875
1050 Ga0501036_0253219 3300049572 Bacteria 1475
1051 Ga0501036_0344726 3300049572 Bacteria 1244
1052 Ga0501036_0555778 3300049572 Bacteria 953
1053 Ga0501037_0000041 3300049573 Bacteria 118457
1054 Ga0501037_0000723 3300049573 Bacteria 25000
1055 Ga0501037_0105678 3300049573 Bacteria 2029
1056 Ga0501037_0199944 3300049573 Bacteria 1412
1057 Ga0501038_0000057 3300049574 Bacteria 92766
1058 Ga0501038_0015059 3300049574 Bacteria 7040
1059 Ga0501038_0019298 3300049574 Bacteria 6149
1060 Ga0501038_0025093 3300049574 Bacteria 5314
1061 Ga0501038_0150539 3300049574 Bacteria 1897
1062 Ga0501038_0160760 3300049574 Bacteria 1825
1063 Ga0501038_0200100 3300049574 Bacteria 1603
1064 Ga0501038_0290204 3300049574 Bacteria 1286
1065 Ga0501039_0012981 3300049575 Bacteria 6370
1066 Ga0501039_0036122 3300049575 Bacteria 3812
1067 Ga0501039_0083298 3300049575 Bacteria 2490
1068 Ga0501039_0313786 3300049575 Bacteria 1232
1069 Ga0501040_0021943 3300049576 Bacteria 4269
1070 Ga0501041_0076454 3300049577 Bacteria 2060
1071 Ga0501042_0094801 3300049578 Bacteria 2143
1072 Ga0501043_0000184 3300049579 Bacteria 56470
1073 Ga0501043_0014167 3300049579 Bacteria 6238
1074 Ga0501043_0055594 3300049579 Bacteria 3109
1075 Ga0501043_0231712 3300049579 Bacteria 1426
1076 Ga0501046_0000072 3300049580 Bacteria 106407
1077 Ga0501046_0010044 3300049580 Bacteria 8153
1078 Ga0501046_0025914 3300049580 Bacteria 4792
1079 Ga0501046_0458459 3300049580 Bacteria 916
1080 Ga0501047_0000044 3300049581 Bacteria 174789
1081 Ga0501047_0028170 3300049581 Bacteria 5413
1082 Ga0501047_0213160 3300049581 Bacteria 1789
1083 Ga0501047_0271921 3300049581 Bacteria 1540
1084 Ga0501047_0455414 3300049581 Bacteria 1108
1085 Ga0501048_0000117 3300049582 Bacteria 45344
1086 Ga0501048_0012237 3300049582 Bacteria 6386
1087 Ga0501067_0001815 3300049583 Bacteria 11741
1088 Ga0501067_0032603 3300049583 Bacteria 2892
1089 Ga0501068_0001318 3300049584 Bacteria 13160
1090 Ga0501069_0002548 3300049585 Bacteria 9309
1091 Ga0501070_0010826 3300049586 Bacteria 7704
1092 Ga0501070_0018396 3300049586 Bacteria 5861
1093 Ga0501070_0040320 3300049586 Bacteria 3894
1094 Ga0501070_0068187 3300049586 Bacteria 2945
1095 Ga0501070_0279151 3300049586 Bacteria 1363
1096 Ga0501071_0097420 3300049587 Bacteria 2166
1097 Ga0501071_0184407 3300049587 Bacteria 1564
1098 Ga0501072_0000156 3300049588 Bacteria 50717
1099 Ga0501072_0070627 3300049588 Bacteria 2758
1100 Ga0501073_0002824 3300049589 Bacteria 13006
1101 Ga0501073_0024045 3300049589 Bacteria 4375
1102 Ga0501073_0216293 3300049589 Bacteria 1324
1103 Ga0501074_0000035 3300049590 Bacteria 64770
1104 Ga0501074_0002443 3300049590 Bacteria 12958
1105 Ga0501074_0415353 3300049590 Bacteria 954
1106 Ga0501076_0065005 3300049592 Bacteria 2908
1107 Ga0501076_0187321 3300049592 Bacteria 1688
1108 Ga0501209_125077 3300049656 Bacteria 765
1109 Ga0501079_0005573 3300049741 Bacteria 9396
1110 Ga0501079_0114107 3300049741 Bacteria 2100
1111 Ga0501080_0008601 3300049742 Bacteria 9261
1112 Ga0501080_0114315 3300049742 Bacteria 2502
1113 Ga0501080_0452877 3300049742 Bacteria 1150
1114 Ga0501083_0000641 3300049744 Bacteria 22636
1115 Ga0501083_0015704 3300049744 Bacteria 5300
1116 Ga0501035_0000128 3300049822 Bacteria 92297
1117 Ga0501035_0000688 3300049822 Bacteria 36917
1118 Ga0501035_0021153 3300049822 Bacteria 5979
1119 Ga0501035_0057655 3300049822 Bacteria 3462
1120 Ga0501035_0273723 3300049822 Bacteria 1428
1121 Ga0501035_0644437 3300049822 Bacteria 859
1122 Ga0501035_0832803 3300049822 Bacteria 735
1123 Ga0501044_0000108 3300049823 Bacteria 100968
1124 Ga0501044_0005432 3300049823 Bacteria 14156
1125 Ga0501044_0077476 3300049823 Bacteria 3372
1126 Ga0501044_0096923 3300049823 Bacteria 2970
1127 Ga0501044_0138109 3300049823 Bacteria 2427
1128 Ga0501044_0368464 3300049823 Bacteria 1353
1129 Ga0501044_0523294 3300049823 Bacteria 1085
1130 nmdc:mga03n38_46423_c1 3300050490 Bacteria 1918
1131 nmdc:mga00v17_19538_c1 3300050491 Bacteria 3869
1132 nmdc:mga0yw44_156531_c1 3300050492 Bacteria 1490
1133 nmdc:mga0yw44_415317_c1 3300050492 Bacteria 911
1134 nmdc:mga0yw44_52465_c1 3300050492 Bacteria 2472
1135 nmdc:mga0yw44_57242_c1 3300050492 Bacteria 2378
1136 nmdc:mga0k408_157251_c1 3300050493 Bacteria 1354
1137 nmdc:mga0k408_201879_c1 3300050493 Bacteria 1187
1138 nmdc:mga0k408_300346_c1 3300050493 Bacteria 958
1139 nmdc:mga06z11_179815_c1 3300050494 Bacteria 1219
1140 nmdc:mga06z11_227038_c1 3300050494 Bacteria 1093
1141 nmdc:mga06z11_32421_c1 3300050494 Bacteria 2548
1142 nmdc:mga06z11_40491_c1 3300050494 Bacteria 2325
1143 nmdc:mga06z11_406160_c1 3300050494 Bacteria 820
1144 nmdc:mga06z11_425849_c1 3300050494 Bacteria 800
1145 nmdc:mga04h51_229103_c1 3300050495 Bacteria 739
1146 nmdc:mga07m45_37097_c1 3300050496 Bacteria 2718
1147 nmdc:mga07m45_43325_c1 3300050496 Bacteria 2523
1148 nmdc:mga07m45_48959_c1 3300050496 Bacteria 2378
1149 nmdc:mga08y16_1118007_c1 3300050511 Bacteria 762
1150 nmdc:mga0n895_134711_c1 3300050512 Bacteria 2496
1151 nmdc:mga0rr50_226356_c1 3300050513 Bacteria 1546
1152 nmdc:mga0sz30_47184_c1 3300050516 Bacteria 1820
1153 nmdc:mga0sz30_68907_c1 3300050516 Bacteria 1521
1154 nmdc:mga0sz30_97850_c1 3300050516 Bacteria 1280
1155 nmdc:mga0sz30_99987_c1 3300050516 Bacteria 1266
1156 Ga0495601_0060163 3300053077 Bacteria 2410
1157 Ga0495601_0085026 3300053077 Bacteria 2032
1158 Ga0495601_0295696 3300053077 Bacteria 1055
1159 Ga0495612_0054442 3300053078 Bacteria 1648
1160 Ga0495612_0057281 3300053078 Bacteria 1609
1161 Ga0495612_0264197 3300053078 Bacteria 767
1162 Ga0500610_0143787 3300053079 Bacteria 1202
1163 Ga0500635_0010037 3300053080 Bacteria 2647
1164 Ga0495595_0004969 3300053084 Bacteria 5366
1165 Ga0495595_0130591 3300053084 Bacteria 1227
1166 Ga0495619_0002350 3300053085 Bacteria 12447
1167 Ga0495619_0199729 3300053085 Bacteria 1384
1168 Ga0495619_0229170 3300053085 Bacteria 1287
1169 Ga0500643_000079 3300053087 Bacteria 104107
1170 Ga0500643_004939 3300053087 Bacteria 5864
1171 Ga0500651_0014125 3300053093 Bacteria 4881
1172 Ga0500651_0123890 3300053093 Bacteria 1567
1173 Ga0500651_0172550 3300053093 Bacteria 1288
1174 Ga0500566_0000839 3300053094 Bacteria 17527
1175 Ga0500566_0016060 3300053094 Bacteria 4398
1176 Ga0500566_0018425 3300053094 Bacteria 4099
1177 Ga0500640_089708 3300053095 Bacteria 1290
1178 Ga0500641_0008056 3300053096 Bacteria 3754
1179 Ga0500641_0026859 3300053096 Bacteria 2238
1180 Ga0500641_0143640 3300053096 Bacteria 1031
1181 Ga0500650_0046741 3300053098 Bacteria 2005
1182 Ga0500554_002420 3300053102 Bacteria 3669
1183 Ga0500554_003584 3300053102 Bacteria 3199
1184 Ga0500555_012696 3300053103 Bacteria 2425
1185 Ga0500556_0000005 3300053104 Bacteria 581135
1186 Ga0500556_0133228 3300053104 Bacteria 974
1187 Ga0500557_000034 3300053105 Bacteria 71225
1188 Ga0500569_127748 3300053109 Bacteria 849
1189 Ga0500572_005149 3300053111 Bacteria 2956
1190 Ga0500572_009276 3300053111 Bacteria 2322
1191 Ga0500592_030017 3300053116 Bacteria 877
1192 Ga0500593_106790 3300053117 Bacteria 1158
1193 Ga0500595_009330 3300053119 Bacteria 3963
1194 Ga0500595_026590 3300053119 Bacteria 1992
1195 Ga0500607_028739 3300053121 Bacteria 3076
1196 Ga0500607_033910 3300053121 Bacteria 2796
1197 Ga0500608_000330 3300053122 Bacteria 18247
1198 Ga0500608_116450 3300053122 Bacteria 1218
1199 Ga0500614_081683 3300053123 Bacteria 905
1200 Ga0500618_008175 3300053125 Bacteria 2939
1201 Ga0500621_122581 3300053126 Bacteria 1005
1202 Ga0500621_165271 3300053126 Bacteria 817
1203 Ga0500642_0000167 3300053130 Bacteria 27218
1204 Ga0500642_0000400 3300053130 Bacteria 14269
1205 Ga0500642_0093157 3300053130 Bacteria 1394
1206 Ga0500652_001376 3300053131 Bacteria 7601
1207 Ga0500652_044814 3300053131 Bacteria 1791
1208 Ga0500655_047898 3300053133 Bacteria 848
1209 Ga0500658_0065304 3300053134 Bacteria 1523
1210 Ga0500658_0111099 3300053134 Bacteria 1206
1211 Ga0500658_0132176 3300053134 Bacteria 1114
1212 Ga0500559_0000696 3300053136 Bacteria 22137
1213 Ga0500559_0002014 3300053136 Bacteria 10895
1214 Ga0500559_0063271 3300053136 Bacteria 1653
1215 Ga0500559_0113361 3300053136 Bacteria 1257
1216 Ga0500559_0114786 3300053136 Bacteria 1249
1217 Ga0500564_164985 3300053138 Bacteria 935
1218 Ga0500564_210732 3300053138 Bacteria 792
1219 Ga0500568_0006608 3300053139 Bacteria 5799
1220 Ga0500568_0046396 3300053139 Bacteria 1724
1221 Ga0500573_0006675 3300053140 Bacteria 6258
1222 Ga0500577_0038419 3300053142 Bacteria 1728
1223 Ga0500589_022024 3300053147 Bacteria 2929
1224 Ga0500590_049762 3300053148 Bacteria 2133
1225 Ga0500590_055939 3300053148 Bacteria 1995
1226 Ga0500603_001436 3300053150 Bacteria 5444
1227 Ga0500603_030306 3300053150 Bacteria 1391
1228 Ga0500603_136790 3300053150 Bacteria 752
1229 Ga0500604_0007365 3300053151 Bacteria 2914
1230 Ga0500604_0098414 3300053151 Bacteria 962
1231 Ga0500604_0127050 3300053151 Bacteria 855
1232 Ga0500616_0000035 3300053153 Bacteria 394242
1233 Ga0500616_0000038 3300053153 Bacteria 386801
1234 Ga0500620_019648 3300053155 Bacteria 1989
1235 Ga0500622_0008163 3300053156 Bacteria 5881
1236 Ga0500624_003405 3300053157 Bacteria 2089
1237 Ga0500627_0005379 3300053158 Bacteria 4251
1238 Ga0500627_0082232 3300053158 Bacteria 1436
1239 Ga0500630_102889 3300053159 Bacteria 1298
1240 Ga0500633_0047142 3300053160 Bacteria 1474
1241 Ga0500638_076439 3300053162 Bacteria 1595
1242 Ga0500638_146190 3300053162 Bacteria 1056
1243 Ga0500639_040385 3300053163 Bacteria 2455
1244 Ga0500636_0000016 3300053177 Bacteria 123469
1245 Ga0500636_0003032 3300053177 Bacteria 9413
1246 Ga0500636_0010062 3300053177 Bacteria 5507
1247 Ga0500636_0102246 3300053177 Bacteria 1627
1248 Ga0500637_0000172 3300053178 Bacteria 24102
1249 Ga0500637_0324055 3300053178 Bacteria 831
1250 Ga0500576_110125 3300053725 Bacteria 1106
1251 Ga0500611_049459 3300053727 Bacteria 957
1252 Ga0500625_004258 3300053729 Bacteria 5812
1253 Ga0500645_022463 3300053730 Bacteria 1940
1254 Ga0500609_022540 3300053731 Bacteria 862
1255 Ga0500656_021830 3300053732 Bacteria 799
1256 Ga0500596_002622 3300053735 Bacteria 3531
1257 Ga0500596_007030 3300053735 Bacteria 1864
1258 Ga0500596_012800 3300053735 Bacteria 1271
1259 Ga0500599_020197 3300053736 Bacteria 941
1260 Ga0500601_001828 3300053737 Bacteria 2278
1261 Ga0500601_002478 3300053737 Bacteria 1979
1262 Ga0501084_0002007 3300054114 Bacteria 16265
1263 Ga0501084_0014750 3300054114 Bacteria 6481
1264 Ga0500661_001292 3300055283 Bacteria 4680
1265 Ga0500661_012499 3300055283 Bacteria 1532
1266 Ga0501082_0002249 3300060353 Bacteria 16902
1267 Ga0501082_0038629 3300060353 Bacteria 4118
1268 Ga0466962_0033208 3300061719 Bacteria 2469
1269 Ga0466962_0059302 3300061719 Bacteria 1827

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2903748898 2903756794 213
2 3300041492 Ga0451835_0124610 Ga0451835_0124610_37_684 215
3 3300046660 Ga0495625_0281832 Ga0495625_0281832_375_1031 215
4 3300048905 Ga0496102_0283394 Ga0496102_0283394_896_1552 215
5 3300048911 Ga0496108_0565762 Ga0496108_0565762_11_670 215
6 3300048920 Ga0496117_0138041 Ga0496117_0138041_785_1441 215
7 3300049569 Ga0501032_0513354 Ga0501032_0513354_19_678 215
8 3300049571 Ga0501034_0745947 Ga0501034_0745947_44_703 215
9 3300053151 Ga0500604_0127050 Ga0500604_0127050_13_669 215
10 3300006028 Ga0070717_10534744 Ga0070717_105347442 217
11 iso_pu_bacteria 2922368715 2922378545 217
12 3300035083 Ga0373926_0025759 Ga0373926_0025759_500_1261 218
13 3300035111 Ga0373923_0007529 Ga0373923_0007529_2415_3176 218
14 3300035113 Ga0373936_0004331 Ga0373936_0004331_2060_2758 218
15 3300035117 Ga0373953_0088105 Ga0373953_0088105_44_805 218
16 3300035118 Ga0373954_0083181 Ga0373954_0083181_184_882 218
17 3300035170 Ga0373943_0045345 Ga0373943_0045345_951_1640 218
18 3300035171 Ga0373946_0106711 Ga0373946_0106711_377_1075 218
19 3300035410 Ga0373924_0006537 Ga0373924_0006537_3336_4094 218
20 3300035692 Ga0373935_0209753 Ga0373935_0209753_27_788 218
21 3300035724 Ga0373933_0030441 Ga0373933_0030441_139_900 218
22 3300035725 Ga0373947_0019438 Ga0373947_0019438_2326_3024 218
23 3300037068 Ga0373925_0096101 Ga0373925_0096101_1006_1767 218
24 3300046454 Ga0495592_0020079 Ga0495592_0020079_1223_1984 218
25 3300046472 Ga0495580_0126388 Ga0495580_0126388_650_1411 218
26 3300046473 Ga0495582_0006668 Ga0495582_0006668_2675_3370 218
27 3300046477 Ga0495664_0011821 Ga0495664_0011821_2409_3170 218
28 3300046516 Ga0495628_0113540 Ga0495628_0113540_903_1664 218
29 3300046517 Ga0495630_0077166 Ga0495630_0077166_1664_2425 218
30 3300046529 Ga0495652_0079593 Ga0495652_0079593_653_1414 218
31 3300046535 Ga0495586_0215060 Ga0495586_0215060_15_773 218
32 3300046543 Ga0495645_0020509 Ga0495645_0020509_3311_4072 218
33 3300046642 Ga0495634_0049998 Ga0495634_0049998_1007_1768 218
34 3300046681 Ga0495647_0008433 Ga0495647_0008433_1572_2333 218
35 3300046683 Ga0495658_0124749 Ga0495658_0124749_224_913 218
36 3300046689 Ga0495613_0100295 Ga0495613_0100295_560_1321 218
37 3300047319 Ga0495674_0044251 Ga0495674_0044251_2375_3136 218
38 3300047444 Ga0495675_0170302 Ga0495675_0170302_492_1253 218
39 3300047673 Ga0495593_0031077 Ga0495593_0031077_1206_1904 218
40 3300053077 Ga0495601_0295696 Ga0495601_0295696_96_923 218
41 3300053078 Ga0495612_0057281 Ga0495612_0057281_188_886 218
42 3300048929 Ga0496126_0098284 Ga0496126_0098284_687_1379 219
43 3300005458 Ga0070681_10151763 Ga0070681_101517633 220
44 3300005563 Ga0068855_100133882 Ga0068855_1001338824 220
45 3300025949 Ga0207667_10619978 Ga0207667_106199782 221
46 3300026041 Ga0207639_10501367 Ga0207639_105013671 221
47 3300006028 Ga0070717_10069573 Ga0070717_100695732 222
48 iso_pu_bacteria 2524023210 2524466187 222
49 iso_pu_bacteria 2903768456 2903771535 222
50 3300005329 Ga0070683_100110142 Ga0070683_1001101421 223
51 3300005530 Ga0070679_100450714 Ga0070679_1004507141 223
52 3300005535 Ga0070684_100414807 Ga0070684_1004148071 223
53 3300013105 Ga0157369_10740703 Ga0157369_107407031 223
54 3300025912 Ga0207707_10305503 Ga0207707_103055032 223
55 3300025944 Ga0207661_10492713 Ga0207661_104927132 223
56 iso_pu_bacteria 2513237098 2513677603 223
57 iso_pu_bacteria 2667528175 2671121368 223
58 iso_pu_bacteria 2791355197 2793071011 223
59 iso_pu_bacteria 2874604998 2874606915 223
60 iso_pu_bacteria 2885374607 2885381911 223
61 iso_pu_bacteria 2906635258 2906640247 223
62 iso_pu_bacteria 2906660503 2906668670 223
63 iso_pu_bacteria 2908739725 2908747955 223
64 iso_pu_bacteria 2922425934 2922433672 223
65 iso_pu_bacteria 3005474847 3005483327 223
66 iso_pu_bacteria 8019555841 8019563090 223
67 iso_pu_bacteria 8019565922 8019573171 223
68 iso_pu_bacteria 8056673599 8056678391 223
69 3300025912 Ga0207707_10002360 Ga0207707_100023606 224
70 3300031239 Ga0265328_10056045 Ga0265328_100560452 224
71 3300039450 Ga0436363_0593082 Ga0436363_0593082_26_760 224
72 iso_pu_bacteria 2507262055 2507504643 224
73 iso_pu_bacteria 2508501009 2508539633 224
74 iso_pu_bacteria 2508501042 2508694924 224
75 iso_pu_bacteria 2511231028 2511393263 224
76 iso_pu_bacteria 2513237092 2513627020 224
77 iso_pu_bacteria 2513237094 2513638530 224
78 iso_pu_bacteria 2513237095 2513653122 224
79 iso_pu_bacteria 2513237096 2513658958 224
80 iso_pu_bacteria 2513237101 2513694331 224
81 iso_pu_bacteria 2513237102 2513699138 224
82 iso_pu_bacteria 2513237104 2513714845 224
83 iso_pu_bacteria 2513237137 2513858849 224
84 iso_pu_bacteria 2513237139 2513875644 224
85 iso_pu_bacteria 2513237145 2513921222 224
86 iso_pu_bacteria 2513237161 2514016311 224
87 iso_pu_bacteria 2517093001 2517108140 224
88 iso_pu_bacteria 2517572143 2517889346 224
89 iso_pu_bacteria 2524023205 2524438639 224
90 iso_pu_bacteria 2524023228 2524540395 224
91 iso_pu_bacteria 2528768022 2528851467 224
92 iso_pu_bacteria 2617270735 2617347503 224
93 iso_pu_bacteria 2617270741 2617377095 224
94 iso_pu_bacteria 2728368998 2728754255 224
95 iso_pu_bacteria 2744054633 2745080573 224
96 iso_pu_bacteria 2791355196 2793063280 224
97 iso_pu_bacteria 2802429603 2805919320 224
98 iso_pu_bacteria 2816332527 2818243382 224
99 iso_pu_bacteria 2824600985 2824608651 224
100 iso_pu_bacteria 2824609381 2824612007 224
101 iso_pu_bacteria 2824617872 2824622550 224
102 iso_pu_bacteria 2824626560 2824633911 224
103 iso_pu_bacteria 2824635225 2824642354 224
104 iso_pu_bacteria 2824644064 2824649884 224
105 iso_pu_bacteria 2824661429 2824670288 224
106 iso_pu_bacteria 2824671348 2824678689 224
107 iso_pu_bacteria 2824679649 2824684157 224
108 iso_pu_bacteria 2824687955 2824694793 224
109 iso_pu_bacteria 2824696289 2824704086 224
110 iso_pu_bacteria 2824704595 2824711075 224
111 iso_pu_bacteria 2824714736 2824722552 224
112 iso_pu_bacteria 2824723954 2824730128 224
113 iso_pu_bacteria 2824732956 2824738863 224
114 iso_pu_bacteria 2824746037 2824752525 224
115 iso_pu_bacteria 2824753945 2824762857 224
116 iso_pu_bacteria 2824763712 2824770633 224
117 iso_pu_bacteria 2824773399 2824780182 224
118 iso_pu_bacteria 2838122688 2838130281 224
119 iso_pu_bacteria 2841949485 2841954546 224
120 iso_pu_bacteria 2841957949 2841962988 224
121 iso_pu_bacteria 2841966195 2841969054 224
122 iso_pu_bacteria 2841974524 2841979827 224
123 iso_pu_bacteria 2841983080 2841989575 224
124 iso_pu_bacteria 2842038055 2842044079 224
125 iso_pu_bacteria 2842045827 2842051932 224
126 iso_pu_bacteria 2844315083 2844316049 224
127 iso_pu_bacteria 2847930680 2847931537 224
128 iso_pu_bacteria 2847939898 2847941571 224
129 iso_pu_bacteria 2849076700 2849082493 224
130 iso_pu_bacteria 2857509624 2857516629 224
131 iso_pu_bacteria 2874590934 2874593135 224
132 iso_pu_bacteria 2874612657 2874619960 224
133 iso_pu_bacteria 2874620515 2874621435 224
134 iso_pu_bacteria 2874628541 2874632948 224
135 iso_pu_bacteria 2874645413 2874645742 224
136 iso_pu_bacteria 2876761206 2876763371 224
137 iso_pu_bacteria 2876771140 2876773175 224
138 iso_pu_bacteria 2876818435 2876820482 224
139 iso_pu_bacteria 2879074833 2879076879 224
140 iso_pu_bacteria 2879083081 2879091339 224
141 iso_pu_bacteria 2879099564 2879102305 224
142 iso_pu_bacteria 2879127579 2879131066 224
143 iso_pu_bacteria 2879142872 2879150273 224
144 iso_pu_bacteria 2881364244 2881364915 224
145 iso_pu_bacteria 2881665667 2881668568 224
146 iso_pu_bacteria 2885366525 2885368182 224
147 iso_pu_bacteria 2885383462 2885384775 224
148 iso_pu_bacteria 2885409591 2885417087 224
149 iso_pu_bacteria 2888378607 2888378816 224
150 iso_pu_bacteria 2888388044 2888391206 224
151 iso_pu_bacteria 2888419890 2888427241 224
152 iso_pu_bacteria 2889033259 2889036163 224
153 iso_pu_bacteria 2903727486 2903729555 224
154 iso_pu_bacteria 2904666416 2904668104 224
155 iso_pu_bacteria 2904690495 2904692447 224
156 iso_pu_bacteria 2904699407 2904709224 224
157 iso_pu_bacteria 2904711408 2904719879 224
158 iso_pu_bacteria 2906602504 2906608929 224
159 iso_pu_bacteria 2906626472 2906627170 224
160 iso_pu_bacteria 2906643746 2906645658 224
161 iso_pu_bacteria 2908756301 2908764399 224
162 iso_pu_bacteria 2908775508 2908783006 224
163 iso_pu_bacteria 2922361189 2922364537 224
164 iso_pu_bacteria 2922386360 2922389221 224
165 iso_pu_bacteria 2922393267 2922400963 224
166 iso_pu_bacteria 2929615660 2929623675 224
167 iso_pu_bacteria 2929624759 2929632883 224
168 iso_pu_bacteria 2932784394 2932789770 224
169 iso_pu_bacteria 2932794094 2932799537 224
170 iso_pu_bacteria 2932801729 2932805157 224
171 iso_pu_bacteria 2932809354 2932816899 224
172 iso_pu_bacteria 2932818245 2932826039 224
173 iso_pu_bacteria 2932828146 2932829403 224
174 iso_pu_bacteria 2933577622 2933585578 224
175 iso_pu_bacteria 2935608549 2935615162 224
176 iso_pu_bacteria 2935616580 2935617836 224
177 iso_pu_bacteria 2935630451 2935634716 224
178 iso_pu_bacteria 2935638405 2935643880 224
179 iso_pu_bacteria 2935648319 2935651481 224
180 iso_pu_bacteria 2935656913 2935659751 224
181 iso_pu_bacteria 2935665750 2935670810 224
182 iso_pu_bacteria 2935675223 2935678140 224
183 iso_pu_bacteria 2935684952 2935692428 224
184 iso_pu_bacteria 2935694250 2935699354 224
185 iso_pu_bacteria 2935703347 2935710162 224
186 iso_pu_bacteria 2935713505 2935721046 224
187 iso_pu_bacteria 2935722832 2935722871 224
188 iso_pu_bacteria 2935732158 2935739735 224
189 iso_pu_bacteria 2935741537 2935748773 224
190 iso_pu_bacteria 2935750917 2935758643 224
191 iso_pu_bacteria 2935760218 2935769028 224
192 iso_pu_bacteria 2935769743 2935775519 224
193 iso_pu_bacteria 2935777560 2935779768 224
194 iso_pu_bacteria 2935785616 2935790015 224
195 iso_pu_bacteria 2935793552 2935798444 224
196 iso_pu_bacteria 2935801545 2935806673 224
197 iso_pu_bacteria 2935810662 2935819798 224
198 iso_pu_bacteria 2935819856 2935825801 224
199 iso_pu_bacteria 2935827899 2935836934 224
200 iso_pu_bacteria 2935837841 2935843700 224
201 iso_pu_bacteria 2935847175 2935851420 224
202 iso_pu_bacteria 2935855204 2935856665 224
203 iso_pu_bacteria 2935864058 2935868144 224
204 iso_pu_bacteria 2935873716 2935879502 224
205 iso_pu_bacteria 2935883170 2935887753 224
206 iso_pu_bacteria 2935908558 2935910553 224
207 iso_pu_bacteria 2935916978 2935918043 224
208 iso_pu_bacteria 2935926038 2935927536 224
209 iso_pu_bacteria 2935934488 2935936592 224
210 iso_pu_bacteria 2935942939 2935943855 224
211 iso_pu_bacteria 2935951376 2935952292 224
212 iso_pu_bacteria 2935959822 2935967303 224
213 iso_pu_bacteria 2935967501 2935969132 224
214 iso_pu_bacteria 2935984226 2935984584 224
215 iso_pu_bacteria 2935992306 2936001229 224
216 iso_pu_bacteria 2936002035 2936009879 224
217 iso_pu_bacteria 2936011229 2936014167 224
218 iso_pu_bacteria 2936019824 2936022924 224
219 iso_pu_bacteria 2936028420 2936031060 224
220 iso_pu_bacteria 2936037263 2936046510 224
221 iso_pu_bacteria 2936046547 2936049182 224
222 iso_pu_bacteria 2936055302 2936055629 224
223 iso_pu_bacteria 2940556831 2940564767 224
224 iso_pu_bacteria 2941507105 2941511954 224
225 iso_pu_bacteria 2941515067 2941519656 224
226 iso_pu_bacteria 2941523033 2941527652 224
227 iso_pu_bacteria 2941531003 2941535909 224
228 iso_pu_bacteria 2941538514 2941544949 224
229 iso_pu_bacteria 3005483717 3005490484 224
230 iso_pu_bacteria 3005506211 3005509721 224
231 iso_pu_bacteria 3005587118 3005591188 224
232 iso_pu_bacteria 3005594810 3005595640 224
233 iso_pu_bacteria 3005710791 3005711631 224
234 iso_pu_bacteria 3005718088 3005718882 224
235 iso_pu_bacteria 8006926726 8006930150 224
236 iso_pu_bacteria 8006933436 8006935704 224
237 iso_pu_bacteria 8006964411 8006967686 224
238 iso_pu_bacteria 8006973647 8006975625 224
239 iso_pu_bacteria 8006984368 8006992661 224
240 iso_pu_bacteria 8016511872 8016518832 224
241 iso_pu_bacteria 8016522445 8016525611 224
242 iso_pu_bacteria 8016530956 8016539205 224
243 iso_pu_bacteria 8016539877 8016543493 224
244 iso_pu_bacteria 8016548790 8016549801 224
245 iso_pu_bacteria 8016566248 8016568895 224
246 iso_pu_bacteria 8016575299 8016581544 224
247 iso_pu_bacteria 8016583857 8016587101 224
248 iso_pu_bacteria 8016595262 8016596214 224
249 iso_pu_bacteria 8016603502 8016607117 224
250 iso_pu_bacteria 8016613128 8016619018 224
251 iso_pu_bacteria 8016630954 8016636522 224
252 iso_pu_bacteria 8017057580 8017057846 224
253 iso_pu_bacteria 8019530166 8019538873 224
254 iso_pu_bacteria 8019538911 8019541100 224
255 iso_pu_bacteria 8019576017 8019577880 224
256 iso_pu_bacteria 8019586578 8019595982 224
257 iso_pu_bacteria 8019608314 8019612760 224
258 iso_pu_bacteria 8019648815 8019653194 224
259 iso_pu_bacteria 8019687851 8019696909 224
260 iso_pu_bacteria 8055742211 8055750818 224
261 iso_pu_bacteria 8056681323 8056687802 224
262 iso_pu_bacteria 8056689827 8056694071 224
263 iso_pu_bacteria 8056967851 8056970642 224
264 3300005435 Ga0070714_100333722 Ga0070714_1003337222 225
265 3300025297 Ga0209758_1015810 Ga0209758_10158102 225
266 3300025929 Ga0207664_10330114 Ga0207664_103301141 225
267 iso_pu_bacteria 2906610324 2906613173 225
268 3300001979 JGI24740J21852_10002716 JGI24740J21852_100027162 226
269 3300001989 JGI24739J22299_10029161 JGI24739J22299_100291612 226
270 3300005336 Ga0070680_100446137 Ga0070680_1004461371 226
271 3300005439 Ga0070711_100190470 Ga0070711_1001904702 226
272 3300005455 Ga0070663_100097162 Ga0070663_1000971622 226
273 3300005455 Ga0070663_100097589 Ga0070663_1000975891 226
274 3300005455 Ga0070663_100203609 Ga0070663_1002036091 226
275 3300005458 Ga0070681_10075805 Ga0070681_100758051 226
276 3300005539 Ga0068853_100062087 Ga0068853_1000620872 226
277 3300005539 Ga0068853_100201201 Ga0068853_1002012011 226
278 3300005577 Ga0068857_100013608 Ga0068857_1000136083 226
279 3300005577 Ga0068857_100148651 Ga0068857_1001486512 226
280 3300005578 Ga0068854_100025810 Ga0068854_1000258103 226
281 3300005578 Ga0068854_100206980 Ga0068854_1002069802 226
282 3300005614 Ga0068856_100015417 Ga0068856_1000154178 226
283 3300005614 Ga0068856_100083490 Ga0068856_1000834903 226
284 3300005616 Ga0068852_100119103 Ga0068852_1001191032 226
285 3300005616 Ga0068852_100284971 Ga0068852_1002849712 226
286 3300005617 Ga0068859_100264445 Ga0068859_1002644452 226
287 3300005834 Ga0068851_10001765 Ga0068851_1000176510 226
288 3300006931 Ga0097620_100264391 Ga0097620_1002643912 226
289 3300009093 Ga0105240_10007060 Ga0105240_100070609 226
290 3300009174 Ga0105241_10006700 Ga0105241_100067002 226
291 3300009545 Ga0105237_10764827 Ga0105237_107648271 226
292 3300009551 Ga0105238_10035069 Ga0105238_100350696 226
293 3300009551 Ga0105238_10186917 Ga0105238_101869172 226
294 3300009553 Ga0105249_10304805 Ga0105249_103048051 226
295 3300010375 Ga0105239_10015859 Ga0105239_100158598 226
296 3300010375 Ga0105239_10324425 Ga0105239_103244252 226
297 3300013296 Ga0157374_11048682 Ga0157374_110486821 226
298 3300013306 Ga0163162_10178412 Ga0163162_101784122 226
299 3300014325 Ga0163163_10027246 Ga0163163_100272463 226
300 3300025321 Ga0207656_10019833 Ga0207656_100198332 226
301 3300025904 Ga0207647_10002224 Ga0207647_100022246 226
302 3300025911 Ga0207654_10000874 Ga0207654_1000087416 226
303 3300025912 Ga0207707_10204788 Ga0207707_102047881 226
304 3300025913 Ga0207695_10001756 Ga0207695_1000175622 226
305 3300025914 Ga0207671_10095343 Ga0207671_100953432 226
306 3300025914 Ga0207671_10139390 Ga0207671_101393902 226
307 3300025917 Ga0207660_10298211 Ga0207660_102982112 226
308 3300025924 Ga0207694_10000306 Ga0207694_1000030622 226
309 3300025924 Ga0207694_10114401 Ga0207694_101144013 226
310 3300025945 Ga0207679_10467337 Ga0207679_104673371 226
311 3300025949 Ga0207667_10023471 Ga0207667_100234713 226
312 3300025949 Ga0207667_10046562 Ga0207667_100465623 226
313 3300025981 Ga0207640_10078399 Ga0207640_100783992 226
314 3300026041 Ga0207639_10496320 Ga0207639_104963201 226
315 3300026041 Ga0207639_10752375 Ga0207639_107523752 226
316 3300026078 Ga0207702_10000122 Ga0207702_1000012260 226
317 3300026095 Ga0207676_10061211 Ga0207676_100612111 226
318 3300026116 Ga0207674_10022648 Ga0207674_100226481 226
319 3300026116 Ga0207674_10113789 Ga0207674_101137892 226
320 3300026142 Ga0207698_10089140 Ga0207698_100891402 226
321 3300031595 Ga0265313_10001357 Ga0265313_1000135725 226
322 3300048905 Ga0496102_0078329 Ga0496102_0078329_619_1362 226
323 3300048907 Ga0496104_0053542 Ga0496104_0053542_230_973 226
324 3300048908 Ga0496105_0015974 Ga0496105_0015974_724_1467 226
325 3300048909 Ga0496106_0017020 Ga0496106_0017020_302_1045 226
326 3300048911 Ga0496108_0094402 Ga0496108_0094402_1321_2064 226
327 3300048913 Ga0496110_0008268 Ga0496110_0008268_1429_2172 226
328 3300048915 Ga0496112_0005624 Ga0496112_0005624_3904_4647 226
329 3300053093 Ga0500651_0014125 Ga0500651_0014125_2597_3292 226
330 3300053111 Ga0500572_005149 Ga0500572_005149_64_750 226
331 3300053126 Ga0500621_165271 Ga0500621_165271_30_722 226
332 3300053136 Ga0500559_0002014 Ga0500559_0002014_5125_5811 226
333 3300053735 Ga0500596_007030 Ga0500596_007030_1067_1753 226
334 iso_pu_bacteria 2876808645 2876810680 226
335 iso_pu_bacteria 2879110137 2879112574 226
336 iso_pu_bacteria 8006994254 8006998354 226
337 3300003203 JGI25406J46586_10000160 JGI25406J46586_1000016028 227
338 3300003659 JGI25404J52841_10002450 JGI25404J52841_100024503 227
339 3300005262 Ga0065165_1073148 Ga0065165_10731481 227
340 3300005435 Ga0070714_100059128 Ga0070714_1000591284 227
341 3300005436 Ga0070713_100008592 Ga0070713_1000085926 227
342 3300005436 Ga0070713_100455772 Ga0070713_1004557721 227
343 3300005455 Ga0070663_100428110 Ga0070663_1004281102 227
344 3300005467 Ga0070706_100527339 Ga0070706_1005273391 227
345 3300005471 Ga0070698_100096957 Ga0070698_1000969573 227
346 3300005617 Ga0068859_100296250 Ga0068859_1002962502 227
347 3300005841 Ga0068863_100321174 Ga0068863_1003211741 227
348 3300005983 Ga0081540_1005026 Ga0081540_10050266 227
349 3300005983 Ga0081540_1068934 Ga0081540_10689343 227
350 3300005983 Ga0081540_1085672 Ga0081540_10856722 227
351 3300005983 Ga0081540_1160499 Ga0081540_11604991 227
352 3300005985 Ga0081539_10000040 Ga0081539_1000004090 227
353 3300005985 Ga0081539_10097065 Ga0081539_100970651 227
354 3300006028 Ga0070717_10015584 Ga0070717_100155843 227
355 3300006028 Ga0070717_10335683 Ga0070717_103356832 227
356 3300006175 Ga0070712_100115201 Ga0070712_1001152013 227
357 3300006175 Ga0070712_100439293 Ga0070712_1004392931 227
358 3300006175 Ga0070712_100508440 Ga0070712_1005084401 227
359 3300006931 Ga0097620_100296269 Ga0097620_1002962692 227
360 3300007076 Ga0075435_100293353 Ga0075435_1002933532 227
361 3300009101 Ga0105247_10025431 Ga0105247_100254312 227
362 3300013102 Ga0157371_10096483 Ga0157371_100964832 227
363 3300013104 Ga0157370_10062666 Ga0157370_100626664 227
364 3300013297 Ga0157378_10058109 Ga0157378_100581092 227
365 3300013307 Ga0157372_11013806 Ga0157372_110138062 227
366 3300025295 Ga0209564_1000842 Ga0209564_100084221 227
367 3300025900 Ga0207710_10116249 Ga0207710_101162492 227
368 3300025906 Ga0207699_10298005 Ga0207699_102980051 227
369 3300025910 Ga0207684_10640685 Ga0207684_106406851 227
370 3300025915 Ga0207693_10033990 Ga0207693_100339901 227
371 3300025915 Ga0207693_10047780 Ga0207693_100477801 227
372 3300025916 Ga0207663_10028634 Ga0207663_100286342 227
373 3300025916 Ga0207663_10082169 Ga0207663_100821692 227
374 3300025928 Ga0207700_10024741 Ga0207700_100247415 227
375 3300025928 Ga0207700_10274448 Ga0207700_102744482 227
376 3300026035 Ga0207703_10599211 Ga0207703_105992111 227
377 3300026067 Ga0207678_10574833 Ga0207678_105748331 227
378 3300026088 Ga0207641_10270349 Ga0207641_102703492 227
379 3300028379 Ga0268266_10849601 Ga0268266_108496012 227
380 3300030521 Ga0307511_10053968 Ga0307511_100539682 227
381 3300031235 Ga0265330_10038130 Ga0265330_100381303 227
382 3300031239 Ga0265328_10014234 Ga0265328_100142344 227
383 3300031250 Ga0265331_10001005 Ga0265331_1000100519 227
384 3300031344 Ga0265316_10090874 Ga0265316_100908742 227
385 3300031507 Ga0307509_10065722 Ga0307509_100657224 227
386 3300031616 Ga0307508_10001545 Ga0307508_1000154521 227
387 3300031616 Ga0307508_10423503 Ga0307508_104235031 227
388 3300031711 Ga0265314_10011154 Ga0265314_100111545 227
389 3300031730 Ga0307516_10060446 Ga0307516_100604463 227
390 3300033179 Ga0307507_10018905 Ga0307507_100189058 227
391 3300033442 Ga0315911_1000039 Ga0315911_100003954 227
392 3300035207 Ga0373942_0069098 Ga0373942_0069098_291_980 227
393 3300035692 Ga0373935_0027993 Ga0373935_0027993_1189_1884 227
394 3300035695 Ga0373927_0228455 Ga0373927_0228455_301_996 227
395 3300037312 Ga0395899_0143787 Ga0395899_0143787_890_1582 227
396 3300037418 Ga0395900_0000962 Ga0395900_0000962_13808_14494 227
397 3300037418 Ga0395900_0008900 Ga0395900_0008900_577_1269 227
398 3300037466 Ga0395898_0002601 Ga0395898_0002601_12320_13006 227
399 3300037466 Ga0395898_0095452 Ga0395898_0095452_353_1063 227
400 3300038443 Ga0395901_0002873 Ga0395901_0002873_13988_14680 227
401 3300038443 Ga0395901_0697039 Ga0395901_0697039_252_938 227
402 3300039450 Ga0436363_0166451 Ga0436363_0166451_3920_4621 227
403 3300046455 Ga0495603_0087432 Ga0495603_0087432_834_1517 227
404 3300046462 Ga0495651_0083404 Ga0495651_0083404_1574_2272 227
405 3300046507 Ga0495606_0003543 Ga0495606_0003543_12073_12771 227
406 3300046507 Ga0495606_0055131 Ga0495606_0055131_1698_2393 227
407 3300046529 Ga0495652_0159390 Ga0495652_0159390_963_1661 227
408 3300046557 Ga0495622_0159458 Ga0495622_0159458_270_959 227
409 3300046675 Ga0495657_0151678 Ga0495657_0151678_235_933 227
410 3300046694 Ga0495649_0161699 Ga0495649_0161699_457_1149 227
411 3300046809 Ga0495600_0141423 Ga0495600_0141423_736_1434 227
412 3300047469 Ga0495673_0012232 Ga0495673_0012232_1554_2249 227
413 3300048907 Ga0496104_0251678 Ga0496104_0251678_40_726 227
414 3300048909 Ga0496106_0001027 Ga0496106_0001027_4848_5534 227
415 3300048909 Ga0496106_0303538 Ga0496106_0303538_570_1262 227
416 3300048909 Ga0496106_0570586 Ga0496106_0570586_111_803 227
417 3300048910 Ga0496107_0047025 Ga0496107_0047025_2222_2908 227
418 3300048911 Ga0496108_0000649 Ga0496108_0000649_8436_9122 227
419 3300048912 Ga0496109_0000739 Ga0496109_0000739_8401_9087 227
420 3300048913 Ga0496110_0005408 Ga0496110_0005408_4915_5601 227
421 3300048914 Ga0496111_0010567 Ga0496111_0010567_3910_4596 227
422 3300048914 Ga0496111_0082778 Ga0496111_0082778_280_972 227
423 3300048915 Ga0496112_0000055 Ga0496112_0000055_23822_24517 227
424 3300048915 Ga0496112_0001001 Ga0496112_0001001_11621_12307 227
425 3300048915 Ga0496112_0032144 Ga0496112_0032144_2380_3072 227
426 3300048917 Ga0496114_0087906 Ga0496114_0087906_1233_1919 227
427 3300048918 Ga0496115_0004434 Ga0496115_0004434_2789_3484 227
428 3300048918 Ga0496115_0130053 Ga0496115_0130053_411_1103 227
429 3300048918 Ga0496115_0279975 Ga0496115_0279975_110_793 227
430 3300048920 Ga0496117_0069000 Ga0496117_0069000_289_1020 227
431 3300048921 Ga0496118_0007955 Ga0496118_0007955_1075_1806 227
432 3300048921 Ga0496118_0042878 Ga0496118_0042878_1758_2453 227
433 3300048922 Ga0496119_0048531 Ga0496119_0048531_829_1560 227
434 3300048922 Ga0496119_0063950 Ga0496119_0063950_77_775 227
435 3300048924 Ga0496121_0000144 Ga0496121_0000144_44914_45645 227
436 3300048924 Ga0496121_0008147 Ga0496121_0008147_3487_4182 227
437 3300048924 Ga0496121_0031148 Ga0496121_0031148_348_1052 227
438 3300048924 Ga0496121_0182258 Ga0496121_0182258_53_802 227
439 3300048924 Ga0496121_0221403 Ga0496121_0221403_383_1081 227
440 3300048927 Ga0496124_0002408 Ga0496124_0002408_4805_5536 227
441 3300048928 Ga0496125_0045159 Ga0496125_0045159_1082_1813 227
442 3300048929 Ga0496126_0008459 Ga0496126_0008459_6326_7012 227
443 3300048929 Ga0496126_0018002 Ga0496126_0018002_3390_4082 227
444 3300048929 Ga0496126_0028459 Ga0496126_0028459_1033_1764 227
445 3300048929 Ga0496126_0156031 Ga0496126_0156031_964_1647 227
446 3300049568 Ga0501031_0000377 Ga0501031_0000377_3483_4181 227
447 3300049569 Ga0501032_0000040 Ga0501032_0000040_98778_99476 227
448 3300049569 Ga0501032_0003836 Ga0501032_0003836_10622_11314 227
449 3300049569 Ga0501032_0077513 Ga0501032_0077513_840_1544 227
450 3300049570 Ga0501033_0000128 Ga0501033_0000128_38533_39231 227
451 3300049571 Ga0501034_0000254 Ga0501034_0000254_4099_4797 227
452 3300049571 Ga0501034_0014046 Ga0501034_0014046_4973_5665 227
453 3300049571 Ga0501034_0075462 Ga0501034_0075462_1389_2087 227
454 3300049571 Ga0501034_0715413 Ga0501034_0715413_42_740 227
455 3300049573 Ga0501037_0000041 Ga0501037_0000041_98678_99376 227
456 3300049574 Ga0501038_0000057 Ga0501038_0000057_12547_13245 227
457 3300049574 Ga0501038_0025093 Ga0501038_0025093_1651_2343 227
458 3300049574 Ga0501038_0290204 Ga0501038_0290204_68_772 227
459 3300049575 Ga0501039_0012981 Ga0501039_0012981_1300_1998 227
460 3300049579 Ga0501043_0000184 Ga0501043_0000184_9991_10689 227
461 3300049579 Ga0501043_0231712 Ga0501043_0231712_221_925 227
462 3300049580 Ga0501046_0000072 Ga0501046_0000072_6908_7606 227
463 3300049580 Ga0501046_0458459 Ga0501046_0458459_21_713 227
464 3300049581 Ga0501047_0000044 Ga0501047_0000044_98760_99458 227
465 3300049581 Ga0501047_0028170 Ga0501047_0028170_3505_4203 227
466 3300049581 Ga0501047_0455414 Ga0501047_0455414_61_765 227
467 3300049582 Ga0501048_0000117 Ga0501048_0000117_40157_40855 227
468 3300049583 Ga0501067_0001815 Ga0501067_0001815_8025_8723 227
469 3300049584 Ga0501068_0001318 Ga0501068_0001318_9469_10167 227
470 3300049585 Ga0501069_0002548 Ga0501069_0002548_8378_9076 227
471 3300049586 Ga0501070_0018396 Ga0501070_0018396_2405_3103 227
472 3300049586 Ga0501070_0068187 Ga0501070_0068187_1004_1702 227
473 3300049586 Ga0501070_0279151 Ga0501070_0279151_576_1277 227
474 3300049587 Ga0501071_0184407 Ga0501071_0184407_651_1349 227
475 3300049588 Ga0501072_0000156 Ga0501072_0000156_18924_19622 227
476 3300049589 Ga0501073_0002824 Ga0501073_0002824_6908_7606 227
477 3300049590 Ga0501074_0000035 Ga0501074_0000035_34666_35364 227
478 3300049592 Ga0501076_0187321 Ga0501076_0187321_552_1250 227
479 3300049741 Ga0501079_0005573 Ga0501079_0005573_4272_4970 227
480 3300049742 Ga0501080_0008601 Ga0501080_0008601_3841_4539 227
481 3300049744 Ga0501083_0000641 Ga0501083_0000641_10071_10769 227
482 3300049822 Ga0501035_0000128 Ga0501035_0000128_62762_63460 227
483 3300049822 Ga0501035_0021153 Ga0501035_0021153_2791_3483 227
484 3300049822 Ga0501035_0057655 Ga0501035_0057655_1339_2037 227
485 3300049822 Ga0501035_0644437 Ga0501035_0644437_15_719 227
486 3300049823 Ga0501044_0000108 Ga0501044_0000108_31981_32679 227
487 3300049823 Ga0501044_0138109 Ga0501044_0138109_604_1302 227
488 3300049823 Ga0501044_0368464 Ga0501044_0368464_586_1296 227
489 3300050512 nmdc:mga0n895_134711_c1 nmdc:mga0n895_134711_c1_818_1501 227
490 3300053080 Ga0500635_0010037 Ga0500635_0010037_477_1202 227
491 3300053094 Ga0500566_0000839 Ga0500566_0000839_2627_3337 227
492 3300053111 Ga0500572_009276 Ga0500572_009276_450_1160 227
493 3300053119 Ga0500595_026590 Ga0500595_026590_1164_1865 227
494 3300053122 Ga0500608_116450 Ga0500608_116450_70_783 227
495 3300053123 Ga0500614_081683 Ga0500614_081683_49_762 227
496 3300053136 Ga0500559_0063271 Ga0500559_0063271_244_957 227
497 3300053136 Ga0500559_0114786 Ga0500559_0114786_381_1076 227
498 3300053140 Ga0500573_0006675 Ga0500573_0006675_1930_2625 227
499 3300053150 Ga0500603_030306 Ga0500603_030306_144_857 227
500 3300053150 Ga0500603_136790 Ga0500603_136790_19_714 227
501 3300053153 Ga0500616_0000038 Ga0500616_0000038_252991_253686 227
502 3300053158 Ga0500627_0082232 Ga0500627_0082232_480_1178 227
503 3300053159 Ga0500630_102889 Ga0500630_102889_571_1284 227
504 3300053162 Ga0500638_076439 Ga0500638_076439_364_1125 227
505 3300053163 Ga0500639_040385 Ga0500639_040385_685_1398 227
506 3300053177 Ga0500636_0010062 Ga0500636_0010062_1390_2085 227
507 3300053178 Ga0500637_0324055 Ga0500637_0324055_44_769 227
508 3300053725 Ga0500576_110125 Ga0500576_110125_376_1089 227
509 3300053735 Ga0500596_002622 Ga0500596_002622_2737_3432 227
510 3300053735 Ga0500596_012800 Ga0500596_012800_542_1252 227
511 3300054114 Ga0501084_0002007 Ga0501084_0002007_12167_12865 227
512 3300060353 Ga0501082_0002249 Ga0501082_0002249_3458_4156 227
513 iso_pu_bacteria 2508501128 2509149886 227
514 iso_pu_bacteria 2513237141 2513889622 227
515 iso_pu_bacteria 2602042107 2603857920 227
516 iso_pu_bacteria 2721755755 2723849146 227
517 iso_pu_bacteria 2857524615 2857527295 227
518 iso_pu_bacteria 2893066018 2893071834 227
519 iso_pu_bacteria 2919073203 2919078410 227
520 2010549000 RicEn_C2869 RicEn_52840 228
521 3300002077 JGI24744J21845_10030724 JGI24744J21845_100307242 228
522 3300003203 JGI25406J46586_10012370 JGI25406J46586_100123702 228
523 3300003214 JGI25165J46597_1005725 JGI25165J46597_10057252 228
524 3300003214 JGI25165J46597_1006062 JGI25165J46597_10060622 228
525 3300003215 JGI25153J46596_10002632 JGI25153J46596_100026326 228
526 3300003215 JGI25153J46596_10003367 JGI25153J46596_100033673 228
527 3300003215 JGI25153J46596_10008346 JGI25153J46596_100083466 228
528 3300003215 JGI25153J46596_10014306 JGI25153J46596_100143062 228
529 3300003215 JGI25153J46596_10033551 JGI25153J46596_100335512 228
530 3300003354 JGI25160J50197_1003359 JGI25160J50197_10033593 228
531 3300003354 JGI25160J50197_1011680 JGI25160J50197_10116803 228
532 3300003354 JGI25160J50197_1027994 JGI25160J50197_10279942 228
533 3300003659 JGI25404J52841_10024669 JGI25404J52841_100246692 228
534 3300003794 Ga0055531_10020755 Ga0055531_100207551 228
535 3300004625 Ga0055543_1004220 Ga0055543_10042202 228
536 3300005262 Ga0065165_1001384 Ga0065165_10013843 228
537 3300005262 Ga0065165_1001884 Ga0065165_10018843 228
538 3300005262 Ga0065165_1004470 Ga0065165_10044708 228
539 3300005327 Ga0070658_10610270 Ga0070658_106102701 228
540 3300005329 Ga0070683_100372464 Ga0070683_1003724641 228
541 3300005330 Ga0070690_100718201 Ga0070690_1007182011 228
542 3300005331 Ga0070670_100288527 Ga0070670_1002885271 228
543 3300005334 Ga0068869_100065680 Ga0068869_1000656803 228
544 3300005334 Ga0068869_100102515 Ga0068869_1001025153 228
545 3300005336 Ga0070680_100062694 Ga0070680_1000626942 228
546 3300005336 Ga0070680_100089408 Ga0070680_1000894083 228
547 3300005336 Ga0070680_100160108 Ga0070680_1001601082 228
548 3300005338 Ga0068868_100029123 Ga0068868_1000291234 228
549 3300005338 Ga0068868_100033772 Ga0068868_1000337722 228
550 3300005339 Ga0070660_100218007 Ga0070660_1002180071 228
551 3300005340 Ga0070689_100228229 Ga0070689_1002282291 228
552 3300005341 Ga0070691_10051856 Ga0070691_100518562 228
553 3300005343 Ga0070687_100482820 Ga0070687_1004828201 228
554 3300005344 Ga0070661_100209431 Ga0070661_1002094311 228
555 3300005347 Ga0070668_100369657 Ga0070668_1003696572 228
556 3300005353 Ga0070669_100331257 Ga0070669_1003312572 228
557 3300005353 Ga0070669_100430164 Ga0070669_1004301641 228
558 3300005354 Ga0070675_100646897 Ga0070675_1006468971 228
559 3300005354 Ga0070675_100756815 Ga0070675_1007568151 228
560 3300005355 Ga0070671_100293165 Ga0070671_1002931652 228
561 3300005365 Ga0070688_100411113 Ga0070688_1004111131 228
562 3300005366 Ga0070659_100043739 Ga0070659_1000437393 228
563 3300005366 Ga0070659_100464942 Ga0070659_1004649422 228
564 3300005434 Ga0070709_10018844 Ga0070709_100188444 228
565 3300005434 Ga0070709_10046949 Ga0070709_100469494 228
566 3300005435 Ga0070714_100074644 Ga0070714_1000746441 228
567 3300005435 Ga0070714_100094459 Ga0070714_1000944592 228
568 3300005435 Ga0070714_100098717 Ga0070714_1000987171 228
569 3300005436 Ga0070713_100023569 Ga0070713_1000235692 228
570 3300005436 Ga0070713_100052194 Ga0070713_1000521943 228
571 3300005436 Ga0070713_100099028 Ga0070713_1000990283 228
572 3300005436 Ga0070713_100234675 Ga0070713_1002346751 228
573 3300005436 Ga0070713_100428302 Ga0070713_1004283021 228
574 3300005437 Ga0070710_10000883 Ga0070710_100008833 228
575 3300005437 Ga0070710_10001420 Ga0070710_100014207 228
576 3300005439 Ga0070711_100002983 Ga0070711_10000298311 228
577 3300005439 Ga0070711_100012546 Ga0070711_1000125463 228
578 3300005439 Ga0070711_100021714 Ga0070711_1000217143 228
579 3300005440 Ga0070705_100448181 Ga0070705_1004481811 228
580 3300005445 Ga0070708_100057117 Ga0070708_1000571172 228
581 3300005455 Ga0070663_100007823 Ga0070663_1000078236 228
582 3300005455 Ga0070663_100194136 Ga0070663_1001941362 228
583 3300005456 Ga0070678_100061407 Ga0070678_1000614073 228
584 3300005456 Ga0070678_100105110 Ga0070678_1001051102 228
585 3300005456 Ga0070678_100145055 Ga0070678_1001450552 228
586 3300005456 Ga0070678_100185267 Ga0070678_1001852672 228
587 3300005456 Ga0070678_100260787 Ga0070678_1002607872 228
588 3300005457 Ga0070662_100426573 Ga0070662_1004265731 228
589 3300005466 Ga0070685_10218081 Ga0070685_102180812 228
590 3300005466 Ga0070685_10260566 Ga0070685_102605662 228
591 3300005468 Ga0070707_100227591 Ga0070707_1002275912 228
592 3300005530 Ga0070679_100044686 Ga0070679_1000446862 228
593 3300005530 Ga0070679_100124810 Ga0070679_1001248101 228
594 3300005530 Ga0070679_100179414 Ga0070679_1001794142 228
595 3300005535 Ga0070684_100016103 Ga0070684_1000161033 228
596 3300005536 Ga0070697_100025792 Ga0070697_1000257924 228
597 3300005539 Ga0068853_100167859 Ga0068853_1001678592 228
598 3300005539 Ga0068853_100264761 Ga0068853_1002647611 228
599 3300005539 Ga0068853_100402869 Ga0068853_1004028692 228
600 3300005539 Ga0068853_100521057 Ga0068853_1005210572 228
601 3300005543 Ga0070672_100066970 Ga0070672_1000669702 228
602 3300005544 Ga0070686_100079501 Ga0070686_1000795012 228
603 3300005544 Ga0070686_100519495 Ga0070686_1005194952 228
604 3300005547 Ga0070693_100239942 Ga0070693_1002399422 228
605 3300005548 Ga0070665_100011529 Ga0070665_1000115294 228
606 3300005548 Ga0070665_100084179 Ga0070665_1000841793 228
607 3300005548 Ga0070665_100088233 Ga0070665_1000882334 228
608 3300005548 Ga0070665_100248788 Ga0070665_1002487882 228
609 3300005548 Ga0070665_100947156 Ga0070665_1009471562 228
610 3300005549 Ga0070704_100671235 Ga0070704_1006712351 228
611 3300005563 Ga0068855_100250765 Ga0068855_1002507652 228
612 3300005563 Ga0068855_100356423 Ga0068855_1003564232 228
613 3300005563 Ga0068855_101086963 Ga0068855_1010869631 228
614 3300005564 Ga0070664_100728870 Ga0070664_1007288701 228
615 3300005614 Ga0068856_100003436 Ga0068856_1000034366 228
616 3300005614 Ga0068856_100130496 Ga0068856_1001304962 228
617 3300005614 Ga0068856_100286324 Ga0068856_1002863241 228
618 3300005614 Ga0068856_100519611 Ga0068856_1005196111 228
619 3300005615 Ga0070702_100078903 Ga0070702_1000789032 228
620 3300005615 Ga0070702_100106533 Ga0070702_1001065332 228
621 3300005616 Ga0068852_100063044 Ga0068852_1000630442 228
622 3300005616 Ga0068852_100222030 Ga0068852_1002220302 228
623 3300005616 Ga0068852_100337155 Ga0068852_1003371552 228
624 3300005616 Ga0068852_100585806 Ga0068852_1005858062 228
625 3300005616 Ga0068852_100641653 Ga0068852_1006416532 228
626 3300005616 Ga0068852_100912234 Ga0068852_1009122341 228
627 3300005718 Ga0068866_10006968 Ga0068866_100069682 228
628 3300005719 Ga0068861_100022743 Ga0068861_1000227436 228
629 3300005719 Ga0068861_100310536 Ga0068861_1003105362 228
630 3300005719 Ga0068861_100639295 Ga0068861_1006392951 228
631 3300005834 Ga0068851_10045623 Ga0068851_100456232 228
632 3300005841 Ga0068863_100320009 Ga0068863_1003200091 228
633 3300005842 Ga0068858_100157399 Ga0068858_1001573992 228
634 3300005843 Ga0068860_100002621 Ga0068860_1000026217 228
635 3300005843 Ga0068860_100150946 Ga0068860_1001509462 228
636 3300005843 Ga0068860_100294214 Ga0068860_1002942142 228
637 3300005843 Ga0068860_100643834 Ga0068860_1006438342 228
638 3300005844 Ga0068862_100029193 Ga0068862_1000291932 228
639 3300005844 Ga0068862_100107881 Ga0068862_1001078813 228
640 3300005844 Ga0068862_100243422 Ga0068862_1002434222 228
641 3300005844 Ga0068862_100380929 Ga0068862_1003809292 228
642 3300005844 Ga0068862_100515955 Ga0068862_1005159551 228
643 3300005844 Ga0068862_100518016 Ga0068862_1005180161 228
644 3300005937 Ga0081455_10015989 Ga0081455_100159898 228
645 3300005937 Ga0081455_10051879 Ga0081455_100518792 228
646 3300005981 Ga0081538_10073012 Ga0081538_100730122 228
647 3300005983 Ga0081540_1002275 Ga0081540_100227512 228
648 3300005983 Ga0081540_1035395 Ga0081540_10353952 228
649 3300005983 Ga0081540_1035915 Ga0081540_10359152 228
650 3300005983 Ga0081540_1074604 Ga0081540_10746041 228
651 3300005983 Ga0081540_1101551 Ga0081540_11015512 228
652 3300005985 Ga0081539_10001394 Ga0081539_1000139416 228
653 3300005985 Ga0081539_10032566 Ga0081539_100325662 228
654 3300006028 Ga0070717_10115216 Ga0070717_101152162 228
655 3300006028 Ga0070717_10899516 Ga0070717_108995161 228
656 3300006038 Ga0075365_10040867 Ga0075365_100408672 228
657 3300006038 Ga0075365_10066849 Ga0075365_100668492 228
658 3300006038 Ga0075365_10089169 Ga0075365_100891692 228
659 3300006038 Ga0075365_10153495 Ga0075365_101534951 228
660 3300006042 Ga0075368_10017885 Ga0075368_100178851 228
661 3300006048 Ga0075363_100002368 Ga0075363_1000023689 228
662 3300006048 Ga0075363_100118266 Ga0075363_1001182661 228
663 3300006051 Ga0075364_10009615 Ga0075364_100096151 228
664 3300006051 Ga0075364_10050022 Ga0075364_100500222 228
665 3300006051 Ga0075364_10115983 Ga0075364_101159832 228
666 3300006163 Ga0070715_10002422 Ga0070715_100024226 228
667 3300006163 Ga0070715_10068744 Ga0070715_100687442 228
668 3300006173 Ga0070716_100008434 Ga0070716_1000084342 228
669 3300006173 Ga0070716_100011641 Ga0070716_1000116412 228
670 3300006175 Ga0070712_100109785 Ga0070712_1001097852 228
671 3300006177 Ga0075362_10100366 Ga0075362_101003661 228
672 3300006178 Ga0075367_10036634 Ga0075367_100366344 228
673 3300006178 Ga0075367_10088344 Ga0075367_100883442 228
674 3300006178 Ga0075367_10136730 Ga0075367_101367302 228
675 3300006178 Ga0075367_10155520 Ga0075367_101555202 228
676 3300006178 Ga0075367_10157486 Ga0075367_101574862 228
677 3300006178 Ga0075367_10394042 Ga0075367_103940421 228
678 3300006178 Ga0075367_10421840 Ga0075367_104218402 228
679 3300006186 Ga0075369_10016556 Ga0075369_100165564 228
680 3300006186 Ga0075369_10072521 Ga0075369_100725212 228
681 3300006195 Ga0075366_10064541 Ga0075366_100645411 228
682 3300006195 Ga0075366_10091686 Ga0075366_100916862 228
683 3300006195 Ga0075366_10180427 Ga0075366_101804272 228
684 3300006237 Ga0097621_100173174 Ga0097621_1001731742 228
685 3300006237 Ga0097621_100391615 Ga0097621_1003916152 228
686 3300006353 Ga0075370_10044155 Ga0075370_100441554 228
687 3300006353 Ga0075370_10120877 Ga0075370_101208772 228
688 3300006353 Ga0075370_10140886 Ga0075370_101408862 228
689 3300006353 Ga0075370_10145316 Ga0075370_101453162 228
690 3300006353 Ga0075370_10149905 Ga0075370_101499052 228
691 3300006358 Ga0068871_100322507 Ga0068871_1003225072 228
692 3300006358 Ga0068871_100673872 Ga0068871_1006738721 228
693 3300006844 Ga0075428_100042233 Ga0075428_1000422333 228
694 3300006881 Ga0068865_100153220 Ga0068865_1001532202 228
695 3300006941 Ga0099825_1023350 Ga0099825_10233503 228
696 3300006942 Ga0099824_1026659 Ga0099824_10266593 228
697 3300006944 Ga0099823_1035919 Ga0099823_10359195 228
698 3300007076 Ga0075435_100230907 Ga0075435_1002309072 228
699 3300007265 Ga0099794_10047918 Ga0099794_100479182 228
700 3300007265 Ga0099794_10274365 Ga0099794_102743651 228
701 3300007788 Ga0099795_10123152 Ga0099795_101231521 228
702 3300009036 Ga0105244_10268314 Ga0105244_102683141 228
703 3300009093 Ga0105240_10018234 Ga0105240_100182348 228
704 3300009093 Ga0105240_10142386 Ga0105240_101423862 228
705 3300009094 Ga0111539_10206349 Ga0111539_102063492 228
706 3300009098 Ga0105245_10271868 Ga0105245_102718682 228
707 3300009098 Ga0105245_10872282 Ga0105245_108722821 228
708 3300009101 Ga0105247_10324635 Ga0105247_103246351 228
709 3300009148 Ga0105243_10297379 Ga0105243_102973792 228
710 3300009148 Ga0105243_10319149 Ga0105243_103191491 228
711 3300009174 Ga0105241_10040543 Ga0105241_100405432 228
712 3300009174 Ga0105241_10049268 Ga0105241_100492682 228
713 3300009177 Ga0105248_11167893 Ga0105248_111678931 228
714 3300009545 Ga0105237_10021872 Ga0105237_100218724 228
715 3300009545 Ga0105237_10056221 Ga0105237_100562213 228
716 3300009545 Ga0105237_10101785 Ga0105237_101017853 228
717 3300009545 Ga0105237_10112451 Ga0105237_101124513 228
718 3300009545 Ga0105237_10199326 Ga0105237_101993261 228
719 3300009545 Ga0105237_10243819 Ga0105237_102438192 228
720 3300009545 Ga0105237_10264917 Ga0105237_102649172 228
721 3300009551 Ga0105238_10029421 Ga0105238_100294216 228
722 3300009551 Ga0105238_10134629 Ga0105238_101346293 228
723 3300009551 Ga0105238_10167493 Ga0105238_101674932 228
724 3300009551 Ga0105238_10442750 Ga0105238_104427501 228
725 3300009551 Ga0105238_10496026 Ga0105238_104960262 228
726 3300009551 Ga0105238_10520535 Ga0105238_105205352 228
727 3300009553 Ga0105249_10269244 Ga0105249_102692441 228
728 3300009553 Ga0105249_10495183 Ga0105249_104951831 228
729 3300010375 Ga0105239_10079643 Ga0105239_100796434 228
730 3300010375 Ga0105239_10088065 Ga0105239_100880653 228
731 3300010375 Ga0105239_10138557 Ga0105239_101385572 228
732 3300010375 Ga0105239_10324060 Ga0105239_103240602 228
733 3300010375 Ga0105239_10640378 Ga0105239_106403782 228
734 3300011119 Ga0105246_10009694 Ga0105246_100096942 228
735 3300011119 Ga0105246_10059677 Ga0105246_100596773 228
736 3300011119 Ga0105246_10193182 Ga0105246_101931821 228
737 3300011119 Ga0105246_10341679 Ga0105246_103416792 228
738 3300013100 Ga0157373_10153054 Ga0157373_101530542 228
739 3300013102 Ga0157371_10670233 Ga0157371_106702331 228
740 3300013104 Ga0157370_10091902 Ga0157370_100919022 228
741 3300013104 Ga0157370_10248787 Ga0157370_102487872 228
742 3300013105 Ga0157369_10005581 Ga0157369_100055819 228
743 3300013105 Ga0157369_10019064 Ga0157369_100190641 228
744 3300013296 Ga0157374_10165783 Ga0157374_101657832 228
745 3300013296 Ga0157374_10273856 Ga0157374_102738562 228
746 3300013297 Ga0157378_10023907 Ga0157378_100239074 228
747 3300013306 Ga0163162_10161492 Ga0163162_101614922 228
748 3300013306 Ga0163162_10544771 Ga0163162_105447712 228
749 3300013306 Ga0163162_10766710 Ga0163162_107667102 228
750 3300013307 Ga0157372_10218370 Ga0157372_102183702 228
751 3300013307 Ga0157372_10477917 Ga0157372_104779172 228
752 3300013307 Ga0157372_10757252 Ga0157372_107572522 228
753 3300013308 Ga0157375_10408730 Ga0157375_104087302 228
754 3300014325 Ga0163163_10073724 Ga0163163_100737242 228
755 3300014325 Ga0163163_10180400 Ga0163163_101804002 228
756 3300014325 Ga0163163_10323220 Ga0163163_103232202 228
757 3300014325 Ga0163163_10411575 Ga0163163_104115752 228
758 3300014325 Ga0163163_10620113 Ga0163163_106201132 228
759 3300014326 Ga0157380_10197062 Ga0157380_101970622 228
760 3300014326 Ga0157380_10716133 Ga0157380_107161332 228
761 3300014968 Ga0157379_10269437 Ga0157379_102694372 228
762 3300014968 Ga0157379_10743447 Ga0157379_107434471 228
763 3300014969 Ga0157376_10254582 Ga0157376_102545822 228
764 3300014969 Ga0157376_10574867 Ga0157376_105748671 228
765 3300014969 Ga0157376_10744436 Ga0157376_107444362 228
766 3300017792 Ga0163161_10084320 Ga0163161_100843202 228
767 3300017792 Ga0163161_10223845 Ga0163161_102238452 228
768 3300017792 Ga0163161_10777424 Ga0163161_107774241 228
769 3300021320 Ga0214544_1000007 Ga0214544_1000007140 228
770 3300021321 Ga0214542_1000007 Ga0214542_1000007243 228
771 3300021324 Ga0214545_1000006 Ga0214545_100000650 228
772 3300021327 Ga0214543_1000009 Ga0214543_1000009140 228
773 3300021377 Ga0213874_10020651 Ga0213874_100206512 228
774 3300021384 Ga0213876_10008797 Ga0213876_100087974 228
775 3300021384 Ga0213876_10059454 Ga0213876_100594541 228
776 3300021384 Ga0213876_10094182 Ga0213876_100941822 228
777 3300021384 Ga0213876_10166085 Ga0213876_101660851 228
778 3300021384 Ga0213876_10191050 Ga0213876_101910502 228
779 3300021441 Ga0213871_10027153 Ga0213871_100271531 228
780 3300025253 Ga0209677_101800 Ga0209677_1018003 228
781 3300025253 Ga0209677_103149 Ga0209677_1031492 228
782 3300025254 Ga0209148_1000688 Ga0209148_10006887 228
783 3300025261 Ga0209233_1002001 Ga0209233_10020011 228
784 3300025261 Ga0209233_1003079 Ga0209233_10030796 228
785 3300025261 Ga0209233_1018527 Ga0209233_10185272 228
786 3300025272 Ga0209455_1002533 Ga0209455_10025334 228
787 3300025284 Ga0209130_1037253 Ga0209130_10372531 228
788 3300025295 Ga0209564_1004194 Ga0209564_10041945 228
789 3300025295 Ga0209564_1011852 Ga0209564_10118521 228
790 3300025297 Ga0209758_1000015 Ga0209758_1000015353 228
791 3300025297 Ga0209758_1000161 Ga0209758_1000161146 228
792 3300025297 Ga0209758_1001473 Ga0209758_10014739 228
793 3300025297 Ga0209758_1005779 Ga0209758_10057792 228
794 3300025297 Ga0209758_1006771 Ga0209758_10067715 228
795 3300025297 Ga0209758_1010969 Ga0209758_10109692 228
796 3300025299 Ga0209256_1004114 Ga0209256_10041142 228
797 3300025302 Ga0207426_1000186 Ga0207426_100018626 228
798 3300025302 Ga0207426_1004316 Ga0207426_10043166 228
799 3300025302 Ga0207426_1004813 Ga0207426_10048134 228
800 3300025302 Ga0207426_1020280 Ga0207426_10202802 228
801 3300025303 Ga0209051_1093598 Ga0209051_10935981 228
802 3300025304 Ga0209257_1002985 Ga0209257_10029859 228
803 3300025304 Ga0209257_1019262 Ga0209257_10192622 228
804 3300025315 Ga0207697_10040491 Ga0207697_100404912 228
805 3300025898 Ga0207692_10000852 Ga0207692_100008525 228
806 3300025898 Ga0207692_10002369 Ga0207692_100023696 228
807 3300025900 Ga0207710_10103535 Ga0207710_101035352 228
808 3300025901 Ga0207688_10204565 Ga0207688_102045651 228
809 3300025903 Ga0207680_10440173 Ga0207680_104401731 228
810 3300025904 Ga0207647_10163565 Ga0207647_101635652 228
811 3300025905 Ga0207685_10005460 Ga0207685_100054603 228
812 3300025906 Ga0207699_10011751 Ga0207699_100117512 228
813 3300025906 Ga0207699_10013540 Ga0207699_100135402 228
814 3300025906 Ga0207699_10025447 Ga0207699_100254473 228
815 3300025906 Ga0207699_10036285 Ga0207699_100362852 228
816 3300025907 Ga0207645_10017476 Ga0207645_100174765 228
817 3300025912 Ga0207707_10018715 Ga0207707_100187154 228
818 3300025912 Ga0207707_10023081 Ga0207707_100230812 228
819 3300025913 Ga0207695_10000006 Ga0207695_10000006131 228
820 3300025913 Ga0207695_10070740 Ga0207695_100707405 228
821 3300025913 Ga0207695_10163275 Ga0207695_101632752 228
822 3300025914 Ga0207671_10008770 Ga0207671_100087709 228
823 3300025914 Ga0207671_10019054 Ga0207671_100190545 228
824 3300025914 Ga0207671_10114716 Ga0207671_101147162 228
825 3300025914 Ga0207671_10169187 Ga0207671_101691872 228
826 3300025914 Ga0207671_10198075 Ga0207671_101980752 228
827 3300025915 Ga0207693_10023504 Ga0207693_100235041 228
828 3300025915 Ga0207693_10052774 Ga0207693_100527742 228
829 3300025915 Ga0207693_10058480 Ga0207693_100584803 228
830 3300025916 Ga0207663_10000260 Ga0207663_1000026020 228
831 3300025916 Ga0207663_10011583 Ga0207663_100115837 228
832 3300025916 Ga0207663_10025039 Ga0207663_100250393 228
833 3300025917 Ga0207660_10044182 Ga0207660_100441824 228
834 3300025920 Ga0207649_10091495 Ga0207649_100914952 228
835 3300025920 Ga0207649_10143695 Ga0207649_101436952 228
836 3300025920 Ga0207649_10226894 Ga0207649_102268942 228
837 3300025921 Ga0207652_10010155 Ga0207652_100101554 228
838 3300025921 Ga0207652_10030351 Ga0207652_100303515 228
839 3300025921 Ga0207652_10158032 Ga0207652_101580322 228
840 3300025921 Ga0207652_10213939 Ga0207652_102139391 228
841 3300025921 Ga0207652_10705412 Ga0207652_107054121 228
842 3300025922 Ga0207646_10114471 Ga0207646_101144712 228
843 3300025924 Ga0207694_10195256 Ga0207694_101952561 228
844 3300025924 Ga0207694_10264540 Ga0207694_102645402 228
845 3300025924 Ga0207694_10318398 Ga0207694_103183981 228
846 3300025924 Ga0207694_10575585 Ga0207694_105755851 228
847 3300025924 Ga0207694_10669458 Ga0207694_106694581 228
848 3300025926 Ga0207659_10806764 Ga0207659_108067641 228
849 3300025927 Ga0207687_10055668 Ga0207687_100556682 228
850 3300025928 Ga0207700_10014409 Ga0207700_100144095 228
851 3300025928 Ga0207700_10039984 Ga0207700_100399844 228
852 3300025928 Ga0207700_10078951 Ga0207700_100789511 228
853 3300025928 Ga0207700_10359152 Ga0207700_103591521 228
854 3300025929 Ga0207664_10031361 Ga0207664_100313614 228
855 3300025929 Ga0207664_10084151 Ga0207664_100841511 228
856 3300025929 Ga0207664_10210351 Ga0207664_102103512 228
857 3300025931 Ga0207644_10230269 Ga0207644_102302692 228
858 3300025931 Ga0207644_10239558 Ga0207644_102395581 228
859 3300025932 Ga0207690_10039503 Ga0207690_100395033 228
860 3300025933 Ga0207706_10155026 Ga0207706_101550261 228
861 3300025933 Ga0207706_10251996 Ga0207706_102519962 228
862 3300025935 Ga0207709_10503738 Ga0207709_105037381 228
863 3300025936 Ga0207670_10115185 Ga0207670_101151852 228
864 3300025937 Ga0207669_10341136 Ga0207669_103411361 228
865 3300025938 Ga0207704_10046071 Ga0207704_100460711 228
866 3300025938 Ga0207704_10102716 Ga0207704_101027162 228
867 3300025939 Ga0207665_10004492 Ga0207665_100044923 228
868 3300025939 Ga0207665_10165074 Ga0207665_101650742 228
869 3300025941 Ga0207711_10013103 Ga0207711_100131033 228
870 3300025942 Ga0207689_10190132 Ga0207689_101901322 228
871 3300025942 Ga0207689_10351771 Ga0207689_103517711 228
872 3300025942 Ga0207689_10478789 Ga0207689_104787892 228
873 3300025944 Ga0207661_10002241 Ga0207661_100022412 228
874 3300025944 Ga0207661_10054697 Ga0207661_100546972 228
875 3300025944 Ga0207661_10392113 Ga0207661_103921131 228
876 3300025945 Ga0207679_10119105 Ga0207679_101191051 228
877 3300025949 Ga0207667_10015657 Ga0207667_100156578 228
878 3300025949 Ga0207667_10366731 Ga0207667_103667312 228
879 3300025949 Ga0207667_11051790 Ga0207667_110517901 228
880 3300025960 Ga0207651_10111219 Ga0207651_101112192 228
881 3300025972 Ga0207668_10024883 Ga0207668_100248833 228
882 3300025981 Ga0207640_10149826 Ga0207640_101498261 228
883 3300025986 Ga0207658_10570528 Ga0207658_105705281 228
884 3300025986 Ga0207658_10741236 Ga0207658_107412361 228
885 3300026023 Ga0207677_10122481 Ga0207677_101224812 228
886 3300026041 Ga0207639_10055566 Ga0207639_100555663 228
887 3300026041 Ga0207639_10069736 Ga0207639_100697362 228
888 3300026041 Ga0207639_10080517 Ga0207639_100805172 228
889 3300026041 Ga0207639_10103311 Ga0207639_101033112 228
890 3300026041 Ga0207639_10420441 Ga0207639_104204411 228
891 3300026041 Ga0207639_10435925 Ga0207639_104359252 228
892 3300026067 Ga0207678_10063908 Ga0207678_100639082 228
893 3300026067 Ga0207678_10140057 Ga0207678_101400572 228
894 3300026067 Ga0207678_11035082 Ga0207678_110350821 228
895 3300026078 Ga0207702_10000101 Ga0207702_1000010182 228
896 3300026078 Ga0207702_10095262 Ga0207702_100952622 228
897 3300026078 Ga0207702_10115235 Ga0207702_101152351 228
898 3300026088 Ga0207641_10512678 Ga0207641_105126781 228
899 3300026116 Ga0207674_10014216 Ga0207674_100142162 228
900 3300026118 Ga0207675_100169851 Ga0207675_1001698512 228
901 3300026118 Ga0207675_100185016 Ga0207675_1001850162 228
902 3300026121 Ga0207683_10071845 Ga0207683_100718452 228
903 3300026121 Ga0207683_10083043 Ga0207683_100830432 228
904 3300026121 Ga0207683_10202810 Ga0207683_102028102 228
905 3300026121 Ga0207683_10270475 Ga0207683_102704752 228
906 3300026142 Ga0207698_11136849 Ga0207698_111368491 228
907 3300027296 Ga0209389_1000072 Ga0209389_100007299 228
908 3300027296 Ga0209389_1000187 Ga0209389_100018734 228
909 3300027357 Ga0209589_1002629 Ga0209589_100262931 228
910 3300027361 Ga0209489_100206 Ga0209489_10020698 228
911 3300027361 Ga0209489_101592 Ga0209489_10159235 228
912 3300027363 Ga0209700_100014 Ga0209700_10001435 228
913 3300027866 Ga0209813_10021561 Ga0209813_100215612 228
914 3300028379 Ga0268266_10004998 Ga0268266_1000499813 228
915 3300028379 Ga0268266_10013041 Ga0268266_100130416 228
916 3300028379 Ga0268266_10181049 Ga0268266_101810492 228
917 3300028379 Ga0268266_10474762 Ga0268266_104747623 228
918 3300028380 Ga0268265_10426585 Ga0268265_104265851 228
919 3300028381 Ga0268264_10000187 Ga0268264_1000018716 228
920 3300028381 Ga0268264_10299924 Ga0268264_102999241 228
921 3300028558 Ga0265326_10005386 Ga0265326_100053863 228
922 3300028563 Ga0265319_1032588 Ga0265319_10325882 228
923 3300028573 Ga0265334_10000741 Ga0265334_100007418 228
924 3300028577 Ga0265318_10016165 Ga0265318_100161651 228
925 3300028653 Ga0265323_10001701 Ga0265323_100017018 228
926 3300028654 Ga0265322_10011637 Ga0265322_100116372 228
927 3300028666 Ga0265336_10001237 Ga0265336_1000123710 228
928 3300028786 Ga0307517_10000066 Ga0307517_1000006663 228
929 3300028794 Ga0307515_10062791 Ga0307515_100627913 228
930 3300028800 Ga0265338_10000973 Ga0265338_1000097310 228
931 3300029957 Ga0265324_10003799 Ga0265324_100037992 228
932 3300031235 Ga0265330_10012740 Ga0265330_100127403 228
933 3300031235 Ga0265330_10019458 Ga0265330_100194583 228
934 3300031235 Ga0265330_10024564 Ga0265330_100245642 228
935 3300031241 Ga0265325_10012522 Ga0265325_100125222 228
936 3300031247 Ga0265340_10002830 Ga0265340_100028307 228
937 3300031249 Ga0265339_10005543 Ga0265339_100055438 228
938 3300031249 Ga0265339_10007566 Ga0265339_100075662 228
939 3300031249 Ga0265339_10074780 Ga0265339_100747802 228
940 3300031344 Ga0265316_10083560 Ga0265316_100835601 228
941 3300031456 Ga0307513_10108299 Ga0307513_101082993 228
942 3300031507 Ga0307509_10084953 Ga0307509_100849532 228
943 3300031548 Ga0307408_100329450 Ga0307408_1003294502 228
944 3300031616 Ga0307508_10032542 Ga0307508_100325423 228
945 3300031711 Ga0265314_10003805 Ga0265314_1000380510 228
946 3300031711 Ga0265314_10193145 Ga0265314_101931451 228
947 3300031730 Ga0307516_10097402 Ga0307516_100974022 228
948 3300031730 Ga0307516_10205184 Ga0307516_102051841 228
949 3300031730 Ga0307516_10344675 Ga0307516_103446752 228
950 3300031824 Ga0307413_10378884 Ga0307413_103788841 228
951 3300031911 Ga0307412_10375802 Ga0307412_103758022 228
952 3300031911 Ga0307412_10637129 Ga0307412_106371291 228
953 3300032002 Ga0307416_100063629 Ga0307416_1000636292 228
954 3300032002 Ga0307416_100108637 Ga0307416_1001086373 228
955 3300032002 Ga0307416_100312914 Ga0307416_1003129142 228
956 3300032005 Ga0307411_10280466 Ga0307411_102804661 228
957 3300032126 Ga0307415_100072687 Ga0307415_1000726872 228
958 3300033180 Ga0307510_10028628 Ga0307510_100286283 228
959 3300033180 Ga0307510_10061999 Ga0307510_100619993 228
960 3300033180 Ga0307510_10072661 Ga0307510_100726615 228
961 3300033180 Ga0307510_10125969 Ga0307510_101259692 228
962 3300033544 Ga0316215_1001804 Ga0316215_10018042 228
963 3300035083 Ga0373926_0140185 Ga0373926_0140185_65_757 228
964 3300035086 Ga0373934_0002341 Ga0373934_0002341_4642_5442 228
965 3300035111 Ga0373923_0005063 Ga0373923_0005063_64_867 228
966 3300035112 Ga0373932_0036142 Ga0373932_0036142_512_1204 228
967 3300035113 Ga0373936_0041581 Ga0373936_0041581_1016_1708 228
968 3300035113 Ga0373936_0075587 Ga0373936_0075587_317_1009 228
969 3300035116 Ga0373945_0023026 Ga0373945_0023026_136_828 228
970 3300035117 Ga0373953_0030658 Ga0373953_0030658_300_1100 228
971 3300035117 Ga0373953_0060834 Ga0373953_0060834_674_1366 228
972 3300035117 Ga0373953_0112051 Ga0373953_0112051_298_996 228
973 3300035118 Ga0373954_0000182 Ga0373954_0000182_14368_15168 228
974 3300035118 Ga0373954_0053063 Ga0373954_0053063_374_1072 228
975 3300035119 Ga0373956_0001338 Ga0373956_0001338_1165_1965 228
976 3300035119 Ga0373956_0091708 Ga0373956_0091708_674_1372 228
977 3300035120 Ga0373957_0002101 Ga0373957_0002101_1142_1942 228
978 3300035170 Ga0373943_0013966 Ga0373943_0013966_143_892 228
979 3300035171 Ga0373946_0002873 Ga0373946_0002873_3681_4373 228
980 3300035172 Ga0373955_0000471 Ga0373955_0000471_7917_8717 228
981 3300035172 Ga0373955_0066380 Ga0373955_0066380_1108_1806 228
982 3300035172 Ga0373955_0319684 Ga0373955_0319684_98_790 228
983 3300035410 Ga0373924_0013602 Ga0373924_0013602_1090_1890 228
984 3300035691 Ga0373931_0008813 Ga0373931_0008813_1790_2485 228
985 3300035692 Ga0373935_0000128 Ga0373935_0000128_10233_10925 228
986 3300035692 Ga0373935_0196813 Ga0373935_0196813_41_736 228
987 3300035695 Ga0373927_0000496 Ga0373927_0000496_17370_18062 228
988 3300035695 Ga0373927_0019629 Ga0373927_0019629_3601_4350 228
989 3300035695 Ga0373927_0088429 Ga0373927_0088429_353_1105 228
990 3300035695 Ga0373927_0114199 Ga0373927_0114199_722_1411 228
991 3300035695 Ga0373927_0338939 Ga0373927_0338939_84_779 228
992 3300035724 Ga0373933_0000163 Ga0373933_0000163_37232_37960 228
993 3300035724 Ga0373933_0002736 Ga0373933_0002736_1170_1970 228
994 3300035724 Ga0373933_0281527 Ga0373933_0281527_154_846 228
995 3300035725 Ga0373947_0001955 Ga0373947_0001955_6550_7242 228
996 3300035725 Ga0373947_0435328 Ga0373947_0435328_171_866 228
997 3300036401 Ga0373937_0030048 Ga0373937_0030048_1171_1971 228
998 3300036401 Ga0373937_0036173 Ga0373937_0036173_2988_3680 228
999 3300036401 Ga0373937_0064006 Ga0373937_0064006_1469_2167 228
1000 3300037068 Ga0373925_0006551 Ga0373925_0006551_1553_2245 228
1001 3300037068 Ga0373925_0044113 Ga0373925_0044113_1984_2733 228
1002 3300037068 Ga0373925_0112246 Ga0373925_0112246_63_758 228
1003 3300037068 Ga0373925_0146209 Ga0373925_0146209_1137_1832 228
1004 3300037418 Ga0395900_0097162 Ga0395900_0097162_2221_2910 228
1005 3300037418 Ga0395900_0195574 Ga0395900_0195574_618_1310 228
1006 3300037418 Ga0395900_0467657 Ga0395900_0467657_503_1198 228
1007 3300037418 Ga0395900_0779808 Ga0395900_0779808_148_837 228
1008 3300037466 Ga0395898_0019490 Ga0395898_0019490_2142_2834 228
1009 3300037466 Ga0395898_0162711 Ga0395898_0162711_15_707 228
1010 3300037466 Ga0395898_0360651 Ga0395898_0360651_262_957 228
1011 3300037466 Ga0395898_0483860 Ga0395898_0483860_404_1120 228
1012 3300037471 Ga0395905_0014568 Ga0395905_0014568_3510_4199 228
1013 3300037471 Ga0395905_0049145 Ga0395905_0049145_1656_2351 228
1014 3300037471 Ga0395905_0104291 Ga0395905_0104291_1870_2565 228
1015 3300037471 Ga0395905_0554032 Ga0395905_0554032_303_992 228
1016 3300038443 Ga0395901_0016488 Ga0395901_0016488_6246_6953 228
1017 3300038443 Ga0395901_0070062 Ga0395901_0070062_1520_2212 228
1018 3300038443 Ga0395901_0175233 Ga0395901_0175233_809_1501 228
1019 3300038443 Ga0395901_0209102 Ga0395901_0209102_607_1296 228
1020 3300038443 Ga0395901_0445590 Ga0395901_0445590_235_930 228
1021 3300039437 Ga0436365_0015658 Ga0436365_0015658_47_739 228
1022 3300039437 Ga0436365_0076767 Ga0436365_0076767_1439_2137 228
1023 3300039437 Ga0436365_0351010 Ga0436365_0351010_352_1044 228
1024 3300039437 Ga0436365_0655011 Ga0436365_0655011_1499_2191 228
1025 3300039437 Ga0436365_1220227 Ga0436365_1220227_92_778 228
1026 3300039437 Ga0436365_1347888 Ga0436365_1347888_47_763 228
1027 3300039437 Ga0436365_1860217 Ga0436365_1860217_953_1645 228
1028 3300039438 Ga0436360_0415296 Ga0436360_0415296_776_1486 228
1029 3300039438 Ga0436360_0545862 Ga0436360_0545862_23_724 228
1030 3300039438 Ga0436360_1315230 Ga0436360_1315230_87_782 228
1031 3300039447 Ga0436361_0093159 Ga0436361_0093159_62_778 228
1032 3300039447 Ga0436361_0202497 Ga0436361_0202497_46_738 228
1033 3300039447 Ga0436361_0267897 Ga0436361_0267897_163_888 228
1034 3300039450 Ga0436363_0960712 Ga0436363_0960712_70_765 228
1035 3300039450 Ga0436363_1716088 Ga0436363_1716088_677_1372 228
1036 3300041452 Ga0451793_0299829 Ga0451793_0299829_48_758 228
1037 3300041453 Ga0451797_0981027 Ga0451797_0981027_336_1028 228
1038 3300041507 Ga0451851_0940412 Ga0451851_0940412_77_769 228
1039 3300044656 Ga0466969_0251498 Ga0466969_0251498_32_748 228
1040 3300044658 Ga0466972_0000048 Ga0466972_0000048_114146_114841 228
1041 3300044658 Ga0466972_0060310 Ga0466972_0060310_735_1430 228
1042 3300044658 Ga0466972_0144481 Ga0466972_0144481_226_915 228
1043 3300044684 Ga0466966_0001085 Ga0466966_0001085_8410_9117 228
1044 3300044684 Ga0466966_0046527 Ga0466966_0046527_650_1360 228
1045 3300044693 Ga0466961_0000010 Ga0466961_0000010_27351_28058 228
1046 3300044693 Ga0466961_0214683 Ga0466961_0214683_373_1131 228
1047 3300044706 Ga0466964_0055814 Ga0466964_0055814_165_857 228
1048 3300044706 Ga0466964_0067339 Ga0466964_0067339_361_1050 228
1049 3300044706 Ga0466964_0256914 Ga0466964_0256914_72_764 228
1050 3300044735 Ga0466968_0043032 Ga0466968_0043032_72_797 228
1051 3300044735 Ga0466968_0061978 Ga0466968_0061978_90_782 228
1052 3300044735 Ga0466968_0284016 Ga0466968_0284016_18_731 228
1053 3300044765 Ga0466970_0084965 Ga0466970_0084965_827_1522 228
1054 3300044842 Ga0466957_0263094 Ga0466957_0263094_53_742 228
1055 3300044901 Ga0466960_0067537 Ga0466960_0067537_192_881 228
1056 3300045049 Ga0466959_0002483 Ga0466959_0002483_4389_5096 228
1057 3300045049 Ga0466959_0051087 Ga0466959_0051087_1199_1894 228
1058 3300045836 Ga0466958_0350086 Ga0466958_0350086_72_776 228
1059 3300045976 Ga0466967_0124732 Ga0466967_0124732_321_1013 228
1060 3300046452 Ga0495617_041126 Ga0495617_041126_525_1217 228
1061 3300046454 Ga0495592_0002891 Ga0495592_0002891_119_919 228
1062 3300046454 Ga0495592_0070573 Ga0495592_0070573_1799_2497 228
1063 3300046454 Ga0495592_0310801 Ga0495592_0310801_67_759 228
1064 3300046455 Ga0495603_0000104 Ga0495603_0000104_28185_28877 228
1065 3300046455 Ga0495603_0007956 Ga0495603_0007956_3173_3868 228
1066 3300046455 Ga0495603_0009775 Ga0495603_0009775_1463_2212 228
1067 3300046455 Ga0495603_0091982 Ga0495603_0091982_1006_1698 228
1068 3300046455 Ga0495603_0209209 Ga0495603_0209209_399_1091 228
1069 3300046455 Ga0495603_0225994 Ga0495603_0225994_42_737 228
1070 3300046457 Ga0495590_0086807 Ga0495590_0086807_304_996 228
1071 3300046459 Ga0495629_0005026 Ga0495629_0005026_7943_8743 228
1072 3300046459 Ga0495629_0008475 Ga0495629_0008475_6737_7429 228
1073 3300046459 Ga0495629_0034540 Ga0495629_0034540_792_1484 228
1074 3300046459 Ga0495629_0051748 Ga0495629_0051748_2164_2850 228
1075 3300046460 Ga0495638_0037701 Ga0495638_0037701_1143_1832 228
1076 3300046460 Ga0495638_0047273 Ga0495638_0047273_924_1616 228
1077 3300046460 Ga0495638_0077571 Ga0495638_0077571_886_1593 228
1078 3300046460 Ga0495638_0190889 Ga0495638_0190889_218_925 228
1079 3300046461 Ga0495641_0000402 Ga0495641_0000402_24719_25411 228
1080 3300046462 Ga0495651_0005264 Ga0495651_0005264_7892_8692 228
1081 3300046462 Ga0495651_0007958 Ga0495651_0007958_622_1314 228
1082 3300046463 Ga0495653_0023995 Ga0495653_0023995_1170_1970 228
1083 3300046463 Ga0495653_0058017 Ga0495653_0058017_896_1594 228
1084 3300046463 Ga0495653_0066480 Ga0495653_0066480_1095_1787 228
1085 3300046472 Ga0495580_0003617 Ga0495580_0003617_12256_12948 228
1086 3300046473 Ga0495582_0000063 Ga0495582_0000063_27595_28287 228
1087 3300046473 Ga0495582_0105122 Ga0495582_0105122_466_1158 228
1088 3300046474 Ga0495605_0062183 Ga0495605_0062183_565_1257 228
1089 3300046475 Ga0495639_0000485 Ga0495639_0000485_16456_17148 228
1090 3300046476 Ga0495662_0000297 Ga0495662_0000297_154_846 228
1091 3300046476 Ga0495662_0098574 Ga0495662_0098574_393_1085 228
1092 3300046477 Ga0495664_0006814 Ga0495664_0006814_2719_3411 228
1093 3300046477 Ga0495664_0026353 Ga0495664_0026353_2613_3305 228
1094 3300046477 Ga0495664_0146980 Ga0495664_0146980_636_1334 228
1095 3300046491 Ga0495584_0271099 Ga0495584_0271099_48_755 228
1096 3300046492 Ga0495585_0083823 Ga0495585_0083823_847_1536 228
1097 3300046492 Ga0495585_0181363 Ga0495585_0181363_197_886 228
1098 3300046499 Ga0495594_0001344 Ga0495594_0001344_159_851 228
1099 3300046500 Ga0495596_0167193 Ga0495596_0167193_40_747 228
1100 3300046501 Ga0495607_0172336 Ga0495607_0172336_310_1002 228
1101 3300046501 Ga0495607_0240665 Ga0495607_0240665_65_757 228
1102 3300046506 Ga0495583_0105995 Ga0495583_0105995_31_738 228
1103 3300046507 Ga0495606_0051481 Ga0495606_0051481_1017_1703 228
1104 3300046511 Ga0495608_0002114 Ga0495608_0002114_12337_13137 228
1105 3300046511 Ga0495608_0164917 Ga0495608_0164917_70_762 228
1106 3300046511 Ga0495608_0173294 Ga0495608_0173294_20_718 228
1107 3300046512 Ga0495610_0055902 Ga0495610_0055902_409_1116 228
1108 3300046512 Ga0495610_0100423 Ga0495610_0100423_338_1045 228
1109 3300046513 Ga0495616_0037634 Ga0495616_0037634_685_1392 228
1110 3300046514 Ga0495618_0158348 Ga0495618_0158348_119_919 228
1111 3300046515 Ga0495620_0183325 Ga0495620_0183325_81_770 228
1112 3300046516 Ga0495628_0047088 Ga0495628_0047088_2109_2807 228
1113 3300046516 Ga0495628_0073113 Ga0495628_0073113_822_1514 228
1114 3300046516 Ga0495628_0145841 Ga0495628_0145841_63_863 228
1115 3300046517 Ga0495630_0003717 Ga0495630_0003717_4090_4782 228
1116 3300046517 Ga0495630_0205296 Ga0495630_0205296_276_974 228
1117 3300046518 Ga0495631_0028024 Ga0495631_0028024_1338_2045 228
1118 3300046519 Ga0495632_0063341 Ga0495632_0063341_587_1279 228
1119 3300046519 Ga0495632_0165365 Ga0495632_0165365_235_927 228
1120 3300046523 Ga0495644_0015964 Ga0495644_0015964_2129_2818 228
1121 3300046524 Ga0495648_0001804 Ga0495648_0001804_7956_8654 228
1122 3300046524 Ga0495648_0008803 Ga0495648_0008803_2800_3504 228
1123 3300046524 Ga0495648_0159851 Ga0495648_0159851_403_1092 228
1124 3300046526 Ga0495666_0075370 Ga0495666_0075370_191_886 228
1125 3300046526 Ga0495666_0271840 Ga0495666_0271840_51_743 228
1126 3300046529 Ga0495652_0024316 Ga0495652_0024316_1139_1831 228
1127 3300046529 Ga0495652_0028805 Ga0495652_0028805_1170_1970 228
1128 3300046529 Ga0495652_0029863 Ga0495652_0029863_1307_1999 228
1129 3300046529 Ga0495652_0407245 Ga0495652_0407245_244_933 228
1130 3300046530 Ga0495654_0018680 Ga0495654_0018680_1187_1894 228
1131 3300046530 Ga0495654_0076756 Ga0495654_0076756_335_1030 228
1132 3300046531 Ga0495665_0000290 Ga0495665_0000290_7609_8301 228
1133 3300046531 Ga0495665_0301470 Ga0495665_0301470_106_801 228
1134 3300046533 Ga0495640_0005621 Ga0495640_0005621_9112_9804 228
1135 3300046533 Ga0495640_0072047 Ga0495640_0072047_1442_2128 228
1136 3300046533 Ga0495640_0156522 Ga0495640_0156522_521_1219 228
1137 3300046536 Ga0495587_0042093 Ga0495587_0042093_327_1025 228
1138 3300046536 Ga0495587_0054357 Ga0495587_0054357_276_968 228
1139 3300046537 Ga0495598_0141351 Ga0495598_0141351_76_774 228
1140 3300046538 Ga0495609_0039381 Ga0495609_0039381_364_1056 228
1141 3300046538 Ga0495609_0109199 Ga0495609_0109199_384_1073 228
1142 3300046542 Ga0495597_0192786 Ga0495597_0192786_43_735 228
1143 3300046543 Ga0495645_0003860 Ga0495645_0003860_2407_3099 228
1144 3300046543 Ga0495645_0004402 Ga0495645_0004402_103_801 228
1145 3300046543 Ga0495645_0052172 Ga0495645_0052172_724_1419 228
1146 3300046557 Ga0495622_0009243 Ga0495622_0009243_3735_4427 228
1147 3300046557 Ga0495622_0034772 Ga0495622_0034772_1403_2110 228
1148 3300046557 Ga0495622_0055664 Ga0495622_0055664_41_727 228
1149 3300046557 Ga0495622_0059155 Ga0495622_0059155_125_817 228
1150 3300046558 Ga0495633_0090573 Ga0495633_0090573_395_1087 228
1151 3300046559 Ga0495667_0010602 Ga0495667_0010602_1433_2125 228
1152 3300046559 Ga0495667_0054425 Ga0495667_0054425_663_1463 228
1153 3300046559 Ga0495667_0091515 Ga0495667_0091515_1236_1922 228
1154 3300046559 Ga0495667_0143095 Ga0495667_0143095_614_1306 228
1155 3300046615 Ga0495656_0017449 Ga0495656_0017449_1746_2450 228
1156 3300046615 Ga0495656_0028115 Ga0495656_0028115_1013_1705 228
1157 3300046615 Ga0495656_0091630 Ga0495656_0091630_237_929 228
1158 3300046616 Ga0495668_0066432 Ga0495668_0066432_466_1158 228
1159 3300046642 Ga0495634_0000645 Ga0495634_0000645_6485_7177 228
1160 3300046642 Ga0495634_0031674 Ga0495634_0031674_64_756 228
1161 3300046642 Ga0495634_0121018 Ga0495634_0121018_67_867 228
1162 3300046660 Ga0495625_0057521 Ga0495625_0057521_1109_1816 228
1163 3300046660 Ga0495625_0105740 Ga0495625_0105740_115_807 228
1164 3300046660 Ga0495625_0139230 Ga0495625_0139230_770_1462 228
1165 3300046660 Ga0495625_0149038 Ga0495625_0149038_460_1155 228
1166 3300046660 Ga0495625_0380806 Ga0495625_0380806_163_870 228
1167 3300046663 Ga0495635_0007816 Ga0495635_0007816_509_1201 228
1168 3300046663 Ga0495635_0018102 Ga0495635_0018102_2951_3751 228
1169 3300046663 Ga0495635_0049840 Ga0495635_0049840_1637_2335 228
1170 3300046663 Ga0495635_0055521 Ga0495635_0055521_1867_2553 228
1171 3300046663 Ga0495635_0073607 Ga0495635_0073607_966_1658 228
1172 3300046665 Ga0495661_0082848 Ga0495661_0082848_967_1674 228
1173 3300046665 Ga0495661_0145639 Ga0495661_0145639_454_1149 228
1174 3300046665 Ga0495661_0171218 Ga0495661_0171218_361_1053 228
1175 3300046665 Ga0495661_0236581 Ga0495661_0236581_171_869 228
1176 3300046674 Ga0495588_0001460 Ga0495588_0001460_9278_9970 228
1177 3300046674 Ga0495588_0005750 Ga0495588_0005750_4297_4989 228
1178 3300046675 Ga0495657_0005336 Ga0495657_0005336_6602_7294 228
1179 3300046675 Ga0495657_0046640 Ga0495657_0046640_1170_1970 228
1180 3300046675 Ga0495657_0055356 Ga0495657_0055356_50_736 228
1181 3300046678 Ga0495599_0002959 Ga0495599_0002959_7915_8715 228
1182 3300046678 Ga0495599_0026678 Ga0495599_0026678_911_1609 228
1183 3300046678 Ga0495599_0080747 Ga0495599_0080747_912_1604 228
1184 3300046678 Ga0495599_0187254 Ga0495599_0187254_452_1144 228
1185 3300046679 Ga0495623_0003813 Ga0495623_0003813_7971_8771 228
1186 3300046679 Ga0495623_0022363 Ga0495623_0022363_609_1301 228
1187 3300046679 Ga0495623_0022589 Ga0495623_0022589_1746_2444 228
1188 3300046680 Ga0495646_0003545 Ga0495646_0003545_12_812 228
1189 3300046680 Ga0495646_0132756 Ga0495646_0132756_113_805 228
1190 3300046680 Ga0495646_0193637 Ga0495646_0193637_202_888 228
1191 3300046681 Ga0495647_0003274 Ga0495647_0003274_770_1462 228
1192 3300046683 Ga0495658_0000702 Ga0495658_0000702_7911_8603 228
1193 3300046689 Ga0495613_0022713 Ga0495613_0022713_33_836 228
1194 3300046689 Ga0495613_0088265 Ga0495613_0088265_1473_2165 228
1195 3300046689 Ga0495613_0189412 Ga0495613_0189412_24_716 228
1196 3300046690 Ga0495624_0000224 Ga0495624_0000224_17041_17733 228
1197 3300046690 Ga0495624_0014848 Ga0495624_0014848_631_1317 228
1198 3300046690 Ga0495624_0296061 Ga0495624_0296061_230_925 228
1199 3300046691 Ga0495670_0041333 Ga0495670_0041333_1407_2114 228
1200 3300046691 Ga0495670_0255627 Ga0495670_0255627_214_906 228
1201 3300046692 Ga0495671_0018783 Ga0495671_0018783_2569_3276 228
1202 3300046692 Ga0495671_0073822 Ga0495671_0073822_204_896 228
1203 3300046694 Ga0495649_0077730 Ga0495649_0077730_815_1501 228
1204 3300046809 Ga0495600_0000221 Ga0495600_0000221_30200_31000 228
1205 3300046809 Ga0495600_0019491 Ga0495600_0019491_1203_1895 228
1206 3300046809 Ga0495600_0130831 Ga0495600_0130831_650_1348 228
1207 3300047315 Ga0495581_0000168 Ga0495581_0000168_17728_18420 228
1208 3300047315 Ga0495581_0050474 Ga0495581_0050474_1300_1989 228
1209 3300047315 Ga0495581_0062405 Ga0495581_0062405_556_1305 228
1210 3300047317 Ga0495604_0023528 Ga0495604_0023528_1164_1964 228
1211 3300047317 Ga0495604_0084649 Ga0495604_0084649_464_1162 228
1212 3300047317 Ga0495604_0085878 Ga0495604_0085878_1441_2127 228
1213 3300047318 Ga0495636_0059691 Ga0495636_0059691_759_1448 228
1214 3300047319 Ga0495674_0005032 Ga0495674_0005032_258_950 228
1215 3300047319 Ga0495674_0031903 Ga0495674_0031903_1011_1703 228
1216 3300047319 Ga0495674_0058385 Ga0495674_0058385_2572_3270 228
1217 3300047320 Ga0495672_0010686 Ga0495672_0010686_1327_2031 228
1218 3300047320 Ga0495672_0214739 Ga0495672_0214739_25_720 228
1219 3300047321 Ga0495676_0072807 Ga0495676_0072807_1331_2023 228
1220 3300047321 Ga0495676_0092084 Ga0495676_0092084_718_1410 228
1221 3300047321 Ga0495676_0194010 Ga0495676_0194010_75_782 228
1222 3300047321 Ga0495676_0321039 Ga0495676_0321039_76_762 228
1223 3300047322 Ga0495680_0026568 Ga0495680_0026568_431_1123 228
1224 3300047322 Ga0495680_0110044 Ga0495680_0110044_1088_1786 228
1225 3300047444 Ga0495675_0006791 Ga0495675_0006791_2715_3407 228
1226 3300047444 Ga0495675_0055835 Ga0495675_0055835_1170_1970 228
1227 3300047444 Ga0495675_0092770 Ga0495675_0092770_896_1594 228
1228 3300047447 Ga0495685_025882 Ga0495685_025882_1251_1943 228
1229 3300047471 Ga0495684_0002603 Ga0495684_0002603_11639_12439 228
1230 3300047471 Ga0495684_0012173 Ga0495684_0012173_3661_4353 228
1231 3300047472 Ga0495686_0012492 Ga0495686_0012492_5066_5773 228
1232 3300047472 Ga0495686_0237285 Ga0495686_0237285_88_783 228
1233 3300047673 Ga0495593_0000150 Ga0495593_0000150_26375_27067 228
1234 3300047673 Ga0495593_0004768 Ga0495593_0004768_1127_1927 228
1235 3300047673 Ga0495593_0028312 Ga0495593_0028312_825_1511 228
1236 3300048088 Ga0495602_0000907 Ga0495602_0000907_97_897 228
1237 3300048088 Ga0495602_0092951 Ga0495602_0092951_768_1460 228
1238 3300048088 Ga0495602_0151718 Ga0495602_0151718_947_1657 228
1239 3300048088 Ga0495602_0536971 Ga0495602_0536971_63_749 228
1240 3300048091 Ga0495626_0031034 Ga0495626_0031034_509_1216 228
1241 3300048091 Ga0495626_0109103 Ga0495626_0109103_223_915 228
1242 3300048903 Ga0496100_0014076 Ga0496100_0014076_958_1650 228
1243 3300048903 Ga0496100_0125684 Ga0496100_0125684_160_852 228
1244 3300048903 Ga0496100_0156532 Ga0496100_0156532_815_1510 228
1245 3300048903 Ga0496100_0384886 Ga0496100_0384886_225_920 228
1246 3300048904 Ga0496101_0072116 Ga0496101_0072116_1119_1811 228
1247 3300048904 Ga0496101_0231479 Ga0496101_0231479_75_767 228
1248 3300048904 Ga0496101_0236995 Ga0496101_0236995_75_767 228
1249 3300048904 Ga0496101_0649694 Ga0496101_0649694_90_782 228
1250 3300048905 Ga0496102_0073603 Ga0496102_0073603_1321_2013 228
1251 3300048906 Ga0496103_0021504 Ga0496103_0021504_2841_3533 228
1252 3300048907 Ga0496104_0016754 Ga0496104_0016754_127_813 228
1253 3300048907 Ga0496104_0057967 Ga0496104_0057967_415_1107 228
1254 3300048907 Ga0496104_0077641 Ga0496104_0077641_325_1020 228
1255 3300048907 Ga0496104_0093535 Ga0496104_0093535_638_1333 228
1256 3300048907 Ga0496104_0493710 Ga0496104_0493710_122_814 228
1257 3300048908 Ga0496105_0024066 Ga0496105_0024066_3564_4259 228
1258 3300048908 Ga0496105_0025636 Ga0496105_0025636_3090_3776 228
1259 3300048908 Ga0496105_0027172 Ga0496105_0027172_171_863 228
1260 3300048908 Ga0496105_0202195 Ga0496105_0202195_347_1039 228
1261 3300048908 Ga0496105_0597059 Ga0496105_0597059_62_754 228
1262 3300048909 Ga0496106_0024940 Ga0496106_0024940_786_1478 228
1263 3300048909 Ga0496106_0122950 Ga0496106_0122950_544_1239 228
1264 3300048910 Ga0496107_0041793 Ga0496107_0041793_144_836 228
1265 3300048910 Ga0496107_0306829 Ga0496107_0306829_452_1144 228
1266 3300048911 Ga0496108_0368317 Ga0496108_0368317_197_892 228
1267 3300048911 Ga0496108_0432984 Ga0496108_0432984_427_1122 228
1268 3300048911 Ga0496108_0948784 Ga0496108_0948784_18_710 228
1269 3300048912 Ga0496109_0197544 Ga0496109_0197544_17_730 228
1270 3300048912 Ga0496109_0255054 Ga0496109_0255054_63_755 228
1271 3300048912 Ga0496109_0457763 Ga0496109_0457763_218_931 228
1272 3300048913 Ga0496110_0016256 Ga0496110_0016256_1670_2362 228
1273 3300048913 Ga0496110_0040048 Ga0496110_0040048_1205_1903 228
1274 3300048913 Ga0496110_0063614 Ga0496110_0063614_1717_2409 228
1275 3300048914 Ga0496111_0096203 Ga0496111_0096203_305_1000 228
1276 3300048915 Ga0496112_0031931 Ga0496112_0031931_3789_4481 228
1277 3300048915 Ga0496112_0067561 Ga0496112_0067561_677_1372 228
1278 3300048915 Ga0496112_0119028 Ga0496112_0119028_518_1210 228
1279 3300048915 Ga0496112_0610228 Ga0496112_0610228_22_714 228
1280 3300048915 Ga0496112_0769457 Ga0496112_0769457_180_872 228
1281 3300048916 Ga0496113_0044578 Ga0496113_0044578_1343_2035 228
1282 3300048916 Ga0496113_0181629 Ga0496113_0181629_883_1575 228
1283 3300048916 Ga0496113_0233859 Ga0496113_0233859_528_1223 228
1284 3300048916 Ga0496113_0577817 Ga0496113_0577817_189_884 228
1285 3300048917 Ga0496114_0031140 Ga0496114_0031140_3261_3956 228
1286 3300048918 Ga0496115_0021727 Ga0496115_0021727_2819_3511 228
1287 3300048918 Ga0496115_0725312 Ga0496115_0725312_55_747 228
1288 3300048920 Ga0496117_0020433 Ga0496117_0020433_4237_4944 228
1289 3300048920 Ga0496117_0160941 Ga0496117_0160941_145_837 228
1290 3300048921 Ga0496118_0027923 Ga0496118_0027923_85_858 228
1291 3300048921 Ga0496118_0047715 Ga0496118_0047715_572_1279 228
1292 3300048921 Ga0496118_0326863 Ga0496118_0326863_119_814 228
1293 3300048923 Ga0496120_0035243 Ga0496120_0035243_1249_1938 228
1294 3300048923 Ga0496120_0048142 Ga0496120_0048142_1712_2398 228
1295 3300048923 Ga0496120_0075864 Ga0496120_0075864_944_1651 228
1296 3300048924 Ga0496121_0004660 Ga0496121_0004660_15380_16069 228
1297 3300048924 Ga0496121_0005529 Ga0496121_0005529_2540_3247 228
1298 3300048924 Ga0496121_0015400 Ga0496121_0015400_3090_3782 228
1299 3300048924 Ga0496121_0030471 Ga0496121_0030471_178_870 228
1300 3300048924 Ga0496121_0097514 Ga0496121_0097514_86_775 228
1301 3300048924 Ga0496121_0107950 Ga0496121_0107950_393_1082 228
1302 3300048924 Ga0496121_0116739 Ga0496121_0116739_187_960 228
1303 3300048924 Ga0496121_0133042 Ga0496121_0133042_87_779 228
1304 3300048924 Ga0496121_0357748 Ga0496121_0357748_151_852 228
1305 3300048925 Ga0496122_0188704 Ga0496122_0188704_52_759 228
1306 3300048925 Ga0496122_0202809 Ga0496122_0202809_374_1099 228
1307 3300048927 Ga0496124_0188405 Ga0496124_0188405_188_883 228
1308 3300048928 Ga0496125_0000595 Ga0496125_0000595_36179_36904 228
1309 3300048928 Ga0496125_0016728 Ga0496125_0016728_4770_5495 228
1310 3300048928 Ga0496125_0152222 Ga0496125_0152222_713_1420 228
1311 3300048928 Ga0496125_0153397 Ga0496125_0153397_116_805 228
1312 3300048928 Ga0496125_0157204 Ga0496125_0157204_763_1452 228
1313 3300048928 Ga0496125_0415336 Ga0496125_0415336_39_725 228
1314 3300048929 Ga0496126_0006769 Ga0496126_0006769_9023_9715 228
1315 3300048929 Ga0496126_0031874 Ga0496126_0031874_64_750 228
1316 3300048929 Ga0496126_0045972 Ga0496126_0045972_409_1104 228
1317 3300048929 Ga0496126_0075686 Ga0496126_0075686_204_896 228
1318 3300048929 Ga0496126_0117146 Ga0496126_0117146_98_793 228
1319 3300048929 Ga0496126_0147139 Ga0496126_0147139_131_859 228
1320 3300048929 Ga0496126_0203730 Ga0496126_0203730_70_765 228
1321 3300048929 Ga0496126_0205094 Ga0496126_0205094_89_814 228
1322 3300048929 Ga0496126_0214335 Ga0496126_0214335_607_1305 228
1323 3300048929 Ga0496126_0536482 Ga0496126_0536482_200_907 228
1324 3300048929 Ga0496126_0556622 Ga0496126_0556622_56_745 228
1325 3300048929 Ga0496126_0599010 Ga0496126_0599010_84_776 228
1326 3300048929 Ga0496126_0649802 Ga0496126_0649802_89_814 228
1327 3300049460 Ga0495682_0047761 Ga0495682_0047761_404_1090 228
1328 3300049568 Ga0501031_0006067 Ga0501031_0006067_2052_2765 228
1329 3300049569 Ga0501032_0099791 Ga0501032_0099791_501_1214 228
1330 3300049569 Ga0501032_0398695 Ga0501032_0398695_74_781 228
1331 3300049570 Ga0501033_0000291 Ga0501033_0000291_24904_25617 228
1332 3300049570 Ga0501033_0140680 Ga0501033_0140680_120_827 228
1333 3300049570 Ga0501033_0460506 Ga0501033_0460506_86_793 228
1334 3300049571 Ga0501034_0170155 Ga0501034_0170155_859_1572 228
1335 3300049571 Ga0501034_0195466 Ga0501034_0195466_1183_1899 228
1336 3300049572 Ga0501036_0253219 Ga0501036_0253219_292_999 228
1337 3300049572 Ga0501036_0344726 Ga0501036_0344726_387_1103 228
1338 3300049572 Ga0501036_0555778 Ga0501036_0555778_57_770 228
1339 3300049573 Ga0501037_0000723 Ga0501037_0000723_12356_13069 228
1340 3300049573 Ga0501037_0105678 Ga0501037_0105678_1242_1949 228
1341 3300049573 Ga0501037_0199944 Ga0501037_0199944_205_918 228
1342 3300049574 Ga0501038_0015059 Ga0501038_0015059_2318_3031 228
1343 3300049574 Ga0501038_0019298 Ga0501038_0019298_2652_3368 228
1344 3300049574 Ga0501038_0150539 Ga0501038_0150539_980_1693 228
1345 3300049574 Ga0501038_0160760 Ga0501038_0160760_698_1411 228
1346 3300049574 Ga0501038_0200100 Ga0501038_0200100_677_1384 228
1347 3300049575 Ga0501039_0036122 Ga0501039_0036122_2846_3559 228
1348 3300049575 Ga0501039_0083298 Ga0501039_0083298_1558_2274 228
1349 3300049575 Ga0501039_0313786 Ga0501039_0313786_13_726 228
1350 3300049576 Ga0501040_0021943 Ga0501040_0021943_1308_2021 228
1351 3300049577 Ga0501041_0076454 Ga0501041_0076454_1007_1720 228
1352 3300049578 Ga0501042_0094801 Ga0501042_0094801_1042_1755 228
1353 3300049579 Ga0501043_0014167 Ga0501043_0014167_2820_3533 228
1354 3300049579 Ga0501043_0055594 Ga0501043_0055594_2022_2738 228
1355 3300049580 Ga0501046_0010044 Ga0501046_0010044_654_1367 228
1356 3300049580 Ga0501046_0025914 Ga0501046_0025914_3585_4298 228
1357 3300049581 Ga0501047_0213160 Ga0501047_0213160_667_1383 228
1358 3300049581 Ga0501047_0271921 Ga0501047_0271921_623_1336 228
1359 3300049582 Ga0501048_0012237 Ga0501048_0012237_4366_5079 228
1360 3300049583 Ga0501067_0032603 Ga0501067_0032603_263_958 228
1361 3300049586 Ga0501070_0010826 Ga0501070_0010826_6039_6752 228
1362 3300049586 Ga0501070_0040320 Ga0501070_0040320_573_1268 228
1363 3300049587 Ga0501071_0097420 Ga0501071_0097420_38_745 228
1364 3300049588 Ga0501072_0070627 Ga0501072_0070627_981_1694 228
1365 3300049589 Ga0501073_0024045 Ga0501073_0024045_1635_2348 228
1366 3300049589 Ga0501073_0216293 Ga0501073_0216293_587_1300 228
1367 3300049590 Ga0501074_0002443 Ga0501074_0002443_2374_3087 228
1368 3300049590 Ga0501074_0415353 Ga0501074_0415353_114_824 228
1369 3300049592 Ga0501076_0065005 Ga0501076_0065005_1772_2485 228
1370 3300049656 Ga0501209_125077 Ga0501209_125077_47_739 228
1371 3300049741 Ga0501079_0114107 Ga0501079_0114107_1248_1961 228
1372 3300049742 Ga0501080_0114315 Ga0501080_0114315_754_1467 228
1373 3300049742 Ga0501080_0452877 Ga0501080_0452877_361_1056 228
1374 3300049744 Ga0501083_0015704 Ga0501083_0015704_3835_4548 228
1375 3300049822 Ga0501035_0000688 Ga0501035_0000688_23328_24041 228
1376 3300049822 Ga0501035_0273723 Ga0501035_0273723_312_1019 228
1377 3300049822 Ga0501035_0832803 Ga0501035_0832803_18_722 228
1378 3300049823 Ga0501044_0005432 Ga0501044_0005432_13202_13915 228
1379 3300049823 Ga0501044_0077476 Ga0501044_0077476_178_873 228
1380 3300049823 Ga0501044_0096923 Ga0501044_0096923_852_1565 228
1381 3300049823 Ga0501044_0523294 Ga0501044_0523294_132_839 228
1382 3300050490 nmdc:mga03n38_46423_c1 nmdc:mga03n38_46423_c1_351_1046 228
1383 3300050491 nmdc:mga00v17_19538_c1 nmdc:mga00v17_19538_c1_667_1356 228
1384 3300050492 nmdc:mga0yw44_156531_c1 nmdc:mga0yw44_156531_c1_533_1225 228
1385 3300050492 nmdc:mga0yw44_415317_c1 nmdc:mga0yw44_415317_c1_191_898 228
1386 3300050492 nmdc:mga0yw44_52465_c1 nmdc:mga0yw44_52465_c1_1738_2427 228
1387 3300050492 nmdc:mga0yw44_57242_c1 nmdc:mga0yw44_57242_c1_983_1672 228
1388 3300050493 nmdc:mga0k408_157251_c1 nmdc:mga0k408_157251_c1_12_716 228
1389 3300050493 nmdc:mga0k408_201879_c1 nmdc:mga0k408_201879_c1_441_1133 228
1390 3300050493 nmdc:mga0k408_300346_c1 nmdc:mga0k408_300346_c1_12_701 228
1391 3300050494 nmdc:mga06z11_179815_c1 nmdc:mga06z11_179815_c1_304_1008 228
1392 3300050494 nmdc:mga06z11_227038_c1 nmdc:mga06z11_227038_c1_20_721 228
1393 3300050494 nmdc:mga06z11_32421_c1 nmdc:mga06z11_32421_c1_655_1350 228
1394 3300050494 nmdc:mga06z11_40491_c1 nmdc:mga06z11_40491_c1_503_1192 228
1395 3300050494 nmdc:mga06z11_406160_c1 nmdc:mga06z11_406160_c1_47_742 228
1396 3300050494 nmdc:mga06z11_425849_c1 nmdc:mga06z11_425849_c1_48_740 228
1397 3300050495 nmdc:mga04h51_229103_c1 nmdc:mga04h51_229103_c1_24_716 228
1398 3300050496 nmdc:mga07m45_37097_c1 nmdc:mga07m45_37097_c1_734_1429 228
1399 3300050496 nmdc:mga07m45_43325_c1 nmdc:mga07m45_43325_c1_1788_2477 228
1400 3300050496 nmdc:mga07m45_48959_c1 nmdc:mga07m45_48959_c1_1591_2283 228
1401 3300050511 nmdc:mga08y16_1118007_c1 nmdc:mga08y16_1118007_c1_63_752 228
1402 3300050513 nmdc:mga0rr50_226356_c1 nmdc:mga0rr50_226356_c1_507_1199 228
1403 3300050516 nmdc:mga0sz30_47184_c1 nmdc:mga0sz30_47184_c1_147_836 228
1404 3300050516 nmdc:mga0sz30_68907_c1 nmdc:mga0sz30_68907_c1_581_1273 228
1405 3300050516 nmdc:mga0sz30_97850_c1 nmdc:mga0sz30_97850_c1_277_969 228
1406 3300050516 nmdc:mga0sz30_99987_c1 nmdc:mga0sz30_99987_c1_192_899 228
1407 3300053077 Ga0495601_0060163 Ga0495601_0060163_270_965 228
1408 3300053077 Ga0495601_0085026 Ga0495601_0085026_662_1462 228
1409 3300053078 Ga0495612_0054442 Ga0495612_0054442_414_1112 228
1410 3300053078 Ga0495612_0264197 Ga0495612_0264197_24_713 228
1411 3300053079 Ga0500610_0143787 Ga0500610_0143787_229_936 228
1412 3300053084 Ga0495595_0004969 Ga0495595_0004969_2552_3352 228
1413 3300053084 Ga0495595_0130591 Ga0495595_0130591_243_941 228
1414 3300053085 Ga0495619_0002350 Ga0495619_0002350_10477_11277 228
1415 3300053085 Ga0495619_0199729 Ga0495619_0199729_553_1245 228
1416 3300053085 Ga0495619_0229170 Ga0495619_0229170_35_727 228
1417 3300053087 Ga0500643_000079 Ga0500643_000079_36329_37024 228
1418 3300053087 Ga0500643_004939 Ga0500643_004939_5006_5713 228
1419 3300053093 Ga0500651_0123890 Ga0500651_0123890_321_1028 228
1420 3300053093 Ga0500651_0172550 Ga0500651_0172550_357_1064 228
1421 3300053094 Ga0500566_0016060 Ga0500566_0016060_3137_3844 228
1422 3300053094 Ga0500566_0018425 Ga0500566_0018425_3389_4081 228
1423 3300053095 Ga0500640_089708 Ga0500640_089708_506_1195 228
1424 3300053096 Ga0500641_0008056 Ga0500641_0008056_2578_3285 228
1425 3300053096 Ga0500641_0026859 Ga0500641_0026859_102_794 228
1426 3300053096 Ga0500641_0143640 Ga0500641_0143640_235_930 228
1427 3300053098 Ga0500650_0046741 Ga0500650_0046741_324_1031 228
1428 3300053102 Ga0500554_002420 Ga0500554_002420_1422_2117 228
1429 3300053102 Ga0500554_003584 Ga0500554_003584_2036_2728 228
1430 3300053103 Ga0500555_012696 Ga0500555_012696_1597_2289 228
1431 3300053104 Ga0500556_0000005 Ga0500556_0000005_570666_571373 228
1432 3300053104 Ga0500556_0133228 Ga0500556_0133228_70_759 228
1433 3300053105 Ga0500557_000034 Ga0500557_000034_609_1301 228
1434 3300053109 Ga0500569_127748 Ga0500569_127748_130_822 228
1435 3300053116 Ga0500592_030017 Ga0500592_030017_135_842 228
1436 3300053117 Ga0500593_106790 Ga0500593_106790_219_926 228
1437 3300053119 Ga0500595_009330 Ga0500595_009330_1228_1920 228
1438 3300053121 Ga0500607_028739 Ga0500607_028739_44_733 228
1439 3300053121 Ga0500607_033910 Ga0500607_033910_1102_1809 228
1440 3300053122 Ga0500608_000330 Ga0500608_000330_2001_2708 228
1441 3300053125 Ga0500618_008175 Ga0500618_008175_1213_1920 228
1442 3300053126 Ga0500621_122581 Ga0500621_122581_46_750 228
1443 3300053130 Ga0500642_0000167 Ga0500642_0000167_16047_16754 228
1444 3300053130 Ga0500642_0000400 Ga0500642_0000400_8688_9380 228
1445 3300053130 Ga0500642_0093157 Ga0500642_0093157_45_737 228
1446 3300053131 Ga0500652_001376 Ga0500652_001376_1878_2585 228
1447 3300053131 Ga0500652_044814 Ga0500652_044814_502_1197 228
1448 3300053133 Ga0500655_047898 Ga0500655_047898_134_823 228
1449 3300053134 Ga0500658_0065304 Ga0500658_0065304_112_819 228
1450 3300053134 Ga0500658_0111099 Ga0500658_0111099_362_1069 228
1451 3300053134 Ga0500658_0132176 Ga0500658_0132176_88_780 228
1452 3300053136 Ga0500559_0000696 Ga0500559_0000696_3543_4250 228
1453 3300053136 Ga0500559_0113361 Ga0500559_0113361_483_1169 228
1454 3300053138 Ga0500564_164985 Ga0500564_164985_183_890 228
1455 3300053138 Ga0500564_210732 Ga0500564_210732_16_705 228
1456 3300053139 Ga0500568_0006608 Ga0500568_0006608_442_1149 228
1457 3300053139 Ga0500568_0046396 Ga0500568_0046396_61_756 228
1458 3300053142 Ga0500577_0038419 Ga0500577_0038419_632_1339 228
1459 3300053147 Ga0500589_022024 Ga0500589_022024_1236_1931 228
1460 3300053148 Ga0500590_049762 Ga0500590_049762_266_952 228
1461 3300053148 Ga0500590_055939 Ga0500590_055939_153_842 228
1462 3300053150 Ga0500603_001436 Ga0500603_001436_4616_5311 228
1463 3300053151 Ga0500604_0007365 Ga0500604_0007365_703_1410 228
1464 3300053151 Ga0500604_0098414 Ga0500604_0098414_257_952 228
1465 3300053153 Ga0500616_0000035 Ga0500616_0000035_122954_123661 228
1466 3300053155 Ga0500620_019648 Ga0500620_019648_652_1341 228
1467 3300053156 Ga0500622_0008163 Ga0500622_0008163_4244_4951 228
1468 3300053157 Ga0500624_003405 Ga0500624_003405_16_723 228
1469 3300053158 Ga0500627_0005379 Ga0500627_0005379_1299_2006 228
1470 3300053160 Ga0500633_0047142 Ga0500633_0047142_583_1290 228
1471 3300053162 Ga0500638_146190 Ga0500638_146190_321_1010 228
1472 3300053177 Ga0500636_0000016 Ga0500636_0000016_115976_116665 228
1473 3300053177 Ga0500636_0003032 Ga0500636_0003032_4509_5216 228
1474 3300053177 Ga0500636_0102246 Ga0500636_0102246_415_1107 228
1475 3300053178 Ga0500637_0000172 Ga0500637_0000172_7599_8291 228
1476 3300053727 Ga0500611_049459 Ga0500611_049459_94_801 228
1477 3300053729 Ga0500625_004258 Ga0500625_004258_1783_2475 228
1478 3300053730 Ga0500645_022463 Ga0500645_022463_820_1509 228
1479 3300053731 Ga0500609_022540 Ga0500609_022540_152_844 228
1480 3300053732 Ga0500656_021830 Ga0500656_021830_86_784 228
1481 3300053736 Ga0500599_020197 Ga0500599_020197_233_922 228
1482 3300053737 Ga0500601_001828 Ga0500601_001828_676_1368 228
1483 3300053737 Ga0500601_002478 Ga0500601_002478_1167_1865 228
1484 3300054114 Ga0501084_0014750 Ga0501084_0014750_3237_3950 228
1485 3300055283 Ga0500661_001292 Ga0500661_001292_3621_4313 228
1486 3300055283 Ga0500661_012499 Ga0500661_012499_603_1298 228
1487 3300060353 Ga0501082_0038629 Ga0501082_0038629_1208_1921 228
1488 3300061719 Ga0466962_0033208 Ga0466962_0033208_883_1647 228
1489 3300061719 Ga0466962_0059302 Ga0466962_0059302_627_1322 228
1490 iso_pu_bacteria 2791355199 2793078499 228
1491 iso_pu_bacteria 8045864390 8045866195 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

50

227

0.87

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

47

215

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ef6-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase in the unliganded state 0.8565 10 223
7ef7-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase complex with xmp 0.8531 10 223
7ef6-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase in the unliganded state 0.8022 10 223
7ef7-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase complex with xmp 0.7991 10 223
3onn-assembly1.cif.gz_A crystal structure of 5'-nucleotidase sdt1 from saccharomyces cerevisiae 0.7885 1 227
ID Description Score Start End Superfamily
3opxA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9636 27 83 1.10.150.450
af_K7KDK8_16_102_3.30.70.1620 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8805 15 92 3.30.70.1620
af_Q4E4C3_1_85_1.10.150.450 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.858 16 85 1.10.150.450
af_Q5AK98_45_279_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8319 12 221 3.40.50.1000
af_Q54B74_103_232_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8243 92 226 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A525I5T3-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9653 6 227
AF-A0A8B6M2T5-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9642 7 227
AF-A0A4R2GPF8-F1-model_v4 Putative hydrolase of the HAD superfamily 0.9635 3 227 GO:0016787
AF-A0A2D2CYZ6-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9632 7 227
AF-A0A1I4AEZ9-F1-model_v4 Putative hydrolase of the HAD superfamily 0.9629 6 227 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.32 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map