F494336
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1491 | 719 | 1269 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300035111|Ga0373923_0005063|Ga0373923_0005063_64_867 |
| Length | 267 |
| Sequence | MFVVAMRGEERQRALPLSYPPRRMGPGVRRDDGESTMKPRPRPFSHVDTWVFDLDNTLYPHHVNLWQQVDARIGEFVSAWLKVSAQQARVIQKDYYRRYGTTMRGMMTEHGVRADDYLAYVHQIDHSPLEPNPAMGAAIARLPGRKLILTNGSTDHADKVLQRLGIGVHFEAVFDIIAAELEPKPAPQTYRKFLRDHAVNPKTSAMFEDLARNLVVPHQLGMTTVLVVPDGSKEVVREDWELEGRDAAHVDHVTDDLTGFLERVATG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 15 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 16 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 17 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 18 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 19 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 27 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 30 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 31 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 32 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 33 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 34 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 35 | 2791355199 | |||
| 36 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 37 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 38 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 39 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 40 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 41 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 42 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 43 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 44 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 45 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 46 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 47 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 48 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 49 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 50 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 51 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 52 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 53 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 54 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 55 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 56 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 57 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 58 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 59 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 60 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 61 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 62 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 63 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 64 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 65 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 66 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 67 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 68 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 69 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 70 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 71 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 72 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 73 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 74 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 75 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 76 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 77 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 78 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 79 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 80 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 81 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 82 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 83 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 84 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 85 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 86 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 87 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 88 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 89 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 90 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 91 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 92 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 93 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 94 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 95 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 96 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 97 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 98 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 99 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 100 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 101 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 102 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 103 | 2904699407 | |||
| 104 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 105 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 106 | 2906610324 | |||
| 107 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 108 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 109 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 110 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 111 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 112 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 113 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 114 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 115 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 116 | 2922368715 | |||
| 117 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 118 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 119 | 2922425934 | |||
| 120 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 121 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 122 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 123 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 124 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 125 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 126 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 127 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 128 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 129 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 130 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 131 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 132 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 133 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 134 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 135 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 136 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 137 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 138 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 139 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 140 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 141 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 142 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 143 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 144 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 145 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 146 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 147 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 148 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 149 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 150 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 151 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 152 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 153 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 154 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 155 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 156 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 157 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 158 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 159 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 160 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 161 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 162 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 163 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 164 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 165 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 166 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 167 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 168 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 169 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 170 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 171 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 172 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 173 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 174 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 175 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 176 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 177 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 178 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 179 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 180 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 181 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 182 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 183 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 184 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 185 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 186 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 187 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 188 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 189 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 190 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 191 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 192 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 193 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 194 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 195 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 196 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 197 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 198 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 200 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 201 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 204 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 206 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 207 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 208 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 210 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 211 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 212 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 218 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 220 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 222 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 230 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 231 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 232 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 233 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 234 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 235 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 236 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 237 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 238 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 240 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 244 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 246 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 247 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 248 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 250 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 251 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 252 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 253 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 254 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 255 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 256 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 257 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 258 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 259 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 260 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 261 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 262 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 264 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 265 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 266 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 267 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 268 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 269 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 270 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 271 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 272 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 273 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 274 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 276 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 277 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 278 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 279 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 281 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 282 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 283 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 284 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 285 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 286 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 299 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 311 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 312 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 314 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 315 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 316 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 317 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 318 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 319 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 320 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 326 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 328 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 386 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 387 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 388 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 389 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 390 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 394 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 395 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 396 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 397 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 398 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 399 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 400 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 401 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 402 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 403 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 404 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 405 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 406 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 407 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 408 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 409 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 410 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 411 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 412 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 413 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 414 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 415 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 416 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 417 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 418 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 419 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 420 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 421 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 422 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 423 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 424 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 425 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 426 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 427 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 428 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 429 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 430 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 431 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 432 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 433 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 434 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 435 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 436 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 437 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 438 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 439 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 440 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 441 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 442 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 443 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 444 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 445 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 446 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 447 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 448 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 449 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 450 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 451 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 452 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 453 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 454 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 455 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 456 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 457 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 458 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 459 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 460 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 461 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 462 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 463 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 464 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 465 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 466 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 467 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 468 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 469 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 470 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 471 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 472 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 473 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 474 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 475 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 557 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 558 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 559 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 560 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 561 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 562 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 563 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 564 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 565 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 566 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 567 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 568 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 569 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 570 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 571 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 572 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 573 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 574 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 575 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 576 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 577 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 578 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 579 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 580 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 581 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 584 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 587 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 588 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 589 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 590 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 594 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 596 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 597 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 600 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 601 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 603 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 606 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 607 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 608 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 610 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 611 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 612 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 613 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 614 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 615 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 616 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 617 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 618 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 619 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 620 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 621 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 622 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 623 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 626 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 627 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 630 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 631 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 632 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 633 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 634 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 635 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 636 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 637 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 638 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 639 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 640 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 641 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 642 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 643 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 644 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 645 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 646 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 647 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 648 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 649 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 650 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 651 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 652 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 653 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 654 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 655 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 656 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 657 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 658 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 659 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 660 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 661 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 662 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 663 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 664 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 665 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 666 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 667 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 668 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 669 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 670 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 671 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 672 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 673 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 674 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 675 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 676 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 677 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 678 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 679 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 680 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 681 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 682 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 683 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 684 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 685 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 686 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 687 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 688 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 689 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 690 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 691 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 692 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 693 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 694 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 695 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 696 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 697 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 698 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 699 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 700 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 701 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 702 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 703 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 704 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 705 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 706 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 707 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 708 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 709 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 710 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 711 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 712 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 713 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 714 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 715 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 716 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 717 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 718 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 719 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.4 |
| Metatranscriptomes | 0 |
| Isolates | 14.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.88 |
| Nodule | 11.33 |
| Rhizoplane | 5.1 |
| Rhizosphere | 60.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C2869 | 2010549000 | Bacteria | 3128 |
| 2 | JGI24740J21852_10002716 | 3300001979 | Bacteria | 7926 |
| 3 | JGI24739J22299_10029161 | 3300001989 | Bacteria | 1921 |
| 4 | JGI24744J21845_10030724 | 3300002077 | Bacteria | 1029 |
| 5 | JGI25406J46586_10000160 | 3300003203 | Bacteria | 30150 |
| 6 | JGI25406J46586_10012370 | 3300003203 | Bacteria | 3707 |
| 7 | JGI25165J46597_1005725 | 3300003214 | Bacteria | 2332 |
| 8 | JGI25165J46597_1006062 | 3300003214 | Bacteria | 2200 |
| 9 | JGI25153J46596_10002632 | 3300003215 | Bacteria | 10264 |
| 10 | JGI25153J46596_10003367 | 3300003215 | Bacteria | 8974 |
| 11 | JGI25153J46596_10008346 | 3300003215 | Bacteria | 4967 |
| 12 | JGI25153J46596_10014306 | 3300003215 | Bacteria | 3305 |
| 13 | JGI25153J46596_10033551 | 3300003215 | Bacteria | 1693 |
| 14 | JGI25160J50197_1003359 | 3300003354 | Bacteria | 7178 |
| 15 | JGI25160J50197_1011680 | 3300003354 | Bacteria | 3093 |
| 16 | JGI25160J50197_1027994 | 3300003354 | Bacteria | 1522 |
| 17 | JGI25404J52841_10002450 | 3300003659 | Bacteria | 3514 |
| 18 | JGI25404J52841_10024669 | 3300003659 | Bacteria | 1295 |
| 19 | Ga0055531_10020755 | 3300003794 | Bacteria | 2582 |
| 20 | Ga0055543_1004220 | 3300004625 | Bacteria | 3974 |
| 21 | Ga0065165_1001384 | 3300005262 | Bacteria | 26615 |
| 22 | Ga0065165_1001884 | 3300005262 | Bacteria | 20242 |
| 23 | Ga0065165_1004470 | 3300005262 | Bacteria | 8633 |
| 24 | Ga0065165_1073148 | 3300005262 | Bacteria | 906 |
| 25 | Ga0070658_10610270 | 3300005327 | Bacteria | 946 |
| 26 | Ga0070683_100110142 | 3300005329 | Bacteria | 2597 |
| 27 | Ga0070683_100372464 | 3300005329 | Bacteria | 1360 |
| 28 | Ga0070690_100718201 | 3300005330 | Bacteria | 769 |
| 29 | Ga0070670_100288527 | 3300005331 | Bacteria | 1434 |
| 30 | Ga0068869_100065680 | 3300005334 | Bacteria | 2671 |
| 31 | Ga0068869_100102515 | 3300005334 | Bacteria | 2166 |
| 32 | Ga0070680_100062694 | 3300005336 | Bacteria | 3044 |
| 33 | Ga0070680_100089408 | 3300005336 | Bacteria | 2548 |
| 34 | Ga0070680_100160108 | 3300005336 | Bacteria | 1891 |
| 35 | Ga0070680_100446137 | 3300005336 | Bacteria | 1105 |
| 36 | Ga0068868_100029123 | 3300005338 | Bacteria | 4228 |
| 37 | Ga0068868_100033772 | 3300005338 | Bacteria | 3945 |
| 38 | Ga0070660_100218007 | 3300005339 | Bacteria | 1550 |
| 39 | Ga0070689_100228229 | 3300005340 | Bacteria | 1529 |
| 40 | Ga0070691_10051856 | 3300005341 | Bacteria | 1961 |
| 41 | Ga0070687_100482820 | 3300005343 | Bacteria | 831 |
| 42 | Ga0070661_100209431 | 3300005344 | Bacteria | 1492 |
| 43 | Ga0070668_100369657 | 3300005347 | Bacteria | 1218 |
| 44 | Ga0070669_100331257 | 3300005353 | Bacteria | 1231 |
| 45 | Ga0070669_100430164 | 3300005353 | Bacteria | 1085 |
| 46 | Ga0070675_100646897 | 3300005354 | Bacteria | 961 |
| 47 | Ga0070675_100756815 | 3300005354 | Bacteria | 887 |
| 48 | Ga0070671_100293165 | 3300005355 | Bacteria | 1385 |
| 49 | Ga0070688_100411113 | 3300005365 | Bacteria | 1004 |
| 50 | Ga0070659_100043739 | 3300005366 | Bacteria | 3504 |
| 51 | Ga0070659_100464942 | 3300005366 | Bacteria | 1075 |
| 52 | Ga0070709_10018844 | 3300005434 | Bacteria | 3982 |
| 53 | Ga0070709_10046949 | 3300005434 | Bacteria | 2688 |
| 54 | Ga0070714_100059128 | 3300005435 | Bacteria | 3285 |
| 55 | Ga0070714_100074644 | 3300005435 | Bacteria | 2940 |
| 56 | Ga0070714_100094459 | 3300005435 | Bacteria | 2624 |
| 57 | Ga0070714_100098717 | 3300005435 | Bacteria | 2569 |
| 58 | Ga0070714_100333722 | 3300005435 | Bacteria | 1420 |
| 59 | Ga0070713_100008592 | 3300005436 | Bacteria | 7252 |
| 60 | Ga0070713_100023569 | 3300005436 | Bacteria | 4779 |
| 61 | Ga0070713_100052194 | 3300005436 | Bacteria | 3384 |
| 62 | Ga0070713_100099028 | 3300005436 | Bacteria | 2522 |
| 63 | Ga0070713_100234675 | 3300005436 | Bacteria | 1669 |
| 64 | Ga0070713_100428302 | 3300005436 | Bacteria | 1240 |
| 65 | Ga0070713_100455772 | 3300005436 | Bacteria | 1202 |
| 66 | Ga0070710_10000883 | 3300005437 | Bacteria | 14344 |
| 67 | Ga0070710_10001420 | 3300005437 | Bacteria | 11294 |
| 68 | Ga0070711_100002983 | 3300005439 | Bacteria | 9773 |
| 69 | Ga0070711_100012546 | 3300005439 | Bacteria | 5296 |
| 70 | Ga0070711_100021714 | 3300005439 | Bacteria | 4153 |
| 71 | Ga0070711_100190470 | 3300005439 | Bacteria | 1576 |
| 72 | Ga0070705_100448181 | 3300005440 | Bacteria | 967 |
| 73 | Ga0070708_100057117 | 3300005445 | Bacteria | 3473 |
| 74 | Ga0070663_100007823 | 3300005455 | Bacteria | 6534 |
| 75 | Ga0070663_100097162 | 3300005455 | Bacteria | 2192 |
| 76 | Ga0070663_100097589 | 3300005455 | Bacteria | 2188 |
| 77 | Ga0070663_100194136 | 3300005455 | Bacteria | 1581 |
| 78 | Ga0070663_100203609 | 3300005455 | Bacteria | 1546 |
| 79 | Ga0070663_100428110 | 3300005455 | Bacteria | 1087 |
| 80 | Ga0070678_100061407 | 3300005456 | Bacteria | 2770 |
| 81 | Ga0070678_100105110 | 3300005456 | Bacteria | 2197 |
| 82 | Ga0070678_100145055 | 3300005456 | Bacteria | 1904 |
| 83 | Ga0070678_100185267 | 3300005456 | Bacteria | 1708 |
| 84 | Ga0070678_100260787 | 3300005456 | Bacteria | 1457 |
| 85 | Ga0070662_100426573 | 3300005457 | Bacteria | 1098 |
| 86 | Ga0070681_10075805 | 3300005458 | Bacteria | 3323 |
| 87 | Ga0070681_10151763 | 3300005458 | Bacteria | 2243 |
| 88 | Ga0070685_10218081 | 3300005466 | Bacteria | 1249 |
| 89 | Ga0070685_10260566 | 3300005466 | Bacteria | 1153 |
| 90 | Ga0070706_100527339 | 3300005467 | Bacteria | 1099 |
| 91 | Ga0070707_100227591 | 3300005468 | Bacteria | 1816 |
| 92 | Ga0070698_100096957 | 3300005471 | Bacteria | 2925 |
| 93 | Ga0070679_100044686 | 3300005530 | Bacteria | 4413 |
| 94 | Ga0070679_100124810 | 3300005530 | Bacteria | 2557 |
| 95 | Ga0070679_100179414 | 3300005530 | Bacteria | 2090 |
| 96 | Ga0070679_100450714 | 3300005530 | Bacteria | 1231 |
| 97 | Ga0070684_100016103 | 3300005535 | Bacteria | 6108 |
| 98 | Ga0070684_100414807 | 3300005535 | Bacteria | 1242 |
| 99 | Ga0070697_100025792 | 3300005536 | Bacteria | 4689 |
| 100 | Ga0068853_100062087 | 3300005539 | Bacteria | 3232 |
| 101 | Ga0068853_100167859 | 3300005539 | Bacteria | 1984 |
| 102 | Ga0068853_100201201 | 3300005539 | Bacteria | 1813 |
| 103 | Ga0068853_100264761 | 3300005539 | Bacteria | 1581 |
| 104 | Ga0068853_100402869 | 3300005539 | Bacteria | 1281 |
| 105 | Ga0068853_100521057 | 3300005539 | Bacteria | 1124 |
| 106 | Ga0070672_100066970 | 3300005543 | Bacteria | 2844 |
| 107 | Ga0070686_100079501 | 3300005544 | Bacteria | 2168 |
| 108 | Ga0070686_100519495 | 3300005544 | Bacteria | 927 |
| 109 | Ga0070693_100239942 | 3300005547 | Bacteria | 1197 |
| 110 | Ga0070665_100011529 | 3300005548 | Bacteria | 8937 |
| 111 | Ga0070665_100084179 | 3300005548 | Bacteria | 3185 |
| 112 | Ga0070665_100088233 | 3300005548 | Bacteria | 3107 |
| 113 | Ga0070665_100248788 | 3300005548 | Bacteria | 1778 |
| 114 | Ga0070665_100947156 | 3300005548 | Bacteria | 873 |
| 115 | Ga0070704_100671235 | 3300005549 | Bacteria | 917 |
| 116 | Ga0068855_100133882 | 3300005563 | Bacteria | 2829 |
| 117 | Ga0068855_100250765 | 3300005563 | Bacteria | 1975 |
| 118 | Ga0068855_100356423 | 3300005563 | Bacteria | 1610 |
| 119 | Ga0068855_101086963 | 3300005563 | Bacteria | 837 |
| 120 | Ga0070664_100728870 | 3300005564 | Bacteria | 925 |
| 121 | Ga0068857_100013608 | 3300005577 | Bacteria | 7088 |
| 122 | Ga0068857_100148651 | 3300005577 | Bacteria | 2121 |
| 123 | Ga0068854_100025810 | 3300005578 | Bacteria | 4032 |
| 124 | Ga0068854_100206980 | 3300005578 | Bacteria | 1545 |
| 125 | Ga0068856_100003436 | 3300005614 | Bacteria | 16012 |
| 126 | Ga0068856_100015417 | 3300005614 | Bacteria | 7385 |
| 127 | Ga0068856_100083490 | 3300005614 | Bacteria | 3172 |
| 128 | Ga0068856_100130496 | 3300005614 | Bacteria | 2518 |
| 129 | Ga0068856_100286324 | 3300005614 | Bacteria | 1665 |
| 130 | Ga0068856_100519611 | 3300005614 | Bacteria | 1212 |
| 131 | Ga0070702_100078903 | 3300005615 | Bacteria | 1966 |
| 132 | Ga0070702_100106533 | 3300005615 | Bacteria | 1729 |
| 133 | Ga0068852_100063044 | 3300005616 | Bacteria | 3226 |
| 134 | Ga0068852_100119103 | 3300005616 | Bacteria | 2413 |
| 135 | Ga0068852_100222030 | 3300005616 | Bacteria | 1797 |
| 136 | Ga0068852_100284971 | 3300005616 | Bacteria | 1594 |
| 137 | Ga0068852_100337155 | 3300005616 | Bacteria | 1469 |
| 138 | Ga0068852_100585806 | 3300005616 | Bacteria | 1119 |
| 139 | Ga0068852_100641653 | 3300005616 | Bacteria | 1069 |
| 140 | Ga0068852_100912234 | 3300005616 | Bacteria | 896 |
| 141 | Ga0068859_100264445 | 3300005617 | Bacteria | 1812 |
| 142 | Ga0068859_100296250 | 3300005617 | Bacteria | 1711 |
| 143 | Ga0068866_10006968 | 3300005718 | Bacteria | 4723 |
| 144 | Ga0068861_100022743 | 3300005719 | Bacteria | 4520 |
| 145 | Ga0068861_100310536 | 3300005719 | Bacteria | 1369 |
| 146 | Ga0068861_100639295 | 3300005719 | Bacteria | 981 |
| 147 | Ga0068851_10001765 | 3300005834 | Bacteria | 9451 |
| 148 | Ga0068851_10045623 | 3300005834 | Bacteria | 2216 |
| 149 | Ga0068863_100320009 | 3300005841 | Bacteria | 1507 |
| 150 | Ga0068863_100321174 | 3300005841 | Bacteria | 1504 |
| 151 | Ga0068858_100157399 | 3300005842 | Bacteria | 2138 |
| 152 | Ga0068860_100002621 | 3300005843 | Bacteria | 18698 |
| 153 | Ga0068860_100150946 | 3300005843 | Bacteria | 2237 |
| 154 | Ga0068860_100294214 | 3300005843 | Bacteria | 1589 |
| 155 | Ga0068860_100643834 | 3300005843 | Bacteria | 1067 |
| 156 | Ga0068862_100029193 | 3300005844 | Bacteria | 4646 |
| 157 | Ga0068862_100107881 | 3300005844 | Bacteria | 2441 |
| 158 | Ga0068862_100243422 | 3300005844 | Bacteria | 1636 |
| 159 | Ga0068862_100380929 | 3300005844 | Bacteria | 1316 |
| 160 | Ga0068862_100515955 | 3300005844 | Bacteria | 1136 |
| 161 | Ga0068862_100518016 | 3300005844 | Bacteria | 1134 |
| 162 | Ga0081455_10015989 | 3300005937 | Bacteria | 7260 |
| 163 | Ga0081455_10051879 | 3300005937 | Bacteria | 3516 |
| 164 | Ga0081538_10073012 | 3300005981 | Bacteria | 1878 |
| 165 | Ga0081540_1002275 | 3300005983 | Bacteria | 15781 |
| 166 | Ga0081540_1005026 | 3300005983 | Bacteria | 9930 |
| 167 | Ga0081540_1035395 | 3300005983 | Bacteria | 2678 |
| 168 | Ga0081540_1035915 | 3300005983 | Bacteria | 2651 |
| 169 | Ga0081540_1068934 | 3300005983 | Bacteria | 1646 |
| 170 | Ga0081540_1074604 | 3300005983 | Bacteria | 1553 |
| 171 | Ga0081540_1085672 | 3300005983 | Bacteria | 1402 |
| 172 | Ga0081540_1101551 | 3300005983 | Bacteria | 1238 |
| 173 | Ga0081540_1160499 | 3300005983 | Bacteria | 873 |
| 174 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 175 | Ga0081539_10001394 | 3300005985 | Bacteria | 41637 |
| 176 | Ga0081539_10032566 | 3300005985 | Bacteria | 3190 |
| 177 | Ga0081539_10097065 | 3300005985 | Bacteria | 1510 |
| 178 | Ga0070717_10015584 | 3300006028 | Bacteria | 5875 |
| 179 | Ga0070717_10069573 | 3300006028 | Bacteria | 2932 |
| 180 | Ga0070717_10115216 | 3300006028 | Bacteria | 2297 |
| 181 | Ga0070717_10335683 | 3300006028 | Bacteria | 1349 |
| 182 | Ga0070717_10534744 | 3300006028 | Bacteria | 1061 |
| 183 | Ga0070717_10899516 | 3300006028 | Bacteria | 806 |
| 184 | Ga0075365_10040867 | 3300006038 | Bacteria | 3026 |
| 185 | Ga0075365_10066849 | 3300006038 | Bacteria | 2412 |
| 186 | Ga0075365_10089169 | 3300006038 | Bacteria | 2099 |
| 187 | Ga0075365_10153495 | 3300006038 | Bacteria | 1602 |
| 188 | Ga0075368_10017885 | 3300006042 | Bacteria | 2657 |
| 189 | Ga0075363_100002368 | 3300006048 | Bacteria | 7676 |
| 190 | Ga0075363_100118266 | 3300006048 | Bacteria | 1478 |
| 191 | Ga0075364_10009615 | 3300006051 | Bacteria | 5808 |
| 192 | Ga0075364_10050022 | 3300006051 | Bacteria | 2727 |
| 193 | Ga0075364_10115983 | 3300006051 | Bacteria | 1790 |
| 194 | Ga0070715_10002422 | 3300006163 | Bacteria | 5725 |
| 195 | Ga0070715_10068744 | 3300006163 | Bacteria | 1576 |
| 196 | Ga0070716_100008434 | 3300006173 | Bacteria | 5112 |
| 197 | Ga0070716_100011641 | 3300006173 | Bacteria | 4434 |
| 198 | Ga0070712_100109785 | 3300006175 | Bacteria | 2056 |
| 199 | Ga0070712_100115201 | 3300006175 | Bacteria | 2014 |
| 200 | Ga0070712_100439293 | 3300006175 | Bacteria | 1085 |
| 201 | Ga0070712_100508440 | 3300006175 | Bacteria | 1011 |
| 202 | Ga0075362_10100366 | 3300006177 | Bacteria | 1353 |
| 203 | Ga0075367_10036634 | 3300006178 | Bacteria | 2846 |
| 204 | Ga0075367_10088344 | 3300006178 | Bacteria | 1883 |
| 205 | Ga0075367_10136730 | 3300006178 | Bacteria | 1516 |
| 206 | Ga0075367_10155520 | 3300006178 | Bacteria | 1420 |
| 207 | Ga0075367_10157486 | 3300006178 | Bacteria | 1411 |
| 208 | Ga0075367_10394042 | 3300006178 | Bacteria | 875 |
| 209 | Ga0075367_10421840 | 3300006178 | Bacteria | 845 |
| 210 | Ga0075369_10016556 | 3300006186 | Bacteria | 2977 |
| 211 | Ga0075369_10072521 | 3300006186 | Bacteria | 1517 |
| 212 | Ga0075366_10064541 | 3300006195 | Bacteria | 2177 |
| 213 | Ga0075366_10091686 | 3300006195 | Bacteria | 1820 |
| 214 | Ga0075366_10180427 | 3300006195 | Bacteria | 1282 |
| 215 | Ga0097621_100173174 | 3300006237 | Bacteria | 1861 |
| 216 | Ga0097621_100391615 | 3300006237 | Bacteria | 1243 |
| 217 | Ga0075370_10044155 | 3300006353 | Bacteria | 2519 |
| 218 | Ga0075370_10120877 | 3300006353 | Bacteria | 1525 |
| 219 | Ga0075370_10140886 | 3300006353 | Bacteria | 1409 |
| 220 | Ga0075370_10145316 | 3300006353 | Bacteria | 1388 |
| 221 | Ga0075370_10149905 | 3300006353 | Bacteria | 1367 |
| 222 | Ga0068871_100322507 | 3300006358 | Bacteria | 1361 |
| 223 | Ga0068871_100673872 | 3300006358 | Bacteria | 946 |
| 224 | Ga0075428_100042233 | 3300006844 | Bacteria | 5015 |
| 225 | Ga0068865_100153220 | 3300006881 | Bacteria | 1751 |
| 226 | Ga0097620_100264391 | 3300006931 | Bacteria | 1812 |
| 227 | Ga0097620_100296269 | 3300006931 | Bacteria | 1711 |
| 228 | Ga0099825_1023350 | 3300006941 | Bacteria | 3807 |
| 229 | Ga0099824_1026659 | 3300006942 | Bacteria | 2933 |
| 230 | Ga0099823_1035919 | 3300006944 | Bacteria | 3837 |
| 231 | Ga0075435_100230907 | 3300007076 | Bacteria | 1572 |
| 232 | Ga0075435_100293353 | 3300007076 | Bacteria | 1390 |
| 233 | Ga0099794_10047918 | 3300007265 | Bacteria | 2050 |
| 234 | Ga0099794_10274365 | 3300007265 | Bacteria | 871 |
| 235 | Ga0099795_10123152 | 3300007788 | Bacteria | 1039 |
| 236 | Ga0105244_10268314 | 3300009036 | Bacteria | 793 |
| 237 | Ga0105240_10007060 | 3300009093 | Bacteria | 16374 |
| 238 | Ga0105240_10018234 | 3300009093 | Bacteria | 9433 |
| 239 | Ga0105240_10142386 | 3300009093 | Bacteria | 2865 |
| 240 | Ga0111539_10206349 | 3300009094 | Bacteria | 2290 |
| 241 | Ga0105245_10271868 | 3300009098 | Bacteria | 1653 |
| 242 | Ga0105245_10872282 | 3300009098 | Bacteria | 941 |
| 243 | Ga0105247_10025431 | 3300009101 | Bacteria | 3571 |
| 244 | Ga0105247_10324635 | 3300009101 | Bacteria | 1075 |
| 245 | Ga0105243_10297379 | 3300009148 | Bacteria | 1461 |
| 246 | Ga0105243_10319149 | 3300009148 | Bacteria | 1415 |
| 247 | Ga0105241_10006700 | 3300009174 | Bacteria | 8475 |
| 248 | Ga0105241_10040543 | 3300009174 | Bacteria | 3516 |
| 249 | Ga0105241_10049268 | 3300009174 | Bacteria | 3207 |
| 250 | Ga0105248_11167893 | 3300009177 | Bacteria | 870 |
| 251 | Ga0105237_10021872 | 3300009545 | Bacteria | 6569 |
| 252 | Ga0105237_10056221 | 3300009545 | Bacteria | 3939 |
| 253 | Ga0105237_10101785 | 3300009545 | Bacteria | 2864 |
| 254 | Ga0105237_10112451 | 3300009545 | Bacteria | 2715 |
| 255 | Ga0105237_10199326 | 3300009545 | Bacteria | 2001 |
| 256 | Ga0105237_10243819 | 3300009545 | Bacteria | 1798 |
| 257 | Ga0105237_10264917 | 3300009545 | Bacteria | 1721 |
| 258 | Ga0105237_10764827 | 3300009545 | Bacteria | 973 |
| 259 | Ga0105238_10029421 | 3300009551 | Bacteria | 5596 |
| 260 | Ga0105238_10035069 | 3300009551 | Bacteria | 5103 |
| 261 | Ga0105238_10134629 | 3300009551 | Bacteria | 2449 |
| 262 | Ga0105238_10167493 | 3300009551 | Bacteria | 2173 |
| 263 | Ga0105238_10186917 | 3300009551 | Bacteria | 2048 |
| 264 | Ga0105238_10442750 | 3300009551 | Bacteria | 1296 |
| 265 | Ga0105238_10496026 | 3300009551 | Bacteria | 1221 |
| 266 | Ga0105238_10520535 | 3300009551 | Bacteria | 1192 |
| 267 | Ga0105249_10269244 | 3300009553 | Bacteria | 1696 |
| 268 | Ga0105249_10304805 | 3300009553 | Bacteria | 1599 |
| 269 | Ga0105249_10495183 | 3300009553 | Bacteria | 1267 |
| 270 | Ga0105239_10015859 | 3300010375 | Bacteria | 8340 |
| 271 | Ga0105239_10079643 | 3300010375 | Bacteria | 3605 |
| 272 | Ga0105239_10088065 | 3300010375 | Bacteria | 3423 |
| 273 | Ga0105239_10138557 | 3300010375 | Bacteria | 2710 |
| 274 | Ga0105239_10324060 | 3300010375 | Bacteria | 1738 |
| 275 | Ga0105239_10324425 | 3300010375 | Bacteria | 1737 |
| 276 | Ga0105239_10640378 | 3300010375 | Bacteria | 1214 |
| 277 | Ga0105246_10009694 | 3300011119 | Bacteria | 5936 |
| 278 | Ga0105246_10059677 | 3300011119 | Bacteria | 2647 |
| 279 | Ga0105246_10193182 | 3300011119 | Bacteria | 1577 |
| 280 | Ga0105246_10341679 | 3300011119 | Bacteria | 1224 |
| 281 | Ga0157373_10153054 | 3300013100 | Bacteria | 1622 |
| 282 | Ga0157371_10096483 | 3300013102 | Bacteria | 2095 |
| 283 | Ga0157371_10670233 | 3300013102 | Bacteria | 775 |
| 284 | Ga0157370_10062666 | 3300013104 | Bacteria | 3526 |
| 285 | Ga0157370_10091902 | 3300013104 | Bacteria | 2849 |
| 286 | Ga0157370_10248787 | 3300013104 | Bacteria | 1644 |
| 287 | Ga0157369_10005581 | 3300013105 | Bacteria | 14608 |
| 288 | Ga0157369_10019064 | 3300013105 | Bacteria | 7681 |
| 289 | Ga0157369_10740703 | 3300013105 | Bacteria | 1011 |
| 290 | Ga0157374_10165783 | 3300013296 | Bacteria | 2153 |
| 291 | Ga0157374_10273856 | 3300013296 | Bacteria | 1665 |
| 292 | Ga0157374_11048682 | 3300013296 | Bacteria | 835 |
| 293 | Ga0157378_10023907 | 3300013297 | Bacteria | 5375 |
| 294 | Ga0157378_10058109 | 3300013297 | Bacteria | 3449 |
| 295 | Ga0163162_10161492 | 3300013306 | Bacteria | 2362 |
| 296 | Ga0163162_10178412 | 3300013306 | Bacteria | 2250 |
| 297 | Ga0163162_10544771 | 3300013306 | Bacteria | 1289 |
| 298 | Ga0163162_10766710 | 3300013306 | Bacteria | 1083 |
| 299 | Ga0157372_10218370 | 3300013307 | Bacteria | 2210 |
| 300 | Ga0157372_10477917 | 3300013307 | Bacteria | 1453 |
| 301 | Ga0157372_10757252 | 3300013307 | Bacteria | 1129 |
| 302 | Ga0157372_11013806 | 3300013307 | Bacteria | 961 |
| 303 | Ga0157375_10408730 | 3300013308 | Bacteria | 1524 |
| 304 | Ga0163163_10027246 | 3300014325 | Bacteria | 5473 |
| 305 | Ga0163163_10073724 | 3300014325 | Bacteria | 3404 |
| 306 | Ga0163163_10180400 | 3300014325 | Bacteria | 2159 |
| 307 | Ga0163163_10323220 | 3300014325 | Bacteria | 1597 |
| 308 | Ga0163163_10411575 | 3300014325 | Bacteria | 1411 |
| 309 | Ga0163163_10620113 | 3300014325 | Bacteria | 1145 |
| 310 | Ga0157380_10197062 | 3300014326 | Bacteria | 1784 |
| 311 | Ga0157380_10716133 | 3300014326 | Bacteria | 1008 |
| 312 | Ga0157379_10269437 | 3300014968 | Bacteria | 1548 |
| 313 | Ga0157379_10743447 | 3300014968 | Bacteria | 923 |
| 314 | Ga0157376_10254582 | 3300014969 | Bacteria | 1642 |
| 315 | Ga0157376_10574867 | 3300014969 | Bacteria | 1118 |
| 316 | Ga0157376_10744436 | 3300014969 | Bacteria | 989 |
| 317 | Ga0163161_10084320 | 3300017792 | Bacteria | 2343 |
| 318 | Ga0163161_10223845 | 3300017792 | Bacteria | 1458 |
| 319 | Ga0163161_10777424 | 3300017792 | Bacteria | 803 |
| 320 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 321 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 322 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 323 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 324 | Ga0213874_10020651 | 3300021377 | Bacteria | 1808 |
| 325 | Ga0213876_10008797 | 3300021384 | Bacteria | 5453 |
| 326 | Ga0213876_10059454 | 3300021384 | Bacteria | 2017 |
| 327 | Ga0213876_10094182 | 3300021384 | Bacteria | 1587 |
| 328 | Ga0213876_10166085 | 3300021384 | Bacteria | 1174 |
| 329 | Ga0213876_10191050 | 3300021384 | Bacteria | 1089 |
| 330 | Ga0213871_10027153 | 3300021441 | Bacteria | 1468 |
| 331 | Ga0209677_101800 | 3300025253 | Bacteria | 8794 |
| 332 | Ga0209677_103149 | 3300025253 | Bacteria | 5594 |
| 333 | Ga0209148_1000688 | 3300025254 | Bacteria | 27894 |
| 334 | Ga0209233_1002001 | 3300025261 | Bacteria | 7715 |
| 335 | Ga0209233_1003079 | 3300025261 | Bacteria | 5937 |
| 336 | Ga0209233_1018527 | 3300025261 | Bacteria | 1871 |
| 337 | Ga0209455_1002533 | 3300025272 | Bacteria | 6991 |
| 338 | Ga0209130_1037253 | 3300025284 | Bacteria | 961 |
| 339 | Ga0209564_1000842 | 3300025295 | Bacteria | 41342 |
| 340 | Ga0209564_1004194 | 3300025295 | Bacteria | 8990 |
| 341 | Ga0209564_1011852 | 3300025295 | Bacteria | 3864 |
| 342 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 343 | Ga0209758_1000161 | 3300025297 | Bacteria | 154278 |
| 344 | Ga0209758_1001473 | 3300025297 | Bacteria | 27578 |
| 345 | Ga0209758_1005779 | 3300025297 | Bacteria | 9280 |
| 346 | Ga0209758_1006771 | 3300025297 | Bacteria | 8053 |
| 347 | Ga0209758_1010969 | 3300025297 | Bacteria | 5325 |
| 348 | Ga0209758_1015810 | 3300025297 | Bacteria | 3879 |
| 349 | Ga0209256_1004114 | 3300025299 | Bacteria | 9418 |
| 350 | Ga0207426_1000186 | 3300025302 | Bacteria | 154130 |
| 351 | Ga0207426_1004316 | 3300025302 | Bacteria | 7005 |
| 352 | Ga0207426_1004813 | 3300025302 | Bacteria | 6406 |
| 353 | Ga0207426_1020280 | 3300025302 | Bacteria | 2312 |
| 354 | Ga0209051_1093598 | 3300025303 | Bacteria | 828 |
| 355 | Ga0209257_1002985 | 3300025304 | Bacteria | 15399 |
| 356 | Ga0209257_1019262 | 3300025304 | Bacteria | 2579 |
| 357 | Ga0207697_10040491 | 3300025315 | Bacteria | 1913 |
| 358 | Ga0207656_10019833 | 3300025321 | Bacteria | 2663 |
| 359 | Ga0207692_10000852 | 3300025898 | Bacteria | 10957 |
| 360 | Ga0207692_10002369 | 3300025898 | Bacteria | 7230 |
| 361 | Ga0207710_10103535 | 3300025900 | Bacteria | 1345 |
| 362 | Ga0207710_10116249 | 3300025900 | Bacteria | 1274 |
| 363 | Ga0207688_10204565 | 3300025901 | Bacteria | 1185 |
| 364 | Ga0207680_10440173 | 3300025903 | Bacteria | 925 |
| 365 | Ga0207647_10002224 | 3300025904 | Bacteria | 14780 |
| 366 | Ga0207647_10163565 | 3300025904 | Bacteria | 1297 |
| 367 | Ga0207685_10005460 | 3300025905 | Bacteria | 3359 |
| 368 | Ga0207699_10011751 | 3300025906 | Bacteria | 4434 |
| 369 | Ga0207699_10013540 | 3300025906 | Bacteria | 4178 |
| 370 | Ga0207699_10025447 | 3300025906 | Bacteria | 3249 |
| 371 | Ga0207699_10036285 | 3300025906 | Bacteria | 2809 |
| 372 | Ga0207699_10298005 | 3300025906 | Bacteria | 1125 |
| 373 | Ga0207645_10017476 | 3300025907 | Bacteria | 4734 |
| 374 | Ga0207684_10640685 | 3300025910 | Bacteria | 906 |
| 375 | Ga0207654_10000874 | 3300025911 | Bacteria | 16703 |
| 376 | Ga0207707_10002360 | 3300025912 | Bacteria | 17009 |
| 377 | Ga0207707_10018715 | 3300025912 | Bacteria | 6038 |
| 378 | Ga0207707_10023081 | 3300025912 | Bacteria | 5443 |
| 379 | Ga0207707_10204788 | 3300025912 | Bacteria | 1720 |
| 380 | Ga0207707_10305503 | 3300025912 | Bacteria | 1375 |
| 381 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 382 | Ga0207695_10001756 | 3300025913 | Bacteria | 34405 |
| 383 | Ga0207695_10070740 | 3300025913 | Bacteria | 3565 |
| 384 | Ga0207695_10163275 | 3300025913 | Bacteria | 2157 |
| 385 | Ga0207671_10008770 | 3300025914 | Bacteria | 8517 |
| 386 | Ga0207671_10019054 | 3300025914 | Bacteria | 5257 |
| 387 | Ga0207671_10095343 | 3300025914 | Bacteria | 2247 |
| 388 | Ga0207671_10114716 | 3300025914 | Bacteria | 2053 |
| 389 | Ga0207671_10139390 | 3300025914 | Bacteria | 1868 |
| 390 | Ga0207671_10169187 | 3300025914 | Bacteria | 1696 |
| 391 | Ga0207671_10198075 | 3300025914 | Bacteria | 1568 |
| 392 | Ga0207693_10023504 | 3300025915 | Bacteria | 4893 |
| 393 | Ga0207693_10033990 | 3300025915 | Bacteria | 4022 |
| 394 | Ga0207693_10047780 | 3300025915 | Bacteria | 3362 |
| 395 | Ga0207693_10052774 | 3300025915 | Bacteria | 3189 |
| 396 | Ga0207693_10058480 | 3300025915 | Bacteria | 3020 |
| 397 | Ga0207663_10000260 | 3300025916 | Bacteria | 23036 |
| 398 | Ga0207663_10011583 | 3300025916 | Bacteria | 4741 |
| 399 | Ga0207663_10025039 | 3300025916 | Bacteria | 3444 |
| 400 | Ga0207663_10028634 | 3300025916 | Bacteria | 3262 |
| 401 | Ga0207663_10082169 | 3300025916 | Bacteria | 2112 |
| 402 | Ga0207660_10044182 | 3300025917 | Bacteria | 3134 |
| 403 | Ga0207660_10298211 | 3300025917 | Bacteria | 1283 |
| 404 | Ga0207649_10091495 | 3300025920 | Bacteria | 1992 |
| 405 | Ga0207649_10143695 | 3300025920 | Bacteria | 1636 |
| 406 | Ga0207649_10226894 | 3300025920 | Bacteria | 1334 |
| 407 | Ga0207652_10010155 | 3300025921 | Bacteria | 7583 |
| 408 | Ga0207652_10030351 | 3300025921 | Bacteria | 4526 |
| 409 | Ga0207652_10158032 | 3300025921 | Bacteria | 2031 |
| 410 | Ga0207652_10213939 | 3300025921 | Bacteria | 1736 |
| 411 | Ga0207652_10705412 | 3300025921 | Bacteria | 900 |
| 412 | Ga0207646_10114471 | 3300025922 | Bacteria | 2422 |
| 413 | Ga0207694_10000306 | 3300025924 | Bacteria | 46009 |
| 414 | Ga0207694_10114401 | 3300025924 | Bacteria | 2149 |
| 415 | Ga0207694_10195256 | 3300025924 | Bacteria | 1645 |
| 416 | Ga0207694_10264540 | 3300025924 | Bacteria | 1409 |
| 417 | Ga0207694_10318398 | 3300025924 | Bacteria | 1283 |
| 418 | Ga0207694_10575585 | 3300025924 | Bacteria | 946 |
| 419 | Ga0207694_10669458 | 3300025924 | Bacteria | 875 |
| 420 | Ga0207659_10806764 | 3300025926 | Bacteria | 806 |
| 421 | Ga0207687_10055668 | 3300025927 | Bacteria | 2772 |
| 422 | Ga0207700_10014409 | 3300025928 | Bacteria | 5180 |
| 423 | Ga0207700_10024741 | 3300025928 | Bacteria | 4160 |
| 424 | Ga0207700_10039984 | 3300025928 | Bacteria | 3419 |
| 425 | Ga0207700_10078951 | 3300025928 | Bacteria | 2562 |
| 426 | Ga0207700_10274448 | 3300025928 | Bacteria | 1448 |
| 427 | Ga0207700_10359152 | 3300025928 | Bacteria | 1270 |
| 428 | Ga0207664_10031361 | 3300025929 | Bacteria | 4065 |
| 429 | Ga0207664_10084151 | 3300025929 | Bacteria | 2594 |
| 430 | Ga0207664_10210351 | 3300025929 | Bacteria | 1682 |
| 431 | Ga0207664_10330114 | 3300025929 | Bacteria | 1347 |
| 432 | Ga0207644_10230269 | 3300025931 | Bacteria | 1472 |
| 433 | Ga0207644_10239558 | 3300025931 | Bacteria | 1444 |
| 434 | Ga0207690_10039503 | 3300025932 | Bacteria | 3079 |
| 435 | Ga0207706_10155026 | 3300025933 | Bacteria | 2015 |
| 436 | Ga0207706_10251996 | 3300025933 | Bacteria | 1542 |
| 437 | Ga0207709_10503738 | 3300025935 | Bacteria | 945 |
| 438 | Ga0207670_10115185 | 3300025936 | Bacteria | 1944 |
| 439 | Ga0207669_10341136 | 3300025937 | Bacteria | 1154 |
| 440 | Ga0207704_10046071 | 3300025938 | Bacteria | 2596 |
| 441 | Ga0207704_10102716 | 3300025938 | Bacteria | 1910 |
| 442 | Ga0207665_10004492 | 3300025939 | Bacteria | 9257 |
| 443 | Ga0207665_10165074 | 3300025939 | Bacteria | 1596 |
| 444 | Ga0207711_10013103 | 3300025941 | Bacteria | 6887 |
| 445 | Ga0207689_10190132 | 3300025942 | Bacteria | 1694 |
| 446 | Ga0207689_10351771 | 3300025942 | Bacteria | 1225 |
| 447 | Ga0207689_10478789 | 3300025942 | Bacteria | 1042 |
| 448 | Ga0207661_10002241 | 3300025944 | Bacteria | 13339 |
| 449 | Ga0207661_10054697 | 3300025944 | Bacteria | 3198 |
| 450 | Ga0207661_10392113 | 3300025944 | Bacteria | 1258 |
| 451 | Ga0207661_10492713 | 3300025944 | Bacteria | 1119 |
| 452 | Ga0207679_10119105 | 3300025945 | Bacteria | 2098 |
| 453 | Ga0207679_10467337 | 3300025945 | Bacteria | 1121 |
| 454 | Ga0207667_10015657 | 3300025949 | Bacteria | 8603 |
| 455 | Ga0207667_10023471 | 3300025949 | Bacteria | 6792 |
| 456 | Ga0207667_10046562 | 3300025949 | Bacteria | 4592 |
| 457 | Ga0207667_10366731 | 3300025949 | Bacteria | 1468 |
| 458 | Ga0207667_10619978 | 3300025949 | Bacteria | 1089 |
| 459 | Ga0207667_11051790 | 3300025949 | Bacteria | 799 |
| 460 | Ga0207651_10111219 | 3300025960 | Bacteria | 2057 |
| 461 | Ga0207668_10024883 | 3300025972 | Bacteria | 3869 |
| 462 | Ga0207640_10078399 | 3300025981 | Bacteria | 2248 |
| 463 | Ga0207640_10149826 | 3300025981 | Bacteria | 1712 |
| 464 | Ga0207658_10570528 | 3300025986 | Bacteria | 1014 |
| 465 | Ga0207658_10741236 | 3300025986 | Bacteria | 889 |
| 466 | Ga0207677_10122481 | 3300026023 | Bacteria | 1959 |
| 467 | Ga0207703_10599211 | 3300026035 | Bacteria | 1042 |
| 468 | Ga0207639_10055566 | 3300026041 | Bacteria | 3031 |
| 469 | Ga0207639_10069736 | 3300026041 | Bacteria | 2743 |
| 470 | Ga0207639_10080517 | 3300026041 | Bacteria | 2577 |
| 471 | Ga0207639_10103311 | 3300026041 | Bacteria | 2308 |
| 472 | Ga0207639_10420441 | 3300026041 | Bacteria | 1208 |
| 473 | Ga0207639_10435925 | 3300026041 | Bacteria | 1187 |
| 474 | Ga0207639_10496320 | 3300026041 | Bacteria | 1114 |
| 475 | Ga0207639_10501367 | 3300026041 | Bacteria | 1109 |
| 476 | Ga0207639_10752375 | 3300026041 | Bacteria | 906 |
| 477 | Ga0207678_10063908 | 3300026067 | Bacteria | 3162 |
| 478 | Ga0207678_10140057 | 3300026067 | Bacteria | 2064 |
| 479 | Ga0207678_10574833 | 3300026067 | Bacteria | 987 |
| 480 | Ga0207678_11035082 | 3300026067 | Bacteria | 727 |
| 481 | Ga0207702_10000101 | 3300026078 | Bacteria | 99845 |
| 482 | Ga0207702_10000122 | 3300026078 | Bacteria | 91685 |
| 483 | Ga0207702_10095262 | 3300026078 | Bacteria | 2615 |
| 484 | Ga0207702_10115235 | 3300026078 | Bacteria | 2396 |
| 485 | Ga0207641_10270349 | 3300026088 | Bacteria | 1595 |
| 486 | Ga0207641_10512678 | 3300026088 | Bacteria | 1166 |
| 487 | Ga0207676_10061211 | 3300026095 | Bacteria | 2980 |
| 488 | Ga0207674_10014216 | 3300026116 | Bacteria | 8795 |
| 489 | Ga0207674_10022648 | 3300026116 | Bacteria | 6742 |
| 490 | Ga0207674_10113789 | 3300026116 | Bacteria | 2678 |
| 491 | Ga0207675_100169851 | 3300026118 | Bacteria | 2084 |
| 492 | Ga0207675_100185016 | 3300026118 | Bacteria | 1996 |
| 493 | Ga0207683_10071845 | 3300026121 | Bacteria | 3060 |
| 494 | Ga0207683_10083043 | 3300026121 | Bacteria | 2847 |
| 495 | Ga0207683_10202810 | 3300026121 | Bacteria | 1803 |
| 496 | Ga0207683_10270475 | 3300026121 | Bacteria | 1552 |
| 497 | Ga0207698_10089140 | 3300026142 | Bacteria | 2518 |
| 498 | Ga0207698_11136849 | 3300026142 | Bacteria | 794 |
| 499 | Ga0209389_1000072 | 3300027296 | Bacteria | 96795 |
| 500 | Ga0209389_1000187 | 3300027296 | Bacteria | 46903 |
| 501 | Ga0209589_1002629 | 3300027357 | Bacteria | 31273 |
| 502 | Ga0209489_100206 | 3300027361 | Bacteria | 96866 |
| 503 | Ga0209489_101592 | 3300027361 | Bacteria | 46817 |
| 504 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 505 | Ga0209813_10021561 | 3300027866 | Bacteria | 1813 |
| 506 | Ga0268266_10004998 | 3300028379 | Bacteria | 12533 |
| 507 | Ga0268266_10013041 | 3300028379 | Bacteria | 7166 |
| 508 | Ga0268266_10181049 | 3300028379 | Bacteria | 1919 |
| 509 | Ga0268266_10474762 | 3300028379 | Bacteria | 1191 |
| 510 | Ga0268266_10849601 | 3300028379 | Bacteria | 882 |
| 511 | Ga0268265_10426585 | 3300028380 | Bacteria | 1232 |
| 512 | Ga0268264_10000187 | 3300028381 | Bacteria | 129270 |
| 513 | Ga0268264_10299924 | 3300028381 | Bacteria | 1512 |
| 514 | Ga0265326_10005386 | 3300028558 | Bacteria | 4033 |
| 515 | Ga0265319_1032588 | 3300028563 | Bacteria | 1805 |
| 516 | Ga0265334_10000741 | 3300028573 | Bacteria | 16339 |
| 517 | Ga0265318_10016165 | 3300028577 | Bacteria | 3087 |
| 518 | Ga0265323_10001701 | 3300028653 | Bacteria | 10499 |
| 519 | Ga0265322_10011637 | 3300028654 | Bacteria | 2548 |
| 520 | Ga0265336_10001237 | 3300028666 | Bacteria | 12134 |
| 521 | Ga0307517_10000066 | 3300028786 | Bacteria | 141370 |
| 522 | Ga0307515_10062791 | 3300028794 | Bacteria | 5236 |
| 523 | Ga0265338_10000973 | 3300028800 | Bacteria | 48208 |
| 524 | Ga0265324_10003799 | 3300029957 | Bacteria | 7055 |
| 525 | Ga0307511_10053968 | 3300030521 | Bacteria | 3177 |
| 526 | Ga0265330_10012740 | 3300031235 | Bacteria | 3926 |
| 527 | Ga0265330_10019458 | 3300031235 | Bacteria | 3111 |
| 528 | Ga0265330_10024564 | 3300031235 | Bacteria | 2733 |
| 529 | Ga0265330_10038130 | 3300031235 | Bacteria | 2137 |
| 530 | Ga0265328_10014234 | 3300031239 | Bacteria | 3135 |
| 531 | Ga0265328_10056045 | 3300031239 | Bacteria | 1446 |
| 532 | Ga0265325_10012522 | 3300031241 | Bacteria | 4848 |
| 533 | Ga0265340_10002830 | 3300031247 | Bacteria | 9870 |
| 534 | Ga0265339_10005543 | 3300031249 | Bacteria | 8388 |
| 535 | Ga0265339_10007566 | 3300031249 | Bacteria | 7000 |
| 536 | Ga0265339_10074780 | 3300031249 | Bacteria | 1799 |
| 537 | Ga0265331_10001005 | 3300031250 | Bacteria | 22100 |
| 538 | Ga0265316_10083560 | 3300031344 | Bacteria | 2446 |
| 539 | Ga0265316_10090874 | 3300031344 | Bacteria | 2329 |
| 540 | Ga0307513_10108299 | 3300031456 | Bacteria | 2780 |
| 541 | Ga0307509_10065722 | 3300031507 | Bacteria | 3806 |
| 542 | Ga0307509_10084953 | 3300031507 | Bacteria | 3259 |
| 543 | Ga0307408_100329450 | 3300031548 | Bacteria | 1289 |
| 544 | Ga0265313_10001357 | 3300031595 | Bacteria | 23065 |
| 545 | Ga0307508_10001545 | 3300031616 | Bacteria | 25766 |
| 546 | Ga0307508_10032542 | 3300031616 | Bacteria | 4711 |
| 547 | Ga0307508_10423503 | 3300031616 | Bacteria | 923 |
| 548 | Ga0265314_10003805 | 3300031711 | Bacteria | 14416 |
| 549 | Ga0265314_10011154 | 3300031711 | Bacteria | 7447 |
| 550 | Ga0265314_10193145 | 3300031711 | Bacteria | 1210 |
| 551 | Ga0307516_10060446 | 3300031730 | Bacteria | 3681 |
| 552 | Ga0307516_10097402 | 3300031730 | Bacteria | 2761 |
| 553 | Ga0307516_10205184 | 3300031730 | Bacteria | 1688 |
| 554 | Ga0307516_10344675 | 3300031730 | Bacteria | 1156 |
| 555 | Ga0307413_10378884 | 3300031824 | Bacteria | 1101 |
| 556 | Ga0307412_10375802 | 3300031911 | Bacteria | 1149 |
| 557 | Ga0307412_10637129 | 3300031911 | Bacteria | 907 |
| 558 | Ga0307416_100063629 | 3300032002 | Bacteria | 3022 |
| 559 | Ga0307416_100108637 | 3300032002 | Bacteria | 2438 |
| 560 | Ga0307416_100312914 | 3300032002 | Bacteria | 1568 |
| 561 | Ga0307411_10280466 | 3300032005 | Bacteria | 1326 |
| 562 | Ga0307415_100072687 | 3300032126 | Bacteria | 2423 |
| 563 | Ga0307507_10018905 | 3300033179 | Bacteria | 7802 |
| 564 | Ga0307510_10028628 | 3300033180 | Bacteria | 6360 |
| 565 | Ga0307510_10061999 | 3300033180 | Bacteria | 3825 |
| 566 | Ga0307510_10072661 | 3300033180 | Bacteria | 3416 |
| 567 | Ga0307510_10125969 | 3300033180 | Bacteria | 2251 |
| 568 | Ga0315911_1000039 | 3300033442 | Bacteria | 56060 |
| 569 | Ga0316215_1001804 | 3300033544 | Bacteria | 2031 |
| 570 | Ga0373926_0025759 | 3300035083 | Bacteria | 2054 |
| 571 | Ga0373926_0140185 | 3300035083 | Bacteria | 918 |
| 572 | Ga0373934_0002341 | 3300035086 | Bacteria | 6975 |
| 573 | Ga0373923_0005063 | 3300035111 | Bacteria | 4442 |
| 574 | Ga0373923_0007529 | 3300035111 | Bacteria | 3833 |
| 575 | Ga0373932_0036142 | 3300035112 | Bacteria | 1401 |
| 576 | Ga0373936_0004331 | 3300035113 | Bacteria | 5366 |
| 577 | Ga0373936_0041581 | 3300035113 | Bacteria | 1844 |
| 578 | Ga0373936_0075587 | 3300035113 | Bacteria | 1395 |
| 579 | Ga0373945_0023026 | 3300035116 | Bacteria | 2150 |
| 580 | Ga0373953_0030658 | 3300035117 | Bacteria | 2086 |
| 581 | Ga0373953_0060834 | 3300035117 | Bacteria | 1544 |
| 582 | Ga0373953_0088105 | 3300035117 | Bacteria | 1296 |
| 583 | Ga0373953_0112051 | 3300035117 | Bacteria | 1154 |
| 584 | Ga0373954_0000182 | 3300035118 | Bacteria | 22786 |
| 585 | Ga0373954_0053063 | 3300035118 | Bacteria | 1905 |
| 586 | Ga0373954_0083181 | 3300035118 | Bacteria | 1531 |
| 587 | Ga0373956_0001338 | 3300035119 | Bacteria | 10168 |
| 588 | Ga0373956_0091708 | 3300035119 | Bacteria | 1402 |
| 589 | Ga0373957_0002101 | 3300035120 | Bacteria | 5591 |
| 590 | Ga0373943_0013966 | 3300035170 | Bacteria | 3632 |
| 591 | Ga0373943_0045345 | 3300035170 | Bacteria | 2142 |
| 592 | Ga0373946_0002873 | 3300035171 | Bacteria | 6106 |
| 593 | Ga0373946_0106711 | 3300035171 | Bacteria | 1262 |
| 594 | Ga0373955_0000471 | 3300035172 | Bacteria | 16944 |
| 595 | Ga0373955_0066380 | 3300035172 | Bacteria | 2005 |
| 596 | Ga0373955_0319684 | 3300035172 | Bacteria | 937 |
| 597 | Ga0373942_0069098 | 3300035207 | Bacteria | 1028 |
| 598 | Ga0373924_0006537 | 3300035410 | Bacteria | 4180 |
| 599 | Ga0373924_0013602 | 3300035410 | Bacteria | 3059 |
| 600 | Ga0373931_0008813 | 3300035691 | Bacteria | 4799 |
| 601 | Ga0373935_0000128 | 3300035692 | Bacteria | 34347 |
| 602 | Ga0373935_0027993 | 3300035692 | Bacteria | 3483 |
| 603 | Ga0373935_0196813 | 3300035692 | Bacteria | 1391 |
| 604 | Ga0373935_0209753 | 3300035692 | Bacteria | 1349 |
| 605 | Ga0373927_0000496 | 3300035695 | Bacteria | 29963 |
| 606 | Ga0373927_0019629 | 3300035695 | Bacteria | 4431 |
| 607 | Ga0373927_0088429 | 3300035695 | Bacteria | 2011 |
| 608 | Ga0373927_0114199 | 3300035695 | Bacteria | 1760 |
| 609 | Ga0373927_0228455 | 3300035695 | Bacteria | 1223 |
| 610 | Ga0373927_0338939 | 3300035695 | Bacteria | 990 |
| 611 | Ga0373933_0000163 | 3300035724 | Bacteria | 43339 |
| 612 | Ga0373933_0002736 | 3300035724 | Bacteria | 9861 |
| 613 | Ga0373933_0030441 | 3300035724 | Bacteria | 3125 |
| 614 | Ga0373933_0281527 | 3300035724 | Bacteria | 1074 |
| 615 | Ga0373947_0001955 | 3300035725 | Bacteria | 12612 |
| 616 | Ga0373947_0019438 | 3300035725 | Bacteria | 3917 |
| 617 | Ga0373947_0435328 | 3300035725 | Bacteria | 887 |
| 618 | Ga0373937_0030048 | 3300036401 | Bacteria | 4921 |
| 619 | Ga0373937_0036173 | 3300036401 | Bacteria | 4498 |
| 620 | Ga0373937_0064006 | 3300036401 | Bacteria | 3382 |
| 621 | Ga0373925_0006551 | 3300037068 | Bacteria | 8561 |
| 622 | Ga0373925_0044113 | 3300037068 | Bacteria | 3311 |
| 623 | Ga0373925_0096101 | 3300037068 | Bacteria | 2270 |
| 624 | Ga0373925_0112246 | 3300037068 | Bacteria | 2107 |
| 625 | Ga0373925_0146209 | 3300037068 | Bacteria | 1853 |
| 626 | Ga0395899_0143787 | 3300037312 | Bacteria | 1695 |
| 627 | Ga0395900_0000962 | 3300037418 | Bacteria | 37526 |
| 628 | Ga0395900_0008900 | 3300037418 | Bacteria | 10303 |
| 629 | Ga0395900_0097162 | 3300037418 | Bacteria | 3026 |
| 630 | Ga0395900_0195574 | 3300037418 | Bacteria | 2049 |
| 631 | Ga0395900_0467657 | 3300037418 | Bacteria | 1215 |
| 632 | Ga0395900_0779808 | 3300037418 | Bacteria | 885 |
| 633 | Ga0395898_0002601 | 3300037466 | Bacteria | 21069 |
| 634 | Ga0395898_0019490 | 3300037466 | Bacteria | 6902 |
| 635 | Ga0395898_0095452 | 3300037466 | Bacteria | 2857 |
| 636 | Ga0395898_0162711 | 3300037466 | Bacteria | 2135 |
| 637 | Ga0395898_0360651 | 3300037466 | Bacteria | 1386 |
| 638 | Ga0395898_0483860 | 3300037466 | Bacteria | 1177 |
| 639 | Ga0395905_0014568 | 3300037471 | Bacteria | 7501 |
| 640 | Ga0395905_0049145 | 3300037471 | Bacteria | 3952 |
| 641 | Ga0395905_0104291 | 3300037471 | Bacteria | 2662 |
| 642 | Ga0395905_0554032 | 3300037471 | Bacteria | 1051 |
| 643 | Ga0395901_0002873 | 3300038443 | Bacteria | 17387 |
| 644 | Ga0395901_0016488 | 3300038443 | Bacteria | 7528 |
| 645 | Ga0395901_0070062 | 3300038443 | Bacteria | 3653 |
| 646 | Ga0395901_0175233 | 3300038443 | Bacteria | 2250 |
| 647 | Ga0395901_0209102 | 3300038443 | Bacteria | 2043 |
| 648 | Ga0395901_0445590 | 3300038443 | Bacteria | 1325 |
| 649 | Ga0395901_0697039 | 3300038443 | Bacteria | 1014 |
| 650 | Ga0436365_0015658 | 3300039437 | Bacteria | 1049 |
| 651 | Ga0436365_0076767 | 3300039437 | Bacteria | 2835 |
| 652 | Ga0436365_0351010 | 3300039437 | Bacteria | 1584 |
| 653 | Ga0436365_0655011 | 3300039437 | Bacteria | 4116 |
| 654 | Ga0436365_1220227 | 3300039437 | Bacteria | 1144 |
| 655 | Ga0436365_1347888 | 3300039437 | Bacteria | 777 |
| 656 | Ga0436365_1860217 | 3300039437 | Bacteria | 2094 |
| 657 | Ga0436360_0415296 | 3300039438 | Bacteria | 1756 |
| 658 | Ga0436360_0545862 | 3300039438 | Bacteria | 796 |
| 659 | Ga0436360_1315230 | 3300039438 | Bacteria | 882 |
| 660 | Ga0436361_0093159 | 3300039447 | Bacteria | 830 |
| 661 | Ga0436361_0202497 | 3300039447 | Bacteria | 992 |
| 662 | Ga0436361_0267897 | 3300039447 | Bacteria | 986 |
| 663 | Ga0436363_0166451 | 3300039450 | Bacteria | 5768 |
| 664 | Ga0436363_0593082 | 3300039450 | Bacteria | 1826 |
| 665 | Ga0436363_0960712 | 3300039450 | Bacteria | 1032 |
| 666 | Ga0436363_1716088 | 3300039450 | Bacteria | 2336 |
| 667 | Ga0451793_0299829 | 3300041452 | Bacteria | 901 |
| 668 | Ga0451797_0981027 | 3300041453 | Bacteria | 1177 |
| 669 | Ga0451835_0124610 | 3300041492 | Bacteria | 744 |
| 670 | Ga0451851_0940412 | 3300041507 | Bacteria | 853 |
| 671 | Ga0466969_0251498 | 3300044656 | Bacteria | 801 |
| 672 | Ga0466972_0000048 | 3300044658 | Bacteria | 119165 |
| 673 | Ga0466972_0060310 | 3300044658 | Bacteria | 1820 |
| 674 | Ga0466972_0144481 | 3300044658 | Bacteria | 1119 |
| 675 | Ga0466966_0001085 | 3300044684 | Bacteria | 17401 |
| 676 | Ga0466966_0046527 | 3300044684 | Bacteria | 2770 |
| 677 | Ga0466961_0000010 | 3300044693 | Bacteria | 137550 |
| 678 | Ga0466961_0214683 | 3300044693 | Bacteria | 1187 |
| 679 | Ga0466964_0055814 | 3300044706 | Bacteria | 1632 |
| 680 | Ga0466964_0067339 | 3300044706 | Bacteria | 1505 |
| 681 | Ga0466964_0256914 | 3300044706 | Bacteria | 864 |
| 682 | Ga0466968_0043032 | 3300044735 | Bacteria | 1911 |
| 683 | Ga0466968_0061978 | 3300044735 | Bacteria | 1614 |
| 684 | Ga0466968_0284016 | 3300044735 | Bacteria | 793 |
| 685 | Ga0466970_0084965 | 3300044765 | Bacteria | 1714 |
| 686 | Ga0466957_0263094 | 3300044842 | Bacteria | 1150 |
| 687 | Ga0466960_0067537 | 3300044901 | Bacteria | 1771 |
| 688 | Ga0466959_0002483 | 3300045049 | Bacteria | 11808 |
| 689 | Ga0466959_0051087 | 3300045049 | Bacteria | 3034 |
| 690 | Ga0466958_0350086 | 3300045836 | Bacteria | 951 |
| 691 | Ga0466967_0124732 | 3300045976 | Bacteria | 2384 |
| 692 | Ga0495617_041126 | 3300046452 | Bacteria | 1545 |
| 693 | Ga0495592_0002891 | 3300046454 | Bacteria | 12215 |
| 694 | Ga0495592_0020079 | 3300046454 | Bacteria | 5080 |
| 695 | Ga0495592_0070573 | 3300046454 | Bacteria | 2544 |
| 696 | Ga0495592_0310801 | 3300046454 | Bacteria | 1021 |
| 697 | Ga0495603_0000104 | 3300046455 | Bacteria | 39821 |
| 698 | Ga0495603_0007956 | 3300046455 | Bacteria | 6398 |
| 699 | Ga0495603_0009775 | 3300046455 | Bacteria | 5805 |
| 700 | Ga0495603_0087432 | 3300046455 | Bacteria | 1824 |
| 701 | Ga0495603_0091982 | 3300046455 | Bacteria | 1773 |
| 702 | Ga0495603_0209209 | 3300046455 | Bacteria | 1126 |
| 703 | Ga0495603_0225994 | 3300046455 | Bacteria | 1079 |
| 704 | Ga0495590_0086807 | 3300046457 | Bacteria | 1105 |
| 705 | Ga0495629_0005026 | 3300046459 | Bacteria | 9912 |
| 706 | Ga0495629_0008475 | 3300046459 | Bacteria | 7569 |
| 707 | Ga0495629_0034540 | 3300046459 | Bacteria | 3575 |
| 708 | Ga0495629_0051748 | 3300046459 | Bacteria | 2874 |
| 709 | Ga0495638_0037701 | 3300046460 | Bacteria | 3074 |
| 710 | Ga0495638_0047273 | 3300046460 | Bacteria | 2698 |
| 711 | Ga0495638_0077571 | 3300046460 | Bacteria | 2022 |
| 712 | Ga0495638_0190889 | 3300046460 | Bacteria | 1162 |
| 713 | Ga0495641_0000402 | 3300046461 | Bacteria | 36037 |
| 714 | Ga0495651_0005264 | 3300046462 | Bacteria | 9861 |
| 715 | Ga0495651_0007958 | 3300046462 | Bacteria | 8127 |
| 716 | Ga0495651_0083404 | 3300046462 | Bacteria | 2410 |
| 717 | Ga0495653_0023995 | 3300046463 | Bacteria | 4920 |
| 718 | Ga0495653_0058017 | 3300046463 | Bacteria | 2943 |
| 719 | Ga0495653_0066480 | 3300046463 | Bacteria | 2712 |
| 720 | Ga0495580_0003617 | 3300046472 | Bacteria | 13095 |
| 721 | Ga0495580_0126388 | 3300046472 | Bacteria | 1774 |
| 722 | Ga0495582_0000063 | 3300046473 | Bacteria | 54381 |
| 723 | Ga0495582_0006668 | 3300046473 | Bacteria | 6414 |
| 724 | Ga0495582_0105122 | 3300046473 | Bacteria | 1583 |
| 725 | Ga0495605_0062183 | 3300046474 | Bacteria | 1784 |
| 726 | Ga0495639_0000485 | 3300046475 | Bacteria | 18953 |
| 727 | Ga0495662_0000297 | 3300046476 | Bacteria | 21564 |
| 728 | Ga0495662_0098574 | 3300046476 | Bacteria | 1429 |
| 729 | Ga0495664_0006814 | 3300046477 | Bacteria | 6322 |
| 730 | Ga0495664_0011821 | 3300046477 | Bacteria | 4931 |
| 731 | Ga0495664_0026353 | 3300046477 | Bacteria | 3385 |
| 732 | Ga0495664_0146980 | 3300046477 | Bacteria | 1429 |
| 733 | Ga0495584_0271099 | 3300046491 | Bacteria | 863 |
| 734 | Ga0495585_0083823 | 3300046492 | Bacteria | 1724 |
| 735 | Ga0495585_0181363 | 3300046492 | Bacteria | 1082 |
| 736 | Ga0495594_0001344 | 3300046499 | Bacteria | 12765 |
| 737 | Ga0495596_0167193 | 3300046500 | Bacteria | 855 |
| 738 | Ga0495607_0172336 | 3300046501 | Bacteria | 1092 |
| 739 | Ga0495607_0240665 | 3300046501 | Bacteria | 876 |
| 740 | Ga0495583_0105995 | 3300046506 | Bacteria | 1195 |
| 741 | Ga0495606_0003543 | 3300046507 | Bacteria | 16488 |
| 742 | Ga0495606_0051481 | 3300046507 | Bacteria | 2685 |
| 743 | Ga0495606_0055131 | 3300046507 | Bacteria | 2572 |
| 744 | Ga0495608_0002114 | 3300046511 | Bacteria | 14307 |
| 745 | Ga0495608_0164917 | 3300046511 | Bacteria | 1407 |
| 746 | Ga0495608_0173294 | 3300046511 | Bacteria | 1367 |
| 747 | Ga0495610_0055902 | 3300046512 | Bacteria | 1900 |
| 748 | Ga0495610_0100423 | 3300046512 | Bacteria | 1297 |
| 749 | Ga0495616_0037634 | 3300046513 | Bacteria | 2488 |
| 750 | Ga0495618_0158348 | 3300046514 | Bacteria | 1444 |
| 751 | Ga0495620_0183325 | 3300046515 | Bacteria | 809 |
| 752 | Ga0495628_0047088 | 3300046516 | Bacteria | 3423 |
| 753 | Ga0495628_0073113 | 3300046516 | Bacteria | 2671 |
| 754 | Ga0495628_0113540 | 3300046516 | Bacteria | 2082 |
| 755 | Ga0495628_0145841 | 3300046516 | Bacteria | 1804 |
| 756 | Ga0495630_0003717 | 3300046517 | Bacteria | 10637 |
| 757 | Ga0495630_0077166 | 3300046517 | Bacteria | 2511 |
| 758 | Ga0495630_0205296 | 3300046517 | Bacteria | 1504 |
| 759 | Ga0495631_0028024 | 3300046518 | Bacteria | 2572 |
| 760 | Ga0495632_0063341 | 3300046519 | Bacteria | 1790 |
| 761 | Ga0495632_0165365 | 3300046519 | Bacteria | 1018 |
| 762 | Ga0495644_0015964 | 3300046523 | Bacteria | 2877 |
| 763 | Ga0495648_0001804 | 3300046524 | Bacteria | 20615 |
| 764 | Ga0495648_0008803 | 3300046524 | Bacteria | 7896 |
| 765 | Ga0495648_0159851 | 3300046524 | Bacteria | 1166 |
| 766 | Ga0495666_0075370 | 3300046526 | Bacteria | 1600 |
| 767 | Ga0495666_0271840 | 3300046526 | Bacteria | 769 |
| 768 | Ga0495652_0024316 | 3300046529 | Bacteria | 5363 |
| 769 | Ga0495652_0028805 | 3300046529 | Bacteria | 4882 |
| 770 | Ga0495652_0029863 | 3300046529 | Bacteria | 4785 |
| 771 | Ga0495652_0079593 | 3300046529 | Bacteria | 2709 |
| 772 | Ga0495652_0159390 | 3300046529 | Bacteria | 1754 |
| 773 | Ga0495652_0407245 | 3300046529 | Bacteria | 961 |
| 774 | Ga0495654_0018680 | 3300046530 | Bacteria | 3630 |
| 775 | Ga0495654_0076756 | 3300046530 | Bacteria | 1574 |
| 776 | Ga0495665_0000290 | 3300046531 | Bacteria | 25439 |
| 777 | Ga0495665_0301470 | 3300046531 | Bacteria | 820 |
| 778 | Ga0495640_0005621 | 3300046533 | Bacteria | 9972 |
| 779 | Ga0495640_0072047 | 3300046533 | Bacteria | 2316 |
| 780 | Ga0495640_0156522 | 3300046533 | Bacteria | 1462 |
| 781 | Ga0495586_0215060 | 3300046535 | Bacteria | 1091 |
| 782 | Ga0495587_0042093 | 3300046536 | Bacteria | 2724 |
| 783 | Ga0495587_0054357 | 3300046536 | Bacteria | 2360 |
| 784 | Ga0495598_0141351 | 3300046537 | Bacteria | 833 |
| 785 | Ga0495609_0039381 | 3300046538 | Bacteria | 2128 |
| 786 | Ga0495609_0109199 | 3300046538 | Bacteria | 1195 |
| 787 | Ga0495597_0192786 | 3300046542 | Bacteria | 819 |
| 788 | Ga0495645_0003860 | 3300046543 | Bacteria | 10202 |
| 789 | Ga0495645_0004402 | 3300046543 | Bacteria | 9625 |
| 790 | Ga0495645_0020509 | 3300046543 | Bacteria | 4771 |
| 791 | Ga0495645_0052172 | 3300046543 | Bacteria | 2976 |
| 792 | Ga0495622_0009243 | 3300046557 | Bacteria | 4561 |
| 793 | Ga0495622_0034772 | 3300046557 | Bacteria | 2350 |
| 794 | Ga0495622_0055664 | 3300046557 | Bacteria | 1834 |
| 795 | Ga0495622_0059155 | 3300046557 | Bacteria | 1774 |
| 796 | Ga0495622_0159458 | 3300046557 | Bacteria | 1018 |
| 797 | Ga0495633_0090573 | 3300046558 | Bacteria | 1422 |
| 798 | Ga0495667_0010602 | 3300046559 | Bacteria | 6235 |
| 799 | Ga0495667_0054425 | 3300046559 | Bacteria | 2632 |
| 800 | Ga0495667_0091515 | 3300046559 | Bacteria | 1970 |
| 801 | Ga0495667_0143095 | 3300046559 | Bacteria | 1541 |
| 802 | Ga0495656_0017449 | 3300046615 | Bacteria | 2739 |
| 803 | Ga0495656_0028115 | 3300046615 | Bacteria | 2253 |
| 804 | Ga0495656_0091630 | 3300046615 | Bacteria | 1391 |
| 805 | Ga0495668_0066432 | 3300046616 | Bacteria | 1984 |
| 806 | Ga0495634_0000645 | 3300046642 | Bacteria | 33906 |
| 807 | Ga0495634_0031674 | 3300046642 | Bacteria | 3641 |
| 808 | Ga0495634_0049998 | 3300046642 | Bacteria | 2809 |
| 809 | Ga0495634_0121018 | 3300046642 | Bacteria | 1676 |
| 810 | Ga0495625_0057521 | 3300046660 | Bacteria | 2764 |
| 811 | Ga0495625_0105740 | 3300046660 | Bacteria | 1928 |
| 812 | Ga0495625_0139230 | 3300046660 | Bacteria | 1638 |
| 813 | Ga0495625_0149038 | 3300046660 | Bacteria | 1574 |
| 814 | Ga0495625_0281832 | 3300046660 | Bacteria | 1069 |
| 815 | Ga0495625_0380806 | 3300046660 | Bacteria | 885 |
| 816 | Ga0495635_0007816 | 3300046663 | Bacteria | 7465 |
| 817 | Ga0495635_0018102 | 3300046663 | Bacteria | 4920 |
| 818 | Ga0495635_0049840 | 3300046663 | Bacteria | 2886 |
| 819 | Ga0495635_0055521 | 3300046663 | Bacteria | 2728 |
| 820 | Ga0495635_0073607 | 3300046663 | Bacteria | 2340 |
| 821 | Ga0495661_0082848 | 3300046665 | Bacteria | 1845 |
| 822 | Ga0495661_0145639 | 3300046665 | Bacteria | 1284 |
| 823 | Ga0495661_0171218 | 3300046665 | Bacteria | 1158 |
| 824 | Ga0495661_0236581 | 3300046665 | Bacteria | 939 |
| 825 | Ga0495588_0001460 | 3300046674 | Bacteria | 10144 |
| 826 | Ga0495588_0005750 | 3300046674 | Bacteria | 5538 |
| 827 | Ga0495657_0005336 | 3300046675 | Bacteria | 10167 |
| 828 | Ga0495657_0046640 | 3300046675 | Bacteria | 2932 |
| 829 | Ga0495657_0055356 | 3300046675 | Bacteria | 2646 |
| 830 | Ga0495657_0151678 | 3300046675 | Bacteria | 1438 |
| 831 | Ga0495599_0002959 | 3300046678 | Bacteria | 9885 |
| 832 | Ga0495599_0026678 | 3300046678 | Bacteria | 3621 |
| 833 | Ga0495599_0080747 | 3300046678 | Bacteria | 2031 |
| 834 | Ga0495599_0187254 | 3300046678 | Bacteria | 1274 |
| 835 | Ga0495623_0003813 | 3300046679 | Bacteria | 9940 |
| 836 | Ga0495623_0022363 | 3300046679 | Bacteria | 4085 |
| 837 | Ga0495623_0022589 | 3300046679 | Bacteria | 4062 |
| 838 | Ga0495646_0003545 | 3300046680 | Bacteria | 9724 |
| 839 | Ga0495646_0132756 | 3300046680 | Bacteria | 1400 |
| 840 | Ga0495646_0193637 | 3300046680 | Bacteria | 1110 |
| 841 | Ga0495647_0003274 | 3300046681 | Bacteria | 5182 |
| 842 | Ga0495647_0008433 | 3300046681 | Bacteria | 3467 |
| 843 | Ga0495658_0000702 | 3300046683 | Bacteria | 18142 |
| 844 | Ga0495658_0124749 | 3300046683 | Bacteria | 1561 |
| 845 | Ga0495613_0022713 | 3300046689 | Bacteria | 4674 |
| 846 | Ga0495613_0088265 | 3300046689 | Bacteria | 2247 |
| 847 | Ga0495613_0100295 | 3300046689 | Bacteria | 2091 |
| 848 | Ga0495613_0189412 | 3300046689 | Bacteria | 1454 |
| 849 | Ga0495624_0000224 | 3300046690 | Bacteria | 44228 |
| 850 | Ga0495624_0014848 | 3300046690 | Bacteria | 5275 |
| 851 | Ga0495624_0296061 | 3300046690 | Bacteria | 976 |
| 852 | Ga0495670_0041333 | 3300046691 | Bacteria | 2300 |
| 853 | Ga0495670_0255627 | 3300046691 | Bacteria | 934 |
| 854 | Ga0495671_0018783 | 3300046692 | Bacteria | 3663 |
| 855 | Ga0495671_0073822 | 3300046692 | Bacteria | 1674 |
| 856 | Ga0495649_0077730 | 3300046694 | Bacteria | 1776 |
| 857 | Ga0495649_0161699 | 3300046694 | Bacteria | 1174 |
| 858 | Ga0495600_0000221 | 3300046809 | Bacteria | 32170 |
| 859 | Ga0495600_0019491 | 3300046809 | Bacteria | 4331 |
| 860 | Ga0495600_0130831 | 3300046809 | Bacteria | 1631 |
| 861 | Ga0495600_0141423 | 3300046809 | Bacteria | 1561 |
| 862 | Ga0495581_0000168 | 3300047315 | Bacteria | 29532 |
| 863 | Ga0495581_0050474 | 3300047315 | Bacteria | 2403 |
| 864 | Ga0495581_0062405 | 3300047315 | Bacteria | 2153 |
| 865 | Ga0495604_0023528 | 3300047317 | Bacteria | 4914 |
| 866 | Ga0495604_0084649 | 3300047317 | Bacteria | 2367 |
| 867 | Ga0495604_0085878 | 3300047317 | Bacteria | 2347 |
| 868 | Ga0495636_0059691 | 3300047318 | Bacteria | 1610 |
| 869 | Ga0495674_0005032 | 3300047319 | Bacteria | 12712 |
| 870 | Ga0495674_0031903 | 3300047319 | Bacteria | 4781 |
| 871 | Ga0495674_0044251 | 3300047319 | Bacteria | 3958 |
| 872 | Ga0495674_0058385 | 3300047319 | Bacteria | 3373 |
| 873 | Ga0495672_0010686 | 3300047320 | Bacteria | 6518 |
| 874 | Ga0495672_0214739 | 3300047320 | Bacteria | 953 |
| 875 | Ga0495676_0072807 | 3300047321 | Bacteria | 2637 |
| 876 | Ga0495676_0092084 | 3300047321 | Bacteria | 2264 |
| 877 | Ga0495676_0194010 | 3300047321 | Bacteria | 1415 |
| 878 | Ga0495676_0321039 | 3300047321 | Bacteria | 1040 |
| 879 | Ga0495680_0026568 | 3300047322 | Bacteria | 4770 |
| 880 | Ga0495680_0110044 | 3300047322 | Bacteria | 2042 |
| 881 | Ga0495675_0006791 | 3300047444 | Bacteria | 7020 |
| 882 | Ga0495675_0055835 | 3300047444 | Bacteria | 2504 |
| 883 | Ga0495675_0092770 | 3300047444 | Bacteria | 1894 |
| 884 | Ga0495675_0170302 | 3300047444 | Bacteria | 1338 |
| 885 | Ga0495685_025882 | 3300047447 | Bacteria | 2020 |
| 886 | Ga0495673_0012232 | 3300047469 | Bacteria | 4566 |
| 887 | Ga0495684_0002603 | 3300047471 | Bacteria | 14332 |
| 888 | Ga0495684_0012173 | 3300047471 | Bacteria | 6636 |
| 889 | Ga0495686_0012492 | 3300047472 | Bacteria | 5938 |
| 890 | Ga0495686_0237285 | 3300047472 | Bacteria | 1030 |
| 891 | Ga0495593_0000150 | 3300047673 | Bacteria | 34569 |
| 892 | Ga0495593_0004768 | 3300047673 | Bacteria | 8059 |
| 893 | Ga0495593_0028312 | 3300047673 | Bacteria | 3078 |
| 894 | Ga0495593_0031077 | 3300047673 | Bacteria | 2919 |
| 895 | Ga0495602_0000907 | 3300048088 | Bacteria | 28629 |
| 896 | Ga0495602_0092951 | 3300048088 | Bacteria | 2497 |
| 897 | Ga0495602_0151718 | 3300048088 | Bacteria | 1820 |
| 898 | Ga0495602_0536971 | 3300048088 | Bacteria | 812 |
| 899 | Ga0495626_0031034 | 3300048091 | Bacteria | 2575 |
| 900 | Ga0495626_0109103 | 3300048091 | Bacteria | 1200 |
| 901 | Ga0496100_0014076 | 3300048903 | Bacteria | 4636 |
| 902 | Ga0496100_0125684 | 3300048903 | Bacteria | 1800 |
| 903 | Ga0496100_0156532 | 3300048903 | Bacteria | 1630 |
| 904 | Ga0496100_0384886 | 3300048903 | Bacteria | 1066 |
| 905 | Ga0496101_0072116 | 3300048904 | Bacteria | 2534 |
| 906 | Ga0496101_0231479 | 3300048904 | Bacteria | 1436 |
| 907 | Ga0496101_0236995 | 3300048904 | Bacteria | 1419 |
| 908 | Ga0496101_0649694 | 3300048904 | Bacteria | 833 |
| 909 | Ga0496102_0073603 | 3300048905 | Bacteria | 3139 |
| 910 | Ga0496102_0078329 | 3300048905 | Bacteria | 3042 |
| 911 | Ga0496102_0283394 | 3300048905 | Bacteria | 1562 |
| 912 | Ga0496103_0021504 | 3300048906 | Bacteria | 3882 |
| 913 | Ga0496104_0016754 | 3300048907 | Bacteria | 6662 |
| 914 | Ga0496104_0053542 | 3300048907 | Bacteria | 3813 |
| 915 | Ga0496104_0057967 | 3300048907 | Bacteria | 3665 |
| 916 | Ga0496104_0077641 | 3300048907 | Bacteria | 3164 |
| 917 | Ga0496104_0093535 | 3300048907 | Bacteria | 2875 |
| 918 | Ga0496104_0251678 | 3300048907 | Bacteria | 1679 |
| 919 | Ga0496104_0493710 | 3300048907 | Bacteria | 1135 |
| 920 | Ga0496105_0015974 | 3300048908 | Bacteria | 5988 |
| 921 | Ga0496105_0024066 | 3300048908 | Bacteria | 4946 |
| 922 | Ga0496105_0025636 | 3300048908 | Bacteria | 4801 |
| 923 | Ga0496105_0027172 | 3300048908 | Bacteria | 4672 |
| 924 | Ga0496105_0202195 | 3300048908 | Bacteria | 1621 |
| 925 | Ga0496105_0597059 | 3300048908 | Bacteria | 857 |
| 926 | Ga0496106_0001027 | 3300048909 | Bacteria | 20532 |
| 927 | Ga0496106_0017020 | 3300048909 | Bacteria | 5380 |
| 928 | Ga0496106_0024940 | 3300048909 | Bacteria | 4447 |
| 929 | Ga0496106_0122950 | 3300048909 | Bacteria | 2030 |
| 930 | Ga0496106_0303538 | 3300048909 | Bacteria | 1280 |
| 931 | Ga0496106_0570586 | 3300048909 | Bacteria | 907 |
| 932 | Ga0496107_0041793 | 3300048910 | Bacteria | 3293 |
| 933 | Ga0496107_0047025 | 3300048910 | Bacteria | 3106 |
| 934 | Ga0496107_0306829 | 3300048910 | Bacteria | 1181 |
| 935 | Ga0496108_0000649 | 3300048911 | Bacteria | 27099 |
| 936 | Ga0496108_0094402 | 3300048911 | Bacteria | 2546 |
| 937 | Ga0496108_0368317 | 3300048911 | Bacteria | 1254 |
| 938 | Ga0496108_0432984 | 3300048911 | Bacteria | 1149 |
| 939 | Ga0496108_0565762 | 3300048911 | Bacteria | 991 |
| 940 | Ga0496108_0948784 | 3300048911 | Bacteria | 737 |
| 941 | Ga0496109_0000739 | 3300048912 | Bacteria | 27160 |
| 942 | Ga0496109_0197544 | 3300048912 | Bacteria | 1891 |
| 943 | Ga0496109_0255054 | 3300048912 | Bacteria | 1652 |
| 944 | Ga0496109_0457763 | 3300048912 | Bacteria | 1205 |
| 945 | Ga0496110_0005408 | 3300048913 | Bacteria | 10017 |
| 946 | Ga0496110_0008268 | 3300048913 | Bacteria | 8365 |
| 947 | Ga0496110_0016256 | 3300048913 | Bacteria | 6209 |
| 948 | Ga0496110_0040048 | 3300048913 | Bacteria | 4083 |
| 949 | Ga0496110_0063614 | 3300048913 | Bacteria | 3260 |
| 950 | Ga0496111_0010567 | 3300048914 | Bacteria | 6201 |
| 951 | Ga0496111_0082778 | 3300048914 | Bacteria | 2344 |
| 952 | Ga0496111_0096203 | 3300048914 | Bacteria | 2173 |
| 953 | Ga0496112_0000055 | 3300048915 | Bacteria | 78086 |
| 954 | Ga0496112_0001001 | 3300048915 | Bacteria | 20717 |
| 955 | Ga0496112_0005624 | 3300048915 | Bacteria | 10875 |
| 956 | Ga0496112_0031931 | 3300048915 | Bacteria | 5110 |
| 957 | Ga0496112_0032144 | 3300048915 | Bacteria | 5094 |
| 958 | Ga0496112_0067561 | 3300048915 | Bacteria | 3528 |
| 959 | Ga0496112_0119028 | 3300048915 | Bacteria | 2611 |
| 960 | Ga0496112_0610228 | 3300048915 | Bacteria | 1022 |
| 961 | Ga0496112_0769457 | 3300048915 | Bacteria | 888 |
| 962 | Ga0496113_0044578 | 3300048916 | Bacteria | 3286 |
| 963 | Ga0496113_0181629 | 3300048916 | Bacteria | 1668 |
| 964 | Ga0496113_0233859 | 3300048916 | Bacteria | 1466 |
| 965 | Ga0496113_0577817 | 3300048916 | Bacteria | 900 |
| 966 | Ga0496114_0031140 | 3300048917 | Bacteria | 4388 |
| 967 | Ga0496114_0087906 | 3300048917 | Bacteria | 2636 |
| 968 | Ga0496115_0004434 | 3300048918 | Bacteria | 10175 |
| 969 | Ga0496115_0021727 | 3300048918 | Bacteria | 4961 |
| 970 | Ga0496115_0130053 | 3300048918 | Bacteria | 2075 |
| 971 | Ga0496115_0279975 | 3300048918 | Bacteria | 1369 |
| 972 | Ga0496115_0725312 | 3300048918 | Bacteria | 779 |
| 973 | Ga0496117_0020433 | 3300048920 | Bacteria | 5398 |
| 974 | Ga0496117_0069000 | 3300048920 | Bacteria | 2383 |
| 975 | Ga0496117_0138041 | 3300048920 | Bacteria | 1465 |
| 976 | Ga0496117_0160941 | 3300048920 | Bacteria | 1315 |
| 977 | Ga0496118_0007955 | 3300048921 | Bacteria | 11090 |
| 978 | Ga0496118_0027923 | 3300048921 | Bacteria | 4766 |
| 979 | Ga0496118_0042878 | 3300048921 | Bacteria | 3564 |
| 980 | Ga0496118_0047715 | 3300048921 | Bacteria | 3316 |
| 981 | Ga0496118_0326863 | 3300048921 | Bacteria | 829 |
| 982 | Ga0496119_0048531 | 3300048922 | Bacteria | 2632 |
| 983 | Ga0496119_0063950 | 3300048922 | Bacteria | 2187 |
| 984 | Ga0496120_0035243 | 3300048923 | Bacteria | 2991 |
| 985 | Ga0496120_0048142 | 3300048923 | Bacteria | 2454 |
| 986 | Ga0496120_0075864 | 3300048923 | Bacteria | 1834 |
| 987 | Ga0496121_0000144 | 3300048924 | Bacteria | 156856 |
| 988 | Ga0496121_0004660 | 3300048924 | Bacteria | 18214 |
| 989 | Ga0496121_0005529 | 3300048924 | Bacteria | 16149 |
| 990 | Ga0496121_0008147 | 3300048924 | Bacteria | 12447 |
| 991 | Ga0496121_0015400 | 3300048924 | Bacteria | 8014 |
| 992 | Ga0496121_0030471 | 3300048924 | Bacteria | 4954 |
| 993 | Ga0496121_0031148 | 3300048924 | Bacteria | 4881 |
| 994 | Ga0496121_0097514 | 3300048924 | Bacteria | 2278 |
| 995 | Ga0496121_0107950 | 3300048924 | Bacteria | 2130 |
| 996 | Ga0496121_0116739 | 3300048924 | Bacteria | 2023 |
| 997 | Ga0496121_0133042 | 3300048924 | Bacteria | 1857 |
| 998 | Ga0496121_0182258 | 3300048924 | Bacteria | 1514 |
| 999 | Ga0496121_0221403 | 3300048924 | Bacteria | 1333 |
| 1000 | Ga0496121_0357748 | 3300048924 | Bacteria | 970 |
| 1001 | Ga0496122_0188704 | 3300048925 | Bacteria | 1219 |
| 1002 | Ga0496122_0202809 | 3300048925 | Bacteria | 1158 |
| 1003 | Ga0496124_0002408 | 3300048927 | Bacteria | 24540 |
| 1004 | Ga0496124_0188405 | 3300048927 | Bacteria | 1581 |
| 1005 | Ga0496125_0000595 | 3300048928 | Bacteria | 61641 |
| 1006 | Ga0496125_0016728 | 3300048928 | Bacteria | 7033 |
| 1007 | Ga0496125_0045159 | 3300048928 | Bacteria | 3713 |
| 1008 | Ga0496125_0152222 | 3300048928 | Bacteria | 1586 |
| 1009 | Ga0496125_0153397 | 3300048928 | Bacteria | 1578 |
| 1010 | Ga0496125_0157204 | 3300048928 | Bacteria | 1551 |
| 1011 | Ga0496125_0415336 | 3300048928 | Bacteria | 782 |
| 1012 | Ga0496126_0006769 | 3300048929 | Bacteria | 12718 |
| 1013 | Ga0496126_0008459 | 3300048929 | Bacteria | 11100 |
| 1014 | Ga0496126_0018002 | 3300048929 | Bacteria | 7022 |
| 1015 | Ga0496126_0028459 | 3300048929 | Bacteria | 5325 |
| 1016 | Ga0496126_0031874 | 3300048929 | Bacteria | 4973 |
| 1017 | Ga0496126_0045972 | 3300048929 | Bacteria | 4008 |
| 1018 | Ga0496126_0075686 | 3300048929 | Bacteria | 2987 |
| 1019 | Ga0496126_0098284 | 3300048929 | Bacteria | 2565 |
| 1020 | Ga0496126_0117146 | 3300048929 | Bacteria | 2314 |
| 1021 | Ga0496126_0147139 | 3300048929 | Bacteria | 2022 |
| 1022 | Ga0496126_0156031 | 3300048929 | Bacteria | 1953 |
| 1023 | Ga0496126_0203730 | 3300048929 | Bacteria | 1669 |
| 1024 | Ga0496126_0205094 | 3300048929 | Bacteria | 1662 |
| 1025 | Ga0496126_0214335 | 3300048929 | Bacteria | 1620 |
| 1026 | Ga0496126_0536482 | 3300048929 | Bacteria | 930 |
| 1027 | Ga0496126_0556622 | 3300048929 | Bacteria | 909 |
| 1028 | Ga0496126_0599010 | 3300048929 | Bacteria | 868 |
| 1029 | Ga0496126_0649802 | 3300048929 | Bacteria | 825 |
| 1030 | Ga0495682_0047761 | 3300049460 | Bacteria | 1561 |
| 1031 | Ga0501031_0000377 | 3300049568 | Bacteria | 26157 |
| 1032 | Ga0501031_0006067 | 3300049568 | Bacteria | 7891 |
| 1033 | Ga0501032_0000040 | 3300049569 | Bacteria | 115662 |
| 1034 | Ga0501032_0003836 | 3300049569 | Bacteria | 11418 |
| 1035 | Ga0501032_0077513 | 3300049569 | Bacteria | 2213 |
| 1036 | Ga0501032_0099791 | 3300049569 | Bacteria | 1923 |
| 1037 | Ga0501032_0398695 | 3300049569 | Bacteria | 884 |
| 1038 | Ga0501032_0513354 | 3300049569 | Bacteria | 765 |
| 1039 | Ga0501033_0000128 | 3300049570 | Bacteria | 73419 |
| 1040 | Ga0501033_0000291 | 3300049570 | Bacteria | 48207 |
| 1041 | Ga0501033_0140680 | 3300049570 | Bacteria | 1744 |
| 1042 | Ga0501033_0460506 | 3300049570 | Bacteria | 882 |
| 1043 | Ga0501034_0000254 | 3300049571 | Bacteria | 97896 |
| 1044 | Ga0501034_0014046 | 3300049571 | Bacteria | 8248 |
| 1045 | Ga0501034_0075462 | 3300049571 | Bacteria | 3379 |
| 1046 | Ga0501034_0170155 | 3300049571 | Bacteria | 2146 |
| 1047 | Ga0501034_0195466 | 3300049571 | Bacteria | 1983 |
| 1048 | Ga0501034_0715413 | 3300049571 | Bacteria | 899 |
| 1049 | Ga0501034_0745947 | 3300049571 | Bacteria | 875 |
| 1050 | Ga0501036_0253219 | 3300049572 | Bacteria | 1475 |
| 1051 | Ga0501036_0344726 | 3300049572 | Bacteria | 1244 |
| 1052 | Ga0501036_0555778 | 3300049572 | Bacteria | 953 |
| 1053 | Ga0501037_0000041 | 3300049573 | Bacteria | 118457 |
| 1054 | Ga0501037_0000723 | 3300049573 | Bacteria | 25000 |
| 1055 | Ga0501037_0105678 | 3300049573 | Bacteria | 2029 |
| 1056 | Ga0501037_0199944 | 3300049573 | Bacteria | 1412 |
| 1057 | Ga0501038_0000057 | 3300049574 | Bacteria | 92766 |
| 1058 | Ga0501038_0015059 | 3300049574 | Bacteria | 7040 |
| 1059 | Ga0501038_0019298 | 3300049574 | Bacteria | 6149 |
| 1060 | Ga0501038_0025093 | 3300049574 | Bacteria | 5314 |
| 1061 | Ga0501038_0150539 | 3300049574 | Bacteria | 1897 |
| 1062 | Ga0501038_0160760 | 3300049574 | Bacteria | 1825 |
| 1063 | Ga0501038_0200100 | 3300049574 | Bacteria | 1603 |
| 1064 | Ga0501038_0290204 | 3300049574 | Bacteria | 1286 |
| 1065 | Ga0501039_0012981 | 3300049575 | Bacteria | 6370 |
| 1066 | Ga0501039_0036122 | 3300049575 | Bacteria | 3812 |
| 1067 | Ga0501039_0083298 | 3300049575 | Bacteria | 2490 |
| 1068 | Ga0501039_0313786 | 3300049575 | Bacteria | 1232 |
| 1069 | Ga0501040_0021943 | 3300049576 | Bacteria | 4269 |
| 1070 | Ga0501041_0076454 | 3300049577 | Bacteria | 2060 |
| 1071 | Ga0501042_0094801 | 3300049578 | Bacteria | 2143 |
| 1072 | Ga0501043_0000184 | 3300049579 | Bacteria | 56470 |
| 1073 | Ga0501043_0014167 | 3300049579 | Bacteria | 6238 |
| 1074 | Ga0501043_0055594 | 3300049579 | Bacteria | 3109 |
| 1075 | Ga0501043_0231712 | 3300049579 | Bacteria | 1426 |
| 1076 | Ga0501046_0000072 | 3300049580 | Bacteria | 106407 |
| 1077 | Ga0501046_0010044 | 3300049580 | Bacteria | 8153 |
| 1078 | Ga0501046_0025914 | 3300049580 | Bacteria | 4792 |
| 1079 | Ga0501046_0458459 | 3300049580 | Bacteria | 916 |
| 1080 | Ga0501047_0000044 | 3300049581 | Bacteria | 174789 |
| 1081 | Ga0501047_0028170 | 3300049581 | Bacteria | 5413 |
| 1082 | Ga0501047_0213160 | 3300049581 | Bacteria | 1789 |
| 1083 | Ga0501047_0271921 | 3300049581 | Bacteria | 1540 |
| 1084 | Ga0501047_0455414 | 3300049581 | Bacteria | 1108 |
| 1085 | Ga0501048_0000117 | 3300049582 | Bacteria | 45344 |
| 1086 | Ga0501048_0012237 | 3300049582 | Bacteria | 6386 |
| 1087 | Ga0501067_0001815 | 3300049583 | Bacteria | 11741 |
| 1088 | Ga0501067_0032603 | 3300049583 | Bacteria | 2892 |
| 1089 | Ga0501068_0001318 | 3300049584 | Bacteria | 13160 |
| 1090 | Ga0501069_0002548 | 3300049585 | Bacteria | 9309 |
| 1091 | Ga0501070_0010826 | 3300049586 | Bacteria | 7704 |
| 1092 | Ga0501070_0018396 | 3300049586 | Bacteria | 5861 |
| 1093 | Ga0501070_0040320 | 3300049586 | Bacteria | 3894 |
| 1094 | Ga0501070_0068187 | 3300049586 | Bacteria | 2945 |
| 1095 | Ga0501070_0279151 | 3300049586 | Bacteria | 1363 |
| 1096 | Ga0501071_0097420 | 3300049587 | Bacteria | 2166 |
| 1097 | Ga0501071_0184407 | 3300049587 | Bacteria | 1564 |
| 1098 | Ga0501072_0000156 | 3300049588 | Bacteria | 50717 |
| 1099 | Ga0501072_0070627 | 3300049588 | Bacteria | 2758 |
| 1100 | Ga0501073_0002824 | 3300049589 | Bacteria | 13006 |
| 1101 | Ga0501073_0024045 | 3300049589 | Bacteria | 4375 |
| 1102 | Ga0501073_0216293 | 3300049589 | Bacteria | 1324 |
| 1103 | Ga0501074_0000035 | 3300049590 | Bacteria | 64770 |
| 1104 | Ga0501074_0002443 | 3300049590 | Bacteria | 12958 |
| 1105 | Ga0501074_0415353 | 3300049590 | Bacteria | 954 |
| 1106 | Ga0501076_0065005 | 3300049592 | Bacteria | 2908 |
| 1107 | Ga0501076_0187321 | 3300049592 | Bacteria | 1688 |
| 1108 | Ga0501209_125077 | 3300049656 | Bacteria | 765 |
| 1109 | Ga0501079_0005573 | 3300049741 | Bacteria | 9396 |
| 1110 | Ga0501079_0114107 | 3300049741 | Bacteria | 2100 |
| 1111 | Ga0501080_0008601 | 3300049742 | Bacteria | 9261 |
| 1112 | Ga0501080_0114315 | 3300049742 | Bacteria | 2502 |
| 1113 | Ga0501080_0452877 | 3300049742 | Bacteria | 1150 |
| 1114 | Ga0501083_0000641 | 3300049744 | Bacteria | 22636 |
| 1115 | Ga0501083_0015704 | 3300049744 | Bacteria | 5300 |
| 1116 | Ga0501035_0000128 | 3300049822 | Bacteria | 92297 |
| 1117 | Ga0501035_0000688 | 3300049822 | Bacteria | 36917 |
| 1118 | Ga0501035_0021153 | 3300049822 | Bacteria | 5979 |
| 1119 | Ga0501035_0057655 | 3300049822 | Bacteria | 3462 |
| 1120 | Ga0501035_0273723 | 3300049822 | Bacteria | 1428 |
| 1121 | Ga0501035_0644437 | 3300049822 | Bacteria | 859 |
| 1122 | Ga0501035_0832803 | 3300049822 | Bacteria | 735 |
| 1123 | Ga0501044_0000108 | 3300049823 | Bacteria | 100968 |
| 1124 | Ga0501044_0005432 | 3300049823 | Bacteria | 14156 |
| 1125 | Ga0501044_0077476 | 3300049823 | Bacteria | 3372 |
| 1126 | Ga0501044_0096923 | 3300049823 | Bacteria | 2970 |
| 1127 | Ga0501044_0138109 | 3300049823 | Bacteria | 2427 |
| 1128 | Ga0501044_0368464 | 3300049823 | Bacteria | 1353 |
| 1129 | Ga0501044_0523294 | 3300049823 | Bacteria | 1085 |
| 1130 | nmdc:mga03n38_46423_c1 | 3300050490 | Bacteria | 1918 |
| 1131 | nmdc:mga00v17_19538_c1 | 3300050491 | Bacteria | 3869 |
| 1132 | nmdc:mga0yw44_156531_c1 | 3300050492 | Bacteria | 1490 |
| 1133 | nmdc:mga0yw44_415317_c1 | 3300050492 | Bacteria | 911 |
| 1134 | nmdc:mga0yw44_52465_c1 | 3300050492 | Bacteria | 2472 |
| 1135 | nmdc:mga0yw44_57242_c1 | 3300050492 | Bacteria | 2378 |
| 1136 | nmdc:mga0k408_157251_c1 | 3300050493 | Bacteria | 1354 |
| 1137 | nmdc:mga0k408_201879_c1 | 3300050493 | Bacteria | 1187 |
| 1138 | nmdc:mga0k408_300346_c1 | 3300050493 | Bacteria | 958 |
| 1139 | nmdc:mga06z11_179815_c1 | 3300050494 | Bacteria | 1219 |
| 1140 | nmdc:mga06z11_227038_c1 | 3300050494 | Bacteria | 1093 |
| 1141 | nmdc:mga06z11_32421_c1 | 3300050494 | Bacteria | 2548 |
| 1142 | nmdc:mga06z11_40491_c1 | 3300050494 | Bacteria | 2325 |
| 1143 | nmdc:mga06z11_406160_c1 | 3300050494 | Bacteria | 820 |
| 1144 | nmdc:mga06z11_425849_c1 | 3300050494 | Bacteria | 800 |
| 1145 | nmdc:mga04h51_229103_c1 | 3300050495 | Bacteria | 739 |
| 1146 | nmdc:mga07m45_37097_c1 | 3300050496 | Bacteria | 2718 |
| 1147 | nmdc:mga07m45_43325_c1 | 3300050496 | Bacteria | 2523 |
| 1148 | nmdc:mga07m45_48959_c1 | 3300050496 | Bacteria | 2378 |
| 1149 | nmdc:mga08y16_1118007_c1 | 3300050511 | Bacteria | 762 |
| 1150 | nmdc:mga0n895_134711_c1 | 3300050512 | Bacteria | 2496 |
| 1151 | nmdc:mga0rr50_226356_c1 | 3300050513 | Bacteria | 1546 |
| 1152 | nmdc:mga0sz30_47184_c1 | 3300050516 | Bacteria | 1820 |
| 1153 | nmdc:mga0sz30_68907_c1 | 3300050516 | Bacteria | 1521 |
| 1154 | nmdc:mga0sz30_97850_c1 | 3300050516 | Bacteria | 1280 |
| 1155 | nmdc:mga0sz30_99987_c1 | 3300050516 | Bacteria | 1266 |
| 1156 | Ga0495601_0060163 | 3300053077 | Bacteria | 2410 |
| 1157 | Ga0495601_0085026 | 3300053077 | Bacteria | 2032 |
| 1158 | Ga0495601_0295696 | 3300053077 | Bacteria | 1055 |
| 1159 | Ga0495612_0054442 | 3300053078 | Bacteria | 1648 |
| 1160 | Ga0495612_0057281 | 3300053078 | Bacteria | 1609 |
| 1161 | Ga0495612_0264197 | 3300053078 | Bacteria | 767 |
| 1162 | Ga0500610_0143787 | 3300053079 | Bacteria | 1202 |
| 1163 | Ga0500635_0010037 | 3300053080 | Bacteria | 2647 |
| 1164 | Ga0495595_0004969 | 3300053084 | Bacteria | 5366 |
| 1165 | Ga0495595_0130591 | 3300053084 | Bacteria | 1227 |
| 1166 | Ga0495619_0002350 | 3300053085 | Bacteria | 12447 |
| 1167 | Ga0495619_0199729 | 3300053085 | Bacteria | 1384 |
| 1168 | Ga0495619_0229170 | 3300053085 | Bacteria | 1287 |
| 1169 | Ga0500643_000079 | 3300053087 | Bacteria | 104107 |
| 1170 | Ga0500643_004939 | 3300053087 | Bacteria | 5864 |
| 1171 | Ga0500651_0014125 | 3300053093 | Bacteria | 4881 |
| 1172 | Ga0500651_0123890 | 3300053093 | Bacteria | 1567 |
| 1173 | Ga0500651_0172550 | 3300053093 | Bacteria | 1288 |
| 1174 | Ga0500566_0000839 | 3300053094 | Bacteria | 17527 |
| 1175 | Ga0500566_0016060 | 3300053094 | Bacteria | 4398 |
| 1176 | Ga0500566_0018425 | 3300053094 | Bacteria | 4099 |
| 1177 | Ga0500640_089708 | 3300053095 | Bacteria | 1290 |
| 1178 | Ga0500641_0008056 | 3300053096 | Bacteria | 3754 |
| 1179 | Ga0500641_0026859 | 3300053096 | Bacteria | 2238 |
| 1180 | Ga0500641_0143640 | 3300053096 | Bacteria | 1031 |
| 1181 | Ga0500650_0046741 | 3300053098 | Bacteria | 2005 |
| 1182 | Ga0500554_002420 | 3300053102 | Bacteria | 3669 |
| 1183 | Ga0500554_003584 | 3300053102 | Bacteria | 3199 |
| 1184 | Ga0500555_012696 | 3300053103 | Bacteria | 2425 |
| 1185 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 1186 | Ga0500556_0133228 | 3300053104 | Bacteria | 974 |
| 1187 | Ga0500557_000034 | 3300053105 | Bacteria | 71225 |
| 1188 | Ga0500569_127748 | 3300053109 | Bacteria | 849 |
| 1189 | Ga0500572_005149 | 3300053111 | Bacteria | 2956 |
| 1190 | Ga0500572_009276 | 3300053111 | Bacteria | 2322 |
| 1191 | Ga0500592_030017 | 3300053116 | Bacteria | 877 |
| 1192 | Ga0500593_106790 | 3300053117 | Bacteria | 1158 |
| 1193 | Ga0500595_009330 | 3300053119 | Bacteria | 3963 |
| 1194 | Ga0500595_026590 | 3300053119 | Bacteria | 1992 |
| 1195 | Ga0500607_028739 | 3300053121 | Bacteria | 3076 |
| 1196 | Ga0500607_033910 | 3300053121 | Bacteria | 2796 |
| 1197 | Ga0500608_000330 | 3300053122 | Bacteria | 18247 |
| 1198 | Ga0500608_116450 | 3300053122 | Bacteria | 1218 |
| 1199 | Ga0500614_081683 | 3300053123 | Bacteria | 905 |
| 1200 | Ga0500618_008175 | 3300053125 | Bacteria | 2939 |
| 1201 | Ga0500621_122581 | 3300053126 | Bacteria | 1005 |
| 1202 | Ga0500621_165271 | 3300053126 | Bacteria | 817 |
| 1203 | Ga0500642_0000167 | 3300053130 | Bacteria | 27218 |
| 1204 | Ga0500642_0000400 | 3300053130 | Bacteria | 14269 |
| 1205 | Ga0500642_0093157 | 3300053130 | Bacteria | 1394 |
| 1206 | Ga0500652_001376 | 3300053131 | Bacteria | 7601 |
| 1207 | Ga0500652_044814 | 3300053131 | Bacteria | 1791 |
| 1208 | Ga0500655_047898 | 3300053133 | Bacteria | 848 |
| 1209 | Ga0500658_0065304 | 3300053134 | Bacteria | 1523 |
| 1210 | Ga0500658_0111099 | 3300053134 | Bacteria | 1206 |
| 1211 | Ga0500658_0132176 | 3300053134 | Bacteria | 1114 |
| 1212 | Ga0500559_0000696 | 3300053136 | Bacteria | 22137 |
| 1213 | Ga0500559_0002014 | 3300053136 | Bacteria | 10895 |
| 1214 | Ga0500559_0063271 | 3300053136 | Bacteria | 1653 |
| 1215 | Ga0500559_0113361 | 3300053136 | Bacteria | 1257 |
| 1216 | Ga0500559_0114786 | 3300053136 | Bacteria | 1249 |
| 1217 | Ga0500564_164985 | 3300053138 | Bacteria | 935 |
| 1218 | Ga0500564_210732 | 3300053138 | Bacteria | 792 |
| 1219 | Ga0500568_0006608 | 3300053139 | Bacteria | 5799 |
| 1220 | Ga0500568_0046396 | 3300053139 | Bacteria | 1724 |
| 1221 | Ga0500573_0006675 | 3300053140 | Bacteria | 6258 |
| 1222 | Ga0500577_0038419 | 3300053142 | Bacteria | 1728 |
| 1223 | Ga0500589_022024 | 3300053147 | Bacteria | 2929 |
| 1224 | Ga0500590_049762 | 3300053148 | Bacteria | 2133 |
| 1225 | Ga0500590_055939 | 3300053148 | Bacteria | 1995 |
| 1226 | Ga0500603_001436 | 3300053150 | Bacteria | 5444 |
| 1227 | Ga0500603_030306 | 3300053150 | Bacteria | 1391 |
| 1228 | Ga0500603_136790 | 3300053150 | Bacteria | 752 |
| 1229 | Ga0500604_0007365 | 3300053151 | Bacteria | 2914 |
| 1230 | Ga0500604_0098414 | 3300053151 | Bacteria | 962 |
| 1231 | Ga0500604_0127050 | 3300053151 | Bacteria | 855 |
| 1232 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 1233 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 1234 | Ga0500620_019648 | 3300053155 | Bacteria | 1989 |
| 1235 | Ga0500622_0008163 | 3300053156 | Bacteria | 5881 |
| 1236 | Ga0500624_003405 | 3300053157 | Bacteria | 2089 |
| 1237 | Ga0500627_0005379 | 3300053158 | Bacteria | 4251 |
| 1238 | Ga0500627_0082232 | 3300053158 | Bacteria | 1436 |
| 1239 | Ga0500630_102889 | 3300053159 | Bacteria | 1298 |
| 1240 | Ga0500633_0047142 | 3300053160 | Bacteria | 1474 |
| 1241 | Ga0500638_076439 | 3300053162 | Bacteria | 1595 |
| 1242 | Ga0500638_146190 | 3300053162 | Bacteria | 1056 |
| 1243 | Ga0500639_040385 | 3300053163 | Bacteria | 2455 |
| 1244 | Ga0500636_0000016 | 3300053177 | Bacteria | 123469 |
| 1245 | Ga0500636_0003032 | 3300053177 | Bacteria | 9413 |
| 1246 | Ga0500636_0010062 | 3300053177 | Bacteria | 5507 |
| 1247 | Ga0500636_0102246 | 3300053177 | Bacteria | 1627 |
| 1248 | Ga0500637_0000172 | 3300053178 | Bacteria | 24102 |
| 1249 | Ga0500637_0324055 | 3300053178 | Bacteria | 831 |
| 1250 | Ga0500576_110125 | 3300053725 | Bacteria | 1106 |
| 1251 | Ga0500611_049459 | 3300053727 | Bacteria | 957 |
| 1252 | Ga0500625_004258 | 3300053729 | Bacteria | 5812 |
| 1253 | Ga0500645_022463 | 3300053730 | Bacteria | 1940 |
| 1254 | Ga0500609_022540 | 3300053731 | Bacteria | 862 |
| 1255 | Ga0500656_021830 | 3300053732 | Bacteria | 799 |
| 1256 | Ga0500596_002622 | 3300053735 | Bacteria | 3531 |
| 1257 | Ga0500596_007030 | 3300053735 | Bacteria | 1864 |
| 1258 | Ga0500596_012800 | 3300053735 | Bacteria | 1271 |
| 1259 | Ga0500599_020197 | 3300053736 | Bacteria | 941 |
| 1260 | Ga0500601_001828 | 3300053737 | Bacteria | 2278 |
| 1261 | Ga0500601_002478 | 3300053737 | Bacteria | 1979 |
| 1262 | Ga0501084_0002007 | 3300054114 | Bacteria | 16265 |
| 1263 | Ga0501084_0014750 | 3300054114 | Bacteria | 6481 |
| 1264 | Ga0500661_001292 | 3300055283 | Bacteria | 4680 |
| 1265 | Ga0500661_012499 | 3300055283 | Bacteria | 1532 |
| 1266 | Ga0501082_0002249 | 3300060353 | Bacteria | 16902 |
| 1267 | Ga0501082_0038629 | 3300060353 | Bacteria | 4118 |
| 1268 | Ga0466962_0033208 | 3300061719 | Bacteria | 2469 |
| 1269 | Ga0466962_0059302 | 3300061719 | Bacteria | 1827 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2903748898 | 2903756794 | 213 |
| 2 | 3300041492 | Ga0451835_0124610 | Ga0451835_0124610_37_684 | 215 |
| 3 | 3300046660 | Ga0495625_0281832 | Ga0495625_0281832_375_1031 | 215 |
| 4 | 3300048905 | Ga0496102_0283394 | Ga0496102_0283394_896_1552 | 215 |
| 5 | 3300048911 | Ga0496108_0565762 | Ga0496108_0565762_11_670 | 215 |
| 6 | 3300048920 | Ga0496117_0138041 | Ga0496117_0138041_785_1441 | 215 |
| 7 | 3300049569 | Ga0501032_0513354 | Ga0501032_0513354_19_678 | 215 |
| 8 | 3300049571 | Ga0501034_0745947 | Ga0501034_0745947_44_703 | 215 |
| 9 | 3300053151 | Ga0500604_0127050 | Ga0500604_0127050_13_669 | 215 |
| 10 | 3300006028 | Ga0070717_10534744 | Ga0070717_105347442 | 217 |
| 11 | iso_pu_bacteria | 2922368715 | 2922378545 | 217 |
| 12 | 3300035083 | Ga0373926_0025759 | Ga0373926_0025759_500_1261 | 218 |
| 13 | 3300035111 | Ga0373923_0007529 | Ga0373923_0007529_2415_3176 | 218 |
| 14 | 3300035113 | Ga0373936_0004331 | Ga0373936_0004331_2060_2758 | 218 |
| 15 | 3300035117 | Ga0373953_0088105 | Ga0373953_0088105_44_805 | 218 |
| 16 | 3300035118 | Ga0373954_0083181 | Ga0373954_0083181_184_882 | 218 |
| 17 | 3300035170 | Ga0373943_0045345 | Ga0373943_0045345_951_1640 | 218 |
| 18 | 3300035171 | Ga0373946_0106711 | Ga0373946_0106711_377_1075 | 218 |
| 19 | 3300035410 | Ga0373924_0006537 | Ga0373924_0006537_3336_4094 | 218 |
| 20 | 3300035692 | Ga0373935_0209753 | Ga0373935_0209753_27_788 | 218 |
| 21 | 3300035724 | Ga0373933_0030441 | Ga0373933_0030441_139_900 | 218 |
| 22 | 3300035725 | Ga0373947_0019438 | Ga0373947_0019438_2326_3024 | 218 |
| 23 | 3300037068 | Ga0373925_0096101 | Ga0373925_0096101_1006_1767 | 218 |
| 24 | 3300046454 | Ga0495592_0020079 | Ga0495592_0020079_1223_1984 | 218 |
| 25 | 3300046472 | Ga0495580_0126388 | Ga0495580_0126388_650_1411 | 218 |
| 26 | 3300046473 | Ga0495582_0006668 | Ga0495582_0006668_2675_3370 | 218 |
| 27 | 3300046477 | Ga0495664_0011821 | Ga0495664_0011821_2409_3170 | 218 |
| 28 | 3300046516 | Ga0495628_0113540 | Ga0495628_0113540_903_1664 | 218 |
| 29 | 3300046517 | Ga0495630_0077166 | Ga0495630_0077166_1664_2425 | 218 |
| 30 | 3300046529 | Ga0495652_0079593 | Ga0495652_0079593_653_1414 | 218 |
| 31 | 3300046535 | Ga0495586_0215060 | Ga0495586_0215060_15_773 | 218 |
| 32 | 3300046543 | Ga0495645_0020509 | Ga0495645_0020509_3311_4072 | 218 |
| 33 | 3300046642 | Ga0495634_0049998 | Ga0495634_0049998_1007_1768 | 218 |
| 34 | 3300046681 | Ga0495647_0008433 | Ga0495647_0008433_1572_2333 | 218 |
| 35 | 3300046683 | Ga0495658_0124749 | Ga0495658_0124749_224_913 | 218 |
| 36 | 3300046689 | Ga0495613_0100295 | Ga0495613_0100295_560_1321 | 218 |
| 37 | 3300047319 | Ga0495674_0044251 | Ga0495674_0044251_2375_3136 | 218 |
| 38 | 3300047444 | Ga0495675_0170302 | Ga0495675_0170302_492_1253 | 218 |
| 39 | 3300047673 | Ga0495593_0031077 | Ga0495593_0031077_1206_1904 | 218 |
| 40 | 3300053077 | Ga0495601_0295696 | Ga0495601_0295696_96_923 | 218 |
| 41 | 3300053078 | Ga0495612_0057281 | Ga0495612_0057281_188_886 | 218 |
| 42 | 3300048929 | Ga0496126_0098284 | Ga0496126_0098284_687_1379 | 219 |
| 43 | 3300005458 | Ga0070681_10151763 | Ga0070681_101517633 | 220 |
| 44 | 3300005563 | Ga0068855_100133882 | Ga0068855_1001338824 | 220 |
| 45 | 3300025949 | Ga0207667_10619978 | Ga0207667_106199782 | 221 |
| 46 | 3300026041 | Ga0207639_10501367 | Ga0207639_105013671 | 221 |
| 47 | 3300006028 | Ga0070717_10069573 | Ga0070717_100695732 | 222 |
| 48 | iso_pu_bacteria | 2524023210 | 2524466187 | 222 |
| 49 | iso_pu_bacteria | 2903768456 | 2903771535 | 222 |
| 50 | 3300005329 | Ga0070683_100110142 | Ga0070683_1001101421 | 223 |
| 51 | 3300005530 | Ga0070679_100450714 | Ga0070679_1004507141 | 223 |
| 52 | 3300005535 | Ga0070684_100414807 | Ga0070684_1004148071 | 223 |
| 53 | 3300013105 | Ga0157369_10740703 | Ga0157369_107407031 | 223 |
| 54 | 3300025912 | Ga0207707_10305503 | Ga0207707_103055032 | 223 |
| 55 | 3300025944 | Ga0207661_10492713 | Ga0207661_104927132 | 223 |
| 56 | iso_pu_bacteria | 2513237098 | 2513677603 | 223 |
| 57 | iso_pu_bacteria | 2667528175 | 2671121368 | 223 |
| 58 | iso_pu_bacteria | 2791355197 | 2793071011 | 223 |
| 59 | iso_pu_bacteria | 2874604998 | 2874606915 | 223 |
| 60 | iso_pu_bacteria | 2885374607 | 2885381911 | 223 |
| 61 | iso_pu_bacteria | 2906635258 | 2906640247 | 223 |
| 62 | iso_pu_bacteria | 2906660503 | 2906668670 | 223 |
| 63 | iso_pu_bacteria | 2908739725 | 2908747955 | 223 |
| 64 | iso_pu_bacteria | 2922425934 | 2922433672 | 223 |
| 65 | iso_pu_bacteria | 3005474847 | 3005483327 | 223 |
| 66 | iso_pu_bacteria | 8019555841 | 8019563090 | 223 |
| 67 | iso_pu_bacteria | 8019565922 | 8019573171 | 223 |
| 68 | iso_pu_bacteria | 8056673599 | 8056678391 | 223 |
| 69 | 3300025912 | Ga0207707_10002360 | Ga0207707_100023606 | 224 |
| 70 | 3300031239 | Ga0265328_10056045 | Ga0265328_100560452 | 224 |
| 71 | 3300039450 | Ga0436363_0593082 | Ga0436363_0593082_26_760 | 224 |
| 72 | iso_pu_bacteria | 2507262055 | 2507504643 | 224 |
| 73 | iso_pu_bacteria | 2508501009 | 2508539633 | 224 |
| 74 | iso_pu_bacteria | 2508501042 | 2508694924 | 224 |
| 75 | iso_pu_bacteria | 2511231028 | 2511393263 | 224 |
| 76 | iso_pu_bacteria | 2513237092 | 2513627020 | 224 |
| 77 | iso_pu_bacteria | 2513237094 | 2513638530 | 224 |
| 78 | iso_pu_bacteria | 2513237095 | 2513653122 | 224 |
| 79 | iso_pu_bacteria | 2513237096 | 2513658958 | 224 |
| 80 | iso_pu_bacteria | 2513237101 | 2513694331 | 224 |
| 81 | iso_pu_bacteria | 2513237102 | 2513699138 | 224 |
| 82 | iso_pu_bacteria | 2513237104 | 2513714845 | 224 |
| 83 | iso_pu_bacteria | 2513237137 | 2513858849 | 224 |
| 84 | iso_pu_bacteria | 2513237139 | 2513875644 | 224 |
| 85 | iso_pu_bacteria | 2513237145 | 2513921222 | 224 |
| 86 | iso_pu_bacteria | 2513237161 | 2514016311 | 224 |
| 87 | iso_pu_bacteria | 2517093001 | 2517108140 | 224 |
| 88 | iso_pu_bacteria | 2517572143 | 2517889346 | 224 |
| 89 | iso_pu_bacteria | 2524023205 | 2524438639 | 224 |
| 90 | iso_pu_bacteria | 2524023228 | 2524540395 | 224 |
| 91 | iso_pu_bacteria | 2528768022 | 2528851467 | 224 |
| 92 | iso_pu_bacteria | 2617270735 | 2617347503 | 224 |
| 93 | iso_pu_bacteria | 2617270741 | 2617377095 | 224 |
| 94 | iso_pu_bacteria | 2728368998 | 2728754255 | 224 |
| 95 | iso_pu_bacteria | 2744054633 | 2745080573 | 224 |
| 96 | iso_pu_bacteria | 2791355196 | 2793063280 | 224 |
| 97 | iso_pu_bacteria | 2802429603 | 2805919320 | 224 |
| 98 | iso_pu_bacteria | 2816332527 | 2818243382 | 224 |
| 99 | iso_pu_bacteria | 2824600985 | 2824608651 | 224 |
| 100 | iso_pu_bacteria | 2824609381 | 2824612007 | 224 |
| 101 | iso_pu_bacteria | 2824617872 | 2824622550 | 224 |
| 102 | iso_pu_bacteria | 2824626560 | 2824633911 | 224 |
| 103 | iso_pu_bacteria | 2824635225 | 2824642354 | 224 |
| 104 | iso_pu_bacteria | 2824644064 | 2824649884 | 224 |
| 105 | iso_pu_bacteria | 2824661429 | 2824670288 | 224 |
| 106 | iso_pu_bacteria | 2824671348 | 2824678689 | 224 |
| 107 | iso_pu_bacteria | 2824679649 | 2824684157 | 224 |
| 108 | iso_pu_bacteria | 2824687955 | 2824694793 | 224 |
| 109 | iso_pu_bacteria | 2824696289 | 2824704086 | 224 |
| 110 | iso_pu_bacteria | 2824704595 | 2824711075 | 224 |
| 111 | iso_pu_bacteria | 2824714736 | 2824722552 | 224 |
| 112 | iso_pu_bacteria | 2824723954 | 2824730128 | 224 |
| 113 | iso_pu_bacteria | 2824732956 | 2824738863 | 224 |
| 114 | iso_pu_bacteria | 2824746037 | 2824752525 | 224 |
| 115 | iso_pu_bacteria | 2824753945 | 2824762857 | 224 |
| 116 | iso_pu_bacteria | 2824763712 | 2824770633 | 224 |
| 117 | iso_pu_bacteria | 2824773399 | 2824780182 | 224 |
| 118 | iso_pu_bacteria | 2838122688 | 2838130281 | 224 |
| 119 | iso_pu_bacteria | 2841949485 | 2841954546 | 224 |
| 120 | iso_pu_bacteria | 2841957949 | 2841962988 | 224 |
| 121 | iso_pu_bacteria | 2841966195 | 2841969054 | 224 |
| 122 | iso_pu_bacteria | 2841974524 | 2841979827 | 224 |
| 123 | iso_pu_bacteria | 2841983080 | 2841989575 | 224 |
| 124 | iso_pu_bacteria | 2842038055 | 2842044079 | 224 |
| 125 | iso_pu_bacteria | 2842045827 | 2842051932 | 224 |
| 126 | iso_pu_bacteria | 2844315083 | 2844316049 | 224 |
| 127 | iso_pu_bacteria | 2847930680 | 2847931537 | 224 |
| 128 | iso_pu_bacteria | 2847939898 | 2847941571 | 224 |
| 129 | iso_pu_bacteria | 2849076700 | 2849082493 | 224 |
| 130 | iso_pu_bacteria | 2857509624 | 2857516629 | 224 |
| 131 | iso_pu_bacteria | 2874590934 | 2874593135 | 224 |
| 132 | iso_pu_bacteria | 2874612657 | 2874619960 | 224 |
| 133 | iso_pu_bacteria | 2874620515 | 2874621435 | 224 |
| 134 | iso_pu_bacteria | 2874628541 | 2874632948 | 224 |
| 135 | iso_pu_bacteria | 2874645413 | 2874645742 | 224 |
| 136 | iso_pu_bacteria | 2876761206 | 2876763371 | 224 |
| 137 | iso_pu_bacteria | 2876771140 | 2876773175 | 224 |
| 138 | iso_pu_bacteria | 2876818435 | 2876820482 | 224 |
| 139 | iso_pu_bacteria | 2879074833 | 2879076879 | 224 |
| 140 | iso_pu_bacteria | 2879083081 | 2879091339 | 224 |
| 141 | iso_pu_bacteria | 2879099564 | 2879102305 | 224 |
| 142 | iso_pu_bacteria | 2879127579 | 2879131066 | 224 |
| 143 | iso_pu_bacteria | 2879142872 | 2879150273 | 224 |
| 144 | iso_pu_bacteria | 2881364244 | 2881364915 | 224 |
| 145 | iso_pu_bacteria | 2881665667 | 2881668568 | 224 |
| 146 | iso_pu_bacteria | 2885366525 | 2885368182 | 224 |
| 147 | iso_pu_bacteria | 2885383462 | 2885384775 | 224 |
| 148 | iso_pu_bacteria | 2885409591 | 2885417087 | 224 |
| 149 | iso_pu_bacteria | 2888378607 | 2888378816 | 224 |
| 150 | iso_pu_bacteria | 2888388044 | 2888391206 | 224 |
| 151 | iso_pu_bacteria | 2888419890 | 2888427241 | 224 |
| 152 | iso_pu_bacteria | 2889033259 | 2889036163 | 224 |
| 153 | iso_pu_bacteria | 2903727486 | 2903729555 | 224 |
| 154 | iso_pu_bacteria | 2904666416 | 2904668104 | 224 |
| 155 | iso_pu_bacteria | 2904690495 | 2904692447 | 224 |
| 156 | iso_pu_bacteria | 2904699407 | 2904709224 | 224 |
| 157 | iso_pu_bacteria | 2904711408 | 2904719879 | 224 |
| 158 | iso_pu_bacteria | 2906602504 | 2906608929 | 224 |
| 159 | iso_pu_bacteria | 2906626472 | 2906627170 | 224 |
| 160 | iso_pu_bacteria | 2906643746 | 2906645658 | 224 |
| 161 | iso_pu_bacteria | 2908756301 | 2908764399 | 224 |
| 162 | iso_pu_bacteria | 2908775508 | 2908783006 | 224 |
| 163 | iso_pu_bacteria | 2922361189 | 2922364537 | 224 |
| 164 | iso_pu_bacteria | 2922386360 | 2922389221 | 224 |
| 165 | iso_pu_bacteria | 2922393267 | 2922400963 | 224 |
| 166 | iso_pu_bacteria | 2929615660 | 2929623675 | 224 |
| 167 | iso_pu_bacteria | 2929624759 | 2929632883 | 224 |
| 168 | iso_pu_bacteria | 2932784394 | 2932789770 | 224 |
| 169 | iso_pu_bacteria | 2932794094 | 2932799537 | 224 |
| 170 | iso_pu_bacteria | 2932801729 | 2932805157 | 224 |
| 171 | iso_pu_bacteria | 2932809354 | 2932816899 | 224 |
| 172 | iso_pu_bacteria | 2932818245 | 2932826039 | 224 |
| 173 | iso_pu_bacteria | 2932828146 | 2932829403 | 224 |
| 174 | iso_pu_bacteria | 2933577622 | 2933585578 | 224 |
| 175 | iso_pu_bacteria | 2935608549 | 2935615162 | 224 |
| 176 | iso_pu_bacteria | 2935616580 | 2935617836 | 224 |
| 177 | iso_pu_bacteria | 2935630451 | 2935634716 | 224 |
| 178 | iso_pu_bacteria | 2935638405 | 2935643880 | 224 |
| 179 | iso_pu_bacteria | 2935648319 | 2935651481 | 224 |
| 180 | iso_pu_bacteria | 2935656913 | 2935659751 | 224 |
| 181 | iso_pu_bacteria | 2935665750 | 2935670810 | 224 |
| 182 | iso_pu_bacteria | 2935675223 | 2935678140 | 224 |
| 183 | iso_pu_bacteria | 2935684952 | 2935692428 | 224 |
| 184 | iso_pu_bacteria | 2935694250 | 2935699354 | 224 |
| 185 | iso_pu_bacteria | 2935703347 | 2935710162 | 224 |
| 186 | iso_pu_bacteria | 2935713505 | 2935721046 | 224 |
| 187 | iso_pu_bacteria | 2935722832 | 2935722871 | 224 |
| 188 | iso_pu_bacteria | 2935732158 | 2935739735 | 224 |
| 189 | iso_pu_bacteria | 2935741537 | 2935748773 | 224 |
| 190 | iso_pu_bacteria | 2935750917 | 2935758643 | 224 |
| 191 | iso_pu_bacteria | 2935760218 | 2935769028 | 224 |
| 192 | iso_pu_bacteria | 2935769743 | 2935775519 | 224 |
| 193 | iso_pu_bacteria | 2935777560 | 2935779768 | 224 |
| 194 | iso_pu_bacteria | 2935785616 | 2935790015 | 224 |
| 195 | iso_pu_bacteria | 2935793552 | 2935798444 | 224 |
| 196 | iso_pu_bacteria | 2935801545 | 2935806673 | 224 |
| 197 | iso_pu_bacteria | 2935810662 | 2935819798 | 224 |
| 198 | iso_pu_bacteria | 2935819856 | 2935825801 | 224 |
| 199 | iso_pu_bacteria | 2935827899 | 2935836934 | 224 |
| 200 | iso_pu_bacteria | 2935837841 | 2935843700 | 224 |
| 201 | iso_pu_bacteria | 2935847175 | 2935851420 | 224 |
| 202 | iso_pu_bacteria | 2935855204 | 2935856665 | 224 |
| 203 | iso_pu_bacteria | 2935864058 | 2935868144 | 224 |
| 204 | iso_pu_bacteria | 2935873716 | 2935879502 | 224 |
| 205 | iso_pu_bacteria | 2935883170 | 2935887753 | 224 |
| 206 | iso_pu_bacteria | 2935908558 | 2935910553 | 224 |
| 207 | iso_pu_bacteria | 2935916978 | 2935918043 | 224 |
| 208 | iso_pu_bacteria | 2935926038 | 2935927536 | 224 |
| 209 | iso_pu_bacteria | 2935934488 | 2935936592 | 224 |
| 210 | iso_pu_bacteria | 2935942939 | 2935943855 | 224 |
| 211 | iso_pu_bacteria | 2935951376 | 2935952292 | 224 |
| 212 | iso_pu_bacteria | 2935959822 | 2935967303 | 224 |
| 213 | iso_pu_bacteria | 2935967501 | 2935969132 | 224 |
| 214 | iso_pu_bacteria | 2935984226 | 2935984584 | 224 |
| 215 | iso_pu_bacteria | 2935992306 | 2936001229 | 224 |
| 216 | iso_pu_bacteria | 2936002035 | 2936009879 | 224 |
| 217 | iso_pu_bacteria | 2936011229 | 2936014167 | 224 |
| 218 | iso_pu_bacteria | 2936019824 | 2936022924 | 224 |
| 219 | iso_pu_bacteria | 2936028420 | 2936031060 | 224 |
| 220 | iso_pu_bacteria | 2936037263 | 2936046510 | 224 |
| 221 | iso_pu_bacteria | 2936046547 | 2936049182 | 224 |
| 222 | iso_pu_bacteria | 2936055302 | 2936055629 | 224 |
| 223 | iso_pu_bacteria | 2940556831 | 2940564767 | 224 |
| 224 | iso_pu_bacteria | 2941507105 | 2941511954 | 224 |
| 225 | iso_pu_bacteria | 2941515067 | 2941519656 | 224 |
| 226 | iso_pu_bacteria | 2941523033 | 2941527652 | 224 |
| 227 | iso_pu_bacteria | 2941531003 | 2941535909 | 224 |
| 228 | iso_pu_bacteria | 2941538514 | 2941544949 | 224 |
| 229 | iso_pu_bacteria | 3005483717 | 3005490484 | 224 |
| 230 | iso_pu_bacteria | 3005506211 | 3005509721 | 224 |
| 231 | iso_pu_bacteria | 3005587118 | 3005591188 | 224 |
| 232 | iso_pu_bacteria | 3005594810 | 3005595640 | 224 |
| 233 | iso_pu_bacteria | 3005710791 | 3005711631 | 224 |
| 234 | iso_pu_bacteria | 3005718088 | 3005718882 | 224 |
| 235 | iso_pu_bacteria | 8006926726 | 8006930150 | 224 |
| 236 | iso_pu_bacteria | 8006933436 | 8006935704 | 224 |
| 237 | iso_pu_bacteria | 8006964411 | 8006967686 | 224 |
| 238 | iso_pu_bacteria | 8006973647 | 8006975625 | 224 |
| 239 | iso_pu_bacteria | 8006984368 | 8006992661 | 224 |
| 240 | iso_pu_bacteria | 8016511872 | 8016518832 | 224 |
| 241 | iso_pu_bacteria | 8016522445 | 8016525611 | 224 |
| 242 | iso_pu_bacteria | 8016530956 | 8016539205 | 224 |
| 243 | iso_pu_bacteria | 8016539877 | 8016543493 | 224 |
| 244 | iso_pu_bacteria | 8016548790 | 8016549801 | 224 |
| 245 | iso_pu_bacteria | 8016566248 | 8016568895 | 224 |
| 246 | iso_pu_bacteria | 8016575299 | 8016581544 | 224 |
| 247 | iso_pu_bacteria | 8016583857 | 8016587101 | 224 |
| 248 | iso_pu_bacteria | 8016595262 | 8016596214 | 224 |
| 249 | iso_pu_bacteria | 8016603502 | 8016607117 | 224 |
| 250 | iso_pu_bacteria | 8016613128 | 8016619018 | 224 |
| 251 | iso_pu_bacteria | 8016630954 | 8016636522 | 224 |
| 252 | iso_pu_bacteria | 8017057580 | 8017057846 | 224 |
| 253 | iso_pu_bacteria | 8019530166 | 8019538873 | 224 |
| 254 | iso_pu_bacteria | 8019538911 | 8019541100 | 224 |
| 255 | iso_pu_bacteria | 8019576017 | 8019577880 | 224 |
| 256 | iso_pu_bacteria | 8019586578 | 8019595982 | 224 |
| 257 | iso_pu_bacteria | 8019608314 | 8019612760 | 224 |
| 258 | iso_pu_bacteria | 8019648815 | 8019653194 | 224 |
| 259 | iso_pu_bacteria | 8019687851 | 8019696909 | 224 |
| 260 | iso_pu_bacteria | 8055742211 | 8055750818 | 224 |
| 261 | iso_pu_bacteria | 8056681323 | 8056687802 | 224 |
| 262 | iso_pu_bacteria | 8056689827 | 8056694071 | 224 |
| 263 | iso_pu_bacteria | 8056967851 | 8056970642 | 224 |
| 264 | 3300005435 | Ga0070714_100333722 | Ga0070714_1003337222 | 225 |
| 265 | 3300025297 | Ga0209758_1015810 | Ga0209758_10158102 | 225 |
| 266 | 3300025929 | Ga0207664_10330114 | Ga0207664_103301141 | 225 |
| 267 | iso_pu_bacteria | 2906610324 | 2906613173 | 225 |
| 268 | 3300001979 | JGI24740J21852_10002716 | JGI24740J21852_100027162 | 226 |
| 269 | 3300001989 | JGI24739J22299_10029161 | JGI24739J22299_100291612 | 226 |
| 270 | 3300005336 | Ga0070680_100446137 | Ga0070680_1004461371 | 226 |
| 271 | 3300005439 | Ga0070711_100190470 | Ga0070711_1001904702 | 226 |
| 272 | 3300005455 | Ga0070663_100097162 | Ga0070663_1000971622 | 226 |
| 273 | 3300005455 | Ga0070663_100097589 | Ga0070663_1000975891 | 226 |
| 274 | 3300005455 | Ga0070663_100203609 | Ga0070663_1002036091 | 226 |
| 275 | 3300005458 | Ga0070681_10075805 | Ga0070681_100758051 | 226 |
| 276 | 3300005539 | Ga0068853_100062087 | Ga0068853_1000620872 | 226 |
| 277 | 3300005539 | Ga0068853_100201201 | Ga0068853_1002012011 | 226 |
| 278 | 3300005577 | Ga0068857_100013608 | Ga0068857_1000136083 | 226 |
| 279 | 3300005577 | Ga0068857_100148651 | Ga0068857_1001486512 | 226 |
| 280 | 3300005578 | Ga0068854_100025810 | Ga0068854_1000258103 | 226 |
| 281 | 3300005578 | Ga0068854_100206980 | Ga0068854_1002069802 | 226 |
| 282 | 3300005614 | Ga0068856_100015417 | Ga0068856_1000154178 | 226 |
| 283 | 3300005614 | Ga0068856_100083490 | Ga0068856_1000834903 | 226 |
| 284 | 3300005616 | Ga0068852_100119103 | Ga0068852_1001191032 | 226 |
| 285 | 3300005616 | Ga0068852_100284971 | Ga0068852_1002849712 | 226 |
| 286 | 3300005617 | Ga0068859_100264445 | Ga0068859_1002644452 | 226 |
| 287 | 3300005834 | Ga0068851_10001765 | Ga0068851_1000176510 | 226 |
| 288 | 3300006931 | Ga0097620_100264391 | Ga0097620_1002643912 | 226 |
| 289 | 3300009093 | Ga0105240_10007060 | Ga0105240_100070609 | 226 |
| 290 | 3300009174 | Ga0105241_10006700 | Ga0105241_100067002 | 226 |
| 291 | 3300009545 | Ga0105237_10764827 | Ga0105237_107648271 | 226 |
| 292 | 3300009551 | Ga0105238_10035069 | Ga0105238_100350696 | 226 |
| 293 | 3300009551 | Ga0105238_10186917 | Ga0105238_101869172 | 226 |
| 294 | 3300009553 | Ga0105249_10304805 | Ga0105249_103048051 | 226 |
| 295 | 3300010375 | Ga0105239_10015859 | Ga0105239_100158598 | 226 |
| 296 | 3300010375 | Ga0105239_10324425 | Ga0105239_103244252 | 226 |
| 297 | 3300013296 | Ga0157374_11048682 | Ga0157374_110486821 | 226 |
| 298 | 3300013306 | Ga0163162_10178412 | Ga0163162_101784122 | 226 |
| 299 | 3300014325 | Ga0163163_10027246 | Ga0163163_100272463 | 226 |
| 300 | 3300025321 | Ga0207656_10019833 | Ga0207656_100198332 | 226 |
| 301 | 3300025904 | Ga0207647_10002224 | Ga0207647_100022246 | 226 |
| 302 | 3300025911 | Ga0207654_10000874 | Ga0207654_1000087416 | 226 |
| 303 | 3300025912 | Ga0207707_10204788 | Ga0207707_102047881 | 226 |
| 304 | 3300025913 | Ga0207695_10001756 | Ga0207695_1000175622 | 226 |
| 305 | 3300025914 | Ga0207671_10095343 | Ga0207671_100953432 | 226 |
| 306 | 3300025914 | Ga0207671_10139390 | Ga0207671_101393902 | 226 |
| 307 | 3300025917 | Ga0207660_10298211 | Ga0207660_102982112 | 226 |
| 308 | 3300025924 | Ga0207694_10000306 | Ga0207694_1000030622 | 226 |
| 309 | 3300025924 | Ga0207694_10114401 | Ga0207694_101144013 | 226 |
| 310 | 3300025945 | Ga0207679_10467337 | Ga0207679_104673371 | 226 |
| 311 | 3300025949 | Ga0207667_10023471 | Ga0207667_100234713 | 226 |
| 312 | 3300025949 | Ga0207667_10046562 | Ga0207667_100465623 | 226 |
| 313 | 3300025981 | Ga0207640_10078399 | Ga0207640_100783992 | 226 |
| 314 | 3300026041 | Ga0207639_10496320 | Ga0207639_104963201 | 226 |
| 315 | 3300026041 | Ga0207639_10752375 | Ga0207639_107523752 | 226 |
| 316 | 3300026078 | Ga0207702_10000122 | Ga0207702_1000012260 | 226 |
| 317 | 3300026095 | Ga0207676_10061211 | Ga0207676_100612111 | 226 |
| 318 | 3300026116 | Ga0207674_10022648 | Ga0207674_100226481 | 226 |
| 319 | 3300026116 | Ga0207674_10113789 | Ga0207674_101137892 | 226 |
| 320 | 3300026142 | Ga0207698_10089140 | Ga0207698_100891402 | 226 |
| 321 | 3300031595 | Ga0265313_10001357 | Ga0265313_1000135725 | 226 |
| 322 | 3300048905 | Ga0496102_0078329 | Ga0496102_0078329_619_1362 | 226 |
| 323 | 3300048907 | Ga0496104_0053542 | Ga0496104_0053542_230_973 | 226 |
| 324 | 3300048908 | Ga0496105_0015974 | Ga0496105_0015974_724_1467 | 226 |
| 325 | 3300048909 | Ga0496106_0017020 | Ga0496106_0017020_302_1045 | 226 |
| 326 | 3300048911 | Ga0496108_0094402 | Ga0496108_0094402_1321_2064 | 226 |
| 327 | 3300048913 | Ga0496110_0008268 | Ga0496110_0008268_1429_2172 | 226 |
| 328 | 3300048915 | Ga0496112_0005624 | Ga0496112_0005624_3904_4647 | 226 |
| 329 | 3300053093 | Ga0500651_0014125 | Ga0500651_0014125_2597_3292 | 226 |
| 330 | 3300053111 | Ga0500572_005149 | Ga0500572_005149_64_750 | 226 |
| 331 | 3300053126 | Ga0500621_165271 | Ga0500621_165271_30_722 | 226 |
| 332 | 3300053136 | Ga0500559_0002014 | Ga0500559_0002014_5125_5811 | 226 |
| 333 | 3300053735 | Ga0500596_007030 | Ga0500596_007030_1067_1753 | 226 |
| 334 | iso_pu_bacteria | 2876808645 | 2876810680 | 226 |
| 335 | iso_pu_bacteria | 2879110137 | 2879112574 | 226 |
| 336 | iso_pu_bacteria | 8006994254 | 8006998354 | 226 |
| 337 | 3300003203 | JGI25406J46586_10000160 | JGI25406J46586_1000016028 | 227 |
| 338 | 3300003659 | JGI25404J52841_10002450 | JGI25404J52841_100024503 | 227 |
| 339 | 3300005262 | Ga0065165_1073148 | Ga0065165_10731481 | 227 |
| 340 | 3300005435 | Ga0070714_100059128 | Ga0070714_1000591284 | 227 |
| 341 | 3300005436 | Ga0070713_100008592 | Ga0070713_1000085926 | 227 |
| 342 | 3300005436 | Ga0070713_100455772 | Ga0070713_1004557721 | 227 |
| 343 | 3300005455 | Ga0070663_100428110 | Ga0070663_1004281102 | 227 |
| 344 | 3300005467 | Ga0070706_100527339 | Ga0070706_1005273391 | 227 |
| 345 | 3300005471 | Ga0070698_100096957 | Ga0070698_1000969573 | 227 |
| 346 | 3300005617 | Ga0068859_100296250 | Ga0068859_1002962502 | 227 |
| 347 | 3300005841 | Ga0068863_100321174 | Ga0068863_1003211741 | 227 |
| 348 | 3300005983 | Ga0081540_1005026 | Ga0081540_10050266 | 227 |
| 349 | 3300005983 | Ga0081540_1068934 | Ga0081540_10689343 | 227 |
| 350 | 3300005983 | Ga0081540_1085672 | Ga0081540_10856722 | 227 |
| 351 | 3300005983 | Ga0081540_1160499 | Ga0081540_11604991 | 227 |
| 352 | 3300005985 | Ga0081539_10000040 | Ga0081539_1000004090 | 227 |
| 353 | 3300005985 | Ga0081539_10097065 | Ga0081539_100970651 | 227 |
| 354 | 3300006028 | Ga0070717_10015584 | Ga0070717_100155843 | 227 |
| 355 | 3300006028 | Ga0070717_10335683 | Ga0070717_103356832 | 227 |
| 356 | 3300006175 | Ga0070712_100115201 | Ga0070712_1001152013 | 227 |
| 357 | 3300006175 | Ga0070712_100439293 | Ga0070712_1004392931 | 227 |
| 358 | 3300006175 | Ga0070712_100508440 | Ga0070712_1005084401 | 227 |
| 359 | 3300006931 | Ga0097620_100296269 | Ga0097620_1002962692 | 227 |
| 360 | 3300007076 | Ga0075435_100293353 | Ga0075435_1002933532 | 227 |
| 361 | 3300009101 | Ga0105247_10025431 | Ga0105247_100254312 | 227 |
| 362 | 3300013102 | Ga0157371_10096483 | Ga0157371_100964832 | 227 |
| 363 | 3300013104 | Ga0157370_10062666 | Ga0157370_100626664 | 227 |
| 364 | 3300013297 | Ga0157378_10058109 | Ga0157378_100581092 | 227 |
| 365 | 3300013307 | Ga0157372_11013806 | Ga0157372_110138062 | 227 |
| 366 | 3300025295 | Ga0209564_1000842 | Ga0209564_100084221 | 227 |
| 367 | 3300025900 | Ga0207710_10116249 | Ga0207710_101162492 | 227 |
| 368 | 3300025906 | Ga0207699_10298005 | Ga0207699_102980051 | 227 |
| 369 | 3300025910 | Ga0207684_10640685 | Ga0207684_106406851 | 227 |
| 370 | 3300025915 | Ga0207693_10033990 | Ga0207693_100339901 | 227 |
| 371 | 3300025915 | Ga0207693_10047780 | Ga0207693_100477801 | 227 |
| 372 | 3300025916 | Ga0207663_10028634 | Ga0207663_100286342 | 227 |
| 373 | 3300025916 | Ga0207663_10082169 | Ga0207663_100821692 | 227 |
| 374 | 3300025928 | Ga0207700_10024741 | Ga0207700_100247415 | 227 |
| 375 | 3300025928 | Ga0207700_10274448 | Ga0207700_102744482 | 227 |
| 376 | 3300026035 | Ga0207703_10599211 | Ga0207703_105992111 | 227 |
| 377 | 3300026067 | Ga0207678_10574833 | Ga0207678_105748331 | 227 |
| 378 | 3300026088 | Ga0207641_10270349 | Ga0207641_102703492 | 227 |
| 379 | 3300028379 | Ga0268266_10849601 | Ga0268266_108496012 | 227 |
| 380 | 3300030521 | Ga0307511_10053968 | Ga0307511_100539682 | 227 |
| 381 | 3300031235 | Ga0265330_10038130 | Ga0265330_100381303 | 227 |
| 382 | 3300031239 | Ga0265328_10014234 | Ga0265328_100142344 | 227 |
| 383 | 3300031250 | Ga0265331_10001005 | Ga0265331_1000100519 | 227 |
| 384 | 3300031344 | Ga0265316_10090874 | Ga0265316_100908742 | 227 |
| 385 | 3300031507 | Ga0307509_10065722 | Ga0307509_100657224 | 227 |
| 386 | 3300031616 | Ga0307508_10001545 | Ga0307508_1000154521 | 227 |
| 387 | 3300031616 | Ga0307508_10423503 | Ga0307508_104235031 | 227 |
| 388 | 3300031711 | Ga0265314_10011154 | Ga0265314_100111545 | 227 |
| 389 | 3300031730 | Ga0307516_10060446 | Ga0307516_100604463 | 227 |
| 390 | 3300033179 | Ga0307507_10018905 | Ga0307507_100189058 | 227 |
| 391 | 3300033442 | Ga0315911_1000039 | Ga0315911_100003954 | 227 |
| 392 | 3300035207 | Ga0373942_0069098 | Ga0373942_0069098_291_980 | 227 |
| 393 | 3300035692 | Ga0373935_0027993 | Ga0373935_0027993_1189_1884 | 227 |
| 394 | 3300035695 | Ga0373927_0228455 | Ga0373927_0228455_301_996 | 227 |
| 395 | 3300037312 | Ga0395899_0143787 | Ga0395899_0143787_890_1582 | 227 |
| 396 | 3300037418 | Ga0395900_0000962 | Ga0395900_0000962_13808_14494 | 227 |
| 397 | 3300037418 | Ga0395900_0008900 | Ga0395900_0008900_577_1269 | 227 |
| 398 | 3300037466 | Ga0395898_0002601 | Ga0395898_0002601_12320_13006 | 227 |
| 399 | 3300037466 | Ga0395898_0095452 | Ga0395898_0095452_353_1063 | 227 |
| 400 | 3300038443 | Ga0395901_0002873 | Ga0395901_0002873_13988_14680 | 227 |
| 401 | 3300038443 | Ga0395901_0697039 | Ga0395901_0697039_252_938 | 227 |
| 402 | 3300039450 | Ga0436363_0166451 | Ga0436363_0166451_3920_4621 | 227 |
| 403 | 3300046455 | Ga0495603_0087432 | Ga0495603_0087432_834_1517 | 227 |
| 404 | 3300046462 | Ga0495651_0083404 | Ga0495651_0083404_1574_2272 | 227 |
| 405 | 3300046507 | Ga0495606_0003543 | Ga0495606_0003543_12073_12771 | 227 |
| 406 | 3300046507 | Ga0495606_0055131 | Ga0495606_0055131_1698_2393 | 227 |
| 407 | 3300046529 | Ga0495652_0159390 | Ga0495652_0159390_963_1661 | 227 |
| 408 | 3300046557 | Ga0495622_0159458 | Ga0495622_0159458_270_959 | 227 |
| 409 | 3300046675 | Ga0495657_0151678 | Ga0495657_0151678_235_933 | 227 |
| 410 | 3300046694 | Ga0495649_0161699 | Ga0495649_0161699_457_1149 | 227 |
| 411 | 3300046809 | Ga0495600_0141423 | Ga0495600_0141423_736_1434 | 227 |
| 412 | 3300047469 | Ga0495673_0012232 | Ga0495673_0012232_1554_2249 | 227 |
| 413 | 3300048907 | Ga0496104_0251678 | Ga0496104_0251678_40_726 | 227 |
| 414 | 3300048909 | Ga0496106_0001027 | Ga0496106_0001027_4848_5534 | 227 |
| 415 | 3300048909 | Ga0496106_0303538 | Ga0496106_0303538_570_1262 | 227 |
| 416 | 3300048909 | Ga0496106_0570586 | Ga0496106_0570586_111_803 | 227 |
| 417 | 3300048910 | Ga0496107_0047025 | Ga0496107_0047025_2222_2908 | 227 |
| 418 | 3300048911 | Ga0496108_0000649 | Ga0496108_0000649_8436_9122 | 227 |
| 419 | 3300048912 | Ga0496109_0000739 | Ga0496109_0000739_8401_9087 | 227 |
| 420 | 3300048913 | Ga0496110_0005408 | Ga0496110_0005408_4915_5601 | 227 |
| 421 | 3300048914 | Ga0496111_0010567 | Ga0496111_0010567_3910_4596 | 227 |
| 422 | 3300048914 | Ga0496111_0082778 | Ga0496111_0082778_280_972 | 227 |
| 423 | 3300048915 | Ga0496112_0000055 | Ga0496112_0000055_23822_24517 | 227 |
| 424 | 3300048915 | Ga0496112_0001001 | Ga0496112_0001001_11621_12307 | 227 |
| 425 | 3300048915 | Ga0496112_0032144 | Ga0496112_0032144_2380_3072 | 227 |
| 426 | 3300048917 | Ga0496114_0087906 | Ga0496114_0087906_1233_1919 | 227 |
| 427 | 3300048918 | Ga0496115_0004434 | Ga0496115_0004434_2789_3484 | 227 |
| 428 | 3300048918 | Ga0496115_0130053 | Ga0496115_0130053_411_1103 | 227 |
| 429 | 3300048918 | Ga0496115_0279975 | Ga0496115_0279975_110_793 | 227 |
| 430 | 3300048920 | Ga0496117_0069000 | Ga0496117_0069000_289_1020 | 227 |
| 431 | 3300048921 | Ga0496118_0007955 | Ga0496118_0007955_1075_1806 | 227 |
| 432 | 3300048921 | Ga0496118_0042878 | Ga0496118_0042878_1758_2453 | 227 |
| 433 | 3300048922 | Ga0496119_0048531 | Ga0496119_0048531_829_1560 | 227 |
| 434 | 3300048922 | Ga0496119_0063950 | Ga0496119_0063950_77_775 | 227 |
| 435 | 3300048924 | Ga0496121_0000144 | Ga0496121_0000144_44914_45645 | 227 |
| 436 | 3300048924 | Ga0496121_0008147 | Ga0496121_0008147_3487_4182 | 227 |
| 437 | 3300048924 | Ga0496121_0031148 | Ga0496121_0031148_348_1052 | 227 |
| 438 | 3300048924 | Ga0496121_0182258 | Ga0496121_0182258_53_802 | 227 |
| 439 | 3300048924 | Ga0496121_0221403 | Ga0496121_0221403_383_1081 | 227 |
| 440 | 3300048927 | Ga0496124_0002408 | Ga0496124_0002408_4805_5536 | 227 |
| 441 | 3300048928 | Ga0496125_0045159 | Ga0496125_0045159_1082_1813 | 227 |
| 442 | 3300048929 | Ga0496126_0008459 | Ga0496126_0008459_6326_7012 | 227 |
| 443 | 3300048929 | Ga0496126_0018002 | Ga0496126_0018002_3390_4082 | 227 |
| 444 | 3300048929 | Ga0496126_0028459 | Ga0496126_0028459_1033_1764 | 227 |
| 445 | 3300048929 | Ga0496126_0156031 | Ga0496126_0156031_964_1647 | 227 |
| 446 | 3300049568 | Ga0501031_0000377 | Ga0501031_0000377_3483_4181 | 227 |
| 447 | 3300049569 | Ga0501032_0000040 | Ga0501032_0000040_98778_99476 | 227 |
| 448 | 3300049569 | Ga0501032_0003836 | Ga0501032_0003836_10622_11314 | 227 |
| 449 | 3300049569 | Ga0501032_0077513 | Ga0501032_0077513_840_1544 | 227 |
| 450 | 3300049570 | Ga0501033_0000128 | Ga0501033_0000128_38533_39231 | 227 |
| 451 | 3300049571 | Ga0501034_0000254 | Ga0501034_0000254_4099_4797 | 227 |
| 452 | 3300049571 | Ga0501034_0014046 | Ga0501034_0014046_4973_5665 | 227 |
| 453 | 3300049571 | Ga0501034_0075462 | Ga0501034_0075462_1389_2087 | 227 |
| 454 | 3300049571 | Ga0501034_0715413 | Ga0501034_0715413_42_740 | 227 |
| 455 | 3300049573 | Ga0501037_0000041 | Ga0501037_0000041_98678_99376 | 227 |
| 456 | 3300049574 | Ga0501038_0000057 | Ga0501038_0000057_12547_13245 | 227 |
| 457 | 3300049574 | Ga0501038_0025093 | Ga0501038_0025093_1651_2343 | 227 |
| 458 | 3300049574 | Ga0501038_0290204 | Ga0501038_0290204_68_772 | 227 |
| 459 | 3300049575 | Ga0501039_0012981 | Ga0501039_0012981_1300_1998 | 227 |
| 460 | 3300049579 | Ga0501043_0000184 | Ga0501043_0000184_9991_10689 | 227 |
| 461 | 3300049579 | Ga0501043_0231712 | Ga0501043_0231712_221_925 | 227 |
| 462 | 3300049580 | Ga0501046_0000072 | Ga0501046_0000072_6908_7606 | 227 |
| 463 | 3300049580 | Ga0501046_0458459 | Ga0501046_0458459_21_713 | 227 |
| 464 | 3300049581 | Ga0501047_0000044 | Ga0501047_0000044_98760_99458 | 227 |
| 465 | 3300049581 | Ga0501047_0028170 | Ga0501047_0028170_3505_4203 | 227 |
| 466 | 3300049581 | Ga0501047_0455414 | Ga0501047_0455414_61_765 | 227 |
| 467 | 3300049582 | Ga0501048_0000117 | Ga0501048_0000117_40157_40855 | 227 |
| 468 | 3300049583 | Ga0501067_0001815 | Ga0501067_0001815_8025_8723 | 227 |
| 469 | 3300049584 | Ga0501068_0001318 | Ga0501068_0001318_9469_10167 | 227 |
| 470 | 3300049585 | Ga0501069_0002548 | Ga0501069_0002548_8378_9076 | 227 |
| 471 | 3300049586 | Ga0501070_0018396 | Ga0501070_0018396_2405_3103 | 227 |
| 472 | 3300049586 | Ga0501070_0068187 | Ga0501070_0068187_1004_1702 | 227 |
| 473 | 3300049586 | Ga0501070_0279151 | Ga0501070_0279151_576_1277 | 227 |
| 474 | 3300049587 | Ga0501071_0184407 | Ga0501071_0184407_651_1349 | 227 |
| 475 | 3300049588 | Ga0501072_0000156 | Ga0501072_0000156_18924_19622 | 227 |
| 476 | 3300049589 | Ga0501073_0002824 | Ga0501073_0002824_6908_7606 | 227 |
| 477 | 3300049590 | Ga0501074_0000035 | Ga0501074_0000035_34666_35364 | 227 |
| 478 | 3300049592 | Ga0501076_0187321 | Ga0501076_0187321_552_1250 | 227 |
| 479 | 3300049741 | Ga0501079_0005573 | Ga0501079_0005573_4272_4970 | 227 |
| 480 | 3300049742 | Ga0501080_0008601 | Ga0501080_0008601_3841_4539 | 227 |
| 481 | 3300049744 | Ga0501083_0000641 | Ga0501083_0000641_10071_10769 | 227 |
| 482 | 3300049822 | Ga0501035_0000128 | Ga0501035_0000128_62762_63460 | 227 |
| 483 | 3300049822 | Ga0501035_0021153 | Ga0501035_0021153_2791_3483 | 227 |
| 484 | 3300049822 | Ga0501035_0057655 | Ga0501035_0057655_1339_2037 | 227 |
| 485 | 3300049822 | Ga0501035_0644437 | Ga0501035_0644437_15_719 | 227 |
| 486 | 3300049823 | Ga0501044_0000108 | Ga0501044_0000108_31981_32679 | 227 |
| 487 | 3300049823 | Ga0501044_0138109 | Ga0501044_0138109_604_1302 | 227 |
| 488 | 3300049823 | Ga0501044_0368464 | Ga0501044_0368464_586_1296 | 227 |
| 489 | 3300050512 | nmdc:mga0n895_134711_c1 | nmdc:mga0n895_134711_c1_818_1501 | 227 |
| 490 | 3300053080 | Ga0500635_0010037 | Ga0500635_0010037_477_1202 | 227 |
| 491 | 3300053094 | Ga0500566_0000839 | Ga0500566_0000839_2627_3337 | 227 |
| 492 | 3300053111 | Ga0500572_009276 | Ga0500572_009276_450_1160 | 227 |
| 493 | 3300053119 | Ga0500595_026590 | Ga0500595_026590_1164_1865 | 227 |
| 494 | 3300053122 | Ga0500608_116450 | Ga0500608_116450_70_783 | 227 |
| 495 | 3300053123 | Ga0500614_081683 | Ga0500614_081683_49_762 | 227 |
| 496 | 3300053136 | Ga0500559_0063271 | Ga0500559_0063271_244_957 | 227 |
| 497 | 3300053136 | Ga0500559_0114786 | Ga0500559_0114786_381_1076 | 227 |
| 498 | 3300053140 | Ga0500573_0006675 | Ga0500573_0006675_1930_2625 | 227 |
| 499 | 3300053150 | Ga0500603_030306 | Ga0500603_030306_144_857 | 227 |
| 500 | 3300053150 | Ga0500603_136790 | Ga0500603_136790_19_714 | 227 |
| 501 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_252991_253686 | 227 |
| 502 | 3300053158 | Ga0500627_0082232 | Ga0500627_0082232_480_1178 | 227 |
| 503 | 3300053159 | Ga0500630_102889 | Ga0500630_102889_571_1284 | 227 |
| 504 | 3300053162 | Ga0500638_076439 | Ga0500638_076439_364_1125 | 227 |
| 505 | 3300053163 | Ga0500639_040385 | Ga0500639_040385_685_1398 | 227 |
| 506 | 3300053177 | Ga0500636_0010062 | Ga0500636_0010062_1390_2085 | 227 |
| 507 | 3300053178 | Ga0500637_0324055 | Ga0500637_0324055_44_769 | 227 |
| 508 | 3300053725 | Ga0500576_110125 | Ga0500576_110125_376_1089 | 227 |
| 509 | 3300053735 | Ga0500596_002622 | Ga0500596_002622_2737_3432 | 227 |
| 510 | 3300053735 | Ga0500596_012800 | Ga0500596_012800_542_1252 | 227 |
| 511 | 3300054114 | Ga0501084_0002007 | Ga0501084_0002007_12167_12865 | 227 |
| 512 | 3300060353 | Ga0501082_0002249 | Ga0501082_0002249_3458_4156 | 227 |
| 513 | iso_pu_bacteria | 2508501128 | 2509149886 | 227 |
| 514 | iso_pu_bacteria | 2513237141 | 2513889622 | 227 |
| 515 | iso_pu_bacteria | 2602042107 | 2603857920 | 227 |
| 516 | iso_pu_bacteria | 2721755755 | 2723849146 | 227 |
| 517 | iso_pu_bacteria | 2857524615 | 2857527295 | 227 |
| 518 | iso_pu_bacteria | 2893066018 | 2893071834 | 227 |
| 519 | iso_pu_bacteria | 2919073203 | 2919078410 | 227 |
| 520 | 2010549000 | RicEn_C2869 | RicEn_52840 | 228 |
| 521 | 3300002077 | JGI24744J21845_10030724 | JGI24744J21845_100307242 | 228 |
| 522 | 3300003203 | JGI25406J46586_10012370 | JGI25406J46586_100123702 | 228 |
| 523 | 3300003214 | JGI25165J46597_1005725 | JGI25165J46597_10057252 | 228 |
| 524 | 3300003214 | JGI25165J46597_1006062 | JGI25165J46597_10060622 | 228 |
| 525 | 3300003215 | JGI25153J46596_10002632 | JGI25153J46596_100026326 | 228 |
| 526 | 3300003215 | JGI25153J46596_10003367 | JGI25153J46596_100033673 | 228 |
| 527 | 3300003215 | JGI25153J46596_10008346 | JGI25153J46596_100083466 | 228 |
| 528 | 3300003215 | JGI25153J46596_10014306 | JGI25153J46596_100143062 | 228 |
| 529 | 3300003215 | JGI25153J46596_10033551 | JGI25153J46596_100335512 | 228 |
| 530 | 3300003354 | JGI25160J50197_1003359 | JGI25160J50197_10033593 | 228 |
| 531 | 3300003354 | JGI25160J50197_1011680 | JGI25160J50197_10116803 | 228 |
| 532 | 3300003354 | JGI25160J50197_1027994 | JGI25160J50197_10279942 | 228 |
| 533 | 3300003659 | JGI25404J52841_10024669 | JGI25404J52841_100246692 | 228 |
| 534 | 3300003794 | Ga0055531_10020755 | Ga0055531_100207551 | 228 |
| 535 | 3300004625 | Ga0055543_1004220 | Ga0055543_10042202 | 228 |
| 536 | 3300005262 | Ga0065165_1001384 | Ga0065165_10013843 | 228 |
| 537 | 3300005262 | Ga0065165_1001884 | Ga0065165_10018843 | 228 |
| 538 | 3300005262 | Ga0065165_1004470 | Ga0065165_10044708 | 228 |
| 539 | 3300005327 | Ga0070658_10610270 | Ga0070658_106102701 | 228 |
| 540 | 3300005329 | Ga0070683_100372464 | Ga0070683_1003724641 | 228 |
| 541 | 3300005330 | Ga0070690_100718201 | Ga0070690_1007182011 | 228 |
| 542 | 3300005331 | Ga0070670_100288527 | Ga0070670_1002885271 | 228 |
| 543 | 3300005334 | Ga0068869_100065680 | Ga0068869_1000656803 | 228 |
| 544 | 3300005334 | Ga0068869_100102515 | Ga0068869_1001025153 | 228 |
| 545 | 3300005336 | Ga0070680_100062694 | Ga0070680_1000626942 | 228 |
| 546 | 3300005336 | Ga0070680_100089408 | Ga0070680_1000894083 | 228 |
| 547 | 3300005336 | Ga0070680_100160108 | Ga0070680_1001601082 | 228 |
| 548 | 3300005338 | Ga0068868_100029123 | Ga0068868_1000291234 | 228 |
| 549 | 3300005338 | Ga0068868_100033772 | Ga0068868_1000337722 | 228 |
| 550 | 3300005339 | Ga0070660_100218007 | Ga0070660_1002180071 | 228 |
| 551 | 3300005340 | Ga0070689_100228229 | Ga0070689_1002282291 | 228 |
| 552 | 3300005341 | Ga0070691_10051856 | Ga0070691_100518562 | 228 |
| 553 | 3300005343 | Ga0070687_100482820 | Ga0070687_1004828201 | 228 |
| 554 | 3300005344 | Ga0070661_100209431 | Ga0070661_1002094311 | 228 |
| 555 | 3300005347 | Ga0070668_100369657 | Ga0070668_1003696572 | 228 |
| 556 | 3300005353 | Ga0070669_100331257 | Ga0070669_1003312572 | 228 |
| 557 | 3300005353 | Ga0070669_100430164 | Ga0070669_1004301641 | 228 |
| 558 | 3300005354 | Ga0070675_100646897 | Ga0070675_1006468971 | 228 |
| 559 | 3300005354 | Ga0070675_100756815 | Ga0070675_1007568151 | 228 |
| 560 | 3300005355 | Ga0070671_100293165 | Ga0070671_1002931652 | 228 |
| 561 | 3300005365 | Ga0070688_100411113 | Ga0070688_1004111131 | 228 |
| 562 | 3300005366 | Ga0070659_100043739 | Ga0070659_1000437393 | 228 |
| 563 | 3300005366 | Ga0070659_100464942 | Ga0070659_1004649422 | 228 |
| 564 | 3300005434 | Ga0070709_10018844 | Ga0070709_100188444 | 228 |
| 565 | 3300005434 | Ga0070709_10046949 | Ga0070709_100469494 | 228 |
| 566 | 3300005435 | Ga0070714_100074644 | Ga0070714_1000746441 | 228 |
| 567 | 3300005435 | Ga0070714_100094459 | Ga0070714_1000944592 | 228 |
| 568 | 3300005435 | Ga0070714_100098717 | Ga0070714_1000987171 | 228 |
| 569 | 3300005436 | Ga0070713_100023569 | Ga0070713_1000235692 | 228 |
| 570 | 3300005436 | Ga0070713_100052194 | Ga0070713_1000521943 | 228 |
| 571 | 3300005436 | Ga0070713_100099028 | Ga0070713_1000990283 | 228 |
| 572 | 3300005436 | Ga0070713_100234675 | Ga0070713_1002346751 | 228 |
| 573 | 3300005436 | Ga0070713_100428302 | Ga0070713_1004283021 | 228 |
| 574 | 3300005437 | Ga0070710_10000883 | Ga0070710_100008833 | 228 |
| 575 | 3300005437 | Ga0070710_10001420 | Ga0070710_100014207 | 228 |
| 576 | 3300005439 | Ga0070711_100002983 | Ga0070711_10000298311 | 228 |
| 577 | 3300005439 | Ga0070711_100012546 | Ga0070711_1000125463 | 228 |
| 578 | 3300005439 | Ga0070711_100021714 | Ga0070711_1000217143 | 228 |
| 579 | 3300005440 | Ga0070705_100448181 | Ga0070705_1004481811 | 228 |
| 580 | 3300005445 | Ga0070708_100057117 | Ga0070708_1000571172 | 228 |
| 581 | 3300005455 | Ga0070663_100007823 | Ga0070663_1000078236 | 228 |
| 582 | 3300005455 | Ga0070663_100194136 | Ga0070663_1001941362 | 228 |
| 583 | 3300005456 | Ga0070678_100061407 | Ga0070678_1000614073 | 228 |
| 584 | 3300005456 | Ga0070678_100105110 | Ga0070678_1001051102 | 228 |
| 585 | 3300005456 | Ga0070678_100145055 | Ga0070678_1001450552 | 228 |
| 586 | 3300005456 | Ga0070678_100185267 | Ga0070678_1001852672 | 228 |
| 587 | 3300005456 | Ga0070678_100260787 | Ga0070678_1002607872 | 228 |
| 588 | 3300005457 | Ga0070662_100426573 | Ga0070662_1004265731 | 228 |
| 589 | 3300005466 | Ga0070685_10218081 | Ga0070685_102180812 | 228 |
| 590 | 3300005466 | Ga0070685_10260566 | Ga0070685_102605662 | 228 |
| 591 | 3300005468 | Ga0070707_100227591 | Ga0070707_1002275912 | 228 |
| 592 | 3300005530 | Ga0070679_100044686 | Ga0070679_1000446862 | 228 |
| 593 | 3300005530 | Ga0070679_100124810 | Ga0070679_1001248101 | 228 |
| 594 | 3300005530 | Ga0070679_100179414 | Ga0070679_1001794142 | 228 |
| 595 | 3300005535 | Ga0070684_100016103 | Ga0070684_1000161033 | 228 |
| 596 | 3300005536 | Ga0070697_100025792 | Ga0070697_1000257924 | 228 |
| 597 | 3300005539 | Ga0068853_100167859 | Ga0068853_1001678592 | 228 |
| 598 | 3300005539 | Ga0068853_100264761 | Ga0068853_1002647611 | 228 |
| 599 | 3300005539 | Ga0068853_100402869 | Ga0068853_1004028692 | 228 |
| 600 | 3300005539 | Ga0068853_100521057 | Ga0068853_1005210572 | 228 |
| 601 | 3300005543 | Ga0070672_100066970 | Ga0070672_1000669702 | 228 |
| 602 | 3300005544 | Ga0070686_100079501 | Ga0070686_1000795012 | 228 |
| 603 | 3300005544 | Ga0070686_100519495 | Ga0070686_1005194952 | 228 |
| 604 | 3300005547 | Ga0070693_100239942 | Ga0070693_1002399422 | 228 |
| 605 | 3300005548 | Ga0070665_100011529 | Ga0070665_1000115294 | 228 |
| 606 | 3300005548 | Ga0070665_100084179 | Ga0070665_1000841793 | 228 |
| 607 | 3300005548 | Ga0070665_100088233 | Ga0070665_1000882334 | 228 |
| 608 | 3300005548 | Ga0070665_100248788 | Ga0070665_1002487882 | 228 |
| 609 | 3300005548 | Ga0070665_100947156 | Ga0070665_1009471562 | 228 |
| 610 | 3300005549 | Ga0070704_100671235 | Ga0070704_1006712351 | 228 |
| 611 | 3300005563 | Ga0068855_100250765 | Ga0068855_1002507652 | 228 |
| 612 | 3300005563 | Ga0068855_100356423 | Ga0068855_1003564232 | 228 |
| 613 | 3300005563 | Ga0068855_101086963 | Ga0068855_1010869631 | 228 |
| 614 | 3300005564 | Ga0070664_100728870 | Ga0070664_1007288701 | 228 |
| 615 | 3300005614 | Ga0068856_100003436 | Ga0068856_1000034366 | 228 |
| 616 | 3300005614 | Ga0068856_100130496 | Ga0068856_1001304962 | 228 |
| 617 | 3300005614 | Ga0068856_100286324 | Ga0068856_1002863241 | 228 |
| 618 | 3300005614 | Ga0068856_100519611 | Ga0068856_1005196111 | 228 |
| 619 | 3300005615 | Ga0070702_100078903 | Ga0070702_1000789032 | 228 |
| 620 | 3300005615 | Ga0070702_100106533 | Ga0070702_1001065332 | 228 |
| 621 | 3300005616 | Ga0068852_100063044 | Ga0068852_1000630442 | 228 |
| 622 | 3300005616 | Ga0068852_100222030 | Ga0068852_1002220302 | 228 |
| 623 | 3300005616 | Ga0068852_100337155 | Ga0068852_1003371552 | 228 |
| 624 | 3300005616 | Ga0068852_100585806 | Ga0068852_1005858062 | 228 |
| 625 | 3300005616 | Ga0068852_100641653 | Ga0068852_1006416532 | 228 |
| 626 | 3300005616 | Ga0068852_100912234 | Ga0068852_1009122341 | 228 |
| 627 | 3300005718 | Ga0068866_10006968 | Ga0068866_100069682 | 228 |
| 628 | 3300005719 | Ga0068861_100022743 | Ga0068861_1000227436 | 228 |
| 629 | 3300005719 | Ga0068861_100310536 | Ga0068861_1003105362 | 228 |
| 630 | 3300005719 | Ga0068861_100639295 | Ga0068861_1006392951 | 228 |
| 631 | 3300005834 | Ga0068851_10045623 | Ga0068851_100456232 | 228 |
| 632 | 3300005841 | Ga0068863_100320009 | Ga0068863_1003200091 | 228 |
| 633 | 3300005842 | Ga0068858_100157399 | Ga0068858_1001573992 | 228 |
| 634 | 3300005843 | Ga0068860_100002621 | Ga0068860_1000026217 | 228 |
| 635 | 3300005843 | Ga0068860_100150946 | Ga0068860_1001509462 | 228 |
| 636 | 3300005843 | Ga0068860_100294214 | Ga0068860_1002942142 | 228 |
| 637 | 3300005843 | Ga0068860_100643834 | Ga0068860_1006438342 | 228 |
| 638 | 3300005844 | Ga0068862_100029193 | Ga0068862_1000291932 | 228 |
| 639 | 3300005844 | Ga0068862_100107881 | Ga0068862_1001078813 | 228 |
| 640 | 3300005844 | Ga0068862_100243422 | Ga0068862_1002434222 | 228 |
| 641 | 3300005844 | Ga0068862_100380929 | Ga0068862_1003809292 | 228 |
| 642 | 3300005844 | Ga0068862_100515955 | Ga0068862_1005159551 | 228 |
| 643 | 3300005844 | Ga0068862_100518016 | Ga0068862_1005180161 | 228 |
| 644 | 3300005937 | Ga0081455_10015989 | Ga0081455_100159898 | 228 |
| 645 | 3300005937 | Ga0081455_10051879 | Ga0081455_100518792 | 228 |
| 646 | 3300005981 | Ga0081538_10073012 | Ga0081538_100730122 | 228 |
| 647 | 3300005983 | Ga0081540_1002275 | Ga0081540_100227512 | 228 |
| 648 | 3300005983 | Ga0081540_1035395 | Ga0081540_10353952 | 228 |
| 649 | 3300005983 | Ga0081540_1035915 | Ga0081540_10359152 | 228 |
| 650 | 3300005983 | Ga0081540_1074604 | Ga0081540_10746041 | 228 |
| 651 | 3300005983 | Ga0081540_1101551 | Ga0081540_11015512 | 228 |
| 652 | 3300005985 | Ga0081539_10001394 | Ga0081539_1000139416 | 228 |
| 653 | 3300005985 | Ga0081539_10032566 | Ga0081539_100325662 | 228 |
| 654 | 3300006028 | Ga0070717_10115216 | Ga0070717_101152162 | 228 |
| 655 | 3300006028 | Ga0070717_10899516 | Ga0070717_108995161 | 228 |
| 656 | 3300006038 | Ga0075365_10040867 | Ga0075365_100408672 | 228 |
| 657 | 3300006038 | Ga0075365_10066849 | Ga0075365_100668492 | 228 |
| 658 | 3300006038 | Ga0075365_10089169 | Ga0075365_100891692 | 228 |
| 659 | 3300006038 | Ga0075365_10153495 | Ga0075365_101534951 | 228 |
| 660 | 3300006042 | Ga0075368_10017885 | Ga0075368_100178851 | 228 |
| 661 | 3300006048 | Ga0075363_100002368 | Ga0075363_1000023689 | 228 |
| 662 | 3300006048 | Ga0075363_100118266 | Ga0075363_1001182661 | 228 |
| 663 | 3300006051 | Ga0075364_10009615 | Ga0075364_100096151 | 228 |
| 664 | 3300006051 | Ga0075364_10050022 | Ga0075364_100500222 | 228 |
| 665 | 3300006051 | Ga0075364_10115983 | Ga0075364_101159832 | 228 |
| 666 | 3300006163 | Ga0070715_10002422 | Ga0070715_100024226 | 228 |
| 667 | 3300006163 | Ga0070715_10068744 | Ga0070715_100687442 | 228 |
| 668 | 3300006173 | Ga0070716_100008434 | Ga0070716_1000084342 | 228 |
| 669 | 3300006173 | Ga0070716_100011641 | Ga0070716_1000116412 | 228 |
| 670 | 3300006175 | Ga0070712_100109785 | Ga0070712_1001097852 | 228 |
| 671 | 3300006177 | Ga0075362_10100366 | Ga0075362_101003661 | 228 |
| 672 | 3300006178 | Ga0075367_10036634 | Ga0075367_100366344 | 228 |
| 673 | 3300006178 | Ga0075367_10088344 | Ga0075367_100883442 | 228 |
| 674 | 3300006178 | Ga0075367_10136730 | Ga0075367_101367302 | 228 |
| 675 | 3300006178 | Ga0075367_10155520 | Ga0075367_101555202 | 228 |
| 676 | 3300006178 | Ga0075367_10157486 | Ga0075367_101574862 | 228 |
| 677 | 3300006178 | Ga0075367_10394042 | Ga0075367_103940421 | 228 |
| 678 | 3300006178 | Ga0075367_10421840 | Ga0075367_104218402 | 228 |
| 679 | 3300006186 | Ga0075369_10016556 | Ga0075369_100165564 | 228 |
| 680 | 3300006186 | Ga0075369_10072521 | Ga0075369_100725212 | 228 |
| 681 | 3300006195 | Ga0075366_10064541 | Ga0075366_100645411 | 228 |
| 682 | 3300006195 | Ga0075366_10091686 | Ga0075366_100916862 | 228 |
| 683 | 3300006195 | Ga0075366_10180427 | Ga0075366_101804272 | 228 |
| 684 | 3300006237 | Ga0097621_100173174 | Ga0097621_1001731742 | 228 |
| 685 | 3300006237 | Ga0097621_100391615 | Ga0097621_1003916152 | 228 |
| 686 | 3300006353 | Ga0075370_10044155 | Ga0075370_100441554 | 228 |
| 687 | 3300006353 | Ga0075370_10120877 | Ga0075370_101208772 | 228 |
| 688 | 3300006353 | Ga0075370_10140886 | Ga0075370_101408862 | 228 |
| 689 | 3300006353 | Ga0075370_10145316 | Ga0075370_101453162 | 228 |
| 690 | 3300006353 | Ga0075370_10149905 | Ga0075370_101499052 | 228 |
| 691 | 3300006358 | Ga0068871_100322507 | Ga0068871_1003225072 | 228 |
| 692 | 3300006358 | Ga0068871_100673872 | Ga0068871_1006738721 | 228 |
| 693 | 3300006844 | Ga0075428_100042233 | Ga0075428_1000422333 | 228 |
| 694 | 3300006881 | Ga0068865_100153220 | Ga0068865_1001532202 | 228 |
| 695 | 3300006941 | Ga0099825_1023350 | Ga0099825_10233503 | 228 |
| 696 | 3300006942 | Ga0099824_1026659 | Ga0099824_10266593 | 228 |
| 697 | 3300006944 | Ga0099823_1035919 | Ga0099823_10359195 | 228 |
| 698 | 3300007076 | Ga0075435_100230907 | Ga0075435_1002309072 | 228 |
| 699 | 3300007265 | Ga0099794_10047918 | Ga0099794_100479182 | 228 |
| 700 | 3300007265 | Ga0099794_10274365 | Ga0099794_102743651 | 228 |
| 701 | 3300007788 | Ga0099795_10123152 | Ga0099795_101231521 | 228 |
| 702 | 3300009036 | Ga0105244_10268314 | Ga0105244_102683141 | 228 |
| 703 | 3300009093 | Ga0105240_10018234 | Ga0105240_100182348 | 228 |
| 704 | 3300009093 | Ga0105240_10142386 | Ga0105240_101423862 | 228 |
| 705 | 3300009094 | Ga0111539_10206349 | Ga0111539_102063492 | 228 |
| 706 | 3300009098 | Ga0105245_10271868 | Ga0105245_102718682 | 228 |
| 707 | 3300009098 | Ga0105245_10872282 | Ga0105245_108722821 | 228 |
| 708 | 3300009101 | Ga0105247_10324635 | Ga0105247_103246351 | 228 |
| 709 | 3300009148 | Ga0105243_10297379 | Ga0105243_102973792 | 228 |
| 710 | 3300009148 | Ga0105243_10319149 | Ga0105243_103191491 | 228 |
| 711 | 3300009174 | Ga0105241_10040543 | Ga0105241_100405432 | 228 |
| 712 | 3300009174 | Ga0105241_10049268 | Ga0105241_100492682 | 228 |
| 713 | 3300009177 | Ga0105248_11167893 | Ga0105248_111678931 | 228 |
| 714 | 3300009545 | Ga0105237_10021872 | Ga0105237_100218724 | 228 |
| 715 | 3300009545 | Ga0105237_10056221 | Ga0105237_100562213 | 228 |
| 716 | 3300009545 | Ga0105237_10101785 | Ga0105237_101017853 | 228 |
| 717 | 3300009545 | Ga0105237_10112451 | Ga0105237_101124513 | 228 |
| 718 | 3300009545 | Ga0105237_10199326 | Ga0105237_101993261 | 228 |
| 719 | 3300009545 | Ga0105237_10243819 | Ga0105237_102438192 | 228 |
| 720 | 3300009545 | Ga0105237_10264917 | Ga0105237_102649172 | 228 |
| 721 | 3300009551 | Ga0105238_10029421 | Ga0105238_100294216 | 228 |
| 722 | 3300009551 | Ga0105238_10134629 | Ga0105238_101346293 | 228 |
| 723 | 3300009551 | Ga0105238_10167493 | Ga0105238_101674932 | 228 |
| 724 | 3300009551 | Ga0105238_10442750 | Ga0105238_104427501 | 228 |
| 725 | 3300009551 | Ga0105238_10496026 | Ga0105238_104960262 | 228 |
| 726 | 3300009551 | Ga0105238_10520535 | Ga0105238_105205352 | 228 |
| 727 | 3300009553 | Ga0105249_10269244 | Ga0105249_102692441 | 228 |
| 728 | 3300009553 | Ga0105249_10495183 | Ga0105249_104951831 | 228 |
| 729 | 3300010375 | Ga0105239_10079643 | Ga0105239_100796434 | 228 |
| 730 | 3300010375 | Ga0105239_10088065 | Ga0105239_100880653 | 228 |
| 731 | 3300010375 | Ga0105239_10138557 | Ga0105239_101385572 | 228 |
| 732 | 3300010375 | Ga0105239_10324060 | Ga0105239_103240602 | 228 |
| 733 | 3300010375 | Ga0105239_10640378 | Ga0105239_106403782 | 228 |
| 734 | 3300011119 | Ga0105246_10009694 | Ga0105246_100096942 | 228 |
| 735 | 3300011119 | Ga0105246_10059677 | Ga0105246_100596773 | 228 |
| 736 | 3300011119 | Ga0105246_10193182 | Ga0105246_101931821 | 228 |
| 737 | 3300011119 | Ga0105246_10341679 | Ga0105246_103416792 | 228 |
| 738 | 3300013100 | Ga0157373_10153054 | Ga0157373_101530542 | 228 |
| 739 | 3300013102 | Ga0157371_10670233 | Ga0157371_106702331 | 228 |
| 740 | 3300013104 | Ga0157370_10091902 | Ga0157370_100919022 | 228 |
| 741 | 3300013104 | Ga0157370_10248787 | Ga0157370_102487872 | 228 |
| 742 | 3300013105 | Ga0157369_10005581 | Ga0157369_100055819 | 228 |
| 743 | 3300013105 | Ga0157369_10019064 | Ga0157369_100190641 | 228 |
| 744 | 3300013296 | Ga0157374_10165783 | Ga0157374_101657832 | 228 |
| 745 | 3300013296 | Ga0157374_10273856 | Ga0157374_102738562 | 228 |
| 746 | 3300013297 | Ga0157378_10023907 | Ga0157378_100239074 | 228 |
| 747 | 3300013306 | Ga0163162_10161492 | Ga0163162_101614922 | 228 |
| 748 | 3300013306 | Ga0163162_10544771 | Ga0163162_105447712 | 228 |
| 749 | 3300013306 | Ga0163162_10766710 | Ga0163162_107667102 | 228 |
| 750 | 3300013307 | Ga0157372_10218370 | Ga0157372_102183702 | 228 |
| 751 | 3300013307 | Ga0157372_10477917 | Ga0157372_104779172 | 228 |
| 752 | 3300013307 | Ga0157372_10757252 | Ga0157372_107572522 | 228 |
| 753 | 3300013308 | Ga0157375_10408730 | Ga0157375_104087302 | 228 |
| 754 | 3300014325 | Ga0163163_10073724 | Ga0163163_100737242 | 228 |
| 755 | 3300014325 | Ga0163163_10180400 | Ga0163163_101804002 | 228 |
| 756 | 3300014325 | Ga0163163_10323220 | Ga0163163_103232202 | 228 |
| 757 | 3300014325 | Ga0163163_10411575 | Ga0163163_104115752 | 228 |
| 758 | 3300014325 | Ga0163163_10620113 | Ga0163163_106201132 | 228 |
| 759 | 3300014326 | Ga0157380_10197062 | Ga0157380_101970622 | 228 |
| 760 | 3300014326 | Ga0157380_10716133 | Ga0157380_107161332 | 228 |
| 761 | 3300014968 | Ga0157379_10269437 | Ga0157379_102694372 | 228 |
| 762 | 3300014968 | Ga0157379_10743447 | Ga0157379_107434471 | 228 |
| 763 | 3300014969 | Ga0157376_10254582 | Ga0157376_102545822 | 228 |
| 764 | 3300014969 | Ga0157376_10574867 | Ga0157376_105748671 | 228 |
| 765 | 3300014969 | Ga0157376_10744436 | Ga0157376_107444362 | 228 |
| 766 | 3300017792 | Ga0163161_10084320 | Ga0163161_100843202 | 228 |
| 767 | 3300017792 | Ga0163161_10223845 | Ga0163161_102238452 | 228 |
| 768 | 3300017792 | Ga0163161_10777424 | Ga0163161_107774241 | 228 |
| 769 | 3300021320 | Ga0214544_1000007 | Ga0214544_1000007140 | 228 |
| 770 | 3300021321 | Ga0214542_1000007 | Ga0214542_1000007243 | 228 |
| 771 | 3300021324 | Ga0214545_1000006 | Ga0214545_100000650 | 228 |
| 772 | 3300021327 | Ga0214543_1000009 | Ga0214543_1000009140 | 228 |
| 773 | 3300021377 | Ga0213874_10020651 | Ga0213874_100206512 | 228 |
| 774 | 3300021384 | Ga0213876_10008797 | Ga0213876_100087974 | 228 |
| 775 | 3300021384 | Ga0213876_10059454 | Ga0213876_100594541 | 228 |
| 776 | 3300021384 | Ga0213876_10094182 | Ga0213876_100941822 | 228 |
| 777 | 3300021384 | Ga0213876_10166085 | Ga0213876_101660851 | 228 |
| 778 | 3300021384 | Ga0213876_10191050 | Ga0213876_101910502 | 228 |
| 779 | 3300021441 | Ga0213871_10027153 | Ga0213871_100271531 | 228 |
| 780 | 3300025253 | Ga0209677_101800 | Ga0209677_1018003 | 228 |
| 781 | 3300025253 | Ga0209677_103149 | Ga0209677_1031492 | 228 |
| 782 | 3300025254 | Ga0209148_1000688 | Ga0209148_10006887 | 228 |
| 783 | 3300025261 | Ga0209233_1002001 | Ga0209233_10020011 | 228 |
| 784 | 3300025261 | Ga0209233_1003079 | Ga0209233_10030796 | 228 |
| 785 | 3300025261 | Ga0209233_1018527 | Ga0209233_10185272 | 228 |
| 786 | 3300025272 | Ga0209455_1002533 | Ga0209455_10025334 | 228 |
| 787 | 3300025284 | Ga0209130_1037253 | Ga0209130_10372531 | 228 |
| 788 | 3300025295 | Ga0209564_1004194 | Ga0209564_10041945 | 228 |
| 789 | 3300025295 | Ga0209564_1011852 | Ga0209564_10118521 | 228 |
| 790 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015353 | 228 |
| 791 | 3300025297 | Ga0209758_1000161 | Ga0209758_1000161146 | 228 |
| 792 | 3300025297 | Ga0209758_1001473 | Ga0209758_10014739 | 228 |
| 793 | 3300025297 | Ga0209758_1005779 | Ga0209758_10057792 | 228 |
| 794 | 3300025297 | Ga0209758_1006771 | Ga0209758_10067715 | 228 |
| 795 | 3300025297 | Ga0209758_1010969 | Ga0209758_10109692 | 228 |
| 796 | 3300025299 | Ga0209256_1004114 | Ga0209256_10041142 | 228 |
| 797 | 3300025302 | Ga0207426_1000186 | Ga0207426_100018626 | 228 |
| 798 | 3300025302 | Ga0207426_1004316 | Ga0207426_10043166 | 228 |
| 799 | 3300025302 | Ga0207426_1004813 | Ga0207426_10048134 | 228 |
| 800 | 3300025302 | Ga0207426_1020280 | Ga0207426_10202802 | 228 |
| 801 | 3300025303 | Ga0209051_1093598 | Ga0209051_10935981 | 228 |
| 802 | 3300025304 | Ga0209257_1002985 | Ga0209257_10029859 | 228 |
| 803 | 3300025304 | Ga0209257_1019262 | Ga0209257_10192622 | 228 |
| 804 | 3300025315 | Ga0207697_10040491 | Ga0207697_100404912 | 228 |
| 805 | 3300025898 | Ga0207692_10000852 | Ga0207692_100008525 | 228 |
| 806 | 3300025898 | Ga0207692_10002369 | Ga0207692_100023696 | 228 |
| 807 | 3300025900 | Ga0207710_10103535 | Ga0207710_101035352 | 228 |
| 808 | 3300025901 | Ga0207688_10204565 | Ga0207688_102045651 | 228 |
| 809 | 3300025903 | Ga0207680_10440173 | Ga0207680_104401731 | 228 |
| 810 | 3300025904 | Ga0207647_10163565 | Ga0207647_101635652 | 228 |
| 811 | 3300025905 | Ga0207685_10005460 | Ga0207685_100054603 | 228 |
| 812 | 3300025906 | Ga0207699_10011751 | Ga0207699_100117512 | 228 |
| 813 | 3300025906 | Ga0207699_10013540 | Ga0207699_100135402 | 228 |
| 814 | 3300025906 | Ga0207699_10025447 | Ga0207699_100254473 | 228 |
| 815 | 3300025906 | Ga0207699_10036285 | Ga0207699_100362852 | 228 |
| 816 | 3300025907 | Ga0207645_10017476 | Ga0207645_100174765 | 228 |
| 817 | 3300025912 | Ga0207707_10018715 | Ga0207707_100187154 | 228 |
| 818 | 3300025912 | Ga0207707_10023081 | Ga0207707_100230812 | 228 |
| 819 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006131 | 228 |
| 820 | 3300025913 | Ga0207695_10070740 | Ga0207695_100707405 | 228 |
| 821 | 3300025913 | Ga0207695_10163275 | Ga0207695_101632752 | 228 |
| 822 | 3300025914 | Ga0207671_10008770 | Ga0207671_100087709 | 228 |
| 823 | 3300025914 | Ga0207671_10019054 | Ga0207671_100190545 | 228 |
| 824 | 3300025914 | Ga0207671_10114716 | Ga0207671_101147162 | 228 |
| 825 | 3300025914 | Ga0207671_10169187 | Ga0207671_101691872 | 228 |
| 826 | 3300025914 | Ga0207671_10198075 | Ga0207671_101980752 | 228 |
| 827 | 3300025915 | Ga0207693_10023504 | Ga0207693_100235041 | 228 |
| 828 | 3300025915 | Ga0207693_10052774 | Ga0207693_100527742 | 228 |
| 829 | 3300025915 | Ga0207693_10058480 | Ga0207693_100584803 | 228 |
| 830 | 3300025916 | Ga0207663_10000260 | Ga0207663_1000026020 | 228 |
| 831 | 3300025916 | Ga0207663_10011583 | Ga0207663_100115837 | 228 |
| 832 | 3300025916 | Ga0207663_10025039 | Ga0207663_100250393 | 228 |
| 833 | 3300025917 | Ga0207660_10044182 | Ga0207660_100441824 | 228 |
| 834 | 3300025920 | Ga0207649_10091495 | Ga0207649_100914952 | 228 |
| 835 | 3300025920 | Ga0207649_10143695 | Ga0207649_101436952 | 228 |
| 836 | 3300025920 | Ga0207649_10226894 | Ga0207649_102268942 | 228 |
| 837 | 3300025921 | Ga0207652_10010155 | Ga0207652_100101554 | 228 |
| 838 | 3300025921 | Ga0207652_10030351 | Ga0207652_100303515 | 228 |
| 839 | 3300025921 | Ga0207652_10158032 | Ga0207652_101580322 | 228 |
| 840 | 3300025921 | Ga0207652_10213939 | Ga0207652_102139391 | 228 |
| 841 | 3300025921 | Ga0207652_10705412 | Ga0207652_107054121 | 228 |
| 842 | 3300025922 | Ga0207646_10114471 | Ga0207646_101144712 | 228 |
| 843 | 3300025924 | Ga0207694_10195256 | Ga0207694_101952561 | 228 |
| 844 | 3300025924 | Ga0207694_10264540 | Ga0207694_102645402 | 228 |
| 845 | 3300025924 | Ga0207694_10318398 | Ga0207694_103183981 | 228 |
| 846 | 3300025924 | Ga0207694_10575585 | Ga0207694_105755851 | 228 |
| 847 | 3300025924 | Ga0207694_10669458 | Ga0207694_106694581 | 228 |
| 848 | 3300025926 | Ga0207659_10806764 | Ga0207659_108067641 | 228 |
| 849 | 3300025927 | Ga0207687_10055668 | Ga0207687_100556682 | 228 |
| 850 | 3300025928 | Ga0207700_10014409 | Ga0207700_100144095 | 228 |
| 851 | 3300025928 | Ga0207700_10039984 | Ga0207700_100399844 | 228 |
| 852 | 3300025928 | Ga0207700_10078951 | Ga0207700_100789511 | 228 |
| 853 | 3300025928 | Ga0207700_10359152 | Ga0207700_103591521 | 228 |
| 854 | 3300025929 | Ga0207664_10031361 | Ga0207664_100313614 | 228 |
| 855 | 3300025929 | Ga0207664_10084151 | Ga0207664_100841511 | 228 |
| 856 | 3300025929 | Ga0207664_10210351 | Ga0207664_102103512 | 228 |
| 857 | 3300025931 | Ga0207644_10230269 | Ga0207644_102302692 | 228 |
| 858 | 3300025931 | Ga0207644_10239558 | Ga0207644_102395581 | 228 |
| 859 | 3300025932 | Ga0207690_10039503 | Ga0207690_100395033 | 228 |
| 860 | 3300025933 | Ga0207706_10155026 | Ga0207706_101550261 | 228 |
| 861 | 3300025933 | Ga0207706_10251996 | Ga0207706_102519962 | 228 |
| 862 | 3300025935 | Ga0207709_10503738 | Ga0207709_105037381 | 228 |
| 863 | 3300025936 | Ga0207670_10115185 | Ga0207670_101151852 | 228 |
| 864 | 3300025937 | Ga0207669_10341136 | Ga0207669_103411361 | 228 |
| 865 | 3300025938 | Ga0207704_10046071 | Ga0207704_100460711 | 228 |
| 866 | 3300025938 | Ga0207704_10102716 | Ga0207704_101027162 | 228 |
| 867 | 3300025939 | Ga0207665_10004492 | Ga0207665_100044923 | 228 |
| 868 | 3300025939 | Ga0207665_10165074 | Ga0207665_101650742 | 228 |
| 869 | 3300025941 | Ga0207711_10013103 | Ga0207711_100131033 | 228 |
| 870 | 3300025942 | Ga0207689_10190132 | Ga0207689_101901322 | 228 |
| 871 | 3300025942 | Ga0207689_10351771 | Ga0207689_103517711 | 228 |
| 872 | 3300025942 | Ga0207689_10478789 | Ga0207689_104787892 | 228 |
| 873 | 3300025944 | Ga0207661_10002241 | Ga0207661_100022412 | 228 |
| 874 | 3300025944 | Ga0207661_10054697 | Ga0207661_100546972 | 228 |
| 875 | 3300025944 | Ga0207661_10392113 | Ga0207661_103921131 | 228 |
| 876 | 3300025945 | Ga0207679_10119105 | Ga0207679_101191051 | 228 |
| 877 | 3300025949 | Ga0207667_10015657 | Ga0207667_100156578 | 228 |
| 878 | 3300025949 | Ga0207667_10366731 | Ga0207667_103667312 | 228 |
| 879 | 3300025949 | Ga0207667_11051790 | Ga0207667_110517901 | 228 |
| 880 | 3300025960 | Ga0207651_10111219 | Ga0207651_101112192 | 228 |
| 881 | 3300025972 | Ga0207668_10024883 | Ga0207668_100248833 | 228 |
| 882 | 3300025981 | Ga0207640_10149826 | Ga0207640_101498261 | 228 |
| 883 | 3300025986 | Ga0207658_10570528 | Ga0207658_105705281 | 228 |
| 884 | 3300025986 | Ga0207658_10741236 | Ga0207658_107412361 | 228 |
| 885 | 3300026023 | Ga0207677_10122481 | Ga0207677_101224812 | 228 |
| 886 | 3300026041 | Ga0207639_10055566 | Ga0207639_100555663 | 228 |
| 887 | 3300026041 | Ga0207639_10069736 | Ga0207639_100697362 | 228 |
| 888 | 3300026041 | Ga0207639_10080517 | Ga0207639_100805172 | 228 |
| 889 | 3300026041 | Ga0207639_10103311 | Ga0207639_101033112 | 228 |
| 890 | 3300026041 | Ga0207639_10420441 | Ga0207639_104204411 | 228 |
| 891 | 3300026041 | Ga0207639_10435925 | Ga0207639_104359252 | 228 |
| 892 | 3300026067 | Ga0207678_10063908 | Ga0207678_100639082 | 228 |
| 893 | 3300026067 | Ga0207678_10140057 | Ga0207678_101400572 | 228 |
| 894 | 3300026067 | Ga0207678_11035082 | Ga0207678_110350821 | 228 |
| 895 | 3300026078 | Ga0207702_10000101 | Ga0207702_1000010182 | 228 |
| 896 | 3300026078 | Ga0207702_10095262 | Ga0207702_100952622 | 228 |
| 897 | 3300026078 | Ga0207702_10115235 | Ga0207702_101152351 | 228 |
| 898 | 3300026088 | Ga0207641_10512678 | Ga0207641_105126781 | 228 |
| 899 | 3300026116 | Ga0207674_10014216 | Ga0207674_100142162 | 228 |
| 900 | 3300026118 | Ga0207675_100169851 | Ga0207675_1001698512 | 228 |
| 901 | 3300026118 | Ga0207675_100185016 | Ga0207675_1001850162 | 228 |
| 902 | 3300026121 | Ga0207683_10071845 | Ga0207683_100718452 | 228 |
| 903 | 3300026121 | Ga0207683_10083043 | Ga0207683_100830432 | 228 |
| 904 | 3300026121 | Ga0207683_10202810 | Ga0207683_102028102 | 228 |
| 905 | 3300026121 | Ga0207683_10270475 | Ga0207683_102704752 | 228 |
| 906 | 3300026142 | Ga0207698_11136849 | Ga0207698_111368491 | 228 |
| 907 | 3300027296 | Ga0209389_1000072 | Ga0209389_100007299 | 228 |
| 908 | 3300027296 | Ga0209389_1000187 | Ga0209389_100018734 | 228 |
| 909 | 3300027357 | Ga0209589_1002629 | Ga0209589_100262931 | 228 |
| 910 | 3300027361 | Ga0209489_100206 | Ga0209489_10020698 | 228 |
| 911 | 3300027361 | Ga0209489_101592 | Ga0209489_10159235 | 228 |
| 912 | 3300027363 | Ga0209700_100014 | Ga0209700_10001435 | 228 |
| 913 | 3300027866 | Ga0209813_10021561 | Ga0209813_100215612 | 228 |
| 914 | 3300028379 | Ga0268266_10004998 | Ga0268266_1000499813 | 228 |
| 915 | 3300028379 | Ga0268266_10013041 | Ga0268266_100130416 | 228 |
| 916 | 3300028379 | Ga0268266_10181049 | Ga0268266_101810492 | 228 |
| 917 | 3300028379 | Ga0268266_10474762 | Ga0268266_104747623 | 228 |
| 918 | 3300028380 | Ga0268265_10426585 | Ga0268265_104265851 | 228 |
| 919 | 3300028381 | Ga0268264_10000187 | Ga0268264_1000018716 | 228 |
| 920 | 3300028381 | Ga0268264_10299924 | Ga0268264_102999241 | 228 |
| 921 | 3300028558 | Ga0265326_10005386 | Ga0265326_100053863 | 228 |
| 922 | 3300028563 | Ga0265319_1032588 | Ga0265319_10325882 | 228 |
| 923 | 3300028573 | Ga0265334_10000741 | Ga0265334_100007418 | 228 |
| 924 | 3300028577 | Ga0265318_10016165 | Ga0265318_100161651 | 228 |
| 925 | 3300028653 | Ga0265323_10001701 | Ga0265323_100017018 | 228 |
| 926 | 3300028654 | Ga0265322_10011637 | Ga0265322_100116372 | 228 |
| 927 | 3300028666 | Ga0265336_10001237 | Ga0265336_1000123710 | 228 |
| 928 | 3300028786 | Ga0307517_10000066 | Ga0307517_1000006663 | 228 |
| 929 | 3300028794 | Ga0307515_10062791 | Ga0307515_100627913 | 228 |
| 930 | 3300028800 | Ga0265338_10000973 | Ga0265338_1000097310 | 228 |
| 931 | 3300029957 | Ga0265324_10003799 | Ga0265324_100037992 | 228 |
| 932 | 3300031235 | Ga0265330_10012740 | Ga0265330_100127403 | 228 |
| 933 | 3300031235 | Ga0265330_10019458 | Ga0265330_100194583 | 228 |
| 934 | 3300031235 | Ga0265330_10024564 | Ga0265330_100245642 | 228 |
| 935 | 3300031241 | Ga0265325_10012522 | Ga0265325_100125222 | 228 |
| 936 | 3300031247 | Ga0265340_10002830 | Ga0265340_100028307 | 228 |
| 937 | 3300031249 | Ga0265339_10005543 | Ga0265339_100055438 | 228 |
| 938 | 3300031249 | Ga0265339_10007566 | Ga0265339_100075662 | 228 |
| 939 | 3300031249 | Ga0265339_10074780 | Ga0265339_100747802 | 228 |
| 940 | 3300031344 | Ga0265316_10083560 | Ga0265316_100835601 | 228 |
| 941 | 3300031456 | Ga0307513_10108299 | Ga0307513_101082993 | 228 |
| 942 | 3300031507 | Ga0307509_10084953 | Ga0307509_100849532 | 228 |
| 943 | 3300031548 | Ga0307408_100329450 | Ga0307408_1003294502 | 228 |
| 944 | 3300031616 | Ga0307508_10032542 | Ga0307508_100325423 | 228 |
| 945 | 3300031711 | Ga0265314_10003805 | Ga0265314_1000380510 | 228 |
| 946 | 3300031711 | Ga0265314_10193145 | Ga0265314_101931451 | 228 |
| 947 | 3300031730 | Ga0307516_10097402 | Ga0307516_100974022 | 228 |
| 948 | 3300031730 | Ga0307516_10205184 | Ga0307516_102051841 | 228 |
| 949 | 3300031730 | Ga0307516_10344675 | Ga0307516_103446752 | 228 |
| 950 | 3300031824 | Ga0307413_10378884 | Ga0307413_103788841 | 228 |
| 951 | 3300031911 | Ga0307412_10375802 | Ga0307412_103758022 | 228 |
| 952 | 3300031911 | Ga0307412_10637129 | Ga0307412_106371291 | 228 |
| 953 | 3300032002 | Ga0307416_100063629 | Ga0307416_1000636292 | 228 |
| 954 | 3300032002 | Ga0307416_100108637 | Ga0307416_1001086373 | 228 |
| 955 | 3300032002 | Ga0307416_100312914 | Ga0307416_1003129142 | 228 |
| 956 | 3300032005 | Ga0307411_10280466 | Ga0307411_102804661 | 228 |
| 957 | 3300032126 | Ga0307415_100072687 | Ga0307415_1000726872 | 228 |
| 958 | 3300033180 | Ga0307510_10028628 | Ga0307510_100286283 | 228 |
| 959 | 3300033180 | Ga0307510_10061999 | Ga0307510_100619993 | 228 |
| 960 | 3300033180 | Ga0307510_10072661 | Ga0307510_100726615 | 228 |
| 961 | 3300033180 | Ga0307510_10125969 | Ga0307510_101259692 | 228 |
| 962 | 3300033544 | Ga0316215_1001804 | Ga0316215_10018042 | 228 |
| 963 | 3300035083 | Ga0373926_0140185 | Ga0373926_0140185_65_757 | 228 |
| 964 | 3300035086 | Ga0373934_0002341 | Ga0373934_0002341_4642_5442 | 228 |
| 965 | 3300035111 | Ga0373923_0005063 | Ga0373923_0005063_64_867 | 228 |
| 966 | 3300035112 | Ga0373932_0036142 | Ga0373932_0036142_512_1204 | 228 |
| 967 | 3300035113 | Ga0373936_0041581 | Ga0373936_0041581_1016_1708 | 228 |
| 968 | 3300035113 | Ga0373936_0075587 | Ga0373936_0075587_317_1009 | 228 |
| 969 | 3300035116 | Ga0373945_0023026 | Ga0373945_0023026_136_828 | 228 |
| 970 | 3300035117 | Ga0373953_0030658 | Ga0373953_0030658_300_1100 | 228 |
| 971 | 3300035117 | Ga0373953_0060834 | Ga0373953_0060834_674_1366 | 228 |
| 972 | 3300035117 | Ga0373953_0112051 | Ga0373953_0112051_298_996 | 228 |
| 973 | 3300035118 | Ga0373954_0000182 | Ga0373954_0000182_14368_15168 | 228 |
| 974 | 3300035118 | Ga0373954_0053063 | Ga0373954_0053063_374_1072 | 228 |
| 975 | 3300035119 | Ga0373956_0001338 | Ga0373956_0001338_1165_1965 | 228 |
| 976 | 3300035119 | Ga0373956_0091708 | Ga0373956_0091708_674_1372 | 228 |
| 977 | 3300035120 | Ga0373957_0002101 | Ga0373957_0002101_1142_1942 | 228 |
| 978 | 3300035170 | Ga0373943_0013966 | Ga0373943_0013966_143_892 | 228 |
| 979 | 3300035171 | Ga0373946_0002873 | Ga0373946_0002873_3681_4373 | 228 |
| 980 | 3300035172 | Ga0373955_0000471 | Ga0373955_0000471_7917_8717 | 228 |
| 981 | 3300035172 | Ga0373955_0066380 | Ga0373955_0066380_1108_1806 | 228 |
| 982 | 3300035172 | Ga0373955_0319684 | Ga0373955_0319684_98_790 | 228 |
| 983 | 3300035410 | Ga0373924_0013602 | Ga0373924_0013602_1090_1890 | 228 |
| 984 | 3300035691 | Ga0373931_0008813 | Ga0373931_0008813_1790_2485 | 228 |
| 985 | 3300035692 | Ga0373935_0000128 | Ga0373935_0000128_10233_10925 | 228 |
| 986 | 3300035692 | Ga0373935_0196813 | Ga0373935_0196813_41_736 | 228 |
| 987 | 3300035695 | Ga0373927_0000496 | Ga0373927_0000496_17370_18062 | 228 |
| 988 | 3300035695 | Ga0373927_0019629 | Ga0373927_0019629_3601_4350 | 228 |
| 989 | 3300035695 | Ga0373927_0088429 | Ga0373927_0088429_353_1105 | 228 |
| 990 | 3300035695 | Ga0373927_0114199 | Ga0373927_0114199_722_1411 | 228 |
| 991 | 3300035695 | Ga0373927_0338939 | Ga0373927_0338939_84_779 | 228 |
| 992 | 3300035724 | Ga0373933_0000163 | Ga0373933_0000163_37232_37960 | 228 |
| 993 | 3300035724 | Ga0373933_0002736 | Ga0373933_0002736_1170_1970 | 228 |
| 994 | 3300035724 | Ga0373933_0281527 | Ga0373933_0281527_154_846 | 228 |
| 995 | 3300035725 | Ga0373947_0001955 | Ga0373947_0001955_6550_7242 | 228 |
| 996 | 3300035725 | Ga0373947_0435328 | Ga0373947_0435328_171_866 | 228 |
| 997 | 3300036401 | Ga0373937_0030048 | Ga0373937_0030048_1171_1971 | 228 |
| 998 | 3300036401 | Ga0373937_0036173 | Ga0373937_0036173_2988_3680 | 228 |
| 999 | 3300036401 | Ga0373937_0064006 | Ga0373937_0064006_1469_2167 | 228 |
| 1000 | 3300037068 | Ga0373925_0006551 | Ga0373925_0006551_1553_2245 | 228 |
| 1001 | 3300037068 | Ga0373925_0044113 | Ga0373925_0044113_1984_2733 | 228 |
| 1002 | 3300037068 | Ga0373925_0112246 | Ga0373925_0112246_63_758 | 228 |
| 1003 | 3300037068 | Ga0373925_0146209 | Ga0373925_0146209_1137_1832 | 228 |
| 1004 | 3300037418 | Ga0395900_0097162 | Ga0395900_0097162_2221_2910 | 228 |
| 1005 | 3300037418 | Ga0395900_0195574 | Ga0395900_0195574_618_1310 | 228 |
| 1006 | 3300037418 | Ga0395900_0467657 | Ga0395900_0467657_503_1198 | 228 |
| 1007 | 3300037418 | Ga0395900_0779808 | Ga0395900_0779808_148_837 | 228 |
| 1008 | 3300037466 | Ga0395898_0019490 | Ga0395898_0019490_2142_2834 | 228 |
| 1009 | 3300037466 | Ga0395898_0162711 | Ga0395898_0162711_15_707 | 228 |
| 1010 | 3300037466 | Ga0395898_0360651 | Ga0395898_0360651_262_957 | 228 |
| 1011 | 3300037466 | Ga0395898_0483860 | Ga0395898_0483860_404_1120 | 228 |
| 1012 | 3300037471 | Ga0395905_0014568 | Ga0395905_0014568_3510_4199 | 228 |
| 1013 | 3300037471 | Ga0395905_0049145 | Ga0395905_0049145_1656_2351 | 228 |
| 1014 | 3300037471 | Ga0395905_0104291 | Ga0395905_0104291_1870_2565 | 228 |
| 1015 | 3300037471 | Ga0395905_0554032 | Ga0395905_0554032_303_992 | 228 |
| 1016 | 3300038443 | Ga0395901_0016488 | Ga0395901_0016488_6246_6953 | 228 |
| 1017 | 3300038443 | Ga0395901_0070062 | Ga0395901_0070062_1520_2212 | 228 |
| 1018 | 3300038443 | Ga0395901_0175233 | Ga0395901_0175233_809_1501 | 228 |
| 1019 | 3300038443 | Ga0395901_0209102 | Ga0395901_0209102_607_1296 | 228 |
| 1020 | 3300038443 | Ga0395901_0445590 | Ga0395901_0445590_235_930 | 228 |
| 1021 | 3300039437 | Ga0436365_0015658 | Ga0436365_0015658_47_739 | 228 |
| 1022 | 3300039437 | Ga0436365_0076767 | Ga0436365_0076767_1439_2137 | 228 |
| 1023 | 3300039437 | Ga0436365_0351010 | Ga0436365_0351010_352_1044 | 228 |
| 1024 | 3300039437 | Ga0436365_0655011 | Ga0436365_0655011_1499_2191 | 228 |
| 1025 | 3300039437 | Ga0436365_1220227 | Ga0436365_1220227_92_778 | 228 |
| 1026 | 3300039437 | Ga0436365_1347888 | Ga0436365_1347888_47_763 | 228 |
| 1027 | 3300039437 | Ga0436365_1860217 | Ga0436365_1860217_953_1645 | 228 |
| 1028 | 3300039438 | Ga0436360_0415296 | Ga0436360_0415296_776_1486 | 228 |
| 1029 | 3300039438 | Ga0436360_0545862 | Ga0436360_0545862_23_724 | 228 |
| 1030 | 3300039438 | Ga0436360_1315230 | Ga0436360_1315230_87_782 | 228 |
| 1031 | 3300039447 | Ga0436361_0093159 | Ga0436361_0093159_62_778 | 228 |
| 1032 | 3300039447 | Ga0436361_0202497 | Ga0436361_0202497_46_738 | 228 |
| 1033 | 3300039447 | Ga0436361_0267897 | Ga0436361_0267897_163_888 | 228 |
| 1034 | 3300039450 | Ga0436363_0960712 | Ga0436363_0960712_70_765 | 228 |
| 1035 | 3300039450 | Ga0436363_1716088 | Ga0436363_1716088_677_1372 | 228 |
| 1036 | 3300041452 | Ga0451793_0299829 | Ga0451793_0299829_48_758 | 228 |
| 1037 | 3300041453 | Ga0451797_0981027 | Ga0451797_0981027_336_1028 | 228 |
| 1038 | 3300041507 | Ga0451851_0940412 | Ga0451851_0940412_77_769 | 228 |
| 1039 | 3300044656 | Ga0466969_0251498 | Ga0466969_0251498_32_748 | 228 |
| 1040 | 3300044658 | Ga0466972_0000048 | Ga0466972_0000048_114146_114841 | 228 |
| 1041 | 3300044658 | Ga0466972_0060310 | Ga0466972_0060310_735_1430 | 228 |
| 1042 | 3300044658 | Ga0466972_0144481 | Ga0466972_0144481_226_915 | 228 |
| 1043 | 3300044684 | Ga0466966_0001085 | Ga0466966_0001085_8410_9117 | 228 |
| 1044 | 3300044684 | Ga0466966_0046527 | Ga0466966_0046527_650_1360 | 228 |
| 1045 | 3300044693 | Ga0466961_0000010 | Ga0466961_0000010_27351_28058 | 228 |
| 1046 | 3300044693 | Ga0466961_0214683 | Ga0466961_0214683_373_1131 | 228 |
| 1047 | 3300044706 | Ga0466964_0055814 | Ga0466964_0055814_165_857 | 228 |
| 1048 | 3300044706 | Ga0466964_0067339 | Ga0466964_0067339_361_1050 | 228 |
| 1049 | 3300044706 | Ga0466964_0256914 | Ga0466964_0256914_72_764 | 228 |
| 1050 | 3300044735 | Ga0466968_0043032 | Ga0466968_0043032_72_797 | 228 |
| 1051 | 3300044735 | Ga0466968_0061978 | Ga0466968_0061978_90_782 | 228 |
| 1052 | 3300044735 | Ga0466968_0284016 | Ga0466968_0284016_18_731 | 228 |
| 1053 | 3300044765 | Ga0466970_0084965 | Ga0466970_0084965_827_1522 | 228 |
| 1054 | 3300044842 | Ga0466957_0263094 | Ga0466957_0263094_53_742 | 228 |
| 1055 | 3300044901 | Ga0466960_0067537 | Ga0466960_0067537_192_881 | 228 |
| 1056 | 3300045049 | Ga0466959_0002483 | Ga0466959_0002483_4389_5096 | 228 |
| 1057 | 3300045049 | Ga0466959_0051087 | Ga0466959_0051087_1199_1894 | 228 |
| 1058 | 3300045836 | Ga0466958_0350086 | Ga0466958_0350086_72_776 | 228 |
| 1059 | 3300045976 | Ga0466967_0124732 | Ga0466967_0124732_321_1013 | 228 |
| 1060 | 3300046452 | Ga0495617_041126 | Ga0495617_041126_525_1217 | 228 |
| 1061 | 3300046454 | Ga0495592_0002891 | Ga0495592_0002891_119_919 | 228 |
| 1062 | 3300046454 | Ga0495592_0070573 | Ga0495592_0070573_1799_2497 | 228 |
| 1063 | 3300046454 | Ga0495592_0310801 | Ga0495592_0310801_67_759 | 228 |
| 1064 | 3300046455 | Ga0495603_0000104 | Ga0495603_0000104_28185_28877 | 228 |
| 1065 | 3300046455 | Ga0495603_0007956 | Ga0495603_0007956_3173_3868 | 228 |
| 1066 | 3300046455 | Ga0495603_0009775 | Ga0495603_0009775_1463_2212 | 228 |
| 1067 | 3300046455 | Ga0495603_0091982 | Ga0495603_0091982_1006_1698 | 228 |
| 1068 | 3300046455 | Ga0495603_0209209 | Ga0495603_0209209_399_1091 | 228 |
| 1069 | 3300046455 | Ga0495603_0225994 | Ga0495603_0225994_42_737 | 228 |
| 1070 | 3300046457 | Ga0495590_0086807 | Ga0495590_0086807_304_996 | 228 |
| 1071 | 3300046459 | Ga0495629_0005026 | Ga0495629_0005026_7943_8743 | 228 |
| 1072 | 3300046459 | Ga0495629_0008475 | Ga0495629_0008475_6737_7429 | 228 |
| 1073 | 3300046459 | Ga0495629_0034540 | Ga0495629_0034540_792_1484 | 228 |
| 1074 | 3300046459 | Ga0495629_0051748 | Ga0495629_0051748_2164_2850 | 228 |
| 1075 | 3300046460 | Ga0495638_0037701 | Ga0495638_0037701_1143_1832 | 228 |
| 1076 | 3300046460 | Ga0495638_0047273 | Ga0495638_0047273_924_1616 | 228 |
| 1077 | 3300046460 | Ga0495638_0077571 | Ga0495638_0077571_886_1593 | 228 |
| 1078 | 3300046460 | Ga0495638_0190889 | Ga0495638_0190889_218_925 | 228 |
| 1079 | 3300046461 | Ga0495641_0000402 | Ga0495641_0000402_24719_25411 | 228 |
| 1080 | 3300046462 | Ga0495651_0005264 | Ga0495651_0005264_7892_8692 | 228 |
| 1081 | 3300046462 | Ga0495651_0007958 | Ga0495651_0007958_622_1314 | 228 |
| 1082 | 3300046463 | Ga0495653_0023995 | Ga0495653_0023995_1170_1970 | 228 |
| 1083 | 3300046463 | Ga0495653_0058017 | Ga0495653_0058017_896_1594 | 228 |
| 1084 | 3300046463 | Ga0495653_0066480 | Ga0495653_0066480_1095_1787 | 228 |
| 1085 | 3300046472 | Ga0495580_0003617 | Ga0495580_0003617_12256_12948 | 228 |
| 1086 | 3300046473 | Ga0495582_0000063 | Ga0495582_0000063_27595_28287 | 228 |
| 1087 | 3300046473 | Ga0495582_0105122 | Ga0495582_0105122_466_1158 | 228 |
| 1088 | 3300046474 | Ga0495605_0062183 | Ga0495605_0062183_565_1257 | 228 |
| 1089 | 3300046475 | Ga0495639_0000485 | Ga0495639_0000485_16456_17148 | 228 |
| 1090 | 3300046476 | Ga0495662_0000297 | Ga0495662_0000297_154_846 | 228 |
| 1091 | 3300046476 | Ga0495662_0098574 | Ga0495662_0098574_393_1085 | 228 |
| 1092 | 3300046477 | Ga0495664_0006814 | Ga0495664_0006814_2719_3411 | 228 |
| 1093 | 3300046477 | Ga0495664_0026353 | Ga0495664_0026353_2613_3305 | 228 |
| 1094 | 3300046477 | Ga0495664_0146980 | Ga0495664_0146980_636_1334 | 228 |
| 1095 | 3300046491 | Ga0495584_0271099 | Ga0495584_0271099_48_755 | 228 |
| 1096 | 3300046492 | Ga0495585_0083823 | Ga0495585_0083823_847_1536 | 228 |
| 1097 | 3300046492 | Ga0495585_0181363 | Ga0495585_0181363_197_886 | 228 |
| 1098 | 3300046499 | Ga0495594_0001344 | Ga0495594_0001344_159_851 | 228 |
| 1099 | 3300046500 | Ga0495596_0167193 | Ga0495596_0167193_40_747 | 228 |
| 1100 | 3300046501 | Ga0495607_0172336 | Ga0495607_0172336_310_1002 | 228 |
| 1101 | 3300046501 | Ga0495607_0240665 | Ga0495607_0240665_65_757 | 228 |
| 1102 | 3300046506 | Ga0495583_0105995 | Ga0495583_0105995_31_738 | 228 |
| 1103 | 3300046507 | Ga0495606_0051481 | Ga0495606_0051481_1017_1703 | 228 |
| 1104 | 3300046511 | Ga0495608_0002114 | Ga0495608_0002114_12337_13137 | 228 |
| 1105 | 3300046511 | Ga0495608_0164917 | Ga0495608_0164917_70_762 | 228 |
| 1106 | 3300046511 | Ga0495608_0173294 | Ga0495608_0173294_20_718 | 228 |
| 1107 | 3300046512 | Ga0495610_0055902 | Ga0495610_0055902_409_1116 | 228 |
| 1108 | 3300046512 | Ga0495610_0100423 | Ga0495610_0100423_338_1045 | 228 |
| 1109 | 3300046513 | Ga0495616_0037634 | Ga0495616_0037634_685_1392 | 228 |
| 1110 | 3300046514 | Ga0495618_0158348 | Ga0495618_0158348_119_919 | 228 |
| 1111 | 3300046515 | Ga0495620_0183325 | Ga0495620_0183325_81_770 | 228 |
| 1112 | 3300046516 | Ga0495628_0047088 | Ga0495628_0047088_2109_2807 | 228 |
| 1113 | 3300046516 | Ga0495628_0073113 | Ga0495628_0073113_822_1514 | 228 |
| 1114 | 3300046516 | Ga0495628_0145841 | Ga0495628_0145841_63_863 | 228 |
| 1115 | 3300046517 | Ga0495630_0003717 | Ga0495630_0003717_4090_4782 | 228 |
| 1116 | 3300046517 | Ga0495630_0205296 | Ga0495630_0205296_276_974 | 228 |
| 1117 | 3300046518 | Ga0495631_0028024 | Ga0495631_0028024_1338_2045 | 228 |
| 1118 | 3300046519 | Ga0495632_0063341 | Ga0495632_0063341_587_1279 | 228 |
| 1119 | 3300046519 | Ga0495632_0165365 | Ga0495632_0165365_235_927 | 228 |
| 1120 | 3300046523 | Ga0495644_0015964 | Ga0495644_0015964_2129_2818 | 228 |
| 1121 | 3300046524 | Ga0495648_0001804 | Ga0495648_0001804_7956_8654 | 228 |
| 1122 | 3300046524 | Ga0495648_0008803 | Ga0495648_0008803_2800_3504 | 228 |
| 1123 | 3300046524 | Ga0495648_0159851 | Ga0495648_0159851_403_1092 | 228 |
| 1124 | 3300046526 | Ga0495666_0075370 | Ga0495666_0075370_191_886 | 228 |
| 1125 | 3300046526 | Ga0495666_0271840 | Ga0495666_0271840_51_743 | 228 |
| 1126 | 3300046529 | Ga0495652_0024316 | Ga0495652_0024316_1139_1831 | 228 |
| 1127 | 3300046529 | Ga0495652_0028805 | Ga0495652_0028805_1170_1970 | 228 |
| 1128 | 3300046529 | Ga0495652_0029863 | Ga0495652_0029863_1307_1999 | 228 |
| 1129 | 3300046529 | Ga0495652_0407245 | Ga0495652_0407245_244_933 | 228 |
| 1130 | 3300046530 | Ga0495654_0018680 | Ga0495654_0018680_1187_1894 | 228 |
| 1131 | 3300046530 | Ga0495654_0076756 | Ga0495654_0076756_335_1030 | 228 |
| 1132 | 3300046531 | Ga0495665_0000290 | Ga0495665_0000290_7609_8301 | 228 |
| 1133 | 3300046531 | Ga0495665_0301470 | Ga0495665_0301470_106_801 | 228 |
| 1134 | 3300046533 | Ga0495640_0005621 | Ga0495640_0005621_9112_9804 | 228 |
| 1135 | 3300046533 | Ga0495640_0072047 | Ga0495640_0072047_1442_2128 | 228 |
| 1136 | 3300046533 | Ga0495640_0156522 | Ga0495640_0156522_521_1219 | 228 |
| 1137 | 3300046536 | Ga0495587_0042093 | Ga0495587_0042093_327_1025 | 228 |
| 1138 | 3300046536 | Ga0495587_0054357 | Ga0495587_0054357_276_968 | 228 |
| 1139 | 3300046537 | Ga0495598_0141351 | Ga0495598_0141351_76_774 | 228 |
| 1140 | 3300046538 | Ga0495609_0039381 | Ga0495609_0039381_364_1056 | 228 |
| 1141 | 3300046538 | Ga0495609_0109199 | Ga0495609_0109199_384_1073 | 228 |
| 1142 | 3300046542 | Ga0495597_0192786 | Ga0495597_0192786_43_735 | 228 |
| 1143 | 3300046543 | Ga0495645_0003860 | Ga0495645_0003860_2407_3099 | 228 |
| 1144 | 3300046543 | Ga0495645_0004402 | Ga0495645_0004402_103_801 | 228 |
| 1145 | 3300046543 | Ga0495645_0052172 | Ga0495645_0052172_724_1419 | 228 |
| 1146 | 3300046557 | Ga0495622_0009243 | Ga0495622_0009243_3735_4427 | 228 |
| 1147 | 3300046557 | Ga0495622_0034772 | Ga0495622_0034772_1403_2110 | 228 |
| 1148 | 3300046557 | Ga0495622_0055664 | Ga0495622_0055664_41_727 | 228 |
| 1149 | 3300046557 | Ga0495622_0059155 | Ga0495622_0059155_125_817 | 228 |
| 1150 | 3300046558 | Ga0495633_0090573 | Ga0495633_0090573_395_1087 | 228 |
| 1151 | 3300046559 | Ga0495667_0010602 | Ga0495667_0010602_1433_2125 | 228 |
| 1152 | 3300046559 | Ga0495667_0054425 | Ga0495667_0054425_663_1463 | 228 |
| 1153 | 3300046559 | Ga0495667_0091515 | Ga0495667_0091515_1236_1922 | 228 |
| 1154 | 3300046559 | Ga0495667_0143095 | Ga0495667_0143095_614_1306 | 228 |
| 1155 | 3300046615 | Ga0495656_0017449 | Ga0495656_0017449_1746_2450 | 228 |
| 1156 | 3300046615 | Ga0495656_0028115 | Ga0495656_0028115_1013_1705 | 228 |
| 1157 | 3300046615 | Ga0495656_0091630 | Ga0495656_0091630_237_929 | 228 |
| 1158 | 3300046616 | Ga0495668_0066432 | Ga0495668_0066432_466_1158 | 228 |
| 1159 | 3300046642 | Ga0495634_0000645 | Ga0495634_0000645_6485_7177 | 228 |
| 1160 | 3300046642 | Ga0495634_0031674 | Ga0495634_0031674_64_756 | 228 |
| 1161 | 3300046642 | Ga0495634_0121018 | Ga0495634_0121018_67_867 | 228 |
| 1162 | 3300046660 | Ga0495625_0057521 | Ga0495625_0057521_1109_1816 | 228 |
| 1163 | 3300046660 | Ga0495625_0105740 | Ga0495625_0105740_115_807 | 228 |
| 1164 | 3300046660 | Ga0495625_0139230 | Ga0495625_0139230_770_1462 | 228 |
| 1165 | 3300046660 | Ga0495625_0149038 | Ga0495625_0149038_460_1155 | 228 |
| 1166 | 3300046660 | Ga0495625_0380806 | Ga0495625_0380806_163_870 | 228 |
| 1167 | 3300046663 | Ga0495635_0007816 | Ga0495635_0007816_509_1201 | 228 |
| 1168 | 3300046663 | Ga0495635_0018102 | Ga0495635_0018102_2951_3751 | 228 |
| 1169 | 3300046663 | Ga0495635_0049840 | Ga0495635_0049840_1637_2335 | 228 |
| 1170 | 3300046663 | Ga0495635_0055521 | Ga0495635_0055521_1867_2553 | 228 |
| 1171 | 3300046663 | Ga0495635_0073607 | Ga0495635_0073607_966_1658 | 228 |
| 1172 | 3300046665 | Ga0495661_0082848 | Ga0495661_0082848_967_1674 | 228 |
| 1173 | 3300046665 | Ga0495661_0145639 | Ga0495661_0145639_454_1149 | 228 |
| 1174 | 3300046665 | Ga0495661_0171218 | Ga0495661_0171218_361_1053 | 228 |
| 1175 | 3300046665 | Ga0495661_0236581 | Ga0495661_0236581_171_869 | 228 |
| 1176 | 3300046674 | Ga0495588_0001460 | Ga0495588_0001460_9278_9970 | 228 |
| 1177 | 3300046674 | Ga0495588_0005750 | Ga0495588_0005750_4297_4989 | 228 |
| 1178 | 3300046675 | Ga0495657_0005336 | Ga0495657_0005336_6602_7294 | 228 |
| 1179 | 3300046675 | Ga0495657_0046640 | Ga0495657_0046640_1170_1970 | 228 |
| 1180 | 3300046675 | Ga0495657_0055356 | Ga0495657_0055356_50_736 | 228 |
| 1181 | 3300046678 | Ga0495599_0002959 | Ga0495599_0002959_7915_8715 | 228 |
| 1182 | 3300046678 | Ga0495599_0026678 | Ga0495599_0026678_911_1609 | 228 |
| 1183 | 3300046678 | Ga0495599_0080747 | Ga0495599_0080747_912_1604 | 228 |
| 1184 | 3300046678 | Ga0495599_0187254 | Ga0495599_0187254_452_1144 | 228 |
| 1185 | 3300046679 | Ga0495623_0003813 | Ga0495623_0003813_7971_8771 | 228 |
| 1186 | 3300046679 | Ga0495623_0022363 | Ga0495623_0022363_609_1301 | 228 |
| 1187 | 3300046679 | Ga0495623_0022589 | Ga0495623_0022589_1746_2444 | 228 |
| 1188 | 3300046680 | Ga0495646_0003545 | Ga0495646_0003545_12_812 | 228 |
| 1189 | 3300046680 | Ga0495646_0132756 | Ga0495646_0132756_113_805 | 228 |
| 1190 | 3300046680 | Ga0495646_0193637 | Ga0495646_0193637_202_888 | 228 |
| 1191 | 3300046681 | Ga0495647_0003274 | Ga0495647_0003274_770_1462 | 228 |
| 1192 | 3300046683 | Ga0495658_0000702 | Ga0495658_0000702_7911_8603 | 228 |
| 1193 | 3300046689 | Ga0495613_0022713 | Ga0495613_0022713_33_836 | 228 |
| 1194 | 3300046689 | Ga0495613_0088265 | Ga0495613_0088265_1473_2165 | 228 |
| 1195 | 3300046689 | Ga0495613_0189412 | Ga0495613_0189412_24_716 | 228 |
| 1196 | 3300046690 | Ga0495624_0000224 | Ga0495624_0000224_17041_17733 | 228 |
| 1197 | 3300046690 | Ga0495624_0014848 | Ga0495624_0014848_631_1317 | 228 |
| 1198 | 3300046690 | Ga0495624_0296061 | Ga0495624_0296061_230_925 | 228 |
| 1199 | 3300046691 | Ga0495670_0041333 | Ga0495670_0041333_1407_2114 | 228 |
| 1200 | 3300046691 | Ga0495670_0255627 | Ga0495670_0255627_214_906 | 228 |
| 1201 | 3300046692 | Ga0495671_0018783 | Ga0495671_0018783_2569_3276 | 228 |
| 1202 | 3300046692 | Ga0495671_0073822 | Ga0495671_0073822_204_896 | 228 |
| 1203 | 3300046694 | Ga0495649_0077730 | Ga0495649_0077730_815_1501 | 228 |
| 1204 | 3300046809 | Ga0495600_0000221 | Ga0495600_0000221_30200_31000 | 228 |
| 1205 | 3300046809 | Ga0495600_0019491 | Ga0495600_0019491_1203_1895 | 228 |
| 1206 | 3300046809 | Ga0495600_0130831 | Ga0495600_0130831_650_1348 | 228 |
| 1207 | 3300047315 | Ga0495581_0000168 | Ga0495581_0000168_17728_18420 | 228 |
| 1208 | 3300047315 | Ga0495581_0050474 | Ga0495581_0050474_1300_1989 | 228 |
| 1209 | 3300047315 | Ga0495581_0062405 | Ga0495581_0062405_556_1305 | 228 |
| 1210 | 3300047317 | Ga0495604_0023528 | Ga0495604_0023528_1164_1964 | 228 |
| 1211 | 3300047317 | Ga0495604_0084649 | Ga0495604_0084649_464_1162 | 228 |
| 1212 | 3300047317 | Ga0495604_0085878 | Ga0495604_0085878_1441_2127 | 228 |
| 1213 | 3300047318 | Ga0495636_0059691 | Ga0495636_0059691_759_1448 | 228 |
| 1214 | 3300047319 | Ga0495674_0005032 | Ga0495674_0005032_258_950 | 228 |
| 1215 | 3300047319 | Ga0495674_0031903 | Ga0495674_0031903_1011_1703 | 228 |
| 1216 | 3300047319 | Ga0495674_0058385 | Ga0495674_0058385_2572_3270 | 228 |
| 1217 | 3300047320 | Ga0495672_0010686 | Ga0495672_0010686_1327_2031 | 228 |
| 1218 | 3300047320 | Ga0495672_0214739 | Ga0495672_0214739_25_720 | 228 |
| 1219 | 3300047321 | Ga0495676_0072807 | Ga0495676_0072807_1331_2023 | 228 |
| 1220 | 3300047321 | Ga0495676_0092084 | Ga0495676_0092084_718_1410 | 228 |
| 1221 | 3300047321 | Ga0495676_0194010 | Ga0495676_0194010_75_782 | 228 |
| 1222 | 3300047321 | Ga0495676_0321039 | Ga0495676_0321039_76_762 | 228 |
| 1223 | 3300047322 | Ga0495680_0026568 | Ga0495680_0026568_431_1123 | 228 |
| 1224 | 3300047322 | Ga0495680_0110044 | Ga0495680_0110044_1088_1786 | 228 |
| 1225 | 3300047444 | Ga0495675_0006791 | Ga0495675_0006791_2715_3407 | 228 |
| 1226 | 3300047444 | Ga0495675_0055835 | Ga0495675_0055835_1170_1970 | 228 |
| 1227 | 3300047444 | Ga0495675_0092770 | Ga0495675_0092770_896_1594 | 228 |
| 1228 | 3300047447 | Ga0495685_025882 | Ga0495685_025882_1251_1943 | 228 |
| 1229 | 3300047471 | Ga0495684_0002603 | Ga0495684_0002603_11639_12439 | 228 |
| 1230 | 3300047471 | Ga0495684_0012173 | Ga0495684_0012173_3661_4353 | 228 |
| 1231 | 3300047472 | Ga0495686_0012492 | Ga0495686_0012492_5066_5773 | 228 |
| 1232 | 3300047472 | Ga0495686_0237285 | Ga0495686_0237285_88_783 | 228 |
| 1233 | 3300047673 | Ga0495593_0000150 | Ga0495593_0000150_26375_27067 | 228 |
| 1234 | 3300047673 | Ga0495593_0004768 | Ga0495593_0004768_1127_1927 | 228 |
| 1235 | 3300047673 | Ga0495593_0028312 | Ga0495593_0028312_825_1511 | 228 |
| 1236 | 3300048088 | Ga0495602_0000907 | Ga0495602_0000907_97_897 | 228 |
| 1237 | 3300048088 | Ga0495602_0092951 | Ga0495602_0092951_768_1460 | 228 |
| 1238 | 3300048088 | Ga0495602_0151718 | Ga0495602_0151718_947_1657 | 228 |
| 1239 | 3300048088 | Ga0495602_0536971 | Ga0495602_0536971_63_749 | 228 |
| 1240 | 3300048091 | Ga0495626_0031034 | Ga0495626_0031034_509_1216 | 228 |
| 1241 | 3300048091 | Ga0495626_0109103 | Ga0495626_0109103_223_915 | 228 |
| 1242 | 3300048903 | Ga0496100_0014076 | Ga0496100_0014076_958_1650 | 228 |
| 1243 | 3300048903 | Ga0496100_0125684 | Ga0496100_0125684_160_852 | 228 |
| 1244 | 3300048903 | Ga0496100_0156532 | Ga0496100_0156532_815_1510 | 228 |
| 1245 | 3300048903 | Ga0496100_0384886 | Ga0496100_0384886_225_920 | 228 |
| 1246 | 3300048904 | Ga0496101_0072116 | Ga0496101_0072116_1119_1811 | 228 |
| 1247 | 3300048904 | Ga0496101_0231479 | Ga0496101_0231479_75_767 | 228 |
| 1248 | 3300048904 | Ga0496101_0236995 | Ga0496101_0236995_75_767 | 228 |
| 1249 | 3300048904 | Ga0496101_0649694 | Ga0496101_0649694_90_782 | 228 |
| 1250 | 3300048905 | Ga0496102_0073603 | Ga0496102_0073603_1321_2013 | 228 |
| 1251 | 3300048906 | Ga0496103_0021504 | Ga0496103_0021504_2841_3533 | 228 |
| 1252 | 3300048907 | Ga0496104_0016754 | Ga0496104_0016754_127_813 | 228 |
| 1253 | 3300048907 | Ga0496104_0057967 | Ga0496104_0057967_415_1107 | 228 |
| 1254 | 3300048907 | Ga0496104_0077641 | Ga0496104_0077641_325_1020 | 228 |
| 1255 | 3300048907 | Ga0496104_0093535 | Ga0496104_0093535_638_1333 | 228 |
| 1256 | 3300048907 | Ga0496104_0493710 | Ga0496104_0493710_122_814 | 228 |
| 1257 | 3300048908 | Ga0496105_0024066 | Ga0496105_0024066_3564_4259 | 228 |
| 1258 | 3300048908 | Ga0496105_0025636 | Ga0496105_0025636_3090_3776 | 228 |
| 1259 | 3300048908 | Ga0496105_0027172 | Ga0496105_0027172_171_863 | 228 |
| 1260 | 3300048908 | Ga0496105_0202195 | Ga0496105_0202195_347_1039 | 228 |
| 1261 | 3300048908 | Ga0496105_0597059 | Ga0496105_0597059_62_754 | 228 |
| 1262 | 3300048909 | Ga0496106_0024940 | Ga0496106_0024940_786_1478 | 228 |
| 1263 | 3300048909 | Ga0496106_0122950 | Ga0496106_0122950_544_1239 | 228 |
| 1264 | 3300048910 | Ga0496107_0041793 | Ga0496107_0041793_144_836 | 228 |
| 1265 | 3300048910 | Ga0496107_0306829 | Ga0496107_0306829_452_1144 | 228 |
| 1266 | 3300048911 | Ga0496108_0368317 | Ga0496108_0368317_197_892 | 228 |
| 1267 | 3300048911 | Ga0496108_0432984 | Ga0496108_0432984_427_1122 | 228 |
| 1268 | 3300048911 | Ga0496108_0948784 | Ga0496108_0948784_18_710 | 228 |
| 1269 | 3300048912 | Ga0496109_0197544 | Ga0496109_0197544_17_730 | 228 |
| 1270 | 3300048912 | Ga0496109_0255054 | Ga0496109_0255054_63_755 | 228 |
| 1271 | 3300048912 | Ga0496109_0457763 | Ga0496109_0457763_218_931 | 228 |
| 1272 | 3300048913 | Ga0496110_0016256 | Ga0496110_0016256_1670_2362 | 228 |
| 1273 | 3300048913 | Ga0496110_0040048 | Ga0496110_0040048_1205_1903 | 228 |
| 1274 | 3300048913 | Ga0496110_0063614 | Ga0496110_0063614_1717_2409 | 228 |
| 1275 | 3300048914 | Ga0496111_0096203 | Ga0496111_0096203_305_1000 | 228 |
| 1276 | 3300048915 | Ga0496112_0031931 | Ga0496112_0031931_3789_4481 | 228 |
| 1277 | 3300048915 | Ga0496112_0067561 | Ga0496112_0067561_677_1372 | 228 |
| 1278 | 3300048915 | Ga0496112_0119028 | Ga0496112_0119028_518_1210 | 228 |
| 1279 | 3300048915 | Ga0496112_0610228 | Ga0496112_0610228_22_714 | 228 |
| 1280 | 3300048915 | Ga0496112_0769457 | Ga0496112_0769457_180_872 | 228 |
| 1281 | 3300048916 | Ga0496113_0044578 | Ga0496113_0044578_1343_2035 | 228 |
| 1282 | 3300048916 | Ga0496113_0181629 | Ga0496113_0181629_883_1575 | 228 |
| 1283 | 3300048916 | Ga0496113_0233859 | Ga0496113_0233859_528_1223 | 228 |
| 1284 | 3300048916 | Ga0496113_0577817 | Ga0496113_0577817_189_884 | 228 |
| 1285 | 3300048917 | Ga0496114_0031140 | Ga0496114_0031140_3261_3956 | 228 |
| 1286 | 3300048918 | Ga0496115_0021727 | Ga0496115_0021727_2819_3511 | 228 |
| 1287 | 3300048918 | Ga0496115_0725312 | Ga0496115_0725312_55_747 | 228 |
| 1288 | 3300048920 | Ga0496117_0020433 | Ga0496117_0020433_4237_4944 | 228 |
| 1289 | 3300048920 | Ga0496117_0160941 | Ga0496117_0160941_145_837 | 228 |
| 1290 | 3300048921 | Ga0496118_0027923 | Ga0496118_0027923_85_858 | 228 |
| 1291 | 3300048921 | Ga0496118_0047715 | Ga0496118_0047715_572_1279 | 228 |
| 1292 | 3300048921 | Ga0496118_0326863 | Ga0496118_0326863_119_814 | 228 |
| 1293 | 3300048923 | Ga0496120_0035243 | Ga0496120_0035243_1249_1938 | 228 |
| 1294 | 3300048923 | Ga0496120_0048142 | Ga0496120_0048142_1712_2398 | 228 |
| 1295 | 3300048923 | Ga0496120_0075864 | Ga0496120_0075864_944_1651 | 228 |
| 1296 | 3300048924 | Ga0496121_0004660 | Ga0496121_0004660_15380_16069 | 228 |
| 1297 | 3300048924 | Ga0496121_0005529 | Ga0496121_0005529_2540_3247 | 228 |
| 1298 | 3300048924 | Ga0496121_0015400 | Ga0496121_0015400_3090_3782 | 228 |
| 1299 | 3300048924 | Ga0496121_0030471 | Ga0496121_0030471_178_870 | 228 |
| 1300 | 3300048924 | Ga0496121_0097514 | Ga0496121_0097514_86_775 | 228 |
| 1301 | 3300048924 | Ga0496121_0107950 | Ga0496121_0107950_393_1082 | 228 |
| 1302 | 3300048924 | Ga0496121_0116739 | Ga0496121_0116739_187_960 | 228 |
| 1303 | 3300048924 | Ga0496121_0133042 | Ga0496121_0133042_87_779 | 228 |
| 1304 | 3300048924 | Ga0496121_0357748 | Ga0496121_0357748_151_852 | 228 |
| 1305 | 3300048925 | Ga0496122_0188704 | Ga0496122_0188704_52_759 | 228 |
| 1306 | 3300048925 | Ga0496122_0202809 | Ga0496122_0202809_374_1099 | 228 |
| 1307 | 3300048927 | Ga0496124_0188405 | Ga0496124_0188405_188_883 | 228 |
| 1308 | 3300048928 | Ga0496125_0000595 | Ga0496125_0000595_36179_36904 | 228 |
| 1309 | 3300048928 | Ga0496125_0016728 | Ga0496125_0016728_4770_5495 | 228 |
| 1310 | 3300048928 | Ga0496125_0152222 | Ga0496125_0152222_713_1420 | 228 |
| 1311 | 3300048928 | Ga0496125_0153397 | Ga0496125_0153397_116_805 | 228 |
| 1312 | 3300048928 | Ga0496125_0157204 | Ga0496125_0157204_763_1452 | 228 |
| 1313 | 3300048928 | Ga0496125_0415336 | Ga0496125_0415336_39_725 | 228 |
| 1314 | 3300048929 | Ga0496126_0006769 | Ga0496126_0006769_9023_9715 | 228 |
| 1315 | 3300048929 | Ga0496126_0031874 | Ga0496126_0031874_64_750 | 228 |
| 1316 | 3300048929 | Ga0496126_0045972 | Ga0496126_0045972_409_1104 | 228 |
| 1317 | 3300048929 | Ga0496126_0075686 | Ga0496126_0075686_204_896 | 228 |
| 1318 | 3300048929 | Ga0496126_0117146 | Ga0496126_0117146_98_793 | 228 |
| 1319 | 3300048929 | Ga0496126_0147139 | Ga0496126_0147139_131_859 | 228 |
| 1320 | 3300048929 | Ga0496126_0203730 | Ga0496126_0203730_70_765 | 228 |
| 1321 | 3300048929 | Ga0496126_0205094 | Ga0496126_0205094_89_814 | 228 |
| 1322 | 3300048929 | Ga0496126_0214335 | Ga0496126_0214335_607_1305 | 228 |
| 1323 | 3300048929 | Ga0496126_0536482 | Ga0496126_0536482_200_907 | 228 |
| 1324 | 3300048929 | Ga0496126_0556622 | Ga0496126_0556622_56_745 | 228 |
| 1325 | 3300048929 | Ga0496126_0599010 | Ga0496126_0599010_84_776 | 228 |
| 1326 | 3300048929 | Ga0496126_0649802 | Ga0496126_0649802_89_814 | 228 |
| 1327 | 3300049460 | Ga0495682_0047761 | Ga0495682_0047761_404_1090 | 228 |
| 1328 | 3300049568 | Ga0501031_0006067 | Ga0501031_0006067_2052_2765 | 228 |
| 1329 | 3300049569 | Ga0501032_0099791 | Ga0501032_0099791_501_1214 | 228 |
| 1330 | 3300049569 | Ga0501032_0398695 | Ga0501032_0398695_74_781 | 228 |
| 1331 | 3300049570 | Ga0501033_0000291 | Ga0501033_0000291_24904_25617 | 228 |
| 1332 | 3300049570 | Ga0501033_0140680 | Ga0501033_0140680_120_827 | 228 |
| 1333 | 3300049570 | Ga0501033_0460506 | Ga0501033_0460506_86_793 | 228 |
| 1334 | 3300049571 | Ga0501034_0170155 | Ga0501034_0170155_859_1572 | 228 |
| 1335 | 3300049571 | Ga0501034_0195466 | Ga0501034_0195466_1183_1899 | 228 |
| 1336 | 3300049572 | Ga0501036_0253219 | Ga0501036_0253219_292_999 | 228 |
| 1337 | 3300049572 | Ga0501036_0344726 | Ga0501036_0344726_387_1103 | 228 |
| 1338 | 3300049572 | Ga0501036_0555778 | Ga0501036_0555778_57_770 | 228 |
| 1339 | 3300049573 | Ga0501037_0000723 | Ga0501037_0000723_12356_13069 | 228 |
| 1340 | 3300049573 | Ga0501037_0105678 | Ga0501037_0105678_1242_1949 | 228 |
| 1341 | 3300049573 | Ga0501037_0199944 | Ga0501037_0199944_205_918 | 228 |
| 1342 | 3300049574 | Ga0501038_0015059 | Ga0501038_0015059_2318_3031 | 228 |
| 1343 | 3300049574 | Ga0501038_0019298 | Ga0501038_0019298_2652_3368 | 228 |
| 1344 | 3300049574 | Ga0501038_0150539 | Ga0501038_0150539_980_1693 | 228 |
| 1345 | 3300049574 | Ga0501038_0160760 | Ga0501038_0160760_698_1411 | 228 |
| 1346 | 3300049574 | Ga0501038_0200100 | Ga0501038_0200100_677_1384 | 228 |
| 1347 | 3300049575 | Ga0501039_0036122 | Ga0501039_0036122_2846_3559 | 228 |
| 1348 | 3300049575 | Ga0501039_0083298 | Ga0501039_0083298_1558_2274 | 228 |
| 1349 | 3300049575 | Ga0501039_0313786 | Ga0501039_0313786_13_726 | 228 |
| 1350 | 3300049576 | Ga0501040_0021943 | Ga0501040_0021943_1308_2021 | 228 |
| 1351 | 3300049577 | Ga0501041_0076454 | Ga0501041_0076454_1007_1720 | 228 |
| 1352 | 3300049578 | Ga0501042_0094801 | Ga0501042_0094801_1042_1755 | 228 |
| 1353 | 3300049579 | Ga0501043_0014167 | Ga0501043_0014167_2820_3533 | 228 |
| 1354 | 3300049579 | Ga0501043_0055594 | Ga0501043_0055594_2022_2738 | 228 |
| 1355 | 3300049580 | Ga0501046_0010044 | Ga0501046_0010044_654_1367 | 228 |
| 1356 | 3300049580 | Ga0501046_0025914 | Ga0501046_0025914_3585_4298 | 228 |
| 1357 | 3300049581 | Ga0501047_0213160 | Ga0501047_0213160_667_1383 | 228 |
| 1358 | 3300049581 | Ga0501047_0271921 | Ga0501047_0271921_623_1336 | 228 |
| 1359 | 3300049582 | Ga0501048_0012237 | Ga0501048_0012237_4366_5079 | 228 |
| 1360 | 3300049583 | Ga0501067_0032603 | Ga0501067_0032603_263_958 | 228 |
| 1361 | 3300049586 | Ga0501070_0010826 | Ga0501070_0010826_6039_6752 | 228 |
| 1362 | 3300049586 | Ga0501070_0040320 | Ga0501070_0040320_573_1268 | 228 |
| 1363 | 3300049587 | Ga0501071_0097420 | Ga0501071_0097420_38_745 | 228 |
| 1364 | 3300049588 | Ga0501072_0070627 | Ga0501072_0070627_981_1694 | 228 |
| 1365 | 3300049589 | Ga0501073_0024045 | Ga0501073_0024045_1635_2348 | 228 |
| 1366 | 3300049589 | Ga0501073_0216293 | Ga0501073_0216293_587_1300 | 228 |
| 1367 | 3300049590 | Ga0501074_0002443 | Ga0501074_0002443_2374_3087 | 228 |
| 1368 | 3300049590 | Ga0501074_0415353 | Ga0501074_0415353_114_824 | 228 |
| 1369 | 3300049592 | Ga0501076_0065005 | Ga0501076_0065005_1772_2485 | 228 |
| 1370 | 3300049656 | Ga0501209_125077 | Ga0501209_125077_47_739 | 228 |
| 1371 | 3300049741 | Ga0501079_0114107 | Ga0501079_0114107_1248_1961 | 228 |
| 1372 | 3300049742 | Ga0501080_0114315 | Ga0501080_0114315_754_1467 | 228 |
| 1373 | 3300049742 | Ga0501080_0452877 | Ga0501080_0452877_361_1056 | 228 |
| 1374 | 3300049744 | Ga0501083_0015704 | Ga0501083_0015704_3835_4548 | 228 |
| 1375 | 3300049822 | Ga0501035_0000688 | Ga0501035_0000688_23328_24041 | 228 |
| 1376 | 3300049822 | Ga0501035_0273723 | Ga0501035_0273723_312_1019 | 228 |
| 1377 | 3300049822 | Ga0501035_0832803 | Ga0501035_0832803_18_722 | 228 |
| 1378 | 3300049823 | Ga0501044_0005432 | Ga0501044_0005432_13202_13915 | 228 |
| 1379 | 3300049823 | Ga0501044_0077476 | Ga0501044_0077476_178_873 | 228 |
| 1380 | 3300049823 | Ga0501044_0096923 | Ga0501044_0096923_852_1565 | 228 |
| 1381 | 3300049823 | Ga0501044_0523294 | Ga0501044_0523294_132_839 | 228 |
| 1382 | 3300050490 | nmdc:mga03n38_46423_c1 | nmdc:mga03n38_46423_c1_351_1046 | 228 |
| 1383 | 3300050491 | nmdc:mga00v17_19538_c1 | nmdc:mga00v17_19538_c1_667_1356 | 228 |
| 1384 | 3300050492 | nmdc:mga0yw44_156531_c1 | nmdc:mga0yw44_156531_c1_533_1225 | 228 |
| 1385 | 3300050492 | nmdc:mga0yw44_415317_c1 | nmdc:mga0yw44_415317_c1_191_898 | 228 |
| 1386 | 3300050492 | nmdc:mga0yw44_52465_c1 | nmdc:mga0yw44_52465_c1_1738_2427 | 228 |
| 1387 | 3300050492 | nmdc:mga0yw44_57242_c1 | nmdc:mga0yw44_57242_c1_983_1672 | 228 |
| 1388 | 3300050493 | nmdc:mga0k408_157251_c1 | nmdc:mga0k408_157251_c1_12_716 | 228 |
| 1389 | 3300050493 | nmdc:mga0k408_201879_c1 | nmdc:mga0k408_201879_c1_441_1133 | 228 |
| 1390 | 3300050493 | nmdc:mga0k408_300346_c1 | nmdc:mga0k408_300346_c1_12_701 | 228 |
| 1391 | 3300050494 | nmdc:mga06z11_179815_c1 | nmdc:mga06z11_179815_c1_304_1008 | 228 |
| 1392 | 3300050494 | nmdc:mga06z11_227038_c1 | nmdc:mga06z11_227038_c1_20_721 | 228 |
| 1393 | 3300050494 | nmdc:mga06z11_32421_c1 | nmdc:mga06z11_32421_c1_655_1350 | 228 |
| 1394 | 3300050494 | nmdc:mga06z11_40491_c1 | nmdc:mga06z11_40491_c1_503_1192 | 228 |
| 1395 | 3300050494 | nmdc:mga06z11_406160_c1 | nmdc:mga06z11_406160_c1_47_742 | 228 |
| 1396 | 3300050494 | nmdc:mga06z11_425849_c1 | nmdc:mga06z11_425849_c1_48_740 | 228 |
| 1397 | 3300050495 | nmdc:mga04h51_229103_c1 | nmdc:mga04h51_229103_c1_24_716 | 228 |
| 1398 | 3300050496 | nmdc:mga07m45_37097_c1 | nmdc:mga07m45_37097_c1_734_1429 | 228 |
| 1399 | 3300050496 | nmdc:mga07m45_43325_c1 | nmdc:mga07m45_43325_c1_1788_2477 | 228 |
| 1400 | 3300050496 | nmdc:mga07m45_48959_c1 | nmdc:mga07m45_48959_c1_1591_2283 | 228 |
| 1401 | 3300050511 | nmdc:mga08y16_1118007_c1 | nmdc:mga08y16_1118007_c1_63_752 | 228 |
| 1402 | 3300050513 | nmdc:mga0rr50_226356_c1 | nmdc:mga0rr50_226356_c1_507_1199 | 228 |
| 1403 | 3300050516 | nmdc:mga0sz30_47184_c1 | nmdc:mga0sz30_47184_c1_147_836 | 228 |
| 1404 | 3300050516 | nmdc:mga0sz30_68907_c1 | nmdc:mga0sz30_68907_c1_581_1273 | 228 |
| 1405 | 3300050516 | nmdc:mga0sz30_97850_c1 | nmdc:mga0sz30_97850_c1_277_969 | 228 |
| 1406 | 3300050516 | nmdc:mga0sz30_99987_c1 | nmdc:mga0sz30_99987_c1_192_899 | 228 |
| 1407 | 3300053077 | Ga0495601_0060163 | Ga0495601_0060163_270_965 | 228 |
| 1408 | 3300053077 | Ga0495601_0085026 | Ga0495601_0085026_662_1462 | 228 |
| 1409 | 3300053078 | Ga0495612_0054442 | Ga0495612_0054442_414_1112 | 228 |
| 1410 | 3300053078 | Ga0495612_0264197 | Ga0495612_0264197_24_713 | 228 |
| 1411 | 3300053079 | Ga0500610_0143787 | Ga0500610_0143787_229_936 | 228 |
| 1412 | 3300053084 | Ga0495595_0004969 | Ga0495595_0004969_2552_3352 | 228 |
| 1413 | 3300053084 | Ga0495595_0130591 | Ga0495595_0130591_243_941 | 228 |
| 1414 | 3300053085 | Ga0495619_0002350 | Ga0495619_0002350_10477_11277 | 228 |
| 1415 | 3300053085 | Ga0495619_0199729 | Ga0495619_0199729_553_1245 | 228 |
| 1416 | 3300053085 | Ga0495619_0229170 | Ga0495619_0229170_35_727 | 228 |
| 1417 | 3300053087 | Ga0500643_000079 | Ga0500643_000079_36329_37024 | 228 |
| 1418 | 3300053087 | Ga0500643_004939 | Ga0500643_004939_5006_5713 | 228 |
| 1419 | 3300053093 | Ga0500651_0123890 | Ga0500651_0123890_321_1028 | 228 |
| 1420 | 3300053093 | Ga0500651_0172550 | Ga0500651_0172550_357_1064 | 228 |
| 1421 | 3300053094 | Ga0500566_0016060 | Ga0500566_0016060_3137_3844 | 228 |
| 1422 | 3300053094 | Ga0500566_0018425 | Ga0500566_0018425_3389_4081 | 228 |
| 1423 | 3300053095 | Ga0500640_089708 | Ga0500640_089708_506_1195 | 228 |
| 1424 | 3300053096 | Ga0500641_0008056 | Ga0500641_0008056_2578_3285 | 228 |
| 1425 | 3300053096 | Ga0500641_0026859 | Ga0500641_0026859_102_794 | 228 |
| 1426 | 3300053096 | Ga0500641_0143640 | Ga0500641_0143640_235_930 | 228 |
| 1427 | 3300053098 | Ga0500650_0046741 | Ga0500650_0046741_324_1031 | 228 |
| 1428 | 3300053102 | Ga0500554_002420 | Ga0500554_002420_1422_2117 | 228 |
| 1429 | 3300053102 | Ga0500554_003584 | Ga0500554_003584_2036_2728 | 228 |
| 1430 | 3300053103 | Ga0500555_012696 | Ga0500555_012696_1597_2289 | 228 |
| 1431 | 3300053104 | Ga0500556_0000005 | Ga0500556_0000005_570666_571373 | 228 |
| 1432 | 3300053104 | Ga0500556_0133228 | Ga0500556_0133228_70_759 | 228 |
| 1433 | 3300053105 | Ga0500557_000034 | Ga0500557_000034_609_1301 | 228 |
| 1434 | 3300053109 | Ga0500569_127748 | Ga0500569_127748_130_822 | 228 |
| 1435 | 3300053116 | Ga0500592_030017 | Ga0500592_030017_135_842 | 228 |
| 1436 | 3300053117 | Ga0500593_106790 | Ga0500593_106790_219_926 | 228 |
| 1437 | 3300053119 | Ga0500595_009330 | Ga0500595_009330_1228_1920 | 228 |
| 1438 | 3300053121 | Ga0500607_028739 | Ga0500607_028739_44_733 | 228 |
| 1439 | 3300053121 | Ga0500607_033910 | Ga0500607_033910_1102_1809 | 228 |
| 1440 | 3300053122 | Ga0500608_000330 | Ga0500608_000330_2001_2708 | 228 |
| 1441 | 3300053125 | Ga0500618_008175 | Ga0500618_008175_1213_1920 | 228 |
| 1442 | 3300053126 | Ga0500621_122581 | Ga0500621_122581_46_750 | 228 |
| 1443 | 3300053130 | Ga0500642_0000167 | Ga0500642_0000167_16047_16754 | 228 |
| 1444 | 3300053130 | Ga0500642_0000400 | Ga0500642_0000400_8688_9380 | 228 |
| 1445 | 3300053130 | Ga0500642_0093157 | Ga0500642_0093157_45_737 | 228 |
| 1446 | 3300053131 | Ga0500652_001376 | Ga0500652_001376_1878_2585 | 228 |
| 1447 | 3300053131 | Ga0500652_044814 | Ga0500652_044814_502_1197 | 228 |
| 1448 | 3300053133 | Ga0500655_047898 | Ga0500655_047898_134_823 | 228 |
| 1449 | 3300053134 | Ga0500658_0065304 | Ga0500658_0065304_112_819 | 228 |
| 1450 | 3300053134 | Ga0500658_0111099 | Ga0500658_0111099_362_1069 | 228 |
| 1451 | 3300053134 | Ga0500658_0132176 | Ga0500658_0132176_88_780 | 228 |
| 1452 | 3300053136 | Ga0500559_0000696 | Ga0500559_0000696_3543_4250 | 228 |
| 1453 | 3300053136 | Ga0500559_0113361 | Ga0500559_0113361_483_1169 | 228 |
| 1454 | 3300053138 | Ga0500564_164985 | Ga0500564_164985_183_890 | 228 |
| 1455 | 3300053138 | Ga0500564_210732 | Ga0500564_210732_16_705 | 228 |
| 1456 | 3300053139 | Ga0500568_0006608 | Ga0500568_0006608_442_1149 | 228 |
| 1457 | 3300053139 | Ga0500568_0046396 | Ga0500568_0046396_61_756 | 228 |
| 1458 | 3300053142 | Ga0500577_0038419 | Ga0500577_0038419_632_1339 | 228 |
| 1459 | 3300053147 | Ga0500589_022024 | Ga0500589_022024_1236_1931 | 228 |
| 1460 | 3300053148 | Ga0500590_049762 | Ga0500590_049762_266_952 | 228 |
| 1461 | 3300053148 | Ga0500590_055939 | Ga0500590_055939_153_842 | 228 |
| 1462 | 3300053150 | Ga0500603_001436 | Ga0500603_001436_4616_5311 | 228 |
| 1463 | 3300053151 | Ga0500604_0007365 | Ga0500604_0007365_703_1410 | 228 |
| 1464 | 3300053151 | Ga0500604_0098414 | Ga0500604_0098414_257_952 | 228 |
| 1465 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_122954_123661 | 228 |
| 1466 | 3300053155 | Ga0500620_019648 | Ga0500620_019648_652_1341 | 228 |
| 1467 | 3300053156 | Ga0500622_0008163 | Ga0500622_0008163_4244_4951 | 228 |
| 1468 | 3300053157 | Ga0500624_003405 | Ga0500624_003405_16_723 | 228 |
| 1469 | 3300053158 | Ga0500627_0005379 | Ga0500627_0005379_1299_2006 | 228 |
| 1470 | 3300053160 | Ga0500633_0047142 | Ga0500633_0047142_583_1290 | 228 |
| 1471 | 3300053162 | Ga0500638_146190 | Ga0500638_146190_321_1010 | 228 |
| 1472 | 3300053177 | Ga0500636_0000016 | Ga0500636_0000016_115976_116665 | 228 |
| 1473 | 3300053177 | Ga0500636_0003032 | Ga0500636_0003032_4509_5216 | 228 |
| 1474 | 3300053177 | Ga0500636_0102246 | Ga0500636_0102246_415_1107 | 228 |
| 1475 | 3300053178 | Ga0500637_0000172 | Ga0500637_0000172_7599_8291 | 228 |
| 1476 | 3300053727 | Ga0500611_049459 | Ga0500611_049459_94_801 | 228 |
| 1477 | 3300053729 | Ga0500625_004258 | Ga0500625_004258_1783_2475 | 228 |
| 1478 | 3300053730 | Ga0500645_022463 | Ga0500645_022463_820_1509 | 228 |
| 1479 | 3300053731 | Ga0500609_022540 | Ga0500609_022540_152_844 | 228 |
| 1480 | 3300053732 | Ga0500656_021830 | Ga0500656_021830_86_784 | 228 |
| 1481 | 3300053736 | Ga0500599_020197 | Ga0500599_020197_233_922 | 228 |
| 1482 | 3300053737 | Ga0500601_001828 | Ga0500601_001828_676_1368 | 228 |
| 1483 | 3300053737 | Ga0500601_002478 | Ga0500601_002478_1167_1865 | 228 |
| 1484 | 3300054114 | Ga0501084_0014750 | Ga0501084_0014750_3237_3950 | 228 |
| 1485 | 3300055283 | Ga0500661_001292 | Ga0500661_001292_3621_4313 | 228 |
| 1486 | 3300055283 | Ga0500661_012499 | Ga0500661_012499_603_1298 | 228 |
| 1487 | 3300060353 | Ga0501082_0038629 | Ga0501082_0038629_1208_1921 | 228 |
| 1488 | 3300061719 | Ga0466962_0033208 | Ga0466962_0033208_883_1647 | 228 |
| 1489 | 3300061719 | Ga0466962_0059302 | Ga0466962_0059302_627_1322 | 228 |
| 1490 | iso_pu_bacteria | 2791355199 | 2793078499 | 228 |
| 1491 | iso_pu_bacteria | 8045864390 | 8045866195 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ef6-assembly1.cif.gz_A | crystal structure of xanthosine monophosphate phosphatase in the unliganded state | 0.8565 | 10 | 223 |
| 7ef7-assembly1.cif.gz_A | crystal structure of xanthosine monophosphate phosphatase complex with xmp | 0.8531 | 10 | 223 |
| 7ef6-assembly1.cif.gz_A | crystal structure of xanthosine monophosphate phosphatase in the unliganded state | 0.8022 | 10 | 223 |
| 7ef7-assembly1.cif.gz_A | crystal structure of xanthosine monophosphate phosphatase complex with xmp | 0.7991 | 10 | 223 |
| 3onn-assembly1.cif.gz_A | crystal structure of 5'-nucleotidase sdt1 from saccharomyces cerevisiae | 0.7885 | 1 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3opxA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.9636 | 27 | 83 | 1.10.150.450 |
| af_K7KDK8_16_102_3.30.70.1620 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8805 | 15 | 92 | 3.30.70.1620 |
| af_Q4E4C3_1_85_1.10.150.450 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.858 | 16 | 85 | 1.10.150.450 |
| af_Q5AK98_45_279_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8319 | 12 | 221 | 3.40.50.1000 |
| af_Q54B74_103_232_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8243 | 92 | 226 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A525I5T3-F1-model_v4 | Pyrimidine 5'-nucleotidase | 0.9653 | 6 | 227 |
|
| AF-A0A8B6M2T5-F1-model_v4 | Pyrimidine 5'-nucleotidase | 0.9642 | 7 | 227 |
|
| AF-A0A4R2GPF8-F1-model_v4 | Putative hydrolase of the HAD superfamily | 0.9635 | 3 | 227 |
GO:0016787
|
| AF-A0A2D2CYZ6-F1-model_v4 | Pyrimidine 5'-nucleotidase | 0.9632 | 7 | 227 |
|
| AF-A0A1I4AEZ9-F1-model_v4 | Putative hydrolase of the HAD superfamily | 0.9629 | 6 | 227 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar