F494242
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1475 | 693 | 1230 | 323 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2876808645|2876809366 |
| Length | 393 |
| Sequence | TSLVDALEGIGKVERELDDNVEMIALGEAENDEGVVVEAEGALKALKKEVARRELEALLSGEADRFDSYLEVHAGAGGTESQDWASMLLRMYTRWAEEHGFKIEYLEETPGEEAGIKSATIQISGHNAYGWLKTEAGVHRLVRISPFDSNARRHTSFSSVAIFPVVDDSIKIDIKESDVRTDTMRSGGAGGQHVNKTESAVRLTHIPTGVAVVCQAGRSQHKNRAQAWDMLRARLYEIELKRREXXXXXXXXXXXXXXXXXXXXXXXXQDRYRLGPPDPLLRAAALPDGERPAHRRADLRYIRRSRRRPGRVHGGDAGAARLRHHARRGRGCGLIHDQSGLHRARPHGPWHGRPLPRCRLFGCSLESQQGQGGRPDRARRTLGFISGGRCRWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 29 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 33 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 34 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 35 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 36 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 37 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 38 | 2791355199 | |||
| 39 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 40 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 41 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 42 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 43 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 44 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 45 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 46 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 47 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 48 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 49 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 50 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 51 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 52 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 53 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 54 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 55 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 56 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 57 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 58 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 59 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 60 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 61 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 62 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 63 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 64 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 65 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 66 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 67 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 68 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 69 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 70 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 71 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 72 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 73 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 74 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 75 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 76 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 77 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 78 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 79 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 80 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 81 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 82 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 83 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 84 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 85 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 86 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 87 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 88 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 89 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 90 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 91 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 92 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 93 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 94 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 95 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 96 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 97 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 98 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 99 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 100 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 101 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 102 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 103 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 104 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 105 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 106 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 107 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 108 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 109 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 110 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 111 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 112 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 113 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 114 | 2904699407 | |||
| 115 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 116 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 117 | 2906610324 | |||
| 118 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 119 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 120 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 121 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 122 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 123 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 124 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 125 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 126 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 127 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 128 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 129 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 130 | 2922368715 | |||
| 131 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 132 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 133 | 2922425934 | |||
| 134 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 135 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 136 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 137 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 138 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 139 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 140 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 141 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 142 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 143 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 144 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 145 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 146 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 147 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 148 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 149 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 150 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 151 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 152 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 153 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 154 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 155 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 156 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 157 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 158 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 159 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 160 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 161 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 162 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 163 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 164 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 165 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 166 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 167 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 168 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 169 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 170 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 171 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 172 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 173 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 174 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 175 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 176 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 177 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 178 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 179 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 180 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 181 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 182 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 183 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 184 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 185 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 186 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 187 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 188 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 189 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 190 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 191 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 192 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 193 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 194 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 195 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 196 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 197 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 198 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 199 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 200 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 201 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 202 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 203 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 204 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 205 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 206 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 207 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 208 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 209 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 210 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 211 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 212 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 213 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 214 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 215 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 216 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 217 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 218 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 221 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 223 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 224 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 225 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 227 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 228 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 229 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 231 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 235 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 238 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 240 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 241 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 243 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 247 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 248 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 249 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 250 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 251 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 252 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 253 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 254 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 257 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 258 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 260 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 261 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 262 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 263 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 264 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 265 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 266 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 267 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 268 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 269 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 270 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 271 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 272 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 273 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 274 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 275 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 277 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 278 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 279 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 280 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 281 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 282 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 283 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 284 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 285 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 286 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 287 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 289 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 290 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 291 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 292 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 293 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 294 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 296 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 297 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 298 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 299 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 307 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 312 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 316 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 317 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 318 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 323 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 324 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 325 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 326 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 328 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 331 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 333 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 388 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 389 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 390 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 391 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 392 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 396 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 397 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 398 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 399 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 400 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 401 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 402 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 403 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 404 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 405 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 406 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 407 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 408 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 409 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 410 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 411 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 412 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 413 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 414 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 415 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 416 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 417 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 418 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 419 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 420 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 421 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 422 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 423 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 424 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 426 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 427 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 428 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 429 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 430 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 431 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 432 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 433 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 434 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 435 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 436 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 437 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 438 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 439 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 440 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 441 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 442 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 443 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 444 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 445 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 446 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 447 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 448 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 449 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 450 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 451 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 452 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 453 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 454 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 455 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 456 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 457 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 458 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 459 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 460 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 461 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 462 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 463 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 464 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 465 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 466 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 467 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 468 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 469 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 470 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 471 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 472 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 473 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 474 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 475 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 476 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 477 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 547 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 548 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 549 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 550 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 551 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 552 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 553 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 554 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 555 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 556 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 557 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 558 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 559 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 560 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 561 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 562 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 563 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 564 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 565 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 566 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 567 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 568 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 569 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 570 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 571 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 572 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 577 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 580 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 582 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 591 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 592 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 597 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 599 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 601 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 603 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 604 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 605 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 606 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 607 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 608 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 609 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 610 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 611 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 612 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 613 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 614 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 615 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 619 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 620 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 621 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 622 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 623 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 624 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 625 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 626 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 627 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 628 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 629 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 630 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 631 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 632 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 633 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 634 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 635 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 636 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 637 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 638 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 639 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 640 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 641 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 642 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 643 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 644 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 645 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 646 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 647 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 648 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 649 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 650 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 651 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 652 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 653 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 654 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 655 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 656 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 657 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 658 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 659 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 660 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 661 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 662 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 663 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 664 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 665 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 666 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 667 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 668 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 669 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 670 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 671 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 672 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 673 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 674 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 675 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 676 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 677 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 678 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 679 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 680 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 681 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 682 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 683 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 684 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 685 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 686 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 687 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 688 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 689 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 690 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 691 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 692 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 693 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.54 |
| Metatranscriptomes | 0.14 |
| Isolates | 16.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.2 |
| Nodule | 12.34 |
| Rhizoplane | 4.54 |
| Rhizosphere | 65.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1013454 | 3300001904 | Bacteria | 1321 |
| 2 | JGI24739J22299_10015357 | 3300001989 | Bacteria | 2780 |
| 3 | JGI24737J22298_10004960 | 3300001990 | Bacteria | 4612 |
| 4 | JGI24034J26672_10008216 | 3300002239 | Bacteria | 1523 |
| 5 | JGI24742J22300_10013207 | 3300002244 | Bacteria | 1381 |
| 6 | JGI25406J46586_10001258 | 3300003203 | Bacteria | 11887 |
| 7 | JGI25153J46596_10001975 | 3300003215 | Bacteria | 12154 |
| 8 | JGI25153J46596_10008987 | 3300003215 | Bacteria | 4705 |
| 9 | JGI25153J46596_10013218 | 3300003215 | Bacteria | 3505 |
| 10 | JGI25153J46596_10037847 | 3300003215 | Bacteria | 1528 |
| 11 | Ga0007417J51691_1052383 | 3300003544 | Bacteria | 1219 |
| 12 | JGI25404J52841_10006528 | 3300003659 | Bacteria | 2446 |
| 13 | JGI25404J52841_10010095 | 3300003659 | Bacteria | 2027 |
| 14 | JGI25404J52841_10010842 | 3300003659 | Bacteria | 1961 |
| 15 | Ga0055539_1006204 | 3300003752 | Bacteria | 1532 |
| 16 | Ga0055526_1000091 | 3300003771 | Bacteria | 82891 |
| 17 | Ga0055526_1018462 | 3300003771 | Bacteria | 2601 |
| 18 | Ga0065165_1001744 | 3300005262 | Bacteria | 21697 |
| 19 | Ga0065165_1003890 | 3300005262 | Bacteria | 9887 |
| 20 | Ga0065715_10033428 | 3300005293 | Bacteria | 1271 |
| 21 | Ga0070658_10332403 | 3300005327 | Bacteria | 1299 |
| 22 | Ga0070676_10044352 | 3300005328 | Bacteria | 2587 |
| 23 | Ga0070683_100004422 | 3300005329 | Bacteria | 11587 |
| 24 | Ga0070683_100134291 | 3300005329 | Bacteria | 2343 |
| 25 | Ga0070683_100242948 | 3300005329 | Bacteria | 1713 |
| 26 | Ga0070670_100028273 | 3300005331 | Bacteria | 4825 |
| 27 | Ga0068869_100139520 | 3300005334 | Bacteria | 1870 |
| 28 | Ga0070680_100095596 | 3300005336 | Bacteria | 2463 |
| 29 | Ga0068868_100012415 | 3300005338 | Bacteria | 6226 |
| 30 | Ga0068868_100185877 | 3300005338 | Bacteria | 1726 |
| 31 | Ga0070660_100006727 | 3300005339 | Bacteria | 7975 |
| 32 | Ga0070660_100084058 | 3300005339 | Bacteria | 2502 |
| 33 | Ga0070660_100086085 | 3300005339 | Bacteria | 2472 |
| 34 | Ga0070689_100117474 | 3300005340 | Bacteria | 2121 |
| 35 | Ga0070691_10017160 | 3300005341 | Bacteria | 3331 |
| 36 | Ga0070687_100007913 | 3300005343 | Bacteria | 4471 |
| 37 | Ga0070661_100022107 | 3300005344 | Bacteria | 4549 |
| 38 | Ga0070661_100022501 | 3300005344 | Bacteria | 4513 |
| 39 | Ga0070661_100077160 | 3300005344 | Bacteria | 2456 |
| 40 | Ga0070692_10075515 | 3300005345 | Bacteria | 1805 |
| 41 | Ga0070668_100117981 | 3300005347 | Bacteria | 2118 |
| 42 | Ga0070668_100258516 | 3300005347 | Bacteria | 1447 |
| 43 | Ga0070669_100031521 | 3300005353 | Bacteria | 3829 |
| 44 | Ga0070669_100134032 | 3300005353 | Bacteria | 1904 |
| 45 | Ga0070674_100047021 | 3300005356 | Bacteria | 2954 |
| 46 | Ga0070674_100084723 | 3300005356 | Bacteria | 2273 |
| 47 | Ga0070688_100036593 | 3300005365 | Bacteria | 2987 |
| 48 | Ga0070659_100247264 | 3300005366 | Bacteria | 1477 |
| 49 | Ga0070659_100289974 | 3300005366 | Bacteria | 1363 |
| 50 | Ga0070667_100071018 | 3300005367 | Bacteria | 2965 |
| 51 | Ga0070709_10000102 | 3300005434 | Bacteria | 60511 |
| 52 | Ga0070709_10001622 | 3300005434 | Bacteria | 12161 |
| 53 | Ga0070709_10038944 | 3300005434 | Bacteria | 2914 |
| 54 | Ga0070709_10064450 | 3300005434 | Bacteria | 2343 |
| 55 | Ga0070709_10149410 | 3300005434 | Bacteria | 1613 |
| 56 | Ga0070709_10176321 | 3300005434 | Bacteria | 1498 |
| 57 | Ga0070709_10179990 | 3300005434 | Bacteria | 1484 |
| 58 | Ga0070714_100022464 | 3300005435 | Bacteria | 5173 |
| 59 | Ga0070714_100031763 | 3300005435 | Bacteria | 4408 |
| 60 | Ga0070714_100086107 | 3300005435 | Bacteria | 2746 |
| 61 | Ga0070714_100097986 | 3300005435 | Bacteria | 2578 |
| 62 | Ga0070714_100107780 | 3300005435 | Bacteria | 2463 |
| 63 | Ga0070713_100000004 | 3300005436 | Bacteria | 220768 |
| 64 | Ga0070713_100009644 | 3300005436 | Bacteria | 6930 |
| 65 | Ga0070713_100153064 | 3300005436 | Bacteria | 2053 |
| 66 | Ga0070713_100184954 | 3300005436 | Bacteria | 1874 |
| 67 | Ga0070710_10000246 | 3300005437 | Bacteria | 25491 |
| 68 | Ga0070710_10108611 | 3300005437 | Bacteria | 1663 |
| 69 | Ga0070710_10116230 | 3300005437 | Bacteria | 1613 |
| 70 | Ga0070711_100003729 | 3300005439 | Bacteria | 8930 |
| 71 | Ga0070711_100015465 | 3300005439 | Bacteria | 4831 |
| 72 | Ga0070711_100072176 | 3300005439 | Bacteria | 2435 |
| 73 | Ga0070711_100076705 | 3300005439 | Bacteria | 2370 |
| 74 | Ga0070700_100084160 | 3300005441 | Bacteria | 2061 |
| 75 | Ga0070700_100159554 | 3300005441 | Bacteria | 1551 |
| 76 | Ga0070700_100198170 | 3300005441 | Bacteria | 1409 |
| 77 | Ga0070663_100012278 | 3300005455 | Bacteria | 5412 |
| 78 | Ga0070663_100077525 | 3300005455 | Bacteria | 2433 |
| 79 | Ga0070663_100311355 | 3300005455 | Bacteria | 1263 |
| 80 | Ga0070678_100005520 | 3300005456 | Bacteria | 7324 |
| 81 | Ga0070678_100021678 | 3300005456 | Bacteria | 4242 |
| 82 | Ga0070678_100040147 | 3300005456 | Bacteria | 3309 |
| 83 | Ga0070662_100051040 | 3300005457 | Bacteria | 2985 |
| 84 | Ga0070681_10013085 | 3300005458 | Bacteria | 8239 |
| 85 | Ga0070681_10053331 | 3300005458 | Bacteria | 4029 |
| 86 | Ga0070681_10088546 | 3300005458 | Bacteria | 3047 |
| 87 | Ga0070681_10097274 | 3300005458 | Bacteria | 2891 |
| 88 | Ga0070681_10107817 | 3300005458 | Bacteria | 2726 |
| 89 | Ga0070681_10291591 | 3300005458 | Bacteria | 1542 |
| 90 | Ga0070681_10362176 | 3300005458 | Bacteria | 1360 |
| 91 | Ga0068867_100201855 | 3300005459 | Bacteria | 1592 |
| 92 | Ga0070679_100089910 | 3300005530 | Bacteria | 3058 |
| 93 | Ga0070679_100333709 | 3300005530 | Bacteria | 1465 |
| 94 | Ga0070679_100379485 | 3300005530 | Bacteria | 1360 |
| 95 | Ga0070679_100451640 | 3300005530 | Bacteria | 1230 |
| 96 | Ga0070684_100018267 | 3300005535 | Bacteria | 5775 |
| 97 | Ga0070684_100055068 | 3300005535 | Bacteria | 3466 |
| 98 | Ga0070684_100125327 | 3300005535 | Bacteria | 2313 |
| 99 | Ga0070684_100180759 | 3300005535 | Bacteria | 1918 |
| 100 | Ga0070684_100261749 | 3300005535 | Bacteria | 1582 |
| 101 | Ga0070697_100000429 | 3300005536 | Bacteria | 32198 |
| 102 | Ga0070697_100024733 | 3300005536 | Bacteria | 4782 |
| 103 | Ga0068853_100000869 | 3300005539 | Bacteria | 21124 |
| 104 | Ga0068853_100006971 | 3300005539 | Bacteria | 9024 |
| 105 | Ga0068853_100023426 | 3300005539 | Bacteria | 5169 |
| 106 | Ga0068853_100128945 | 3300005539 | Bacteria | 2262 |
| 107 | Ga0068853_100151947 | 3300005539 | Bacteria | 2084 |
| 108 | Ga0068853_100337082 | 3300005539 | Bacteria | 1400 |
| 109 | Ga0070686_100010855 | 3300005544 | Bacteria | 5152 |
| 110 | Ga0070686_100015574 | 3300005544 | Bacteria | 4408 |
| 111 | Ga0070686_100218276 | 3300005544 | Bacteria | 1377 |
| 112 | Ga0070695_100003134 | 3300005545 | Bacteria | 9639 |
| 113 | Ga0070695_100011981 | 3300005545 | Bacteria | 5195 |
| 114 | Ga0070695_100051997 | 3300005545 | Bacteria | 2631 |
| 115 | Ga0070693_100148211 | 3300005547 | Bacteria | 1483 |
| 116 | Ga0070665_100020137 | 3300005548 | Bacteria | 6698 |
| 117 | Ga0070665_100145789 | 3300005548 | Bacteria | 2370 |
| 118 | Ga0070665_100192062 | 3300005548 | Bacteria | 2042 |
| 119 | Ga0070665_100379380 | 3300005548 | Bacteria | 1421 |
| 120 | Ga0070665_100476651 | 3300005548 | Bacteria | 1259 |
| 121 | Ga0070704_100002047 | 3300005549 | Bacteria | 11182 |
| 122 | Ga0068855_100007226 | 3300005563 | Bacteria | 13476 |
| 123 | Ga0068855_100045775 | 3300005563 | Bacteria | 5173 |
| 124 | Ga0068855_100079891 | 3300005563 | Bacteria | 3792 |
| 125 | Ga0068855_100093456 | 3300005563 | Bacteria | 3468 |
| 126 | Ga0068855_100101222 | 3300005563 | Bacteria | 3317 |
| 127 | Ga0068855_100174019 | 3300005563 | Bacteria | 2437 |
| 128 | Ga0068855_100379041 | 3300005563 | Bacteria | 1553 |
| 129 | Ga0068855_100618949 | 3300005563 | Bacteria | 1166 |
| 130 | Ga0070664_100056179 | 3300005564 | Bacteria | 3345 |
| 131 | Ga0070664_100082541 | 3300005564 | Bacteria | 2772 |
| 132 | Ga0068857_100000944 | 3300005577 | Bacteria | 22139 |
| 133 | Ga0068857_100003243 | 3300005577 | Bacteria | 13510 |
| 134 | Ga0068857_100068528 | 3300005577 | Bacteria | 3157 |
| 135 | Ga0068857_100263689 | 3300005577 | Bacteria | 1582 |
| 136 | Ga0068857_100303640 | 3300005577 | Bacteria | 1472 |
| 137 | Ga0068854_100005134 | 3300005578 | Bacteria | 8253 |
| 138 | Ga0068854_100015602 | 3300005578 | Bacteria | 5037 |
| 139 | Ga0068854_100041156 | 3300005578 | Bacteria | 3264 |
| 140 | Ga0068856_100000144 | 3300005614 | Bacteria | 72020 |
| 141 | Ga0068856_100001349 | 3300005614 | Bacteria | 25791 |
| 142 | Ga0068856_100003004 | 3300005614 | Bacteria | 17269 |
| 143 | Ga0068856_100015680 | 3300005614 | Bacteria | 7327 |
| 144 | Ga0068856_100027505 | 3300005614 | Bacteria | 5548 |
| 145 | Ga0068856_100042065 | 3300005614 | Bacteria | 4494 |
| 146 | Ga0068856_100127393 | 3300005614 | Bacteria | 2549 |
| 147 | Ga0068852_100008781 | 3300005616 | Bacteria | 7476 |
| 148 | Ga0068852_100022868 | 3300005616 | Bacteria | 5022 |
| 149 | Ga0068852_100037474 | 3300005616 | Bacteria | 4066 |
| 150 | Ga0068859_100445830 | 3300005617 | Bacteria | 1390 |
| 151 | Ga0068864_100014660 | 3300005618 | Bacteria | 6511 |
| 152 | Ga0068864_100091806 | 3300005618 | Bacteria | 2679 |
| 153 | Ga0068864_100204427 | 3300005618 | Bacteria | 1816 |
| 154 | Ga0068861_100236290 | 3300005719 | Bacteria | 1552 |
| 155 | Ga0068851_10001219 | 3300005834 | Bacteria | 11171 |
| 156 | Ga0068863_100042721 | 3300005841 | Bacteria | 4307 |
| 157 | Ga0068863_100308169 | 3300005841 | Bacteria | 1536 |
| 158 | Ga0068858_100015026 | 3300005842 | Bacteria | 7283 |
| 159 | Ga0068858_100219928 | 3300005842 | Bacteria | 1798 |
| 160 | Ga0068858_100286753 | 3300005842 | Bacteria | 1568 |
| 161 | Ga0068858_100436675 | 3300005842 | Bacteria | 1260 |
| 162 | Ga0068860_100001369 | 3300005843 | Bacteria | 26465 |
| 163 | Ga0068860_100372443 | 3300005843 | Bacteria | 1408 |
| 164 | Ga0068860_100410163 | 3300005843 | Bacteria | 1341 |
| 165 | Ga0068862_100097391 | 3300005844 | Bacteria | 2568 |
| 166 | Ga0068862_100125134 | 3300005844 | Bacteria | 2269 |
| 167 | Ga0081455_10002234 | 3300005937 | Bacteria | 23056 |
| 168 | Ga0081455_10004479 | 3300005937 | Bacteria | 15634 |
| 169 | Ga0081455_10007376 | 3300005937 | Bacteria | 11594 |
| 170 | Ga0081455_10079870 | 3300005937 | Bacteria | 2684 |
| 171 | Ga0081538_10006633 | 3300005981 | Bacteria | 10147 |
| 172 | Ga0081540_1003148 | 3300005983 | Bacteria | 13183 |
| 173 | Ga0081540_1004298 | 3300005983 | Bacteria | 10912 |
| 174 | Ga0081540_1005800 | 3300005983 | Bacteria | 9137 |
| 175 | Ga0081540_1016355 | 3300005983 | Bacteria | 4646 |
| 176 | Ga0081540_1050668 | 3300005983 | Bacteria | 2059 |
| 177 | Ga0081540_1054025 | 3300005983 | Bacteria | 1966 |
| 178 | Ga0081539_10000498 | 3300005985 | Bacteria | 82216 |
| 179 | Ga0081539_10000616 | 3300005985 | Bacteria | 72108 |
| 180 | Ga0081539_10008413 | 3300005985 | Bacteria | 9002 |
| 181 | Ga0081539_10046173 | 3300005985 | Bacteria | 2498 |
| 182 | Ga0081539_10107456 | 3300005985 | Bacteria | 1411 |
| 183 | Ga0070717_10003922 | 3300006028 | Bacteria | 10709 |
| 184 | Ga0070717_10150872 | 3300006028 | Bacteria | 2010 |
| 185 | Ga0070717_10227968 | 3300006028 | Bacteria | 1639 |
| 186 | Ga0070717_10245336 | 3300006028 | Bacteria | 1581 |
| 187 | Ga0070717_10359963 | 3300006028 | Bacteria | 1302 |
| 188 | Ga0075365_10102444 | 3300006038 | Bacteria | 1961 |
| 189 | Ga0075368_10003816 | 3300006042 | Bacteria | 5067 |
| 190 | Ga0075368_10050755 | 3300006042 | Bacteria | 1648 |
| 191 | Ga0075363_100002036 | 3300006048 | Bacteria | 8065 |
| 192 | Ga0075363_100015362 | 3300006048 | Bacteria | 3762 |
| 193 | Ga0075364_10098331 | 3300006051 | Bacteria | 1947 |
| 194 | Ga0075364_10127875 | 3300006051 | Bacteria | 1704 |
| 195 | Ga0070715_10055100 | 3300006163 | Bacteria | 1724 |
| 196 | Ga0070716_100004742 | 3300006173 | Bacteria | 6523 |
| 197 | Ga0070716_100036119 | 3300006173 | Bacteria | 2722 |
| 198 | Ga0070712_100000358 | 3300006175 | Bacteria | 25814 |
| 199 | Ga0070712_100006021 | 3300006175 | Bacteria | 7505 |
| 200 | Ga0070712_100009398 | 3300006175 | Bacteria | 6159 |
| 201 | Ga0070712_100064276 | 3300006175 | Bacteria | 2602 |
| 202 | Ga0075362_10027635 | 3300006177 | Bacteria | 2430 |
| 203 | Ga0075362_10040719 | 3300006177 | Bacteria | 2046 |
| 204 | Ga0075362_10068760 | 3300006177 | Bacteria | 1614 |
| 205 | Ga0075367_10108180 | 3300006178 | Bacteria | 1704 |
| 206 | Ga0075369_10062592 | 3300006186 | Bacteria | 1626 |
| 207 | Ga0075369_10119058 | 3300006186 | Bacteria | 1194 |
| 208 | Ga0075366_10007702 | 3300006195 | Bacteria | 5964 |
| 209 | Ga0075366_10175615 | 3300006195 | Bacteria | 1300 |
| 210 | Ga0097621_100194270 | 3300006237 | Bacteria | 1759 |
| 211 | Ga0075370_10042918 | 3300006353 | Bacteria | 2555 |
| 212 | Ga0075370_10070344 | 3300006353 | Bacteria | 2001 |
| 213 | Ga0075370_10077535 | 3300006353 | Bacteria | 1907 |
| 214 | Ga0068871_100239577 | 3300006358 | Bacteria | 1577 |
| 215 | Ga0075428_100493568 | 3300006844 | Bacteria | 1310 |
| 216 | Ga0075434_100082822 | 3300006871 | Bacteria | 3206 |
| 217 | Ga0068865_100098159 | 3300006881 | Bacteria | 2140 |
| 218 | Ga0068865_100166537 | 3300006881 | Bacteria | 1686 |
| 219 | Ga0068865_100383018 | 3300006881 | Bacteria | 1147 |
| 220 | Ga0075436_100009384 | 3300006914 | Bacteria | 6691 |
| 221 | Ga0097620_100085658 | 3300006931 | Bacteria | 3197 |
| 222 | Ga0097620_100445830 | 3300006931 | Bacteria | 1390 |
| 223 | Ga0099824_1008576 | 3300006942 | Bacteria | 13016 |
| 224 | Ga0099824_1012782 | 3300006942 | Bacteria | 8990 |
| 225 | Ga0099822_1004091 | 3300006943 | Bacteria | 18896 |
| 226 | Ga0075435_100185232 | 3300007076 | Bacteria | 1760 |
| 227 | Ga0099794_10029937 | 3300007265 | Bacteria | 2539 |
| 228 | Ga0099794_10051984 | 3300007265 | Bacteria | 1975 |
| 229 | Ga0105250_10056103 | 3300009092 | Bacteria | 1581 |
| 230 | Ga0105240_10001917 | 3300009093 | Bacteria | 34551 |
| 231 | Ga0105240_10014223 | 3300009093 | Bacteria | 10871 |
| 232 | Ga0105240_10055530 | 3300009093 | Bacteria | 4958 |
| 233 | Ga0105245_10033500 | 3300009098 | Bacteria | 4554 |
| 234 | Ga0105247_10012294 | 3300009101 | Bacteria | 5143 |
| 235 | Ga0114129_10021007 | 3300009147 | Bacteria | 9272 |
| 236 | Ga0105243_10014895 | 3300009148 | Bacteria | 5886 |
| 237 | Ga0105241_10001171 | 3300009174 | Bacteria | 19971 |
| 238 | Ga0105241_10007199 | 3300009174 | Bacteria | 8189 |
| 239 | Ga0105248_10056530 | 3300009177 | Bacteria | 4402 |
| 240 | Ga0105237_10003815 | 3300009545 | Bacteria | 17712 |
| 241 | Ga0105237_10024567 | 3300009545 | Bacteria | 6162 |
| 242 | Ga0105237_10090324 | 3300009545 | Bacteria | 3052 |
| 243 | Ga0105237_10356549 | 3300009545 | Bacteria | 1467 |
| 244 | Ga0105237_10447678 | 3300009545 | Bacteria | 1297 |
| 245 | Ga0105238_10000639 | 3300009551 | Bacteria | 36877 |
| 246 | Ga0105238_10000897 | 3300009551 | Bacteria | 30590 |
| 247 | Ga0105238_10003968 | 3300009551 | Bacteria | 14675 |
| 248 | Ga0105238_10018050 | 3300009551 | Bacteria | 7171 |
| 249 | Ga0105238_10094937 | 3300009551 | Bacteria | 2970 |
| 250 | Ga0105239_10001513 | 3300010375 | Bacteria | 30845 |
| 251 | Ga0105239_10005537 | 3300010375 | Bacteria | 14786 |
| 252 | Ga0105239_10100251 | 3300010375 | Bacteria | 3203 |
| 253 | Ga0105239_10106443 | 3300010375 | Bacteria | 3107 |
| 254 | Ga0105239_10313113 | 3300010375 | Bacteria | 1769 |
| 255 | Ga0105239_10519995 | 3300010375 | Bacteria | 1354 |
| 256 | Ga0105246_10001247 | 3300011119 | Bacteria | 14936 |
| 257 | Ga0105246_10409549 | 3300011119 | Bacteria | 1128 |
| 258 | Ga0157373_10013340 | 3300013100 | Bacteria | 6029 |
| 259 | Ga0157371_10077493 | 3300013102 | Bacteria | 2354 |
| 260 | Ga0157371_10092526 | 3300013102 | Bacteria | 2142 |
| 261 | Ga0157370_10007043 | 3300013104 | Bacteria | 12273 |
| 262 | Ga0157370_10027064 | 3300013104 | Bacteria | 5654 |
| 263 | Ga0157369_10029906 | 3300013105 | Bacteria | 6014 |
| 264 | Ga0157369_10039221 | 3300013105 | Bacteria | 5176 |
| 265 | Ga0157369_10055013 | 3300013105 | Bacteria | 4296 |
| 266 | Ga0157374_10060187 | 3300013296 | Bacteria | 3553 |
| 267 | Ga0157374_10101153 | 3300013296 | Bacteria | 2764 |
| 268 | Ga0157378_10104209 | 3300013297 | Bacteria | 2593 |
| 269 | Ga0157372_10038507 | 3300013307 | Bacteria | 5276 |
| 270 | Ga0163163_10065227 | 3300014325 | Bacteria | 3614 |
| 271 | Ga0163163_10226000 | 3300014325 | Bacteria | 1921 |
| 272 | Ga0157380_10169296 | 3300014326 | Bacteria | 1907 |
| 273 | Ga0157379_10039891 | 3300014968 | Bacteria | 4190 |
| 274 | Ga0157376_10011610 | 3300014969 | Bacteria | 6503 |
| 275 | Ga0157376_10033518 | 3300014969 | Bacteria | 4135 |
| 276 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 277 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 278 | Ga0214542_1020125 | 3300021321 | Bacteria | 4998 |
| 279 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 280 | Ga0214545_1019688 | 3300021324 | Bacteria | 5686 |
| 281 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 282 | Ga0209677_100639 | 3300025253 | Bacteria | 18592 |
| 283 | Ga0209677_106368 | 3300025253 | Bacteria | 2808 |
| 284 | Ga0209148_1000356 | 3300025254 | Bacteria | 58774 |
| 285 | Ga0209233_1001736 | 3300025261 | Bacteria | 8414 |
| 286 | Ga0209233_1008415 | 3300025261 | Bacteria | 3197 |
| 287 | Ga0209455_1001391 | 3300025272 | Bacteria | 11010 |
| 288 | Ga0209455_1001958 | 3300025272 | Bacteria | 8484 |
| 289 | Ga0209455_1008852 | 3300025272 | Bacteria | 2694 |
| 290 | Ga0209564_1000017 | 3300025295 | Bacteria | 594063 |
| 291 | Ga0209564_1000810 | 3300025295 | Bacteria | 42727 |
| 292 | Ga0209564_1004546 | 3300025295 | Bacteria | 8425 |
| 293 | Ga0209564_1040998 | 3300025295 | Bacteria | 1248 |
| 294 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 295 | Ga0209758_1001018 | 3300025297 | Bacteria | 37092 |
| 296 | Ga0209758_1002832 | 3300025297 | Bacteria | 16855 |
| 297 | Ga0209758_1003606 | 3300025297 | Bacteria | 13855 |
| 298 | Ga0209758_1006112 | 3300025297 | Bacteria | 8834 |
| 299 | Ga0209758_1010040 | 3300025297 | Bacteria | 5747 |
| 300 | Ga0209758_1022450 | 3300025297 | Bacteria | 2892 |
| 301 | Ga0209256_1007804 | 3300025299 | Bacteria | 5151 |
| 302 | Ga0207426_1000599 | 3300025302 | Bacteria | 47456 |
| 303 | Ga0207426_1000960 | 3300025302 | Bacteria | 28422 |
| 304 | Ga0207426_1012993 | 3300025302 | Bacteria | 3105 |
| 305 | Ga0207426_1033688 | 3300025302 | Bacteria | 1649 |
| 306 | Ga0209257_1002984 | 3300025304 | Bacteria | 15406 |
| 307 | Ga0207656_10005751 | 3300025321 | Bacteria | 4410 |
| 308 | Ga0207656_10036638 | 3300025321 | Bacteria | 2060 |
| 309 | Ga0207682_10001895 | 3300025893 | Bacteria | 9497 |
| 310 | Ga0207692_10000514 | 3300025898 | Bacteria | 13701 |
| 311 | Ga0207692_10006093 | 3300025898 | Bacteria | 4878 |
| 312 | Ga0207692_10123861 | 3300025898 | Bacteria | 1451 |
| 313 | Ga0207692_10144008 | 3300025898 | Bacteria | 1358 |
| 314 | Ga0207688_10081217 | 3300025901 | Bacteria | 1852 |
| 315 | Ga0207647_10010800 | 3300025904 | Bacteria | 6428 |
| 316 | Ga0207699_10000230 | 3300025906 | Bacteria | 31963 |
| 317 | Ga0207699_10000607 | 3300025906 | Bacteria | 17517 |
| 318 | Ga0207699_10061551 | 3300025906 | Bacteria | 2259 |
| 319 | Ga0207699_10115584 | 3300025906 | Bacteria | 1727 |
| 320 | Ga0207699_10224595 | 3300025906 | Bacteria | 1284 |
| 321 | Ga0207645_10013748 | 3300025907 | Bacteria | 5434 |
| 322 | Ga0207645_10029619 | 3300025907 | Bacteria | 3528 |
| 323 | Ga0207705_10078317 | 3300025909 | Bacteria | 2405 |
| 324 | Ga0207705_10157169 | 3300025909 | Bacteria | 1706 |
| 325 | Ga0207654_10000337 | 3300025911 | Bacteria | 28090 |
| 326 | Ga0207654_10069921 | 3300025911 | Bacteria | 2082 |
| 327 | Ga0207707_10006249 | 3300025912 | Bacteria | 10402 |
| 328 | Ga0207707_10021859 | 3300025912 | Bacteria | 5591 |
| 329 | Ga0207707_10030821 | 3300025912 | Bacteria | 4692 |
| 330 | Ga0207707_10278072 | 3300025912 | Bacteria | 1450 |
| 331 | Ga0207707_10291078 | 3300025912 | Bacteria | 1413 |
| 332 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 333 | Ga0207695_10010607 | 3300025913 | Bacteria | 11263 |
| 334 | Ga0207695_10036177 | 3300025913 | Bacteria | 5341 |
| 335 | Ga0207695_10036612 | 3300025913 | Bacteria | 5303 |
| 336 | Ga0207695_10204848 | 3300025913 | Bacteria | 1886 |
| 337 | Ga0207695_10287141 | 3300025913 | Bacteria | 1538 |
| 338 | Ga0207671_10012975 | 3300025914 | Bacteria | 6666 |
| 339 | Ga0207671_10017413 | 3300025914 | Bacteria | 5541 |
| 340 | Ga0207671_10030613 | 3300025914 | Bacteria | 4012 |
| 341 | Ga0207671_10039046 | 3300025914 | Bacteria | 3517 |
| 342 | Ga0207671_10046210 | 3300025914 | Bacteria | 3221 |
| 343 | Ga0207671_10110789 | 3300025914 | Bacteria | 2088 |
| 344 | Ga0207693_10001087 | 3300025915 | Bacteria | 24400 |
| 345 | Ga0207693_10002443 | 3300025915 | Bacteria | 16136 |
| 346 | Ga0207693_10013717 | 3300025915 | Bacteria | 6528 |
| 347 | Ga0207693_10100300 | 3300025915 | Bacteria | 2270 |
| 348 | Ga0207693_10106616 | 3300025915 | Bacteria | 2198 |
| 349 | Ga0207693_10191996 | 3300025915 | Bacteria | 1607 |
| 350 | Ga0207663_10052256 | 3300025916 | Bacteria | 2548 |
| 351 | Ga0207663_10061257 | 3300025916 | Bacteria | 2387 |
| 352 | Ga0207663_10247396 | 3300025916 | Bacteria | 1310 |
| 353 | Ga0207660_10085029 | 3300025917 | Bacteria | 2333 |
| 354 | Ga0207660_10156170 | 3300025917 | Bacteria | 1756 |
| 355 | Ga0207660_10214989 | 3300025917 | Bacteria | 1507 |
| 356 | Ga0207657_10000784 | 3300025919 | Bacteria | 33773 |
| 357 | Ga0207657_10001921 | 3300025919 | Bacteria | 22438 |
| 358 | Ga0207657_10084339 | 3300025919 | Bacteria | 2663 |
| 359 | Ga0207657_10086958 | 3300025919 | Bacteria | 2615 |
| 360 | Ga0207657_10193603 | 3300025919 | Bacteria | 1639 |
| 361 | Ga0207649_10033623 | 3300025920 | Bacteria | 3065 |
| 362 | Ga0207649_10286038 | 3300025920 | Bacteria | 1200 |
| 363 | Ga0207652_10025865 | 3300025921 | Bacteria | 4884 |
| 364 | Ga0207652_10029672 | 3300025921 | Bacteria | 4575 |
| 365 | Ga0207652_10030541 | 3300025921 | Bacteria | 4513 |
| 366 | Ga0207652_10090631 | 3300025921 | Bacteria | 2687 |
| 367 | Ga0207646_10365184 | 3300025922 | Bacteria | 1304 |
| 368 | Ga0207681_10082035 | 3300025923 | Bacteria | 2278 |
| 369 | Ga0207694_10000082 | 3300025924 | Bacteria | 109787 |
| 370 | Ga0207694_10026888 | 3300025924 | Bacteria | 4381 |
| 371 | Ga0207694_10184894 | 3300025924 | Bacteria | 1691 |
| 372 | Ga0207687_10013817 | 3300025927 | Bacteria | 5273 |
| 373 | Ga0207687_10039262 | 3300025927 | Bacteria | 3241 |
| 374 | Ga0207700_10000011 | 3300025928 | Bacteria | 266323 |
| 375 | Ga0207700_10248977 | 3300025928 | Bacteria | 1517 |
| 376 | Ga0207700_10353032 | 3300025928 | Bacteria | 1281 |
| 377 | Ga0207664_10036404 | 3300025929 | Bacteria | 3805 |
| 378 | Ga0207664_10105526 | 3300025929 | Bacteria | 2335 |
| 379 | Ga0207664_10205363 | 3300025929 | Bacteria | 1702 |
| 380 | Ga0207690_10061838 | 3300025932 | Bacteria | 2547 |
| 381 | Ga0207690_10250251 | 3300025932 | Bacteria | 1368 |
| 382 | Ga0207706_10069539 | 3300025933 | Bacteria | 3097 |
| 383 | Ga0207709_10120006 | 3300025935 | Bacteria | 1774 |
| 384 | Ga0207670_10001095 | 3300025936 | Bacteria | 14264 |
| 385 | Ga0207670_10172708 | 3300025936 | Bacteria | 1622 |
| 386 | Ga0207670_10217743 | 3300025936 | Bacteria | 1460 |
| 387 | Ga0207669_10015062 | 3300025937 | Bacteria | 3889 |
| 388 | Ga0207669_10024600 | 3300025937 | Bacteria | 3239 |
| 389 | Ga0207669_10028991 | 3300025937 | Bacteria | 3054 |
| 390 | Ga0207704_10182750 | 3300025938 | Bacteria | 1517 |
| 391 | Ga0207665_10000192 | 3300025939 | Bacteria | 41165 |
| 392 | Ga0207665_10045186 | 3300025939 | Bacteria | 2949 |
| 393 | Ga0207665_10089804 | 3300025939 | Bacteria | 2128 |
| 394 | Ga0207691_10070174 | 3300025940 | Bacteria | 3164 |
| 395 | Ga0207691_10254469 | 3300025940 | Bacteria | 1515 |
| 396 | Ga0207711_10040269 | 3300025941 | Bacteria | 3975 |
| 397 | Ga0207711_10241632 | 3300025941 | Bacteria | 1656 |
| 398 | Ga0207661_10007314 | 3300025944 | Bacteria | 7853 |
| 399 | Ga0207679_10184476 | 3300025945 | Bacteria | 1729 |
| 400 | Ga0207667_10002113 | 3300025949 | Bacteria | 24906 |
| 401 | Ga0207667_10073167 | 3300025949 | Bacteria | 3561 |
| 402 | Ga0207667_10113569 | 3300025949 | Bacteria | 2792 |
| 403 | Ga0207651_10134505 | 3300025960 | Bacteria | 1899 |
| 404 | Ga0207712_10261971 | 3300025961 | Bacteria | 1403 |
| 405 | Ga0207640_10071361 | 3300025981 | Bacteria | 2339 |
| 406 | Ga0207640_10103261 | 3300025981 | Bacteria | 2004 |
| 407 | Ga0207640_10192095 | 3300025981 | Bacteria | 1540 |
| 408 | Ga0207658_10027891 | 3300025986 | Bacteria | 3972 |
| 409 | Ga0207658_10071529 | 3300025986 | Bacteria | 2627 |
| 410 | Ga0207677_10017957 | 3300026023 | Bacteria | 4235 |
| 411 | Ga0207677_10048420 | 3300026023 | Bacteria | 2862 |
| 412 | Ga0207703_10075271 | 3300026035 | Bacteria | 2797 |
| 413 | Ga0207703_10492404 | 3300026035 | Bacteria | 1150 |
| 414 | Ga0207639_10034763 | 3300026041 | Bacteria | 3727 |
| 415 | Ga0207639_10069221 | 3300026041 | Bacteria | 2753 |
| 416 | Ga0207678_10007958 | 3300026067 | Bacteria | 9348 |
| 417 | Ga0207678_10020639 | 3300026067 | Bacteria | 5775 |
| 418 | Ga0207708_10051265 | 3300026075 | Bacteria | 3141 |
| 419 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 420 | Ga0207702_10000226 | 3300026078 | Bacteria | 65919 |
| 421 | Ga0207702_10000442 | 3300026078 | Bacteria | 47074 |
| 422 | Ga0207702_10002060 | 3300026078 | Bacteria | 19465 |
| 423 | Ga0207702_10019299 | 3300026078 | Bacteria | 5641 |
| 424 | Ga0207702_10044911 | 3300026078 | Bacteria | 3715 |
| 425 | Ga0207641_10032278 | 3300026088 | Bacteria | 4347 |
| 426 | Ga0207641_10252533 | 3300026088 | Bacteria | 1647 |
| 427 | Ga0207648_10178965 | 3300026089 | Bacteria | 1876 |
| 428 | Ga0207648_10246631 | 3300026089 | Bacteria | 1592 |
| 429 | Ga0207648_10267675 | 3300026089 | Bacteria | 1526 |
| 430 | Ga0207674_10000261 | 3300026116 | Bacteria | 66008 |
| 431 | Ga0207674_10001614 | 3300026116 | Bacteria | 29042 |
| 432 | Ga0207674_10011733 | 3300026116 | Bacteria | 9831 |
| 433 | Ga0207674_10257826 | 3300026116 | Bacteria | 1691 |
| 434 | Ga0207675_100124084 | 3300026118 | Bacteria | 2445 |
| 435 | Ga0207675_100198557 | 3300026118 | Bacteria | 1926 |
| 436 | Ga0207675_100251309 | 3300026118 | Bacteria | 1711 |
| 437 | Ga0207683_10018855 | 3300026121 | Bacteria | 5886 |
| 438 | Ga0207683_10020766 | 3300026121 | Bacteria | 5619 |
| 439 | Ga0207683_10045508 | 3300026121 | Bacteria | 3838 |
| 440 | Ga0207683_10255624 | 3300026121 | Bacteria | 1599 |
| 441 | Ga0207683_10455501 | 3300026121 | Bacteria | 1180 |
| 442 | Ga0207698_10019754 | 3300026142 | Bacteria | 4620 |
| 443 | Ga0209389_1000008 | 3300027296 | Bacteria | 227385 |
| 444 | Ga0209389_1000121 | 3300027296 | Bacteria | 70490 |
| 445 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 446 | Ga0209589_1002735 | 3300027357 | Bacteria | 30739 |
| 447 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 448 | Ga0209489_101490 | 3300027361 | Bacteria | 48185 |
| 449 | Ga0209489_103445 | 3300027361 | Bacteria | 30849 |
| 450 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 451 | Ga0209700_100036 | 3300027363 | Bacteria | 187888 |
| 452 | Ga0207428_10011461 | 3300027907 | Bacteria | 7835 |
| 453 | Ga0207428_10078702 | 3300027907 | Bacteria | 2579 |
| 454 | Ga0268266_10000908 | 3300028379 | Bacteria | 38174 |
| 455 | Ga0268266_10008371 | 3300028379 | Bacteria | 9197 |
| 456 | Ga0268266_10067894 | 3300028379 | Bacteria | 3086 |
| 457 | Ga0268266_10125463 | 3300028379 | Bacteria | 2290 |
| 458 | Ga0268266_10191132 | 3300028379 | Bacteria | 1869 |
| 459 | Ga0268265_10144509 | 3300028380 | Bacteria | 1996 |
| 460 | Ga0268265_10351527 | 3300028380 | Bacteria | 1346 |
| 461 | Ga0268264_10000043 | 3300028381 | Bacteria | 371761 |
| 462 | Ga0265337_1012538 | 3300028556 | Bacteria | 2877 |
| 463 | Ga0265337_1015056 | 3300028556 | Bacteria | 2544 |
| 464 | Ga0265326_10002188 | 3300028558 | Bacteria | 6631 |
| 465 | Ga0265334_10002607 | 3300028573 | Bacteria | 8406 |
| 466 | Ga0265334_10014246 | 3300028573 | Bacteria | 3314 |
| 467 | Ga0265323_10003939 | 3300028653 | Bacteria | 6452 |
| 468 | Ga0265322_10002310 | 3300028654 | Bacteria | 5913 |
| 469 | Ga0265336_10001608 | 3300028666 | Bacteria | 10074 |
| 470 | Ga0307517_10000063 | 3300028786 | Bacteria | 144304 |
| 471 | Ga0307515_10100819 | 3300028794 | Bacteria | 3492 |
| 472 | Ga0307515_10160523 | 3300028794 | Bacteria | 2295 |
| 473 | Ga0265338_10000667 | 3300028800 | Bacteria | 59318 |
| 474 | Ga0265338_10021413 | 3300028800 | Bacteria | 6743 |
| 475 | Ga0265324_10003760 | 3300029957 | Bacteria | 7088 |
| 476 | Ga0265330_10007489 | 3300031235 | Bacteria | 5314 |
| 477 | Ga0265332_10035696 | 3300031238 | Bacteria | 2159 |
| 478 | Ga0265320_10000953 | 3300031240 | Bacteria | 21567 |
| 479 | Ga0265325_10000098 | 3300031241 | Bacteria | 61384 |
| 480 | Ga0265325_10007037 | 3300031241 | Bacteria | 6782 |
| 481 | Ga0265325_10014108 | 3300031241 | Bacteria | 4526 |
| 482 | Ga0265325_10061548 | 3300031241 | Bacteria | 1903 |
| 483 | Ga0265325_10082418 | 3300031241 | Bacteria | 1596 |
| 484 | Ga0265340_10004938 | 3300031247 | Bacteria | 7414 |
| 485 | Ga0265340_10015221 | 3300031247 | Bacteria | 4000 |
| 486 | Ga0265340_10092226 | 3300031247 | Bacteria | 1414 |
| 487 | Ga0265339_10000145 | 3300031249 | Bacteria | 58275 |
| 488 | Ga0265339_10001071 | 3300031249 | Bacteria | 20801 |
| 489 | Ga0265339_10002292 | 3300031249 | Bacteria | 13811 |
| 490 | Ga0265339_10007152 | 3300031249 | Bacteria | 7244 |
| 491 | Ga0265331_10005233 | 3300031250 | Bacteria | 7866 |
| 492 | Ga0265331_10027187 | 3300031250 | Bacteria | 2870 |
| 493 | Ga0265331_10058559 | 3300031250 | Bacteria | 1824 |
| 494 | Ga0265316_10024242 | 3300031344 | Bacteria | 5090 |
| 495 | Ga0265316_10040807 | 3300031344 | Bacteria | 3719 |
| 496 | Ga0265316_10049430 | 3300031344 | Bacteria | 3313 |
| 497 | Ga0265316_10315327 | 3300031344 | Bacteria | 1137 |
| 498 | Ga0307509_10048183 | 3300031507 | Bacteria | 4578 |
| 499 | Ga0265313_10000173 | 3300031595 | Bacteria | 68499 |
| 500 | Ga0265313_10001153 | 3300031595 | Bacteria | 25235 |
| 501 | Ga0265313_10009753 | 3300031595 | Bacteria | 6188 |
| 502 | Ga0265313_10016846 | 3300031595 | Bacteria | 4186 |
| 503 | Ga0265313_10064549 | 3300031595 | Bacteria | 1703 |
| 504 | Ga0307508_10000010 | 3300031616 | Bacteria | 255747 |
| 505 | Ga0307508_10058073 | 3300031616 | Bacteria | 3424 |
| 506 | Ga0316579_10106656 | 3300031691 | Bacteria | 1343 |
| 507 | Ga0265314_10000125 | 3300031711 | Bacteria | 118671 |
| 508 | Ga0265314_10011664 | 3300031711 | Bacteria | 7231 |
| 509 | Ga0265314_10041990 | 3300031711 | Bacteria | 3267 |
| 510 | Ga0265342_10000110 | 3300031712 | Bacteria | 91145 |
| 511 | Ga0265342_10003916 | 3300031712 | Bacteria | 11954 |
| 512 | Ga0265342_10011179 | 3300031712 | Bacteria | 6160 |
| 513 | Ga0265342_10019680 | 3300031712 | Bacteria | 4346 |
| 514 | Ga0316578_10023053 | 3300031728 | Bacteria | 3481 |
| 515 | Ga0307516_10083248 | 3300031730 | Bacteria | 3041 |
| 516 | Ga0307516_10122318 | 3300031730 | Bacteria | 2391 |
| 517 | Ga0307516_10302458 | 3300031730 | Bacteria | 1275 |
| 518 | Ga0307416_100598822 | 3300032002 | Bacteria | 1182 |
| 519 | Ga0307414_10098259 | 3300032004 | Bacteria | 2196 |
| 520 | Ga0307414_10327816 | 3300032004 | Bacteria | 1306 |
| 521 | Ga0307415_100019128 | 3300032126 | Bacteria | 4152 |
| 522 | Ga0316593_10041240 | 3300032168 | Bacteria | 1536 |
| 523 | Ga0307510_10006860 | 3300033180 | Bacteria | 13587 |
| 524 | Ga0307510_10040547 | 3300033180 | Bacteria | 5110 |
| 525 | Ga0307510_10082351 | 3300033180 | Bacteria | 3114 |
| 526 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 527 | Ga0373930_0004300 | 3300034816 | Bacteria | 2309 |
| 528 | Ga0373958_0001587 | 3300034819 | Bacteria | 3078 |
| 529 | Ga0373958_0015432 | 3300034819 | Bacteria | 1350 |
| 530 | Ga0373959_0010268 | 3300034820 | Bacteria | 1633 |
| 531 | Ga0373926_0005541 | 3300035083 | Bacteria | 4164 |
| 532 | Ga0373926_0059391 | 3300035083 | Bacteria | 1392 |
| 533 | Ga0373934_0001152 | 3300035086 | Bacteria | 9636 |
| 534 | Ga0373940_0006936 | 3300035088 | Bacteria | 2538 |
| 535 | Ga0373944_0000364 | 3300035089 | Bacteria | 10277 |
| 536 | Ga0373944_0001934 | 3300035089 | Bacteria | 5242 |
| 537 | Ga0373952_0003964 | 3300035092 | Bacteria | 2676 |
| 538 | Ga0373923_0005611 | 3300035111 | Bacteria | 4272 |
| 539 | Ga0373936_0002224 | 3300035113 | Bacteria | 7245 |
| 540 | Ga0373936_0007579 | 3300035113 | Bacteria | 4080 |
| 541 | Ga0373936_0008721 | 3300035113 | Bacteria | 3819 |
| 542 | Ga0373936_0032331 | 3300035113 | Bacteria | 2069 |
| 543 | Ga0373936_0046255 | 3300035113 | Bacteria | 1754 |
| 544 | Ga0373939_0014060 | 3300035114 | Bacteria | 2070 |
| 545 | Ga0373939_0016255 | 3300035114 | Bacteria | 1959 |
| 546 | Ga0373941_0025759 | 3300035115 | Bacteria | 1702 |
| 547 | Ga0373945_0000604 | 3300035116 | Bacteria | 10308 |
| 548 | Ga0373945_0019944 | 3300035116 | Bacteria | 2292 |
| 549 | Ga0373945_0021270 | 3300035116 | Bacteria | 2228 |
| 550 | Ga0373945_0053896 | 3300035116 | Bacteria | 1486 |
| 551 | Ga0373954_0000976 | 3300035118 | Bacteria | 11241 |
| 552 | Ga0373954_0049349 | 3300035118 | Bacteria | 1973 |
| 553 | Ga0373954_0141110 | 3300035118 | Bacteria | 1175 |
| 554 | Ga0373956_0009428 | 3300035119 | Bacteria | 3972 |
| 555 | Ga0373956_0118025 | 3300035119 | Bacteria | 1238 |
| 556 | Ga0373943_0001320 | 3300035170 | Bacteria | 11151 |
| 557 | Ga0373943_0003503 | 3300035170 | Bacteria | 7149 |
| 558 | Ga0373943_0026179 | 3300035170 | Bacteria | 2731 |
| 559 | Ga0373943_0046365 | 3300035170 | Bacteria | 2121 |
| 560 | Ga0373946_0022234 | 3300035171 | Bacteria | 2466 |
| 561 | Ga0373946_0022683 | 3300035171 | Bacteria | 2446 |
| 562 | Ga0373955_0000198 | 3300035172 | Bacteria | 24944 |
| 563 | Ga0373955_0007268 | 3300035172 | Bacteria | 5084 |
| 564 | Ga0373955_0007759 | 3300035172 | Bacteria | 4945 |
| 565 | Ga0373955_0012193 | 3300035172 | Bacteria | 4127 |
| 566 | Ga0373955_0069792 | 3300035172 | Bacteria | 1961 |
| 567 | Ga0373955_0117205 | 3300035172 | Bacteria | 1545 |
| 568 | Ga0373942_0017492 | 3300035207 | Bacteria | 1768 |
| 569 | Ga0373962_0009654 | 3300035242 | Bacteria | 2395 |
| 570 | Ga0316574_0000486 | 3300035398 | Bacteria | 16059 |
| 571 | Ga0373924_0006081 | 3300035410 | Bacteria | 4311 |
| 572 | Ga0373924_0013867 | 3300035410 | Bacteria | 3035 |
| 573 | Ga0373924_0028954 | 3300035410 | Bacteria | 2210 |
| 574 | Ga0373931_0000263 | 3300035691 | Bacteria | 22257 |
| 575 | Ga0373931_0075155 | 3300035691 | Bacteria | 1852 |
| 576 | Ga0373935_0000880 | 3300035692 | Bacteria | 16208 |
| 577 | Ga0373935_0008666 | 3300035692 | Bacteria | 6088 |
| 578 | Ga0373935_0052556 | 3300035692 | Bacteria | 2590 |
| 579 | Ga0373935_0066064 | 3300035692 | Bacteria | 2322 |
| 580 | Ga0373927_0000415 | 3300035695 | Bacteria | 32709 |
| 581 | Ga0373927_0011994 | 3300035695 | Bacteria | 5765 |
| 582 | Ga0373927_0012818 | 3300035695 | Bacteria | 5576 |
| 583 | Ga0373927_0040906 | 3300035695 | Bacteria | 3007 |
| 584 | Ga0373927_0055937 | 3300035695 | Bacteria | 2550 |
| 585 | Ga0373927_0060421 | 3300035695 | Bacteria | 2452 |
| 586 | Ga0373927_0090305 | 3300035695 | Bacteria | 1989 |
| 587 | Ga0373927_0122069 | 3300035695 | Bacteria | 1700 |
| 588 | Ga0373933_0000274 | 3300035724 | Bacteria | 33544 |
| 589 | Ga0373933_0000475 | 3300035724 | Bacteria | 25100 |
| 590 | Ga0373947_0002859 | 3300035725 | Bacteria | 10310 |
| 591 | Ga0373947_0008223 | 3300035725 | Bacteria | 6015 |
| 592 | Ga0373947_0012808 | 3300035725 | Bacteria | 4806 |
| 593 | Ga0373947_0030611 | 3300035725 | Bacteria | 3163 |
| 594 | Ga0373947_0040403 | 3300035725 | Bacteria | 2778 |
| 595 | Ga0373947_0103748 | 3300035725 | Bacteria | 1790 |
| 596 | Ga0373937_0008251 | 3300036401 | Bacteria | 9043 |
| 597 | Ga0373937_0030039 | 3300036401 | Bacteria | 4922 |
| 598 | Ga0373937_0086774 | 3300036401 | Bacteria | 2896 |
| 599 | Ga0373937_0103040 | 3300036401 | Bacteria | 2650 |
| 600 | Ga0373937_0111865 | 3300036401 | Bacteria | 2540 |
| 601 | Ga0373937_0169621 | 3300036401 | Bacteria | 2047 |
| 602 | Ga0373937_0174649 | 3300036401 | Bacteria | 2016 |
| 603 | Ga0373937_0258853 | 3300036401 | Bacteria | 1641 |
| 604 | Ga0316584_0004453 | 3300036712 | Bacteria | 9272 |
| 605 | Ga0373925_0008160 | 3300037068 | Bacteria | 7624 |
| 606 | Ga0373925_0012044 | 3300037068 | Bacteria | 6263 |
| 607 | Ga0373925_0030528 | 3300037068 | Bacteria | 3956 |
| 608 | Ga0373925_0035309 | 3300037068 | Bacteria | 3687 |
| 609 | Ga0373925_0125228 | 3300037068 | Bacteria | 1998 |
| 610 | Ga0373925_0139611 | 3300037068 | Bacteria | 1896 |
| 611 | Ga0373925_0181220 | 3300037068 | Bacteria | 1667 |
| 612 | Ga0373925_0270584 | 3300037068 | Bacteria | 1366 |
| 613 | Ga0395900_0000361 | 3300037418 | Bacteria | 65918 |
| 614 | Ga0395900_0034548 | 3300037418 | Bacteria | 5208 |
| 615 | Ga0395900_0047403 | 3300037418 | Bacteria | 4424 |
| 616 | Ga0395900_0155460 | 3300037418 | Bacteria | 2336 |
| 617 | Ga0395900_0277052 | 3300037418 | Bacteria | 1670 |
| 618 | Ga0395900_0554187 | 3300037418 | Bacteria | 1094 |
| 619 | Ga0395898_0020363 | 3300037466 | Bacteria | 6737 |
| 620 | Ga0395898_0132439 | 3300037466 | Bacteria | 2387 |
| 621 | Ga0395905_0003578 | 3300037471 | Bacteria | 16545 |
| 622 | Ga0395905_0271700 | 3300037471 | Bacteria | 1581 |
| 623 | Ga0395905_0411017 | 3300037471 | Bacteria | 1248 |
| 624 | Ga0436364_0033868 | 3300037853 | Bacteria | 1530 |
| 625 | Ga0436364_0171330 | 3300037853 | Bacteria | 2443 |
| 626 | Ga0436364_1331450 | 3300037853 | Bacteria | 3035 |
| 627 | Ga0395901_0005029 | 3300038443 | Bacteria | 13349 |
| 628 | Ga0395901_0150364 | 3300038443 | Bacteria | 2447 |
| 629 | Ga0395901_0179118 | 3300038443 | Bacteria | 2223 |
| 630 | Ga0395901_0192872 | 3300038443 | Bacteria | 2136 |
| 631 | Ga0400483_139806 | 3300039062 | Bacteria | 21288 |
| 632 | Ga0400483_175766 | 3300039062 | Bacteria | 10246 |
| 633 | Ga0400483_205987 | 3300039062 | Bacteria | 15999 |
| 634 | Ga0436365_0369699 | 3300039437 | Bacteria | 3107 |
| 635 | Ga0436365_0733835 | 3300039437 | Bacteria | 1221 |
| 636 | Ga0436365_1018795 | 3300039437 | Bacteria | 1622 |
| 637 | Ga0436365_1361494 | 3300039437 | Bacteria | 15892 |
| 638 | Ga0436365_1556838 | 3300039437 | Bacteria | 2735 |
| 639 | Ga0436360_0623528 | 3300039438 | Bacteria | 2229 |
| 640 | Ga0436361_0266153 | 3300039447 | Bacteria | 2518 |
| 641 | Ga0436363_1628749 | 3300039450 | Bacteria | 3332 |
| 642 | Ga0439453_0008825 | 3300041408 | Bacteria | 1628 |
| 643 | Ga0439455_0058595 | 3300042012 | Bacteria | 1018 |
| 644 | Ga0466972_0000271 | 3300044658 | Bacteria | 32697 |
| 645 | Ga0466972_0034153 | 3300044658 | Bacteria | 2493 |
| 646 | Ga0466965_0004372 | 3300044683 | Bacteria | 6283 |
| 647 | Ga0466966_0004743 | 3300044684 | Bacteria | 8946 |
| 648 | Ga0466966_0230914 | 3300044684 | Bacteria | 1116 |
| 649 | Ga0466961_0000859 | 3300044693 | Bacteria | 18957 |
| 650 | Ga0466963_0077341 | 3300044694 | Bacteria | 2248 |
| 651 | Ga0466968_0008864 | 3300044735 | Bacteria | 3860 |
| 652 | Ga0466957_0026509 | 3300044842 | Bacteria | 3439 |
| 653 | Ga0466957_0084796 | 3300044842 | Bacteria | 1978 |
| 654 | Ga0466957_0145095 | 3300044842 | Bacteria | 1532 |
| 655 | Ga0466957_0215789 | 3300044842 | Bacteria | 1265 |
| 656 | Ga0466959_0033478 | 3300045049 | Bacteria | 3800 |
| 657 | Ga0466959_0036020 | 3300045049 | Bacteria | 3657 |
| 658 | Ga0466959_0117515 | 3300045049 | Bacteria | 1893 |
| 659 | Ga0495617_048848 | 3300046452 | Bacteria | 1408 |
| 660 | Ga0495592_0007563 | 3300046454 | Bacteria | 8138 |
| 661 | Ga0495592_0013902 | 3300046454 | Bacteria | 6115 |
| 662 | Ga0495592_0150556 | 3300046454 | Bacteria | 1609 |
| 663 | Ga0495603_0000676 | 3300046455 | Bacteria | 19328 |
| 664 | Ga0495603_0009006 | 3300046455 | Bacteria | 6037 |
| 665 | Ga0495603_0031745 | 3300046455 | Bacteria | 3180 |
| 666 | Ga0495603_0241912 | 3300046455 | Bacteria | 1039 |
| 667 | Ga0495629_0000176 | 3300046459 | Bacteria | 56922 |
| 668 | Ga0495629_0003088 | 3300046459 | Bacteria | 12634 |
| 669 | Ga0495629_0003357 | 3300046459 | Bacteria | 12088 |
| 670 | Ga0495629_0012129 | 3300046459 | Bacteria | 6245 |
| 671 | Ga0495629_0024799 | 3300046459 | Bacteria | 4269 |
| 672 | Ga0495629_0081977 | 3300046459 | Bacteria | 2251 |
| 673 | Ga0495638_0019106 | 3300046460 | Bacteria | 4538 |
| 674 | Ga0495638_0068357 | 3300046460 | Bacteria | 2178 |
| 675 | Ga0495641_0008578 | 3300046461 | Bacteria | 6198 |
| 676 | Ga0495641_0012702 | 3300046461 | Bacteria | 4688 |
| 677 | Ga0495651_0002298 | 3300046462 | Bacteria | 14746 |
| 678 | Ga0495651_0009559 | 3300046462 | Bacteria | 7449 |
| 679 | Ga0495651_0092718 | 3300046462 | Bacteria | 2262 |
| 680 | Ga0495653_0004529 | 3300046463 | Bacteria | 11230 |
| 681 | Ga0495580_0004887 | 3300046472 | Bacteria | 11206 |
| 682 | Ga0495580_0009272 | 3300046472 | Bacteria | 7744 |
| 683 | Ga0495580_0013690 | 3300046472 | Bacteria | 6180 |
| 684 | Ga0495580_0031326 | 3300046472 | Bacteria | 3844 |
| 685 | Ga0495580_0084911 | 3300046472 | Bacteria | 2205 |
| 686 | Ga0495582_0000177 | 3300046473 | Bacteria | 34588 |
| 687 | Ga0495605_0090097 | 3300046474 | Bacteria | 1423 |
| 688 | Ga0495605_0107899 | 3300046474 | Bacteria | 1273 |
| 689 | Ga0495639_0000726 | 3300046475 | Bacteria | 15095 |
| 690 | Ga0495639_0004110 | 3300046475 | Bacteria | 6235 |
| 691 | Ga0495639_0022248 | 3300046475 | Bacteria | 2780 |
| 692 | Ga0495662_0000028 | 3300046476 | Bacteria | 51556 |
| 693 | Ga0495662_0003064 | 3300046476 | Bacteria | 8427 |
| 694 | Ga0495662_0017858 | 3300046476 | Bacteria | 3434 |
| 695 | Ga0495664_0008779 | 3300046477 | Bacteria | 5647 |
| 696 | Ga0495664_0025560 | 3300046477 | Bacteria | 3439 |
| 697 | Ga0495585_0054100 | 3300046492 | Bacteria | 2220 |
| 698 | Ga0495594_0000020 | 3300046499 | Bacteria | 80534 |
| 699 | Ga0495594_0005321 | 3300046499 | Bacteria | 6610 |
| 700 | Ga0495594_0052047 | 3300046499 | Bacteria | 2254 |
| 701 | Ga0495606_0001226 | 3300046507 | Bacteria | 35910 |
| 702 | Ga0495606_0060335 | 3300046507 | Bacteria | 2429 |
| 703 | Ga0495608_0000721 | 3300046511 | Bacteria | 23015 |
| 704 | Ga0495608_0078020 | 3300046511 | Bacteria | 2156 |
| 705 | Ga0495608_0101820 | 3300046511 | Bacteria | 1851 |
| 706 | Ga0495608_0133537 | 3300046511 | Bacteria | 1587 |
| 707 | Ga0495618_0018572 | 3300046514 | Bacteria | 4270 |
| 708 | Ga0495620_0026112 | 3300046515 | Bacteria | 2751 |
| 709 | Ga0495620_0109991 | 3300046515 | Bacteria | 1093 |
| 710 | Ga0495628_0004786 | 3300046516 | Bacteria | 11931 |
| 711 | Ga0495628_0074309 | 3300046516 | Bacteria | 2648 |
| 712 | Ga0495628_0093530 | 3300046516 | Bacteria | 2325 |
| 713 | Ga0495628_0130981 | 3300046516 | Bacteria | 1918 |
| 714 | Ga0495628_0317667 | 3300046516 | Bacteria | 1150 |
| 715 | Ga0495630_0002476 | 3300046517 | Bacteria | 12804 |
| 716 | Ga0495630_0225693 | 3300046517 | Bacteria | 1430 |
| 717 | Ga0495632_0008927 | 3300046519 | Bacteria | 6088 |
| 718 | Ga0495644_0002732 | 3300046523 | Bacteria | 7000 |
| 719 | Ga0495644_0022480 | 3300046523 | Bacteria | 2404 |
| 720 | Ga0495648_0002422 | 3300046524 | Bacteria | 17288 |
| 721 | Ga0495648_0008933 | 3300046524 | Bacteria | 7831 |
| 722 | Ga0495648_0059123 | 3300046524 | Bacteria | 2288 |
| 723 | Ga0495648_0074244 | 3300046524 | Bacteria | 1960 |
| 724 | Ga0495663_0025921 | 3300046525 | Bacteria | 1713 |
| 725 | Ga0495666_0006077 | 3300046526 | Bacteria | 6079 |
| 726 | Ga0495666_0010823 | 3300046526 | Bacteria | 4549 |
| 727 | Ga0495652_0063452 | 3300046529 | Bacteria | 3110 |
| 728 | Ga0495652_0086353 | 3300046529 | Bacteria | 2576 |
| 729 | Ga0495652_0100838 | 3300046529 | Bacteria | 2341 |
| 730 | Ga0495654_0049895 | 3300046530 | Bacteria | 2047 |
| 731 | Ga0495654_0143360 | 3300046530 | Bacteria | 1063 |
| 732 | Ga0495665_0000057 | 3300046531 | Bacteria | 44876 |
| 733 | Ga0495665_0009325 | 3300046531 | Bacteria | 5314 |
| 734 | Ga0495665_0021145 | 3300046531 | Bacteria | 3495 |
| 735 | Ga0495665_0032754 | 3300046531 | Bacteria | 2780 |
| 736 | Ga0495665_0033665 | 3300046531 | Bacteria | 2741 |
| 737 | Ga0495640_0001533 | 3300046533 | Bacteria | 18200 |
| 738 | Ga0495640_0006411 | 3300046533 | Bacteria | 9304 |
| 739 | Ga0495640_0031293 | 3300046533 | Bacteria | 3799 |
| 740 | Ga0495640_0051277 | 3300046533 | Bacteria | 2836 |
| 741 | Ga0495587_0000736 | 3300046536 | Bacteria | 21940 |
| 742 | Ga0495621_0015238 | 3300046539 | Bacteria | 2449 |
| 743 | Ga0495621_0018932 | 3300046539 | Bacteria | 2242 |
| 744 | Ga0495645_0007114 | 3300046543 | Bacteria | 7789 |
| 745 | Ga0495645_0038764 | 3300046543 | Bacteria | 3475 |
| 746 | Ga0495622_0001520 | 3300046557 | Bacteria | 11590 |
| 747 | Ga0495622_0017143 | 3300046557 | Bacteria | 3372 |
| 748 | Ga0495622_0093161 | 3300046557 | Bacteria | 1383 |
| 749 | Ga0495633_0009880 | 3300046558 | Bacteria | 5241 |
| 750 | Ga0495667_0000319 | 3300046559 | Bacteria | 30374 |
| 751 | Ga0495667_0008737 | 3300046559 | Bacteria | 6882 |
| 752 | Ga0495667_0020907 | 3300046559 | Bacteria | 4417 |
| 753 | Ga0495667_0036184 | 3300046559 | Bacteria | 3296 |
| 754 | Ga0495656_0000064 | 3300046615 | Bacteria | 48582 |
| 755 | Ga0495668_0036816 | 3300046616 | Bacteria | 2740 |
| 756 | Ga0495668_0060757 | 3300046616 | Bacteria | 2084 |
| 757 | Ga0495668_0062215 | 3300046616 | Bacteria | 2057 |
| 758 | Ga0495634_0008509 | 3300046642 | Bacteria | 7628 |
| 759 | Ga0495634_0010828 | 3300046642 | Bacteria | 6668 |
| 760 | Ga0495634_0024302 | 3300046642 | Bacteria | 4253 |
| 761 | Ga0495634_0030256 | 3300046642 | Bacteria | 3741 |
| 762 | Ga0495634_0105411 | 3300046642 | Bacteria | 1817 |
| 763 | Ga0495634_0233566 | 3300046642 | Bacteria | 1130 |
| 764 | Ga0495625_0124200 | 3300046660 | Bacteria | 1753 |
| 765 | Ga0495625_0147310 | 3300046660 | Bacteria | 1584 |
| 766 | Ga0495625_0211726 | 3300046660 | Bacteria | 1274 |
| 767 | Ga0495635_0004372 | 3300046663 | Bacteria | 9784 |
| 768 | Ga0495635_0008796 | 3300046663 | Bacteria | 7049 |
| 769 | Ga0495635_0008850 | 3300046663 | Bacteria | 7027 |
| 770 | Ga0495635_0049438 | 3300046663 | Bacteria | 2898 |
| 771 | Ga0495635_0249464 | 3300046663 | Bacteria | 1197 |
| 772 | Ga0495659_0002437 | 3300046664 | Bacteria | 6000 |
| 773 | Ga0495659_0020085 | 3300046664 | Bacteria | 2240 |
| 774 | Ga0495588_0011011 | 3300046674 | Bacteria | 4231 |
| 775 | Ga0495588_0018632 | 3300046674 | Bacteria | 3388 |
| 776 | Ga0495588_0040969 | 3300046674 | Bacteria | 2364 |
| 777 | Ga0495588_0105764 | 3300046674 | Bacteria | 1481 |
| 778 | Ga0495657_0001557 | 3300046675 | Bacteria | 19730 |
| 779 | Ga0495657_0044896 | 3300046675 | Bacteria | 3001 |
| 780 | Ga0495657_0049297 | 3300046675 | Bacteria | 2837 |
| 781 | Ga0495657_0049317 | 3300046675 | Bacteria | 2836 |
| 782 | Ga0495599_0001378 | 3300046678 | Bacteria | 13874 |
| 783 | Ga0495599_0021867 | 3300046678 | Bacteria | 3993 |
| 784 | Ga0495599_0071568 | 3300046678 | Bacteria | 2164 |
| 785 | Ga0495623_0008240 | 3300046679 | Bacteria | 6779 |
| 786 | Ga0495623_0010692 | 3300046679 | Bacteria | 5941 |
| 787 | Ga0495646_0003336 | 3300046680 | Bacteria | 9986 |
| 788 | Ga0495646_0013387 | 3300046680 | Bacteria | 5214 |
| 789 | Ga0495646_0016906 | 3300046680 | Bacteria | 4632 |
| 790 | Ga0495646_0108359 | 3300046680 | Bacteria | 1584 |
| 791 | Ga0495647_0012769 | 3300046681 | Bacteria | 2897 |
| 792 | Ga0495647_0020139 | 3300046681 | Bacteria | 2392 |
| 793 | Ga0495647_0072707 | 3300046681 | Bacteria | 1380 |
| 794 | Ga0495658_0003230 | 3300046683 | Bacteria | 8117 |
| 795 | Ga0495658_0010431 | 3300046683 | Bacteria | 4648 |
| 796 | Ga0495658_0043195 | 3300046683 | Bacteria | 2520 |
| 797 | Ga0495669_0004325 | 3300046684 | Bacteria | 5861 |
| 798 | Ga0495613_0012712 | 3300046689 | Bacteria | 6260 |
| 799 | Ga0495613_0013818 | 3300046689 | Bacteria | 5990 |
| 800 | Ga0495613_0033299 | 3300046689 | Bacteria | 3829 |
| 801 | Ga0495613_0105399 | 3300046689 | Bacteria | 2035 |
| 802 | Ga0495613_0247800 | 3300046689 | Bacteria | 1244 |
| 803 | Ga0495624_0005807 | 3300046690 | Bacteria | 8837 |
| 804 | Ga0495624_0007826 | 3300046690 | Bacteria | 7500 |
| 805 | Ga0495624_0010764 | 3300046690 | Bacteria | 6305 |
| 806 | Ga0495624_0029244 | 3300046690 | Bacteria | 3596 |
| 807 | Ga0495624_0032844 | 3300046690 | Bacteria | 3363 |
| 808 | Ga0495624_0054083 | 3300046690 | Bacteria | 2532 |
| 809 | Ga0495624_0059398 | 3300046690 | Bacteria | 2400 |
| 810 | Ga0495670_0000258 | 3300046691 | Bacteria | 24647 |
| 811 | Ga0495670_0029296 | 3300046691 | Bacteria | 2732 |
| 812 | Ga0495671_0024554 | 3300046692 | Bacteria | 3138 |
| 813 | Ga0495600_0000314 | 3300046809 | Bacteria | 25635 |
| 814 | Ga0495600_0001994 | 3300046809 | Bacteria | 11472 |
| 815 | Ga0495600_0047739 | 3300046809 | Bacteria | 2793 |
| 816 | Ga0495600_0103975 | 3300046809 | Bacteria | 1850 |
| 817 | Ga0495600_0203278 | 3300046809 | Bacteria | 1271 |
| 818 | Ga0495581_0004028 | 3300047315 | Bacteria | 8459 |
| 819 | Ga0495581_0020045 | 3300047315 | Bacteria | 3882 |
| 820 | Ga0495581_0047694 | 3300047315 | Bacteria | 2475 |
| 821 | Ga0495604_0001137 | 3300047317 | Bacteria | 22068 |
| 822 | Ga0495604_0012931 | 3300047317 | Bacteria | 6651 |
| 823 | Ga0495604_0019823 | 3300047317 | Bacteria | 5379 |
| 824 | Ga0495604_0054739 | 3300047317 | Bacteria | 3077 |
| 825 | Ga0495604_0284117 | 3300047317 | Bacteria | 1117 |
| 826 | Ga0495674_0088433 | 3300047319 | Bacteria | 2649 |
| 827 | Ga0495674_0144949 | 3300047319 | Bacteria | 1994 |
| 828 | Ga0495674_0193450 | 3300047319 | Bacteria | 1689 |
| 829 | Ga0495672_0011418 | 3300047320 | Bacteria | 6271 |
| 830 | Ga0495672_0061120 | 3300047320 | Bacteria | 2172 |
| 831 | Ga0495672_0077248 | 3300047320 | Bacteria | 1867 |
| 832 | Ga0495672_0169407 | 3300047320 | Bacteria | 1115 |
| 833 | Ga0495676_0019882 | 3300047321 | Bacteria | 5902 |
| 834 | Ga0495676_0030061 | 3300047321 | Bacteria | 4617 |
| 835 | Ga0495680_0002499 | 3300047322 | Bacteria | 18805 |
| 836 | Ga0495680_0019888 | 3300047322 | Bacteria | 5659 |
| 837 | Ga0495680_0150915 | 3300047322 | Bacteria | 1694 |
| 838 | Ga0495675_0002364 | 3300047444 | Bacteria | 11266 |
| 839 | Ga0495675_0115306 | 3300047444 | Bacteria | 1675 |
| 840 | Ga0495684_0000023 | 3300047471 | Bacteria | 133626 |
| 841 | Ga0495684_0003050 | 3300047471 | Bacteria | 13176 |
| 842 | Ga0495684_0011309 | 3300047471 | Bacteria | 6891 |
| 843 | Ga0495684_0011436 | 3300047471 | Bacteria | 6853 |
| 844 | Ga0495684_0018741 | 3300047471 | Bacteria | 5331 |
| 845 | Ga0495684_0177272 | 3300047471 | Bacteria | 1582 |
| 846 | Ga0495684_0190589 | 3300047471 | Bacteria | 1516 |
| 847 | Ga0495684_0195250 | 3300047471 | Bacteria | 1494 |
| 848 | Ga0495686_0035662 | 3300047472 | Bacteria | 3196 |
| 849 | Ga0495686_0175147 | 3300047472 | Bacteria | 1246 |
| 850 | Ga0495593_0000165 | 3300047673 | Bacteria | 33774 |
| 851 | Ga0495593_0000221 | 3300047673 | Bacteria | 30321 |
| 852 | Ga0495593_0003546 | 3300047673 | Bacteria | 9336 |
| 853 | Ga0495593_0007451 | 3300047673 | Bacteria | 6402 |
| 854 | Ga0495593_0047522 | 3300047673 | Bacteria | 2282 |
| 855 | Ga0495593_0085274 | 3300047673 | Bacteria | 1630 |
| 856 | Ga0495602_0026464 | 3300048088 | Bacteria | 5593 |
| 857 | Ga0495602_0084652 | 3300048088 | Bacteria | 2652 |
| 858 | Ga0495602_0105766 | 3300048088 | Bacteria | 2299 |
| 859 | Ga0495602_0173238 | 3300048088 | Bacteria | 1673 |
| 860 | Ga0495602_0247252 | 3300048088 | Bacteria | 1331 |
| 861 | Ga0495614_0012122 | 3300048089 | Bacteria | 3786 |
| 862 | Ga0495614_0026074 | 3300048089 | Bacteria | 2519 |
| 863 | Ga0495614_0104589 | 3300048089 | Bacteria | 1240 |
| 864 | Ga0495614_0118280 | 3300048089 | Bacteria | 1167 |
| 865 | Ga0495626_0065183 | 3300048091 | Bacteria | 1649 |
| 866 | Ga0496100_0114033 | 3300048903 | Bacteria | 1882 |
| 867 | Ga0496101_0003066 | 3300048904 | Bacteria | 10322 |
| 868 | Ga0496102_0004610 | 3300048905 | Bacteria | 11664 |
| 869 | Ga0496102_0028901 | 3300048905 | Bacteria | 4955 |
| 870 | Ga0496102_0103280 | 3300048905 | Bacteria | 2651 |
| 871 | Ga0496102_0115938 | 3300048905 | Bacteria | 2499 |
| 872 | Ga0496102_0125281 | 3300048905 | Bacteria | 2401 |
| 873 | Ga0496102_0321675 | 3300048905 | Bacteria | 1457 |
| 874 | Ga0496103_0022889 | 3300048906 | Bacteria | 3765 |
| 875 | Ga0496103_0025422 | 3300048906 | Bacteria | 3579 |
| 876 | Ga0496104_0005886 | 3300048907 | Bacteria | 10738 |
| 877 | Ga0496104_0007966 | 3300048907 | Bacteria | 9396 |
| 878 | Ga0496104_0014294 | 3300048907 | Bacteria | 7167 |
| 879 | Ga0496104_0077274 | 3300048907 | Bacteria | 3172 |
| 880 | Ga0496104_0160498 | 3300048907 | Bacteria | 2156 |
| 881 | Ga0496104_0336510 | 3300048907 | Bacteria | 1422 |
| 882 | Ga0496105_0009152 | 3300048908 | Bacteria | 7727 |
| 883 | Ga0496105_0049567 | 3300048908 | Bacteria | 3467 |
| 884 | Ga0496105_0106438 | 3300048908 | Bacteria | 2315 |
| 885 | Ga0496105_0163756 | 3300048908 | Bacteria | 1825 |
| 886 | Ga0496105_0183766 | 3300048908 | Bacteria | 1711 |
| 887 | Ga0496106_0000363 | 3300048909 | Bacteria | 32218 |
| 888 | Ga0496106_0002373 | 3300048909 | Bacteria | 14021 |
| 889 | Ga0496106_0018324 | 3300048909 | Bacteria | 5174 |
| 890 | Ga0496106_0018493 | 3300048909 | Bacteria | 5153 |
| 891 | Ga0496106_0039925 | 3300048909 | Bacteria | 3514 |
| 892 | Ga0496106_0082089 | 3300048909 | Bacteria | 2477 |
| 893 | Ga0496107_0004064 | 3300048910 | Bacteria | 9851 |
| 894 | Ga0496107_0056799 | 3300048910 | Bacteria | 2828 |
| 895 | Ga0496107_0113218 | 3300048910 | Bacteria | 1995 |
| 896 | Ga0496108_0000625 | 3300048911 | Bacteria | 27651 |
| 897 | Ga0496108_0001361 | 3300048911 | Bacteria | 19211 |
| 898 | Ga0496108_0012338 | 3300048911 | Bacteria | 6953 |
| 899 | Ga0496108_0053812 | 3300048911 | Bacteria | 3376 |
| 900 | Ga0496108_0079513 | 3300048911 | Bacteria | 2776 |
| 901 | Ga0496108_0157821 | 3300048911 | Bacteria | 1959 |
| 902 | Ga0496109_0000909 | 3300048912 | Bacteria | 24642 |
| 903 | Ga0496109_0034392 | 3300048912 | Bacteria | 4564 |
| 904 | Ga0496109_0035150 | 3300048912 | Bacteria | 4518 |
| 905 | Ga0496109_0078162 | 3300048912 | Bacteria | 3046 |
| 906 | Ga0496109_0092263 | 3300048912 | Bacteria | 2801 |
| 907 | Ga0496109_0351915 | 3300048912 | Bacteria | 1391 |
| 908 | Ga0496109_0523395 | 3300048912 | Bacteria | 1119 |
| 909 | Ga0496110_0023859 | 3300048913 | Bacteria | 5207 |
| 910 | Ga0496110_0029464 | 3300048913 | Bacteria | 4724 |
| 911 | Ga0496110_0123106 | 3300048913 | Bacteria | 2338 |
| 912 | Ga0496111_0031776 | 3300048914 | Bacteria | 3762 |
| 913 | Ga0496111_0032439 | 3300048914 | Bacteria | 3724 |
| 914 | Ga0496111_0283191 | 3300048914 | Bacteria | 1229 |
| 915 | Ga0496112_0000031 | 3300048915 | Bacteria | 120022 |
| 916 | Ga0496112_0015495 | 3300048915 | Bacteria | 7118 |
| 917 | Ga0496112_0032484 | 3300048915 | Bacteria | 5068 |
| 918 | Ga0496112_0070476 | 3300048915 | Bacteria | 3455 |
| 919 | Ga0496112_0102666 | 3300048915 | Bacteria | 2829 |
| 920 | Ga0496112_0139351 | 3300048915 | Bacteria | 2395 |
| 921 | Ga0496112_0175574 | 3300048915 | Bacteria | 2107 |
| 922 | Ga0496112_0410920 | 3300048915 | Bacteria | 1293 |
| 923 | Ga0496113_0000087 | 3300048916 | Bacteria | 40247 |
| 924 | Ga0496113_0076481 | 3300048916 | Bacteria | 2557 |
| 925 | Ga0496114_0047001 | 3300048917 | Bacteria | 3588 |
| 926 | Ga0496114_0294811 | 3300048917 | Bacteria | 1431 |
| 927 | Ga0496115_0000713 | 3300048918 | Bacteria | 24637 |
| 928 | Ga0496115_0040376 | 3300048918 | Bacteria | 3709 |
| 929 | Ga0496115_0055903 | 3300048918 | Bacteria | 3171 |
| 930 | Ga0496115_0093325 | 3300048918 | Bacteria | 2461 |
| 931 | Ga0496116_0082401 | 3300048919 | Bacteria | 1990 |
| 932 | Ga0496117_0051775 | 3300048920 | Bacteria | 2899 |
| 933 | Ga0496117_0075134 | 3300048920 | Bacteria | 2246 |
| 934 | Ga0496118_0002080 | 3300048921 | Bacteria | 28152 |
| 935 | Ga0496118_0081179 | 3300048921 | Bacteria | 2278 |
| 936 | Ga0496118_0102331 | 3300048921 | Bacteria | 1931 |
| 937 | Ga0496119_0015210 | 3300048922 | Bacteria | 5951 |
| 938 | Ga0496120_0010096 | 3300048923 | Bacteria | 6618 |
| 939 | Ga0496121_0000183 | 3300048924 | Bacteria | 139168 |
| 940 | Ga0496121_0000407 | 3300048924 | Bacteria | 85728 |
| 941 | Ga0496121_0001403 | 3300048924 | Bacteria | 40795 |
| 942 | Ga0496121_0020343 | 3300048924 | Bacteria | 6578 |
| 943 | Ga0496121_0023725 | 3300048924 | Bacteria | 5895 |
| 944 | Ga0496121_0027667 | 3300048924 | Bacteria | 5300 |
| 945 | Ga0496121_0048678 | 3300048924 | Bacteria | 3604 |
| 946 | Ga0496121_0052234 | 3300048924 | Bacteria | 3435 |
| 947 | Ga0496121_0088209 | 3300048924 | Bacteria | 2432 |
| 948 | Ga0496121_0108085 | 3300048924 | Bacteria | 2128 |
| 949 | Ga0496121_0136647 | 3300048924 | Bacteria | 1825 |
| 950 | Ga0496121_0256896 | 3300048924 | Bacteria | 1208 |
| 951 | Ga0496123_0000812 | 3300048926 | Bacteria | 50414 |
| 952 | Ga0496123_0028711 | 3300048926 | Bacteria | 4112 |
| 953 | Ga0496123_0035502 | 3300048926 | Bacteria | 3550 |
| 954 | Ga0496123_0087889 | 3300048926 | Bacteria | 1858 |
| 955 | Ga0496124_0010967 | 3300048927 | Bacteria | 9111 |
| 956 | Ga0496124_0068590 | 3300048927 | Bacteria | 2947 |
| 957 | Ga0496124_0240919 | 3300048927 | Bacteria | 1345 |
| 958 | Ga0496125_0000090 | 3300048928 | Bacteria | 214433 |
| 959 | Ga0496125_0000602 | 3300048928 | Bacteria | 61264 |
| 960 | Ga0496125_0001219 | 3300048928 | Bacteria | 38596 |
| 961 | Ga0496125_0001713 | 3300048928 | Bacteria | 30526 |
| 962 | Ga0496125_0022884 | 3300048928 | Bacteria | 5789 |
| 963 | Ga0496125_0025195 | 3300048928 | Bacteria | 5453 |
| 964 | Ga0496125_0082459 | 3300048928 | Bacteria | 2451 |
| 965 | Ga0496125_0090461 | 3300048928 | Bacteria | 2297 |
| 966 | Ga0496126_0008736 | 3300048929 | Bacteria | 10878 |
| 967 | Ga0496126_0008974 | 3300048929 | Bacteria | 10702 |
| 968 | Ga0496126_0010266 | 3300048929 | Bacteria | 9838 |
| 969 | Ga0496126_0028595 | 3300048929 | Bacteria | 5310 |
| 970 | Ga0496126_0043018 | 3300048929 | Bacteria | 4169 |
| 971 | Ga0496126_0059498 | 3300048929 | Bacteria | 3440 |
| 972 | Ga0496126_0079627 | 3300048929 | Bacteria | 2900 |
| 973 | Ga0496126_0090067 | 3300048929 | Bacteria | 2699 |
| 974 | Ga0496126_0123540 | 3300048929 | Bacteria | 2242 |
| 975 | Ga0496126_0162134 | 3300048929 | Bacteria | 1910 |
| 976 | Ga0496126_0274822 | 3300048929 | Bacteria | 1397 |
| 977 | Ga0496126_0307307 | 3300048929 | Bacteria | 1306 |
| 978 | Ga0501031_0008429 | 3300049568 | Bacteria | 6704 |
| 979 | Ga0501031_0013071 | 3300049568 | Bacteria | 5416 |
| 980 | Ga0501032_0000087 | 3300049569 | Bacteria | 79948 |
| 981 | Ga0501032_0005128 | 3300049569 | Bacteria | 9769 |
| 982 | Ga0501032_0011988 | 3300049569 | Bacteria | 6207 |
| 983 | Ga0501032_0016894 | 3300049569 | Bacteria | 5129 |
| 984 | Ga0501032_0019804 | 3300049569 | Bacteria | 4698 |
| 985 | Ga0501032_0030627 | 3300049569 | Bacteria | 3692 |
| 986 | Ga0501032_0034125 | 3300049569 | Bacteria | 3484 |
| 987 | Ga0501033_0000181 | 3300049570 | Bacteria | 60365 |
| 988 | Ga0501033_0000510 | 3300049570 | Bacteria | 36533 |
| 989 | Ga0501033_0003261 | 3300049570 | Bacteria | 13432 |
| 990 | Ga0501033_0081180 | 3300049570 | Bacteria | 2378 |
| 991 | Ga0501033_0195265 | 3300049570 | Bacteria | 1447 |
| 992 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 993 | Ga0501034_0000211 | 3300049571 | Bacteria | 110858 |
| 994 | Ga0501034_0003829 | 3300049571 | Bacteria | 16950 |
| 995 | Ga0501034_0009992 | 3300049571 | Bacteria | 9915 |
| 996 | Ga0501034_0061016 | 3300049571 | Bacteria | 3788 |
| 997 | Ga0501034_0089287 | 3300049571 | Bacteria | 3080 |
| 998 | Ga0501034_0114284 | 3300049571 | Bacteria | 2688 |
| 999 | Ga0501034_0231765 | 3300049571 | Bacteria | 1795 |
| 1000 | Ga0501034_0435722 | 3300049571 | Bacteria | 1230 |
| 1001 | Ga0501036_0000069 | 3300049572 | Bacteria | 64331 |
| 1002 | Ga0501036_0014141 | 3300049572 | Bacteria | 6638 |
| 1003 | Ga0501036_0024390 | 3300049572 | Bacteria | 5098 |
| 1004 | Ga0501036_0043219 | 3300049572 | Bacteria | 3815 |
| 1005 | Ga0501036_0093787 | 3300049572 | Bacteria | 2536 |
| 1006 | Ga0501036_0175379 | 3300049572 | Bacteria | 1805 |
| 1007 | Ga0501036_0233897 | 3300049572 | Bacteria | 1542 |
| 1008 | Ga0501037_0000034 | 3300049573 | Bacteria | 126321 |
| 1009 | Ga0501037_0002667 | 3300049573 | Bacteria | 12862 |
| 1010 | Ga0501037_0010155 | 3300049573 | Bacteria | 6908 |
| 1011 | Ga0501037_0033876 | 3300049573 | Bacteria | 3771 |
| 1012 | Ga0501037_0063822 | 3300049573 | Bacteria | 2685 |
| 1013 | Ga0501037_0121741 | 3300049573 | Bacteria | 1876 |
| 1014 | Ga0501038_0000628 | 3300049574 | Bacteria | 31365 |
| 1015 | Ga0501038_0001570 | 3300049574 | Bacteria | 21153 |
| 1016 | Ga0501038_0007511 | 3300049574 | Bacteria | 10051 |
| 1017 | Ga0501038_0025032 | 3300049574 | Bacteria | 5321 |
| 1018 | Ga0501038_0081851 | 3300049574 | Bacteria | 2719 |
| 1019 | Ga0501038_0250242 | 3300049574 | Bacteria | 1404 |
| 1020 | Ga0501038_0264278 | 3300049574 | Bacteria | 1359 |
| 1021 | Ga0501039_0000931 | 3300049575 | Bacteria | 21350 |
| 1022 | Ga0501039_0081486 | 3300049575 | Bacteria | 2519 |
| 1023 | Ga0501039_0087487 | 3300049575 | Bacteria | 2427 |
| 1024 | Ga0501039_0283717 | 3300049575 | Bacteria | 1302 |
| 1025 | Ga0501041_0166749 | 3300049577 | Bacteria | 1378 |
| 1026 | Ga0501042_0013413 | 3300049578 | Bacteria | 5576 |
| 1027 | Ga0501042_0026741 | 3300049578 | Bacteria | 4053 |
| 1028 | Ga0501042_0131408 | 3300049578 | Bacteria | 1804 |
| 1029 | Ga0501042_0156475 | 3300049578 | Bacteria | 1644 |
| 1030 | Ga0501043_0000033 | 3300049579 | Bacteria | 139500 |
| 1031 | Ga0501043_0009976 | 3300049579 | Bacteria | 7449 |
| 1032 | Ga0501043_0012412 | 3300049579 | Bacteria | 6663 |
| 1033 | Ga0501043_0014386 | 3300049579 | Bacteria | 6195 |
| 1034 | Ga0501043_0023684 | 3300049579 | Bacteria | 4815 |
| 1035 | Ga0501043_0030178 | 3300049579 | Bacteria | 4259 |
| 1036 | Ga0501043_0224348 | 3300049579 | Bacteria | 1453 |
| 1037 | Ga0501046_0000412 | 3300049580 | Bacteria | 42614 |
| 1038 | Ga0501046_0002043 | 3300049580 | Bacteria | 19173 |
| 1039 | Ga0501046_0039760 | 3300049580 | Bacteria | 3764 |
| 1040 | Ga0501046_0041076 | 3300049580 | Bacteria | 3692 |
| 1041 | Ga0501046_0048020 | 3300049580 | Bacteria | 3382 |
| 1042 | Ga0501046_0072996 | 3300049580 | Bacteria | 2663 |
| 1043 | Ga0501046_0084232 | 3300049580 | Bacteria | 2452 |
| 1044 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 1045 | Ga0501047_0000434 | 3300049581 | Bacteria | 46522 |
| 1046 | Ga0501047_0007147 | 3300049581 | Bacteria | 10488 |
| 1047 | Ga0501047_0048439 | 3300049581 | Bacteria | 4103 |
| 1048 | Ga0501047_0050922 | 3300049581 | Bacteria | 3999 |
| 1049 | Ga0501047_0085492 | 3300049581 | Bacteria | 3031 |
| 1050 | Ga0501047_0102401 | 3300049581 | Bacteria | 2743 |
| 1051 | Ga0501047_0226226 | 3300049581 | Bacteria | 1725 |
| 1052 | Ga0501048_0000290 | 3300049582 | Bacteria | 34170 |
| 1053 | Ga0501048_0001809 | 3300049582 | Bacteria | 16245 |
| 1054 | Ga0501048_0007260 | 3300049582 | Bacteria | 8404 |
| 1055 | Ga0501048_0032399 | 3300049582 | Bacteria | 3777 |
| 1056 | Ga0501048_0106814 | 3300049582 | Bacteria | 1976 |
| 1057 | Ga0501067_0000067 | 3300049583 | Bacteria | 59367 |
| 1058 | Ga0501067_0000477 | 3300049583 | Bacteria | 21826 |
| 1059 | Ga0501067_0028186 | 3300049583 | Bacteria | 3111 |
| 1060 | Ga0501068_0000742 | 3300049584 | Bacteria | 16718 |
| 1061 | Ga0501068_0001335 | 3300049584 | Bacteria | 13079 |
| 1062 | Ga0501068_0018982 | 3300049584 | Bacteria | 3985 |
| 1063 | Ga0501068_0023768 | 3300049584 | Bacteria | 3594 |
| 1064 | Ga0501069_0004553 | 3300049585 | Bacteria | 7165 |
| 1065 | Ga0501069_0022381 | 3300049585 | Bacteria | 3438 |
| 1066 | Ga0501069_0090686 | 3300049585 | Bacteria | 1728 |
| 1067 | Ga0501069_0172576 | 3300049585 | Bacteria | 1248 |
| 1068 | Ga0501070_0002965 | 3300049586 | Bacteria | 14789 |
| 1069 | Ga0501070_0068121 | 3300049586 | Bacteria | 2946 |
| 1070 | Ga0501070_0082127 | 3300049586 | Bacteria | 2667 |
| 1071 | Ga0501070_0106575 | 3300049586 | Bacteria | 2316 |
| 1072 | Ga0501071_0037987 | 3300049587 | Bacteria | 3440 |
| 1073 | Ga0501071_0131572 | 3300049587 | Bacteria | 1859 |
| 1074 | Ga0501072_0000515 | 3300049588 | Bacteria | 27822 |
| 1075 | Ga0501072_0002718 | 3300049588 | Bacteria | 13281 |
| 1076 | Ga0501072_0032950 | 3300049588 | Bacteria | 4058 |
| 1077 | Ga0501072_0115580 | 3300049588 | Bacteria | 2136 |
| 1078 | Ga0501073_0000144 | 3300049589 | Bacteria | 47087 |
| 1079 | Ga0501073_0032555 | 3300049589 | Bacteria | 3717 |
| 1080 | Ga0501073_0038197 | 3300049589 | Bacteria | 3407 |
| 1081 | Ga0501073_0090037 | 3300049589 | Bacteria | 2133 |
| 1082 | Ga0501074_0000675 | 3300049590 | Bacteria | 21305 |
| 1083 | Ga0501074_0001696 | 3300049590 | Bacteria | 15006 |
| 1084 | Ga0501074_0013775 | 3300049590 | Bacteria | 5881 |
| 1085 | Ga0501074_0016400 | 3300049590 | Bacteria | 5380 |
| 1086 | Ga0501074_0025795 | 3300049590 | Bacteria | 4264 |
| 1087 | Ga0501075_0028447 | 3300049591 | Bacteria | 4126 |
| 1088 | Ga0501076_0056868 | 3300049592 | Bacteria | 3105 |
| 1089 | Ga0501079_0007639 | 3300049741 | Bacteria | 8189 |
| 1090 | Ga0501079_0013242 | 3300049741 | Bacteria | 6289 |
| 1091 | Ga0501079_0127854 | 3300049741 | Bacteria | 1977 |
| 1092 | Ga0501079_0150611 | 3300049741 | Bacteria | 1813 |
| 1093 | Ga0501079_0266487 | 3300049741 | Bacteria | 1339 |
| 1094 | Ga0501080_0001018 | 3300049742 | Bacteria | 23056 |
| 1095 | Ga0501080_0005763 | 3300049742 | Bacteria | 11078 |
| 1096 | Ga0501080_0031077 | 3300049742 | Bacteria | 4976 |
| 1097 | Ga0501080_0032014 | 3300049742 | Bacteria | 4902 |
| 1098 | Ga0501080_0054631 | 3300049742 | Bacteria | 3719 |
| 1099 | Ga0501080_0107099 | 3300049742 | Bacteria | 2591 |
| 1100 | Ga0501080_0116972 | 3300049742 | Bacteria | 2471 |
| 1101 | Ga0501080_0273644 | 3300049742 | Bacteria | 1536 |
| 1102 | Ga0501081_0071478 | 3300049743 | Bacteria | 2419 |
| 1103 | Ga0501081_0077444 | 3300049743 | Bacteria | 2324 |
| 1104 | Ga0501083_0000192 | 3300049744 | Bacteria | 39270 |
| 1105 | Ga0501083_0000756 | 3300049744 | Bacteria | 21111 |
| 1106 | Ga0501083_0000803 | 3300049744 | Bacteria | 20575 |
| 1107 | Ga0501083_0006485 | 3300049744 | Bacteria | 8301 |
| 1108 | Ga0501083_0125118 | 3300049744 | Bacteria | 1685 |
| 1109 | Ga0501083_0138277 | 3300049744 | Bacteria | 1595 |
| 1110 | Ga0501035_0000323 | 3300049822 | Bacteria | 55329 |
| 1111 | Ga0501035_0002209 | 3300049822 | Bacteria | 19332 |
| 1112 | Ga0501035_0021197 | 3300049822 | Bacteria | 5973 |
| 1113 | Ga0501035_0028072 | 3300049822 | Bacteria | 5139 |
| 1114 | Ga0501035_0072007 | 3300049822 | Bacteria | 3059 |
| 1115 | Ga0501044_0000181 | 3300049823 | Bacteria | 78075 |
| 1116 | Ga0501044_0004415 | 3300049823 | Bacteria | 15735 |
| 1117 | Ga0501044_0037155 | 3300049823 | Bacteria | 5091 |
| 1118 | Ga0501044_0054245 | 3300049823 | Bacteria | 4122 |
| 1119 | Ga0501044_0083608 | 3300049823 | Bacteria | 3228 |
| 1120 | Ga0501044_0104855 | 3300049823 | Bacteria | 2840 |
| 1121 | Ga0501044_0119143 | 3300049823 | Bacteria | 2642 |
| 1122 | Ga0501044_0119891 | 3300049823 | Bacteria | 2632 |
| 1123 | Ga0501044_0162321 | 3300049823 | Bacteria | 2210 |
| 1124 | Ga0501044_0193463 | 3300049823 | Bacteria | 1995 |
| 1125 | Ga0501044_0237831 | 3300049823 | Bacteria | 1766 |
| 1126 | Ga0501044_0288826 | 3300049823 | Bacteria | 1572 |
| 1127 | Ga0501044_0310631 | 3300049823 | Bacteria | 1503 |
| 1128 | Ga0501045_0006122 | 3300049824 | Bacteria | 8335 |
| 1129 | Ga0501045_0110078 | 3300049824 | Bacteria | 2042 |
| 1130 | nmdc:mga03n38_894_c1 | 3300050490 | Bacteria | 8014 |
| 1131 | nmdc:mga00v17_12176_c1 | 3300050491 | Bacteria | 3610 |
| 1132 | nmdc:mga0yw44_103754_c1 | 3300050492 | Bacteria | 1814 |
| 1133 | nmdc:mga0yw44_24388_c1 | 3300050492 | Bacteria | 3422 |
| 1134 | nmdc:mga0k408_2338_c1 | 3300050493 | Bacteria | 10087 |
| 1135 | nmdc:mga0k408_8984_c1 | 3300050493 | Bacteria | 5376 |
| 1136 | nmdc:mga06z11_43306_c1 | 3300050494 | Bacteria | 2264 |
| 1137 | nmdc:mga06z11_46170_c1 | 3300050494 | Bacteria | 2206 |
| 1138 | nmdc:mga04h51_22683_c1 | 3300050495 | Bacteria | 1902 |
| 1139 | nmdc:mga07m45_20249_c1 | 3300050496 | Bacteria | 3613 |
| 1140 | nmdc:mga07m45_28805_c1 | 3300050496 | Bacteria | 2417 |
| 1141 | nmdc:mga07m45_49122_c2 | 3300050496 | Bacteria | 1901 |
| 1142 | nmdc:mga05p37_8896_c1 | 3300050507 | Bacteria | 11865 |
| 1143 | nmdc:mga06r32_135973_c1 | 3300050510 | Bacteria | 2432 |
| 1144 | nmdc:mga08y16_29004_c1 | 3300050511 | Bacteria | 5833 |
| 1145 | nmdc:mga08y16_315278_c1 | 3300050511 | Bacteria | 1610 |
| 1146 | nmdc:mga08y16_61354_c1 | 3300050511 | Bacteria | 3926 |
| 1147 | nmdc:mga0n895_173857_c1 | 3300050512 | Bacteria | 2185 |
| 1148 | nmdc:mga0n895_59753_c1 | 3300050512 | Bacteria | 3761 |
| 1149 | nmdc:mga08x19_129_c1 | 3300050514 | Bacteria | 66982 |
| 1150 | nmdc:mga08x19_193038_c1 | 3300050514 | Bacteria | 1394 |
| 1151 | nmdc:mga08x19_4_c2 | 3300050514 | Bacteria | 202063 |
| 1152 | nmdc:mga08x19_67627_c1 | 3300050514 | Bacteria | 2324 |
| 1153 | Ga0495601_0048214 | 3300053077 | Bacteria | 2683 |
| 1154 | Ga0495601_0065747 | 3300053077 | Bacteria | 2308 |
| 1155 | Ga0495601_0067781 | 3300053077 | Bacteria | 2273 |
| 1156 | Ga0495601_0095205 | 3300053077 | Bacteria | 1920 |
| 1157 | Ga0495595_0000218 | 3300053084 | Bacteria | 23092 |
| 1158 | Ga0495595_0015072 | 3300053084 | Bacteria | 3291 |
| 1159 | Ga0495619_0000111 | 3300053085 | Bacteria | 61304 |
| 1160 | Ga0495619_0003381 | 3300053085 | Bacteria | 10311 |
| 1161 | Ga0495619_0043944 | 3300053085 | Bacteria | 2931 |
| 1162 | Ga0495619_0045960 | 3300053085 | Bacteria | 2870 |
| 1163 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 1164 | Ga0500651_0001257 | 3300053093 | Bacteria | 12627 |
| 1165 | Ga0500651_0061510 | 3300053093 | Bacteria | 2345 |
| 1166 | Ga0500566_0000028 | 3300053094 | Bacteria | 75589 |
| 1167 | Ga0500566_0000249 | 3300053094 | Bacteria | 28873 |
| 1168 | Ga0500566_0001671 | 3300053094 | Bacteria | 13028 |
| 1169 | Ga0500566_0006790 | 3300053094 | Bacteria | 6779 |
| 1170 | Ga0500641_0010046 | 3300053096 | Bacteria | 3412 |
| 1171 | Ga0500555_003873 | 3300053103 | Bacteria | 4258 |
| 1172 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 1173 | Ga0500556_0000071 | 3300053104 | Bacteria | 100768 |
| 1174 | Ga0500557_000110 | 3300053105 | Bacteria | 23691 |
| 1175 | Ga0500572_000420 | 3300053111 | Bacteria | 14884 |
| 1176 | Ga0500572_001411 | 3300053111 | Bacteria | 6595 |
| 1177 | Ga0500592_002327 | 3300053116 | Bacteria | 3064 |
| 1178 | Ga0500593_019912 | 3300053117 | Bacteria | 2937 |
| 1179 | Ga0500595_000590 | 3300053119 | Bacteria | 21658 |
| 1180 | Ga0500595_004506 | 3300053119 | Bacteria | 6233 |
| 1181 | Ga0500607_039728 | 3300053121 | Bacteria | 2553 |
| 1182 | Ga0500608_008414 | 3300053122 | Bacteria | 4334 |
| 1183 | Ga0500608_040527 | 3300053122 | Bacteria | 2233 |
| 1184 | Ga0500608_097487 | 3300053122 | Bacteria | 1366 |
| 1185 | Ga0500618_009095 | 3300053125 | Bacteria | 2731 |
| 1186 | Ga0500642_0000036 | 3300053130 | Bacteria | 104249 |
| 1187 | Ga0500642_0000086 | 3300053130 | Bacteria | 48427 |
| 1188 | Ga0500642_0085036 | 3300053130 | Bacteria | 1457 |
| 1189 | Ga0500652_000837 | 3300053131 | Bacteria | 10198 |
| 1190 | Ga0500559_0000154 | 3300053136 | Bacteria | 54106 |
| 1191 | Ga0500559_0003041 | 3300053136 | Bacteria | 8382 |
| 1192 | Ga0500559_0004402 | 3300053136 | Bacteria | 6694 |
| 1193 | Ga0500568_0000599 | 3300053139 | Bacteria | 26179 |
| 1194 | Ga0500568_0003668 | 3300053139 | Bacteria | 8441 |
| 1195 | Ga0500568_0008132 | 3300053139 | Bacteria | 5085 |
| 1196 | Ga0500577_0000074 | 3300053142 | Bacteria | 23109 |
| 1197 | Ga0500577_0069081 | 3300053142 | Bacteria | 1381 |
| 1198 | Ga0500586_003626 | 3300053145 | Bacteria | 3677 |
| 1199 | Ga0500590_057344 | 3300053148 | Bacteria | 1965 |
| 1200 | Ga0500590_069197 | 3300053148 | Bacteria | 1757 |
| 1201 | Ga0500603_001125 | 3300053150 | Bacteria | 6243 |
| 1202 | Ga0500604_0002371 | 3300053151 | Bacteria | 5152 |
| 1203 | Ga0500604_0021396 | 3300053151 | Bacteria | 1828 |
| 1204 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 1205 | Ga0500616_0000325 | 3300053153 | Bacteria | 68300 |
| 1206 | Ga0500616_0007667 | 3300053153 | Bacteria | 6817 |
| 1207 | Ga0500619_002452 | 3300053154 | Bacteria | 3573 |
| 1208 | Ga0500622_0003210 | 3300053156 | Bacteria | 11123 |
| 1209 | Ga0500622_0117062 | 3300053156 | Bacteria | 1296 |
| 1210 | Ga0500627_0019326 | 3300053158 | Bacteria | 2712 |
| 1211 | Ga0500627_0108383 | 3300053158 | Bacteria | 1249 |
| 1212 | Ga0500634_0031888 | 3300053161 | Bacteria | 2875 |
| 1213 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 1214 | Ga0500636_0000151 | 3300053177 | Bacteria | 35998 |
| 1215 | Ga0500636_0005425 | 3300053177 | Bacteria | 7278 |
| 1216 | Ga0500636_0024548 | 3300053177 | Bacteria | 3566 |
| 1217 | Ga0500637_0000751 | 3300053178 | Bacteria | 13000 |
| 1218 | Ga0500637_0111130 | 3300053178 | Bacteria | 1589 |
| 1219 | Ga0500601_000098 | 3300053737 | Bacteria | 18298 |
| 1220 | Ga0501084_0007759 | 3300054114 | Bacteria | 8834 |
| 1221 | Ga0501084_0044564 | 3300054114 | Bacteria | 3714 |
| 1222 | Ga0501084_0068379 | 3300054114 | Bacteria | 2973 |
| 1223 | Ga0501084_0092897 | 3300054114 | Bacteria | 2533 |
| 1224 | Ga0501084_0219092 | 3300054114 | Bacteria | 1606 |
| 1225 | Ga0501082_0000025 | 3300060353 | Bacteria | 103262 |
| 1226 | Ga0501082_0010489 | 3300060353 | Bacteria | 7972 |
| 1227 | Ga0501082_0041736 | 3300060353 | Bacteria | 3956 |
| 1228 | Ga0501082_0058195 | 3300060353 | Bacteria | 3330 |
| 1229 | Ga0501082_0263232 | 3300060353 | Bacteria | 1500 |
| 1230 | Ga0466962_0094305 | 3300061719 | Bacteria | 1435 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0274822 | Ga0496126_0274822_131_1183 | 304 |
| 2 | 3300002239 | JGI24034J26672_10008216 | JGI24034J26672_100082161 | 314 |
| 3 | 3300002244 | JGI24742J22300_10013207 | JGI24742J22300_100132071 | 314 |
| 4 | 3300005343 | Ga0070687_100007913 | Ga0070687_1000079134 | 314 |
| 5 | 3300005344 | Ga0070661_100077160 | Ga0070661_1000771602 | 314 |
| 6 | 3300005345 | Ga0070692_10075515 | Ga0070692_100755152 | 314 |
| 7 | 3300005365 | Ga0070688_100036593 | Ga0070688_1000365931 | 314 |
| 8 | 3300005535 | Ga0070684_100261749 | Ga0070684_1002617492 | 314 |
| 9 | 3300005544 | Ga0070686_100010855 | Ga0070686_1000108554 | 314 |
| 10 | 3300005616 | Ga0068852_100022868 | Ga0068852_1000228682 | 314 |
| 11 | 3300005618 | Ga0068864_100014660 | Ga0068864_1000146602 | 314 |
| 12 | 3300005842 | Ga0068858_100015026 | Ga0068858_1000150263 | 314 |
| 13 | 3300005843 | Ga0068860_100410163 | Ga0068860_1004101632 | 314 |
| 14 | 3300014968 | Ga0157379_10039891 | Ga0157379_100398912 | 314 |
| 15 | iso_pu_bacteria | 2876808645 | 2876809366 | 314 |
| 16 | 3300005328 | Ga0070676_10044352 | Ga0070676_100443522 | 315 |
| 17 | 3300005338 | Ga0068868_100185877 | Ga0068868_1001858772 | 315 |
| 18 | 3300005341 | Ga0070691_10017160 | Ga0070691_100171602 | 315 |
| 19 | 3300005353 | Ga0070669_100134032 | Ga0070669_1001340322 | 315 |
| 20 | 3300005356 | Ga0070674_100084723 | Ga0070674_1000847231 | 315 |
| 21 | 3300005366 | Ga0070659_100247264 | Ga0070659_1002472641 | 315 |
| 22 | 3300005545 | Ga0070695_100051997 | Ga0070695_1000519972 | 315 |
| 23 | 3300006042 | Ga0075368_10050755 | Ga0075368_100507552 | 315 |
| 24 | 3300014969 | Ga0157376_10011610 | Ga0157376_100116102 | 315 |
| 25 | 3300025907 | Ga0207645_10013748 | Ga0207645_100137483 | 315 |
| 26 | 3300025932 | Ga0207690_10061838 | Ga0207690_100618382 | 315 |
| 27 | 3300025940 | Ga0207691_10070174 | Ga0207691_100701742 | 315 |
| 28 | 3300025941 | Ga0207711_10040269 | Ga0207711_100402693 | 315 |
| 29 | 3300026023 | Ga0207677_10048420 | Ga0207677_100484202 | 315 |
| 30 | 3300028379 | Ga0268266_10191132 | Ga0268266_101911322 | 315 |
| 31 | 3300028380 | Ga0268265_10351527 | Ga0268265_103515271 | 315 |
| 32 | 3300039062 | Ga0400483_139806 | Ga0400483_139806_20180_21145 | 315 |
| 33 | 3300039062 | Ga0400483_175766 | Ga0400483_175766_2086_3051 | 315 |
| 34 | 3300039062 | Ga0400483_205987 | Ga0400483_205987_2206_3171 | 315 |
| 35 | 3300046660 | Ga0495625_0211726 | Ga0495625_0211726_237_1205 | 315 |
| 36 | 3300048905 | Ga0496102_0028901 | Ga0496102_0028901_212_1180 | 315 |
| 37 | 3300048912 | Ga0496109_0351915 | Ga0496109_0351915_168_1136 | 315 |
| 38 | 3300048918 | Ga0496115_0040376 | Ga0496115_0040376_2492_3460 | 315 |
| 39 | 3300049569 | Ga0501032_0011988 | Ga0501032_0011988_5144_6112 | 315 |
| 40 | 3300049571 | Ga0501034_0231765 | Ga0501034_0231765_758_1726 | 315 |
| 41 | 3300049572 | Ga0501036_0014141 | Ga0501036_0014141_2960_3928 | 315 |
| 42 | 3300049574 | Ga0501038_0025032 | Ga0501038_0025032_3764_4732 | 315 |
| 43 | 3300049579 | Ga0501043_0014386 | Ga0501043_0014386_4746_5714 | 315 |
| 44 | 3300049582 | Ga0501048_0106814 | Ga0501048_0106814_915_1883 | 315 |
| 45 | 3300049822 | Ga0501035_0021197 | Ga0501035_0021197_832_1800 | 315 |
| 46 | 3300050494 | nmdc:mga06z11_46170_c1 | nmdc:mga06z11_46170_c1_379_1347 | 315 |
| 47 | 3300050511 | nmdc:mga08y16_315278_c1 | nmdc:mga08y16_315278_c1_378_1346 | 315 |
| 48 | 3300053177 | Ga0500636_0024548 | Ga0500636_0024548_1123_2091 | 315 |
| 49 | iso_pu_bacteria | 2842333319 | 2842334661 | 315 |
| 50 | 3300005843 | Ga0068860_100372443 | Ga0068860_1003724432 | 316 |
| 51 | 3300028379 | Ga0268266_10008371 | Ga0268266_100083714 | 316 |
| 52 | 3300031247 | Ga0265340_10015221 | Ga0265340_100152212 | 316 |
| 53 | 3300031249 | Ga0265339_10002292 | Ga0265339_100022927 | 316 |
| 54 | 3300031250 | Ga0265331_10058559 | Ga0265331_100585592 | 316 |
| 55 | 3300031507 | Ga0307509_10048183 | Ga0307509_100481834 | 316 |
| 56 | 3300031712 | Ga0265342_10000110 | Ga0265342_1000011053 | 316 |
| 57 | 3300031730 | Ga0307516_10302458 | Ga0307516_103024582 | 316 |
| 58 | 3300037418 | Ga0395900_0554187 | Ga0395900_0554187_14_964 | 316 |
| 59 | 3300046460 | Ga0495638_0068357 | Ga0495638_0068357_109_1077 | 316 |
| 60 | 3300046519 | Ga0495632_0008927 | Ga0495632_0008927_4069_5037 | 316 |
| 61 | 3300046557 | Ga0495622_0017143 | Ga0495622_0017143_91_1059 | 316 |
| 62 | 3300046616 | Ga0495668_0060757 | Ga0495668_0060757_15_983 | 316 |
| 63 | 3300046660 | Ga0495625_0147310 | Ga0495625_0147310_340_1308 | 316 |
| 64 | 3300046692 | Ga0495671_0024554 | Ga0495671_0024554_1625_2593 | 316 |
| 65 | 3300048924 | Ga0496121_0256896 | Ga0496121_0256896_122_1090 | 316 |
| 66 | 3300049570 | Ga0501033_0195265 | Ga0501033_0195265_448_1416 | 316 |
| 67 | 3300049588 | Ga0501072_0115580 | Ga0501072_0115580_122_1090 | 316 |
| 68 | 3300053119 | Ga0500595_004506 | Ga0500595_004506_325_1293 | 316 |
| 69 | iso_pu_bacteria | 2897803580 | 2897804234 | 316 |
| 70 | 3300006195 | Ga0075366_10175615 | Ga0075366_101756152 | 317 |
| 71 | 3300031241 | Ga0265325_10082418 | Ga0265325_100824181 | 317 |
| 72 | 3300031247 | Ga0265340_10092226 | Ga0265340_100922262 | 317 |
| 73 | 3300031595 | Ga0265313_10016846 | Ga0265313_100168464 | 317 |
| 74 | 3300031712 | Ga0265342_10019680 | Ga0265342_100196804 | 317 |
| 75 | iso_pu_bacteria | 2534681786 | 2535484647 | 317 |
| 76 | iso_pu_bacteria | 2643221591 | 2643963306 | 317 |
| 77 | iso_pu_bacteria | 2751185800 | 2753359229 | 317 |
| 78 | iso_pu_bacteria | 2767802442 | 2770199435 | 317 |
| 79 | iso_pu_bacteria | 2840764183 | 2840767964 | 317 |
| 80 | iso_pu_bacteria | 2889790730 | 2889792134 | 317 |
| 81 | iso_pu_bacteria | 2889914905 | 2889917895 | 317 |
| 82 | iso_pu_bacteria | 2904578770 | 2904581611 | 317 |
| 83 | iso_pu_bacteria | 2919119836 | 2919122847 | 317 |
| 84 | iso_pu_bacteria | 8045864390 | 8045865250 | 317 |
| 85 | iso_pu_bacteria | 2508501128 | 2509150424 | 318 |
| 86 | iso_pu_bacteria | 2511231028 | 2511395516 | 318 |
| 87 | iso_pu_bacteria | 2513237092 | 2513623122 | 318 |
| 88 | iso_pu_bacteria | 2513237094 | 2513639053 | 318 |
| 89 | iso_pu_bacteria | 2513237095 | 2513645930 | 318 |
| 90 | iso_pu_bacteria | 2513237096 | 2513654657 | 318 |
| 91 | iso_pu_bacteria | 2513237098 | 2513673893 | 318 |
| 92 | iso_pu_bacteria | 2513237101 | 2513692441 | 318 |
| 93 | iso_pu_bacteria | 2513237102 | 2513700146 | 318 |
| 94 | iso_pu_bacteria | 2513237104 | 2513719535 | 318 |
| 95 | iso_pu_bacteria | 2513237137 | 2513855932 | 318 |
| 96 | iso_pu_bacteria | 2513237139 | 2513872686 | 318 |
| 97 | iso_pu_bacteria | 2513237141 | 2513889046 | 318 |
| 98 | iso_pu_bacteria | 2513237145 | 2513915163 | 318 |
| 99 | iso_pu_bacteria | 2513237161 | 2514011936 | 318 |
| 100 | iso_pu_bacteria | 2515154112 | 2515628278 | 318 |
| 101 | iso_pu_bacteria | 2517093001 | 2517101316 | 318 |
| 102 | iso_pu_bacteria | 2524023205 | 2524440485 | 318 |
| 103 | iso_pu_bacteria | 2524023210 | 2524469599 | 318 |
| 104 | iso_pu_bacteria | 2524023228 | 2524541159 | 318 |
| 105 | iso_pu_bacteria | 2528768022 | 2528851180 | 318 |
| 106 | iso_pu_bacteria | 2617270735 | 2617348932 | 318 |
| 107 | iso_pu_bacteria | 2617270741 | 2617375850 | 318 |
| 108 | iso_pu_bacteria | 2643221651 | 2644288678 | 318 |
| 109 | iso_pu_bacteria | 2667528175 | 2671122432 | 318 |
| 110 | iso_pu_bacteria | 2721755755 | 2723845177 | 318 |
| 111 | iso_pu_bacteria | 2728368998 | 2728751503 | 318 |
| 112 | iso_pu_bacteria | 2744054633 | 2745075246 | 318 |
| 113 | iso_pu_bacteria | 2791355196 | 2793062482 | 318 |
| 114 | iso_pu_bacteria | 2791355197 | 2793072059 | 318 |
| 115 | iso_pu_bacteria | 2791355199 | 2793080901 | 318 |
| 116 | iso_pu_bacteria | 2802429603 | 2805915416 | 318 |
| 117 | iso_pu_bacteria | 2816332527 | 2818238999 | 318 |
| 118 | iso_pu_bacteria | 2824600985 | 2824603486 | 318 |
| 119 | iso_pu_bacteria | 2824609381 | 2824617603 | 318 |
| 120 | iso_pu_bacteria | 2824617872 | 2824625709 | 318 |
| 121 | iso_pu_bacteria | 2824626560 | 2824634518 | 318 |
| 122 | iso_pu_bacteria | 2824635225 | 2824642034 | 318 |
| 123 | iso_pu_bacteria | 2824644064 | 2824650363 | 318 |
| 124 | iso_pu_bacteria | 2824653114 | 2824654728 | 318 |
| 125 | iso_pu_bacteria | 2824661429 | 2824667459 | 318 |
| 126 | iso_pu_bacteria | 2824671348 | 2824675822 | 318 |
| 127 | iso_pu_bacteria | 2824679649 | 2824686549 | 318 |
| 128 | iso_pu_bacteria | 2824687955 | 2824693110 | 318 |
| 129 | iso_pu_bacteria | 2824696289 | 2824701722 | 318 |
| 130 | iso_pu_bacteria | 2824704595 | 2824711901 | 318 |
| 131 | iso_pu_bacteria | 2824714736 | 2824720231 | 318 |
| 132 | iso_pu_bacteria | 2824723954 | 2824730582 | 318 |
| 133 | iso_pu_bacteria | 2824732956 | 2824739271 | 318 |
| 134 | iso_pu_bacteria | 2824746037 | 2824751594 | 318 |
| 135 | iso_pu_bacteria | 2824753945 | 2824762671 | 318 |
| 136 | iso_pu_bacteria | 2824763712 | 2824772767 | 318 |
| 137 | iso_pu_bacteria | 2824773399 | 2824777670 | 318 |
| 138 | iso_pu_bacteria | 2838122688 | 2838123837 | 318 |
| 139 | iso_pu_bacteria | 2841941048 | 2841944034 | 318 |
| 140 | iso_pu_bacteria | 2841949485 | 2841949937 | 318 |
| 141 | iso_pu_bacteria | 2841957949 | 2841958584 | 318 |
| 142 | iso_pu_bacteria | 2841966195 | 2841966355 | 318 |
| 143 | iso_pu_bacteria | 2841974524 | 2841975089 | 318 |
| 144 | iso_pu_bacteria | 2841983080 | 2841983339 | 318 |
| 145 | iso_pu_bacteria | 2842038055 | 2842039150 | 318 |
| 146 | iso_pu_bacteria | 2842045827 | 2842047903 | 318 |
| 147 | iso_pu_bacteria | 2844315083 | 2844319004 | 318 |
| 148 | iso_pu_bacteria | 2847930680 | 2847936129 | 318 |
| 149 | iso_pu_bacteria | 2847939898 | 2847946480 | 318 |
| 150 | iso_pu_bacteria | 2849076700 | 2849079399 | 318 |
| 151 | iso_pu_bacteria | 2857509624 | 2857514396 | 318 |
| 152 | iso_pu_bacteria | 2857524615 | 2857529218 | 318 |
| 153 | iso_pu_bacteria | 2874590934 | 2874593406 | 318 |
| 154 | iso_pu_bacteria | 2874604998 | 2874605109 | 318 |
| 155 | iso_pu_bacteria | 2874612657 | 2874615223 | 318 |
| 156 | iso_pu_bacteria | 2874620515 | 2874627184 | 318 |
| 157 | iso_pu_bacteria | 2874628541 | 2874631760 | 318 |
| 158 | iso_pu_bacteria | 2874645413 | 2874648961 | 318 |
| 159 | iso_pu_bacteria | 2876761206 | 2876767044 | 318 |
| 160 | iso_pu_bacteria | 2876771140 | 2876771988 | 318 |
| 161 | iso_pu_bacteria | 2876818435 | 2876822067 | 318 |
| 162 | iso_pu_bacteria | 2879074833 | 2879075580 | 318 |
| 163 | iso_pu_bacteria | 2879083081 | 2879090106 | 318 |
| 164 | iso_pu_bacteria | 2879099564 | 2879103274 | 318 |
| 165 | iso_pu_bacteria | 2879110137 | 2879113611 | 318 |
| 166 | iso_pu_bacteria | 2879127579 | 2879130010 | 318 |
| 167 | iso_pu_bacteria | 2879142872 | 2879147073 | 318 |
| 168 | iso_pu_bacteria | 2881364244 | 2881367022 | 318 |
| 169 | iso_pu_bacteria | 2881665667 | 2881671092 | 318 |
| 170 | iso_pu_bacteria | 2885366525 | 2885370553 | 318 |
| 171 | iso_pu_bacteria | 2885374607 | 2885376468 | 318 |
| 172 | iso_pu_bacteria | 2885383462 | 2885390587 | 318 |
| 173 | iso_pu_bacteria | 2885409591 | 2885412139 | 318 |
| 174 | iso_pu_bacteria | 2888378607 | 2888383974 | 318 |
| 175 | iso_pu_bacteria | 2888388044 | 2888393882 | 318 |
| 176 | iso_pu_bacteria | 2888419890 | 2888424385 | 318 |
| 177 | iso_pu_bacteria | 2889033259 | 2889039927 | 318 |
| 178 | iso_pu_bacteria | 2893066018 | 2893071332 | 318 |
| 179 | iso_pu_bacteria | 2903727486 | 2903729071 | 318 |
| 180 | iso_pu_bacteria | 2903748898 | 2903751732 | 318 |
| 181 | iso_pu_bacteria | 2903768456 | 2903773893 | 318 |
| 182 | iso_pu_bacteria | 2904666416 | 2904671297 | 318 |
| 183 | iso_pu_bacteria | 2904690495 | 2904698390 | 318 |
| 184 | iso_pu_bacteria | 2904699407 | 2904703356 | 318 |
| 185 | iso_pu_bacteria | 2904711408 | 2904714528 | 318 |
| 186 | iso_pu_bacteria | 2906602504 | 2906610117 | 318 |
| 187 | iso_pu_bacteria | 2906610324 | 2906618554 | 318 |
| 188 | iso_pu_bacteria | 2906626472 | 2906628585 | 318 |
| 189 | iso_pu_bacteria | 2906635258 | 2906635547 | 318 |
| 190 | iso_pu_bacteria | 2906643746 | 2906651182 | 318 |
| 191 | iso_pu_bacteria | 2906660503 | 2906666446 | 318 |
| 192 | iso_pu_bacteria | 2908739725 | 2908742766 | 318 |
| 193 | iso_pu_bacteria | 2908756301 | 2908761050 | 318 |
| 194 | iso_pu_bacteria | 2908775508 | 2908780093 | 318 |
| 195 | iso_pu_bacteria | 2919073203 | 2919076726 | 318 |
| 196 | iso_pu_bacteria | 2922361189 | 2922365273 | 318 |
| 197 | iso_pu_bacteria | 2922368715 | 2922374298 | 318 |
| 198 | iso_pu_bacteria | 2922393267 | 2922396392 | 318 |
| 199 | iso_pu_bacteria | 2922425934 | 2922430211 | 318 |
| 200 | iso_pu_bacteria | 2929615660 | 2929617972 | 318 |
| 201 | iso_pu_bacteria | 2929624759 | 2929627653 | 318 |
| 202 | iso_pu_bacteria | 2932784394 | 2932788245 | 318 |
| 203 | iso_pu_bacteria | 2932794094 | 2932797559 | 318 |
| 204 | iso_pu_bacteria | 2932801729 | 2932802875 | 318 |
| 205 | iso_pu_bacteria | 2932809354 | 2932810605 | 318 |
| 206 | iso_pu_bacteria | 2932818245 | 2932821249 | 318 |
| 207 | iso_pu_bacteria | 2932828146 | 2932831242 | 318 |
| 208 | iso_pu_bacteria | 2933577622 | 2933579901 | 318 |
| 209 | iso_pu_bacteria | 2935608549 | 2935608800 | 318 |
| 210 | iso_pu_bacteria | 2935616580 | 2935622962 | 318 |
| 211 | iso_pu_bacteria | 2935630451 | 2935631727 | 318 |
| 212 | iso_pu_bacteria | 2935638405 | 2935642322 | 318 |
| 213 | iso_pu_bacteria | 2935648319 | 2935649955 | 318 |
| 214 | iso_pu_bacteria | 2935656913 | 2935661893 | 318 |
| 215 | iso_pu_bacteria | 2935665750 | 2935668375 | 318 |
| 216 | iso_pu_bacteria | 2935675223 | 2935680508 | 318 |
| 217 | iso_pu_bacteria | 2935684952 | 2935692822 | 318 |
| 218 | iso_pu_bacteria | 2935694250 | 2935700991 | 318 |
| 219 | iso_pu_bacteria | 2935703347 | 2935706230 | 318 |
| 220 | iso_pu_bacteria | 2935713505 | 2935721453 | 318 |
| 221 | iso_pu_bacteria | 2935722832 | 2935730371 | 318 |
| 222 | iso_pu_bacteria | 2935732158 | 2935740384 | 318 |
| 223 | iso_pu_bacteria | 2935741537 | 2935749648 | 318 |
| 224 | iso_pu_bacteria | 2935750917 | 2935759039 | 318 |
| 225 | iso_pu_bacteria | 2935760218 | 2935762631 | 318 |
| 226 | iso_pu_bacteria | 2935769743 | 2935773212 | 318 |
| 227 | iso_pu_bacteria | 2935777560 | 2935778457 | 318 |
| 228 | iso_pu_bacteria | 2935785616 | 2935790423 | 318 |
| 229 | iso_pu_bacteria | 2935793552 | 2935798152 | 318 |
| 230 | iso_pu_bacteria | 2935801545 | 2935803230 | 318 |
| 231 | iso_pu_bacteria | 2935810662 | 2935814550 | 318 |
| 232 | iso_pu_bacteria | 2935819856 | 2935821960 | 318 |
| 233 | iso_pu_bacteria | 2935827899 | 2935831688 | 318 |
| 234 | iso_pu_bacteria | 2935837841 | 2935838556 | 318 |
| 235 | iso_pu_bacteria | 2935847175 | 2935847542 | 318 |
| 236 | iso_pu_bacteria | 2935855204 | 2935861210 | 318 |
| 237 | iso_pu_bacteria | 2935864058 | 2935865748 | 318 |
| 238 | iso_pu_bacteria | 2935873716 | 2935878249 | 318 |
| 239 | iso_pu_bacteria | 2935883170 | 2935885216 | 318 |
| 240 | iso_pu_bacteria | 2935908558 | 2935909191 | 318 |
| 241 | iso_pu_bacteria | 2935916978 | 2935919912 | 318 |
| 242 | iso_pu_bacteria | 2935926038 | 2935926235 | 318 |
| 243 | iso_pu_bacteria | 2935934488 | 2935934685 | 318 |
| 244 | iso_pu_bacteria | 2935942939 | 2935943135 | 318 |
| 245 | iso_pu_bacteria | 2935951376 | 2935951573 | 318 |
| 246 | iso_pu_bacteria | 2935959822 | 2935966401 | 318 |
| 247 | iso_pu_bacteria | 2935967501 | 2935967698 | 318 |
| 248 | iso_pu_bacteria | 2935975950 | 2935977102 | 318 |
| 249 | iso_pu_bacteria | 2935984226 | 2935988261 | 318 |
| 250 | iso_pu_bacteria | 2935992306 | 2935994562 | 318 |
| 251 | iso_pu_bacteria | 2936002035 | 2936007638 | 318 |
| 252 | iso_pu_bacteria | 2936011229 | 2936012562 | 318 |
| 253 | iso_pu_bacteria | 2936019824 | 2936021126 | 318 |
| 254 | iso_pu_bacteria | 2936028420 | 2936029855 | 318 |
| 255 | iso_pu_bacteria | 2936037263 | 2936040107 | 318 |
| 256 | iso_pu_bacteria | 2936046547 | 2936047320 | 318 |
| 257 | iso_pu_bacteria | 2936055302 | 2936057522 | 318 |
| 258 | iso_pu_bacteria | 2940556831 | 2940564956 | 318 |
| 259 | iso_pu_bacteria | 2941507105 | 2941511521 | 318 |
| 260 | iso_pu_bacteria | 2941515067 | 2941519222 | 318 |
| 261 | iso_pu_bacteria | 2941523033 | 2941526198 | 318 |
| 262 | iso_pu_bacteria | 2941531003 | 2941532673 | 318 |
| 263 | iso_pu_bacteria | 2941538514 | 2941538776 | 318 |
| 264 | iso_pu_bacteria | 3005474847 | 3005480145 | 318 |
| 265 | iso_pu_bacteria | 3005483717 | 3005487261 | 318 |
| 266 | iso_pu_bacteria | 3005506211 | 3005510253 | 318 |
| 267 | iso_pu_bacteria | 3005587118 | 3005591050 | 318 |
| 268 | iso_pu_bacteria | 3005594810 | 3005599150 | 318 |
| 269 | iso_pu_bacteria | 3005710791 | 3005714815 | 318 |
| 270 | iso_pu_bacteria | 3005718088 | 3005722245 | 318 |
| 271 | iso_pu_bacteria | 8006926726 | 8006929977 | 318 |
| 272 | iso_pu_bacteria | 8006933436 | 8006940743 | 318 |
| 273 | iso_pu_bacteria | 8006973647 | 8006980433 | 318 |
| 274 | iso_pu_bacteria | 8006984368 | 8006987134 | 318 |
| 275 | iso_pu_bacteria | 8006994254 | 8006998817 | 318 |
| 276 | iso_pu_bacteria | 8016511872 | 8016522432 | 318 |
| 277 | iso_pu_bacteria | 8016522445 | 8016529698 | 318 |
| 278 | iso_pu_bacteria | 8016530956 | 8016534918 | 318 |
| 279 | iso_pu_bacteria | 8016548790 | 8016553997 | 318 |
| 280 | iso_pu_bacteria | 8016566248 | 8016573261 | 318 |
| 281 | iso_pu_bacteria | 8016575299 | 8016577403 | 318 |
| 282 | iso_pu_bacteria | 8016583857 | 8016591886 | 318 |
| 283 | iso_pu_bacteria | 8016595262 | 8016600174 | 318 |
| 284 | iso_pu_bacteria | 8016603502 | 8016610577 | 318 |
| 285 | iso_pu_bacteria | 8016613128 | 8016614353 | 318 |
| 286 | iso_pu_bacteria | 8016622563 | 8016626632 | 318 |
| 287 | iso_pu_bacteria | 8016630954 | 8016640444 | 318 |
| 288 | iso_pu_bacteria | 8017057580 | 8017063131 | 318 |
| 289 | iso_pu_bacteria | 8019530166 | 8019534679 | 318 |
| 290 | iso_pu_bacteria | 8019538911 | 8019544794 | 318 |
| 291 | iso_pu_bacteria | 8019547302 | 8019553743 | 318 |
| 292 | iso_pu_bacteria | 8019555841 | 8019556826 | 318 |
| 293 | iso_pu_bacteria | 8019565922 | 8019568475 | 318 |
| 294 | iso_pu_bacteria | 8019586578 | 8019590354 | 318 |
| 295 | iso_pu_bacteria | 8019597564 | 8019600999 | 318 |
| 296 | iso_pu_bacteria | 8019619141 | 8019628045 | 318 |
| 297 | iso_pu_bacteria | 8019629233 | 8019634557 | 318 |
| 298 | iso_pu_bacteria | 8019648815 | 8019658302 | 318 |
| 299 | iso_pu_bacteria | 8019659431 | 8019662450 | 318 |
| 300 | iso_pu_bacteria | 8019668869 | 8019671948 | 318 |
| 301 | iso_pu_bacteria | 8019678201 | 8019684146 | 318 |
| 302 | iso_pu_bacteria | 8019687851 | 8019689983 | 318 |
| 303 | iso_pu_bacteria | 8055742211 | 8055746438 | 318 |
| 304 | iso_pu_bacteria | 8056673599 | 8056673952 | 318 |
| 305 | iso_pu_bacteria | 8056681323 | 8056686613 | 318 |
| 306 | iso_pu_bacteria | 8056689827 | 8056693601 | 318 |
| 307 | iso_pu_bacteria | 8056967851 | 8056967948 | 318 |
| 308 | 3300005367 | Ga0070667_100071018 | Ga0070667_1000710182 | 319 |
| 309 | 3300009148 | Ga0105243_10014895 | Ga0105243_100148955 | 319 |
| 310 | 3300025920 | Ga0207649_10033623 | Ga0207649_100336231 | 319 |
| 311 | 3300025986 | Ga0207658_10027891 | Ga0207658_100278912 | 319 |
| 312 | 3300032004 | Ga0307414_10098259 | Ga0307414_100982592 | 319 |
| 313 | 3300034819 | Ga0373958_0001587 | Ga0373958_0001587_1765_2793 | 319 |
| 314 | 3300034820 | Ga0373959_0010268 | Ga0373959_0010268_494_1522 | 319 |
| 315 | 3300035092 | Ga0373952_0003964 | Ga0373952_0003964_399_1427 | 319 |
| 316 | 3300035114 | Ga0373939_0016255 | Ga0373939_0016255_127_1155 | 319 |
| 317 | 3300049573 | Ga0501037_0121741 | Ga0501037_0121741_523_1482 | 319 |
| 318 | 3300049581 | Ga0501047_0050922 | Ga0501047_0050922_2148_3107 | 319 |
| 319 | 3300049742 | Ga0501080_0273644 | Ga0501080_0273644_322_1281 | 319 |
| 320 | 3300049744 | Ga0501083_0006485 | Ga0501083_0006485_1835_2794 | 319 |
| 321 | 3300050514 | nmdc:mga08x19_193038_c1 | nmdc:mga08x19_193038_c1_140_1168 | 319 |
| 322 | 3300003544 | Ga0007417J51691_1052383 | Ga0007417J51691_10523831 | 320 |
| 323 | 3300032004 | Ga0307414_10327816 | Ga0307414_103278162 | 320 |
| 324 | 3300048928 | Ga0496125_0000602 | Ga0496125_0000602_19139_20101 | 320 |
| 325 | 3300049575 | Ga0501039_0283717 | Ga0501039_0283717_75_1037 | 320 |
| 326 | 3300050491 | nmdc:mga00v17_12176_c1 | nmdc:mga00v17_12176_c1_2171_3133 | 320 |
| 327 | 3300050496 | nmdc:mga07m45_28805_c1 | nmdc:mga07m45_28805_c1_1392_2354 | 320 |
| 328 | 3300003771 | Ga0055526_1000091 | Ga0055526_100009128 | 321 |
| 329 | 3300005329 | Ga0070683_100134291 | Ga0070683_1001342913 | 321 |
| 330 | 3300005339 | Ga0070660_100006727 | Ga0070660_1000067276 | 321 |
| 331 | 3300005339 | Ga0070660_100084058 | Ga0070660_1000840581 | 321 |
| 332 | 3300005344 | Ga0070661_100022107 | Ga0070661_1000221073 | 321 |
| 333 | 3300005344 | Ga0070661_100022501 | Ga0070661_1000225012 | 321 |
| 334 | 3300005356 | Ga0070674_100047021 | Ga0070674_1000470212 | 321 |
| 335 | 3300005456 | Ga0070678_100040147 | Ga0070678_1000401473 | 321 |
| 336 | 3300005458 | Ga0070681_10013085 | Ga0070681_100130854 | 321 |
| 337 | 3300005459 | Ga0068867_100201855 | Ga0068867_1002018552 | 321 |
| 338 | 3300005563 | Ga0068855_100174019 | Ga0068855_1001740192 | 321 |
| 339 | 3300005564 | Ga0070664_100056179 | Ga0070664_1000561793 | 321 |
| 340 | 3300005578 | Ga0068854_100041156 | Ga0068854_1000411563 | 321 |
| 341 | 3300005614 | Ga0068856_100015680 | Ga0068856_1000156801 | 321 |
| 342 | 3300005616 | Ga0068852_100037474 | Ga0068852_1000374742 | 321 |
| 343 | 3300005618 | Ga0068864_100204427 | Ga0068864_1002044271 | 321 |
| 344 | 3300006881 | Ga0068865_100098159 | Ga0068865_1000981591 | 321 |
| 345 | 3300009551 | Ga0105238_10094937 | Ga0105238_100949372 | 321 |
| 346 | 3300011119 | Ga0105246_10409549 | Ga0105246_104095491 | 321 |
| 347 | 3300013102 | Ga0157371_10077493 | Ga0157371_100774932 | 321 |
| 348 | 3300013104 | Ga0157370_10027064 | Ga0157370_100270644 | 321 |
| 349 | 3300025253 | Ga0209677_100639 | Ga0209677_10063910 | 321 |
| 350 | 3300025261 | Ga0209233_1001736 | Ga0209233_10017364 | 321 |
| 351 | 3300025272 | Ga0209455_1001958 | Ga0209455_10019585 | 321 |
| 352 | 3300025295 | Ga0209564_1000017 | Ga0209564_1000017104 | 321 |
| 353 | 3300025907 | Ga0207645_10029619 | Ga0207645_100296192 | 321 |
| 354 | 3300025912 | Ga0207707_10021859 | Ga0207707_100218593 | 321 |
| 355 | 3300025913 | Ga0207695_10036612 | Ga0207695_100366122 | 321 |
| 356 | 3300025917 | Ga0207660_10085029 | Ga0207660_100850292 | 321 |
| 357 | 3300025919 | Ga0207657_10084339 | Ga0207657_100843392 | 321 |
| 358 | 3300025919 | Ga0207657_10086958 | Ga0207657_100869581 | 321 |
| 359 | 3300025937 | Ga0207669_10028991 | Ga0207669_100289913 | 321 |
| 360 | 3300025960 | Ga0207651_10134505 | Ga0207651_101345052 | 321 |
| 361 | 3300025981 | Ga0207640_10071361 | Ga0207640_100713612 | 321 |
| 362 | 3300026078 | Ga0207702_10019299 | Ga0207702_100192993 | 321 |
| 363 | 3300026089 | Ga0207648_10246631 | Ga0207648_102466311 | 321 |
| 364 | 3300026121 | Ga0207683_10018855 | Ga0207683_100188552 | 321 |
| 365 | 3300027907 | Ga0207428_10078702 | Ga0207428_100787023 | 321 |
| 366 | 3300037418 | Ga0395900_0277052 | Ga0395900_0277052_307_1272 | 321 |
| 367 | 3300046516 | Ga0495628_0317667 | Ga0495628_0317667_47_1012 | 321 |
| 368 | 3300048920 | Ga0496117_0051775 | Ga0496117_0051775_1070_2038 | 321 |
| 369 | 3300048921 | Ga0496118_0081179 | Ga0496118_0081179_105_1070 | 321 |
| 370 | 3300048922 | Ga0496119_0015210 | Ga0496119_0015210_4522_5487 | 321 |
| 371 | 3300048924 | Ga0496121_0023725 | Ga0496121_0023725_3613_4581 | 321 |
| 372 | 3300048924 | Ga0496121_0052234 | Ga0496121_0052234_2308_3276 | 321 |
| 373 | 3300048928 | Ga0496125_0090461 | Ga0496125_0090461_198_1166 | 321 |
| 374 | 3300049574 | Ga0501038_0250242 | Ga0501038_0250242_71_1036 | 321 |
| 375 | 3300049578 | Ga0501042_0156475 | Ga0501042_0156475_224_1189 | 321 |
| 376 | 3300049580 | Ga0501046_0041076 | Ga0501046_0041076_1382_2347 | 321 |
| 377 | 3300049587 | Ga0501071_0131572 | Ga0501071_0131572_135_1100 | 321 |
| 378 | 3300049743 | Ga0501081_0077444 | Ga0501081_0077444_1085_2050 | 321 |
| 379 | 3300060353 | Ga0501082_0058195 | Ga0501082_0058195_1573_2538 | 321 |
| 380 | 3300003203 | JGI25406J46586_10001258 | JGI25406J46586_100012587 | 322 |
| 381 | 3300003215 | JGI25153J46596_10001975 | JGI25153J46596_100019755 | 322 |
| 382 | 3300003215 | JGI25153J46596_10008987 | JGI25153J46596_100089875 | 322 |
| 383 | 3300003215 | JGI25153J46596_10013218 | JGI25153J46596_100132184 | 322 |
| 384 | 3300003215 | JGI25153J46596_10037847 | JGI25153J46596_100378472 | 322 |
| 385 | 3300003659 | JGI25404J52841_10006528 | JGI25404J52841_100065282 | 322 |
| 386 | 3300003659 | JGI25404J52841_10010095 | JGI25404J52841_100100952 | 322 |
| 387 | 3300003659 | JGI25404J52841_10010842 | JGI25404J52841_100108421 | 322 |
| 388 | 3300003752 | Ga0055539_1006204 | Ga0055539_10062042 | 322 |
| 389 | 3300003771 | Ga0055526_1018462 | Ga0055526_10184622 | 322 |
| 390 | 3300005262 | Ga0065165_1001744 | Ga0065165_100174415 | 322 |
| 391 | 3300005262 | Ga0065165_1003890 | Ga0065165_10038901 | 322 |
| 392 | 3300005293 | Ga0065715_10033428 | Ga0065715_100334282 | 322 |
| 393 | 3300005327 | Ga0070658_10332403 | Ga0070658_103324031 | 322 |
| 394 | 3300005329 | Ga0070683_100004422 | Ga0070683_1000044226 | 322 |
| 395 | 3300005329 | Ga0070683_100242948 | Ga0070683_1002429482 | 322 |
| 396 | 3300005331 | Ga0070670_100028273 | Ga0070670_1000282735 | 322 |
| 397 | 3300005334 | Ga0068869_100139520 | Ga0068869_1001395202 | 322 |
| 398 | 3300005336 | Ga0070680_100095596 | Ga0070680_1000955962 | 322 |
| 399 | 3300005338 | Ga0068868_100012415 | Ga0068868_1000124154 | 322 |
| 400 | 3300005339 | Ga0070660_100086085 | Ga0070660_1000860852 | 322 |
| 401 | 3300005340 | Ga0070689_100117474 | Ga0070689_1001174743 | 322 |
| 402 | 3300005347 | Ga0070668_100258516 | Ga0070668_1002585162 | 322 |
| 403 | 3300005353 | Ga0070669_100031521 | Ga0070669_1000315212 | 322 |
| 404 | 3300005366 | Ga0070659_100289974 | Ga0070659_1002899741 | 322 |
| 405 | 3300005434 | Ga0070709_10000102 | Ga0070709_1000010251 | 322 |
| 406 | 3300005434 | Ga0070709_10038944 | Ga0070709_100389442 | 322 |
| 407 | 3300005434 | Ga0070709_10064450 | Ga0070709_100644503 | 322 |
| 408 | 3300005434 | Ga0070709_10176321 | Ga0070709_101763212 | 322 |
| 409 | 3300005434 | Ga0070709_10179990 | Ga0070709_101799902 | 322 |
| 410 | 3300005435 | Ga0070714_100031763 | Ga0070714_1000317631 | 322 |
| 411 | 3300005435 | Ga0070714_100086107 | Ga0070714_1000861071 | 322 |
| 412 | 3300005435 | Ga0070714_100097986 | Ga0070714_1000979861 | 322 |
| 413 | 3300005435 | Ga0070714_100107780 | Ga0070714_1001077802 | 322 |
| 414 | 3300005436 | Ga0070713_100009644 | Ga0070713_1000096446 | 322 |
| 415 | 3300005436 | Ga0070713_100153064 | Ga0070713_1001530642 | 322 |
| 416 | 3300005436 | Ga0070713_100184954 | Ga0070713_1001849542 | 322 |
| 417 | 3300005437 | Ga0070710_10000246 | Ga0070710_100002467 | 322 |
| 418 | 3300005437 | Ga0070710_10108611 | Ga0070710_101086112 | 322 |
| 419 | 3300005439 | Ga0070711_100003729 | Ga0070711_1000037294 | 322 |
| 420 | 3300005439 | Ga0070711_100015465 | Ga0070711_1000154653 | 322 |
| 421 | 3300005439 | Ga0070711_100072176 | Ga0070711_1000721762 | 322 |
| 422 | 3300005441 | Ga0070700_100084160 | Ga0070700_1000841601 | 322 |
| 423 | 3300005441 | Ga0070700_100159554 | Ga0070700_1001595543 | 322 |
| 424 | 3300005441 | Ga0070700_100198170 | Ga0070700_1001981701 | 322 |
| 425 | 3300005455 | Ga0070663_100012278 | Ga0070663_1000122786 | 322 |
| 426 | 3300005455 | Ga0070663_100077525 | Ga0070663_1000775252 | 322 |
| 427 | 3300005455 | Ga0070663_100311355 | Ga0070663_1003113552 | 322 |
| 428 | 3300005456 | Ga0070678_100005520 | Ga0070678_1000055203 | 322 |
| 429 | 3300005456 | Ga0070678_100021678 | Ga0070678_1000216783 | 322 |
| 430 | 3300005458 | Ga0070681_10053331 | Ga0070681_100533312 | 322 |
| 431 | 3300005458 | Ga0070681_10088546 | Ga0070681_100885461 | 322 |
| 432 | 3300005458 | Ga0070681_10097274 | Ga0070681_100972742 | 322 |
| 433 | 3300005458 | Ga0070681_10107817 | Ga0070681_101078173 | 322 |
| 434 | 3300005458 | Ga0070681_10291591 | Ga0070681_102915911 | 322 |
| 435 | 3300005458 | Ga0070681_10362176 | Ga0070681_103621762 | 322 |
| 436 | 3300005530 | Ga0070679_100089910 | Ga0070679_1000899102 | 322 |
| 437 | 3300005530 | Ga0070679_100333709 | Ga0070679_1003337092 | 322 |
| 438 | 3300005530 | Ga0070679_100379485 | Ga0070679_1003794851 | 322 |
| 439 | 3300005530 | Ga0070679_100451640 | Ga0070679_1004516401 | 322 |
| 440 | 3300005535 | Ga0070684_100018267 | Ga0070684_1000182673 | 322 |
| 441 | 3300005535 | Ga0070684_100125327 | Ga0070684_1001253272 | 322 |
| 442 | 3300005535 | Ga0070684_100180759 | Ga0070684_1001807591 | 322 |
| 443 | 3300005536 | Ga0070697_100000429 | Ga0070697_10000042911 | 322 |
| 444 | 3300005536 | Ga0070697_100024733 | Ga0070697_1000247333 | 322 |
| 445 | 3300005539 | Ga0068853_100000869 | Ga0068853_10000086910 | 322 |
| 446 | 3300005539 | Ga0068853_100006971 | Ga0068853_1000069712 | 322 |
| 447 | 3300005539 | Ga0068853_100128945 | Ga0068853_1001289452 | 322 |
| 448 | 3300005539 | Ga0068853_100151947 | Ga0068853_1001519471 | 322 |
| 449 | 3300005539 | Ga0068853_100337082 | Ga0068853_1003370822 | 322 |
| 450 | 3300005544 | Ga0070686_100015574 | Ga0070686_1000155744 | 322 |
| 451 | 3300005544 | Ga0070686_100218276 | Ga0070686_1002182762 | 322 |
| 452 | 3300005545 | Ga0070695_100011981 | Ga0070695_1000119816 | 322 |
| 453 | 3300005547 | Ga0070693_100148211 | Ga0070693_1001482112 | 322 |
| 454 | 3300005548 | Ga0070665_100020137 | Ga0070665_1000201372 | 322 |
| 455 | 3300005548 | Ga0070665_100145789 | Ga0070665_1001457892 | 322 |
| 456 | 3300005548 | Ga0070665_100192062 | Ga0070665_1001920622 | 322 |
| 457 | 3300005548 | Ga0070665_100379380 | Ga0070665_1003793802 | 322 |
| 458 | 3300005548 | Ga0070665_100476651 | Ga0070665_1004766511 | 322 |
| 459 | 3300005549 | Ga0070704_100002047 | Ga0070704_10000204713 | 322 |
| 460 | 3300005563 | Ga0068855_100079891 | Ga0068855_1000798912 | 322 |
| 461 | 3300005563 | Ga0068855_100093456 | Ga0068855_1000934562 | 322 |
| 462 | 3300005563 | Ga0068855_100101222 | Ga0068855_1001012221 | 322 |
| 463 | 3300005563 | Ga0068855_100379041 | Ga0068855_1003790412 | 322 |
| 464 | 3300005563 | Ga0068855_100618949 | Ga0068855_1006189491 | 322 |
| 465 | 3300005577 | Ga0068857_100068528 | Ga0068857_1000685283 | 322 |
| 466 | 3300005577 | Ga0068857_100263689 | Ga0068857_1002636892 | 322 |
| 467 | 3300005577 | Ga0068857_100303640 | Ga0068857_1003036402 | 322 |
| 468 | 3300005578 | Ga0068854_100005134 | Ga0068854_1000051345 | 322 |
| 469 | 3300005614 | Ga0068856_100027505 | Ga0068856_1000275053 | 322 |
| 470 | 3300005614 | Ga0068856_100042065 | Ga0068856_1000420652 | 322 |
| 471 | 3300005614 | Ga0068856_100127393 | Ga0068856_1001273932 | 322 |
| 472 | 3300005617 | Ga0068859_100445830 | Ga0068859_1004458302 | 322 |
| 473 | 3300005618 | Ga0068864_100091806 | Ga0068864_1000918062 | 322 |
| 474 | 3300005719 | Ga0068861_100236290 | Ga0068861_1002362902 | 322 |
| 475 | 3300005834 | Ga0068851_10001219 | Ga0068851_100012193 | 322 |
| 476 | 3300005841 | Ga0068863_100042721 | Ga0068863_1000427211 | 322 |
| 477 | 3300005841 | Ga0068863_100308169 | Ga0068863_1003081692 | 322 |
| 478 | 3300005842 | Ga0068858_100219928 | Ga0068858_1002199282 | 322 |
| 479 | 3300005842 | Ga0068858_100286753 | Ga0068858_1002867532 | 322 |
| 480 | 3300005842 | Ga0068858_100436675 | Ga0068858_1004366752 | 322 |
| 481 | 3300005843 | Ga0068860_100001369 | Ga0068860_10000136923 | 322 |
| 482 | 3300005844 | Ga0068862_100097391 | Ga0068862_1000973911 | 322 |
| 483 | 3300005844 | Ga0068862_100125134 | Ga0068862_1001251343 | 322 |
| 484 | 3300005937 | Ga0081455_10002234 | Ga0081455_1000223419 | 322 |
| 485 | 3300005937 | Ga0081455_10004479 | Ga0081455_100044792 | 322 |
| 486 | 3300005937 | Ga0081455_10007376 | Ga0081455_100073762 | 322 |
| 487 | 3300005937 | Ga0081455_10079870 | Ga0081455_100798702 | 322 |
| 488 | 3300005981 | Ga0081538_10006633 | Ga0081538_100066335 | 322 |
| 489 | 3300005983 | Ga0081540_1003148 | Ga0081540_10031482 | 322 |
| 490 | 3300005983 | Ga0081540_1004298 | Ga0081540_10042982 | 322 |
| 491 | 3300005983 | Ga0081540_1005800 | Ga0081540_10058003 | 322 |
| 492 | 3300005983 | Ga0081540_1016355 | Ga0081540_10163554 | 322 |
| 493 | 3300005983 | Ga0081540_1050668 | Ga0081540_10506682 | 322 |
| 494 | 3300005983 | Ga0081540_1054025 | Ga0081540_10540252 | 322 |
| 495 | 3300005985 | Ga0081539_10000498 | Ga0081539_1000049874 | 322 |
| 496 | 3300005985 | Ga0081539_10000616 | Ga0081539_1000061624 | 322 |
| 497 | 3300005985 | Ga0081539_10008413 | Ga0081539_100084135 | 322 |
| 498 | 3300005985 | Ga0081539_10046173 | Ga0081539_100461733 | 322 |
| 499 | 3300005985 | Ga0081539_10107456 | Ga0081539_101074561 | 322 |
| 500 | 3300006028 | Ga0070717_10003922 | Ga0070717_100039226 | 322 |
| 501 | 3300006028 | Ga0070717_10150872 | Ga0070717_101508722 | 322 |
| 502 | 3300006028 | Ga0070717_10227968 | Ga0070717_102279683 | 322 |
| 503 | 3300006028 | Ga0070717_10245336 | Ga0070717_102453362 | 322 |
| 504 | 3300006028 | Ga0070717_10359963 | Ga0070717_103599632 | 322 |
| 505 | 3300006038 | Ga0075365_10102444 | Ga0075365_101024442 | 322 |
| 506 | 3300006042 | Ga0075368_10003816 | Ga0075368_100038164 | 322 |
| 507 | 3300006048 | Ga0075363_100002036 | Ga0075363_1000020362 | 322 |
| 508 | 3300006048 | Ga0075363_100015362 | Ga0075363_1000153624 | 322 |
| 509 | 3300006051 | Ga0075364_10098331 | Ga0075364_100983312 | 322 |
| 510 | 3300006051 | Ga0075364_10127875 | Ga0075364_101278752 | 322 |
| 511 | 3300006163 | Ga0070715_10055100 | Ga0070715_100551002 | 322 |
| 512 | 3300006173 | Ga0070716_100004742 | Ga0070716_1000047424 | 322 |
| 513 | 3300006173 | Ga0070716_100036119 | Ga0070716_1000361193 | 322 |
| 514 | 3300006175 | Ga0070712_100006021 | Ga0070712_1000060213 | 322 |
| 515 | 3300006175 | Ga0070712_100009398 | Ga0070712_1000093982 | 322 |
| 516 | 3300006175 | Ga0070712_100064276 | Ga0070712_1000642762 | 322 |
| 517 | 3300006177 | Ga0075362_10027635 | Ga0075362_100276352 | 322 |
| 518 | 3300006177 | Ga0075362_10040719 | Ga0075362_100407192 | 322 |
| 519 | 3300006177 | Ga0075362_10068760 | Ga0075362_100687602 | 322 |
| 520 | 3300006178 | Ga0075367_10108180 | Ga0075367_101081802 | 322 |
| 521 | 3300006186 | Ga0075369_10062592 | Ga0075369_100625922 | 322 |
| 522 | 3300006186 | Ga0075369_10119058 | Ga0075369_101190581 | 322 |
| 523 | 3300006195 | Ga0075366_10007702 | Ga0075366_100077024 | 322 |
| 524 | 3300006353 | Ga0075370_10042918 | Ga0075370_100429182 | 322 |
| 525 | 3300006353 | Ga0075370_10070344 | Ga0075370_100703442 | 322 |
| 526 | 3300006353 | Ga0075370_10077535 | Ga0075370_100775352 | 322 |
| 527 | 3300006358 | Ga0068871_100239577 | Ga0068871_1002395771 | 322 |
| 528 | 3300006844 | Ga0075428_100493568 | Ga0075428_1004935681 | 322 |
| 529 | 3300006881 | Ga0068865_100166537 | Ga0068865_1001665372 | 322 |
| 530 | 3300006881 | Ga0068865_100383018 | Ga0068865_1003830181 | 322 |
| 531 | 3300006931 | Ga0097620_100085658 | Ga0097620_1000856583 | 322 |
| 532 | 3300006931 | Ga0097620_100445830 | Ga0097620_1004458302 | 322 |
| 533 | 3300006942 | Ga0099824_1008576 | Ga0099824_10085766 | 322 |
| 534 | 3300006942 | Ga0099824_1012782 | Ga0099824_10127822 | 322 |
| 535 | 3300006943 | Ga0099822_1004091 | Ga0099822_10040916 | 322 |
| 536 | 3300007076 | Ga0075435_100185232 | Ga0075435_1001852321 | 322 |
| 537 | 3300007265 | Ga0099794_10029937 | Ga0099794_100299372 | 322 |
| 538 | 3300007265 | Ga0099794_10051984 | Ga0099794_100519842 | 322 |
| 539 | 3300009092 | Ga0105250_10056103 | Ga0105250_100561032 | 322 |
| 540 | 3300009093 | Ga0105240_10014223 | Ga0105240_100142232 | 322 |
| 541 | 3300009093 | Ga0105240_10055530 | Ga0105240_100555302 | 322 |
| 542 | 3300009098 | Ga0105245_10033500 | Ga0105245_100335003 | 322 |
| 543 | 3300009101 | Ga0105247_10012294 | Ga0105247_100122944 | 322 |
| 544 | 3300009147 | Ga0114129_10021007 | Ga0114129_100210072 | 322 |
| 545 | 3300009174 | Ga0105241_10007199 | Ga0105241_100071993 | 322 |
| 546 | 3300009177 | Ga0105248_10056530 | Ga0105248_100565302 | 322 |
| 547 | 3300009545 | Ga0105237_10024567 | Ga0105237_100245674 | 322 |
| 548 | 3300009545 | Ga0105237_10090324 | Ga0105237_100903242 | 322 |
| 549 | 3300009545 | Ga0105237_10356549 | Ga0105237_103565491 | 322 |
| 550 | 3300009545 | Ga0105237_10447678 | Ga0105237_104476782 | 322 |
| 551 | 3300009551 | Ga0105238_10000897 | Ga0105238_1000089722 | 322 |
| 552 | 3300009551 | Ga0105238_10003968 | Ga0105238_100039685 | 322 |
| 553 | 3300009551 | Ga0105238_10018050 | Ga0105238_100180504 | 322 |
| 554 | 3300010375 | Ga0105239_10005537 | Ga0105239_100055372 | 322 |
| 555 | 3300010375 | Ga0105239_10100251 | Ga0105239_101002513 | 322 |
| 556 | 3300010375 | Ga0105239_10313113 | Ga0105239_103131131 | 322 |
| 557 | 3300010375 | Ga0105239_10519995 | Ga0105239_105199951 | 322 |
| 558 | 3300011119 | Ga0105246_10001247 | Ga0105246_1000124710 | 322 |
| 559 | 3300013102 | Ga0157371_10092526 | Ga0157371_100925262 | 322 |
| 560 | 3300013105 | Ga0157369_10029906 | Ga0157369_100299064 | 322 |
| 561 | 3300013105 | Ga0157369_10055013 | Ga0157369_100550131 | 322 |
| 562 | 3300013296 | Ga0157374_10060187 | Ga0157374_100601872 | 322 |
| 563 | 3300013296 | Ga0157374_10101153 | Ga0157374_101011532 | 322 |
| 564 | 3300014325 | Ga0163163_10065227 | Ga0163163_100652272 | 322 |
| 565 | 3300014325 | Ga0163163_10226000 | Ga0163163_102260002 | 322 |
| 566 | 3300014326 | Ga0157380_10169296 | Ga0157380_101692962 | 322 |
| 567 | 3300014969 | Ga0157376_10033518 | Ga0157376_100335182 | 322 |
| 568 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002512 | 322 |
| 569 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001862 | 322 |
| 570 | 3300021321 | Ga0214542_1020125 | Ga0214542_10201253 | 322 |
| 571 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001928 | 322 |
| 572 | 3300021324 | Ga0214545_1019688 | Ga0214545_10196886 | 322 |
| 573 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001265 | 322 |
| 574 | 3300025253 | Ga0209677_106368 | Ga0209677_1063681 | 322 |
| 575 | 3300025254 | Ga0209148_1000356 | Ga0209148_100035632 | 322 |
| 576 | 3300025261 | Ga0209233_1008415 | Ga0209233_10084153 | 322 |
| 577 | 3300025272 | Ga0209455_1001391 | Ga0209455_10013918 | 322 |
| 578 | 3300025272 | Ga0209455_1008852 | Ga0209455_10088522 | 322 |
| 579 | 3300025295 | Ga0209564_1000810 | Ga0209564_100081010 | 322 |
| 580 | 3300025295 | Ga0209564_1004546 | Ga0209564_10045464 | 322 |
| 581 | 3300025295 | Ga0209564_1040998 | Ga0209564_10409982 | 322 |
| 582 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021628 | 322 |
| 583 | 3300025297 | Ga0209758_1001018 | Ga0209758_10010185 | 322 |
| 584 | 3300025297 | Ga0209758_1002832 | Ga0209758_10028329 | 322 |
| 585 | 3300025297 | Ga0209758_1003606 | Ga0209758_10036067 | 322 |
| 586 | 3300025297 | Ga0209758_1006112 | Ga0209758_10061123 | 322 |
| 587 | 3300025297 | Ga0209758_1010040 | Ga0209758_10100404 | 322 |
| 588 | 3300025297 | Ga0209758_1022450 | Ga0209758_10224502 | 322 |
| 589 | 3300025299 | Ga0209256_1007804 | Ga0209256_10078045 | 322 |
| 590 | 3300025302 | Ga0207426_1000599 | Ga0207426_10005992 | 322 |
| 591 | 3300025302 | Ga0207426_1000960 | Ga0207426_10009602 | 322 |
| 592 | 3300025302 | Ga0207426_1012993 | Ga0207426_10129931 | 322 |
| 593 | 3300025302 | Ga0207426_1033688 | Ga0207426_10336882 | 322 |
| 594 | 3300025304 | Ga0209257_1002984 | Ga0209257_100298412 | 322 |
| 595 | 3300025321 | Ga0207656_10005751 | Ga0207656_100057512 | 322 |
| 596 | 3300025321 | Ga0207656_10036638 | Ga0207656_100366382 | 322 |
| 597 | 3300025893 | Ga0207682_10001895 | Ga0207682_100018954 | 322 |
| 598 | 3300025898 | Ga0207692_10000514 | Ga0207692_100005142 | 322 |
| 599 | 3300025898 | Ga0207692_10006093 | Ga0207692_100060933 | 322 |
| 600 | 3300025898 | Ga0207692_10144008 | Ga0207692_101440082 | 322 |
| 601 | 3300025901 | Ga0207688_10081217 | Ga0207688_100812173 | 322 |
| 602 | 3300025906 | Ga0207699_10000230 | Ga0207699_1000023023 | 322 |
| 603 | 3300025906 | Ga0207699_10061551 | Ga0207699_100615512 | 322 |
| 604 | 3300025906 | Ga0207699_10115584 | Ga0207699_101155842 | 322 |
| 605 | 3300025909 | Ga0207705_10078317 | Ga0207705_100783172 | 322 |
| 606 | 3300025909 | Ga0207705_10157169 | Ga0207705_101571692 | 322 |
| 607 | 3300025911 | Ga0207654_10000337 | Ga0207654_1000033719 | 322 |
| 608 | 3300025911 | Ga0207654_10069921 | Ga0207654_100699211 | 322 |
| 609 | 3300025912 | Ga0207707_10006249 | Ga0207707_100062494 | 322 |
| 610 | 3300025912 | Ga0207707_10030821 | Ga0207707_100308212 | 322 |
| 611 | 3300025912 | Ga0207707_10278072 | Ga0207707_102780722 | 322 |
| 612 | 3300025912 | Ga0207707_10291078 | Ga0207707_102910782 | 322 |
| 613 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015177 | 322 |
| 614 | 3300025913 | Ga0207695_10036177 | Ga0207695_100361772 | 322 |
| 615 | 3300025913 | Ga0207695_10204848 | Ga0207695_102048482 | 322 |
| 616 | 3300025913 | Ga0207695_10287141 | Ga0207695_102871411 | 322 |
| 617 | 3300025914 | Ga0207671_10012975 | Ga0207671_100129756 | 322 |
| 618 | 3300025914 | Ga0207671_10017413 | Ga0207671_100174133 | 322 |
| 619 | 3300025914 | Ga0207671_10030613 | Ga0207671_100306133 | 322 |
| 620 | 3300025914 | Ga0207671_10039046 | Ga0207671_100390462 | 322 |
| 621 | 3300025914 | Ga0207671_10046210 | Ga0207671_100462102 | 322 |
| 622 | 3300025914 | Ga0207671_10110789 | Ga0207671_101107892 | 322 |
| 623 | 3300025915 | Ga0207693_10002443 | Ga0207693_100024432 | 322 |
| 624 | 3300025915 | Ga0207693_10013717 | Ga0207693_100137175 | 322 |
| 625 | 3300025915 | Ga0207693_10100300 | Ga0207693_101003001 | 322 |
| 626 | 3300025915 | Ga0207693_10106616 | Ga0207693_101066162 | 322 |
| 627 | 3300025915 | Ga0207693_10191996 | Ga0207693_101919962 | 322 |
| 628 | 3300025916 | Ga0207663_10052256 | Ga0207663_100522563 | 322 |
| 629 | 3300025916 | Ga0207663_10061257 | Ga0207663_100612573 | 322 |
| 630 | 3300025917 | Ga0207660_10156170 | Ga0207660_101561702 | 322 |
| 631 | 3300025917 | Ga0207660_10214989 | Ga0207660_102149891 | 322 |
| 632 | 3300025919 | Ga0207657_10000784 | Ga0207657_1000078427 | 322 |
| 633 | 3300025919 | Ga0207657_10001921 | Ga0207657_1000192116 | 322 |
| 634 | 3300025919 | Ga0207657_10193603 | Ga0207657_101936032 | 322 |
| 635 | 3300025920 | Ga0207649_10286038 | Ga0207649_102860382 | 322 |
| 636 | 3300025921 | Ga0207652_10025865 | Ga0207652_100258652 | 322 |
| 637 | 3300025921 | Ga0207652_10029672 | Ga0207652_100296722 | 322 |
| 638 | 3300025921 | Ga0207652_10030541 | Ga0207652_100305412 | 322 |
| 639 | 3300025921 | Ga0207652_10090631 | Ga0207652_100906313 | 322 |
| 640 | 3300025922 | Ga0207646_10365184 | Ga0207646_103651842 | 322 |
| 641 | 3300025923 | Ga0207681_10082035 | Ga0207681_100820352 | 322 |
| 642 | 3300025924 | Ga0207694_10000082 | Ga0207694_1000008232 | 322 |
| 643 | 3300025924 | Ga0207694_10184894 | Ga0207694_101848942 | 322 |
| 644 | 3300025927 | Ga0207687_10013817 | Ga0207687_100138172 | 322 |
| 645 | 3300025927 | Ga0207687_10039262 | Ga0207687_100392623 | 322 |
| 646 | 3300025928 | Ga0207700_10248977 | Ga0207700_102489771 | 322 |
| 647 | 3300025928 | Ga0207700_10353032 | Ga0207700_103530322 | 322 |
| 648 | 3300025929 | Ga0207664_10036404 | Ga0207664_100364041 | 322 |
| 649 | 3300025929 | Ga0207664_10205363 | Ga0207664_102053632 | 322 |
| 650 | 3300025932 | Ga0207690_10250251 | Ga0207690_102502512 | 322 |
| 651 | 3300025935 | Ga0207709_10120006 | Ga0207709_101200062 | 322 |
| 652 | 3300025936 | Ga0207670_10001095 | Ga0207670_1000109510 | 322 |
| 653 | 3300025936 | Ga0207670_10172708 | Ga0207670_101727082 | 322 |
| 654 | 3300025936 | Ga0207670_10217743 | Ga0207670_102177432 | 322 |
| 655 | 3300025937 | Ga0207669_10015062 | Ga0207669_100150622 | 322 |
| 656 | 3300025937 | Ga0207669_10024600 | Ga0207669_100246003 | 322 |
| 657 | 3300025938 | Ga0207704_10182750 | Ga0207704_101827501 | 322 |
| 658 | 3300025939 | Ga0207665_10000192 | Ga0207665_1000019219 | 322 |
| 659 | 3300025939 | Ga0207665_10045186 | Ga0207665_100451862 | 322 |
| 660 | 3300025939 | Ga0207665_10089804 | Ga0207665_100898043 | 322 |
| 661 | 3300025940 | Ga0207691_10254469 | Ga0207691_102544691 | 322 |
| 662 | 3300025941 | Ga0207711_10241632 | Ga0207711_102416321 | 322 |
| 663 | 3300025944 | Ga0207661_10007314 | Ga0207661_100073142 | 322 |
| 664 | 3300025949 | Ga0207667_10002113 | Ga0207667_1000211316 | 322 |
| 665 | 3300025949 | Ga0207667_10113569 | Ga0207667_101135692 | 322 |
| 666 | 3300025961 | Ga0207712_10261971 | Ga0207712_102619712 | 322 |
| 667 | 3300025981 | Ga0207640_10192095 | Ga0207640_101920952 | 322 |
| 668 | 3300025986 | Ga0207658_10071529 | Ga0207658_100715293 | 322 |
| 669 | 3300026023 | Ga0207677_10017957 | Ga0207677_100179572 | 322 |
| 670 | 3300026035 | Ga0207703_10075271 | Ga0207703_100752712 | 322 |
| 671 | 3300026041 | Ga0207639_10034763 | Ga0207639_100347632 | 322 |
| 672 | 3300026041 | Ga0207639_10069221 | Ga0207639_100692212 | 322 |
| 673 | 3300026067 | Ga0207678_10007958 | Ga0207678_100079584 | 322 |
| 674 | 3300026067 | Ga0207678_10020639 | Ga0207678_100206392 | 322 |
| 675 | 3300026075 | Ga0207708_10051265 | Ga0207708_100512653 | 322 |
| 676 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002388 | 322 |
| 677 | 3300026088 | Ga0207641_10032278 | Ga0207641_100322784 | 322 |
| 678 | 3300026088 | Ga0207641_10252533 | Ga0207641_102525332 | 322 |
| 679 | 3300026089 | Ga0207648_10178965 | Ga0207648_101789652 | 322 |
| 680 | 3300026089 | Ga0207648_10267675 | Ga0207648_102676751 | 322 |
| 681 | 3300026116 | Ga0207674_10011733 | Ga0207674_100117332 | 322 |
| 682 | 3300026116 | Ga0207674_10257826 | Ga0207674_102578261 | 322 |
| 683 | 3300026118 | Ga0207675_100124084 | Ga0207675_1001240842 | 322 |
| 684 | 3300026118 | Ga0207675_100198557 | Ga0207675_1001985572 | 322 |
| 685 | 3300026118 | Ga0207675_100251309 | Ga0207675_1002513091 | 322 |
| 686 | 3300026121 | Ga0207683_10020766 | Ga0207683_100207663 | 322 |
| 687 | 3300026121 | Ga0207683_10045508 | Ga0207683_100455082 | 322 |
| 688 | 3300026121 | Ga0207683_10255624 | Ga0207683_102556242 | 322 |
| 689 | 3300026121 | Ga0207683_10455501 | Ga0207683_104555011 | 322 |
| 690 | 3300027296 | Ga0209389_1000008 | Ga0209389_1000008215 | 322 |
| 691 | 3300027296 | Ga0209389_1000121 | Ga0209389_100012142 | 322 |
| 692 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003500 | 322 |
| 693 | 3300027357 | Ga0209589_1002735 | Ga0209589_100273517 | 322 |
| 694 | 3300027361 | Ga0209489_100003 | Ga0209489_100003551 | 322 |
| 695 | 3300027361 | Ga0209489_101490 | Ga0209489_1014905 | 322 |
| 696 | 3300027361 | Ga0209489_103445 | Ga0209489_10344517 | 322 |
| 697 | 3300027363 | Ga0209700_100003 | Ga0209700_100003551 | 322 |
| 698 | 3300027363 | Ga0209700_100036 | Ga0209700_100036102 | 322 |
| 699 | 3300028379 | Ga0268266_10000908 | Ga0268266_1000090819 | 322 |
| 700 | 3300028379 | Ga0268266_10067894 | Ga0268266_100678942 | 322 |
| 701 | 3300028379 | Ga0268266_10125463 | Ga0268266_101254632 | 322 |
| 702 | 3300028380 | Ga0268265_10144509 | Ga0268265_101445091 | 322 |
| 703 | 3300028381 | Ga0268264_10000043 | Ga0268264_1000004379 | 322 |
| 704 | 3300028556 | Ga0265337_1012538 | Ga0265337_10125383 | 322 |
| 705 | 3300028556 | Ga0265337_1015056 | Ga0265337_10150562 | 322 |
| 706 | 3300028558 | Ga0265326_10002188 | Ga0265326_100021885 | 322 |
| 707 | 3300028573 | Ga0265334_10002607 | Ga0265334_100026075 | 322 |
| 708 | 3300028573 | Ga0265334_10014246 | Ga0265334_100142462 | 322 |
| 709 | 3300028653 | Ga0265323_10003939 | Ga0265323_100039391 | 322 |
| 710 | 3300028654 | Ga0265322_10002310 | Ga0265322_100023104 | 322 |
| 711 | 3300028666 | Ga0265336_10001608 | Ga0265336_100016083 | 322 |
| 712 | 3300028786 | Ga0307517_10000063 | Ga0307517_10000063121 | 322 |
| 713 | 3300028794 | Ga0307515_10100819 | Ga0307515_101008194 | 322 |
| 714 | 3300028794 | Ga0307515_10160523 | Ga0307515_101605232 | 322 |
| 715 | 3300028800 | Ga0265338_10000667 | Ga0265338_1000066732 | 322 |
| 716 | 3300028800 | Ga0265338_10021413 | Ga0265338_100214136 | 322 |
| 717 | 3300029957 | Ga0265324_10003760 | Ga0265324_100037603 | 322 |
| 718 | 3300031235 | Ga0265330_10007489 | Ga0265330_100074891 | 322 |
| 719 | 3300031238 | Ga0265332_10035696 | Ga0265332_100356962 | 322 |
| 720 | 3300031240 | Ga0265320_10000953 | Ga0265320_100009538 | 322 |
| 721 | 3300031241 | Ga0265325_10007037 | Ga0265325_100070373 | 322 |
| 722 | 3300031241 | Ga0265325_10014108 | Ga0265325_100141083 | 322 |
| 723 | 3300031241 | Ga0265325_10061548 | Ga0265325_100615484 | 322 |
| 724 | 3300031247 | Ga0265340_10004938 | Ga0265340_100049382 | 322 |
| 725 | 3300031249 | Ga0265339_10000145 | Ga0265339_1000014553 | 322 |
| 726 | 3300031249 | Ga0265339_10007152 | Ga0265339_100071524 | 322 |
| 727 | 3300031250 | Ga0265331_10005233 | Ga0265331_100052336 | 322 |
| 728 | 3300031250 | Ga0265331_10027187 | Ga0265331_100271872 | 322 |
| 729 | 3300031344 | Ga0265316_10040807 | Ga0265316_100408075 | 322 |
| 730 | 3300031344 | Ga0265316_10049430 | Ga0265316_100494303 | 322 |
| 731 | 3300031595 | Ga0265313_10000173 | Ga0265313_1000017349 | 322 |
| 732 | 3300031595 | Ga0265313_10001153 | Ga0265313_100011532 | 322 |
| 733 | 3300031595 | Ga0265313_10064549 | Ga0265313_100645492 | 322 |
| 734 | 3300031616 | Ga0307508_10000010 | Ga0307508_100000103 | 322 |
| 735 | 3300031616 | Ga0307508_10058073 | Ga0307508_100580732 | 322 |
| 736 | 3300031691 | Ga0316579_10106656 | Ga0316579_101066561 | 322 |
| 737 | 3300031711 | Ga0265314_10000125 | Ga0265314_1000012575 | 322 |
| 738 | 3300031711 | Ga0265314_10011664 | Ga0265314_100116642 | 322 |
| 739 | 3300031711 | Ga0265314_10041990 | Ga0265314_100419903 | 322 |
| 740 | 3300031712 | Ga0265342_10003916 | Ga0265342_100039168 | 322 |
| 741 | 3300031712 | Ga0265342_10011179 | Ga0265342_100111794 | 322 |
| 742 | 3300031728 | Ga0316578_10023053 | Ga0316578_100230534 | 322 |
| 743 | 3300031730 | Ga0307516_10083248 | Ga0307516_100832483 | 322 |
| 744 | 3300031730 | Ga0307516_10122318 | Ga0307516_101223182 | 322 |
| 745 | 3300032002 | Ga0307416_100598822 | Ga0307416_1005988221 | 322 |
| 746 | 3300032126 | Ga0307415_100019128 | Ga0307415_1000191283 | 322 |
| 747 | 3300032168 | Ga0316593_10041240 | Ga0316593_100412401 | 322 |
| 748 | 3300033180 | Ga0307510_10006860 | Ga0307510_100068602 | 322 |
| 749 | 3300033180 | Ga0307510_10040547 | Ga0307510_100405473 | 322 |
| 750 | 3300033180 | Ga0307510_10082351 | Ga0307510_100823513 | 322 |
| 751 | 3300033442 | Ga0315911_1000001 | Ga0315911_1000001216 | 322 |
| 752 | 3300034816 | Ga0373930_0004300 | Ga0373930_0004300_446_1414 | 322 |
| 753 | 3300035083 | Ga0373926_0005541 | Ga0373926_0005541_2910_3878 | 322 |
| 754 | 3300035083 | Ga0373926_0059391 | Ga0373926_0059391_33_1001 | 322 |
| 755 | 3300035086 | Ga0373934_0001152 | Ga0373934_0001152_5363_6331 | 322 |
| 756 | 3300035088 | Ga0373940_0006936 | Ga0373940_0006936_533_1501 | 322 |
| 757 | 3300035089 | Ga0373944_0000364 | Ga0373944_0000364_8112_9080 | 322 |
| 758 | 3300035089 | Ga0373944_0001934 | Ga0373944_0001934_2569_3537 | 322 |
| 759 | 3300035111 | Ga0373923_0005611 | Ga0373923_0005611_3241_4209 | 322 |
| 760 | 3300035113 | Ga0373936_0002224 | Ga0373936_0002224_310_1278 | 322 |
| 761 | 3300035113 | Ga0373936_0007579 | Ga0373936_0007579_822_1790 | 322 |
| 762 | 3300035113 | Ga0373936_0008721 | Ga0373936_0008721_2537_3505 | 322 |
| 763 | 3300035113 | Ga0373936_0032331 | Ga0373936_0032331_954_1922 | 322 |
| 764 | 3300035113 | Ga0373936_0046255 | Ga0373936_0046255_610_1578 | 322 |
| 765 | 3300035114 | Ga0373939_0014060 | Ga0373939_0014060_838_1806 | 322 |
| 766 | 3300035115 | Ga0373941_0025759 | Ga0373941_0025759_257_1225 | 322 |
| 767 | 3300035116 | Ga0373945_0000604 | Ga0373945_0000604_9287_10255 | 322 |
| 768 | 3300035116 | Ga0373945_0019944 | Ga0373945_0019944_275_1243 | 322 |
| 769 | 3300035116 | Ga0373945_0021270 | Ga0373945_0021270_1090_2058 | 322 |
| 770 | 3300035116 | Ga0373945_0053896 | Ga0373945_0053896_309_1277 | 322 |
| 771 | 3300035118 | Ga0373954_0000976 | Ga0373954_0000976_5624_6592 | 322 |
| 772 | 3300035118 | Ga0373954_0049349 | Ga0373954_0049349_863_1831 | 322 |
| 773 | 3300035118 | Ga0373954_0141110 | Ga0373954_0141110_181_1149 | 322 |
| 774 | 3300035119 | Ga0373956_0009428 | Ga0373956_0009428_2922_3890 | 322 |
| 775 | 3300035119 | Ga0373956_0118025 | Ga0373956_0118025_24_992 | 322 |
| 776 | 3300035170 | Ga0373943_0001320 | Ga0373943_0001320_9876_10844 | 322 |
| 777 | 3300035170 | Ga0373943_0003503 | Ga0373943_0003503_5969_6937 | 322 |
| 778 | 3300035170 | Ga0373943_0026179 | Ga0373943_0026179_1476_2444 | 322 |
| 779 | 3300035170 | Ga0373943_0046365 | Ga0373943_0046365_19_987 | 322 |
| 780 | 3300035171 | Ga0373946_0022234 | Ga0373946_0022234_846_1814 | 322 |
| 781 | 3300035171 | Ga0373946_0022683 | Ga0373946_0022683_208_1176 | 322 |
| 782 | 3300035172 | Ga0373955_0000198 | Ga0373955_0000198_6819_7787 | 322 |
| 783 | 3300035172 | Ga0373955_0007268 | Ga0373955_0007268_2993_3961 | 322 |
| 784 | 3300035172 | Ga0373955_0007759 | Ga0373955_0007759_523_1491 | 322 |
| 785 | 3300035172 | Ga0373955_0012193 | Ga0373955_0012193_247_1215 | 322 |
| 786 | 3300035172 | Ga0373955_0069792 | Ga0373955_0069792_648_1616 | 322 |
| 787 | 3300035172 | Ga0373955_0117205 | Ga0373955_0117205_32_1000 | 322 |
| 788 | 3300035207 | Ga0373942_0017492 | Ga0373942_0017492_147_1115 | 322 |
| 789 | 3300035242 | Ga0373962_0009654 | Ga0373962_0009654_306_1274 | 322 |
| 790 | 3300035398 | Ga0316574_0000486 | Ga0316574_0000486_4276_5244 | 322 |
| 791 | 3300035410 | Ga0373924_0006081 | Ga0373924_0006081_507_1475 | 322 |
| 792 | 3300035410 | Ga0373924_0013867 | Ga0373924_0013867_1067_2035 | 322 |
| 793 | 3300035410 | Ga0373924_0028954 | Ga0373924_0028954_832_1800 | 322 |
| 794 | 3300035691 | Ga0373931_0000263 | Ga0373931_0000263_8443_9411 | 322 |
| 795 | 3300035691 | Ga0373931_0075155 | Ga0373931_0075155_526_1494 | 322 |
| 796 | 3300035692 | Ga0373935_0000880 | Ga0373935_0000880_14688_15656 | 322 |
| 797 | 3300035692 | Ga0373935_0008666 | Ga0373935_0008666_910_1878 | 322 |
| 798 | 3300035692 | Ga0373935_0052556 | Ga0373935_0052556_519_1487 | 322 |
| 799 | 3300035692 | Ga0373935_0066064 | Ga0373935_0066064_213_1181 | 322 |
| 800 | 3300035695 | Ga0373927_0000415 | Ga0373927_0000415_9741_10709 | 322 |
| 801 | 3300035695 | Ga0373927_0011994 | Ga0373927_0011994_1515_2483 | 322 |
| 802 | 3300035695 | Ga0373927_0012818 | Ga0373927_0012818_3132_4100 | 322 |
| 803 | 3300035695 | Ga0373927_0040906 | Ga0373927_0040906_600_1568 | 322 |
| 804 | 3300035695 | Ga0373927_0055937 | Ga0373927_0055937_669_1637 | 322 |
| 805 | 3300035695 | Ga0373927_0060421 | Ga0373927_0060421_1069_2037 | 322 |
| 806 | 3300035695 | Ga0373927_0090305 | Ga0373927_0090305_293_1261 | 322 |
| 807 | 3300035695 | Ga0373927_0122069 | Ga0373927_0122069_714_1682 | 322 |
| 808 | 3300035724 | Ga0373933_0000274 | Ga0373933_0000274_5847_6815 | 322 |
| 809 | 3300035724 | Ga0373933_0000475 | Ga0373933_0000475_2346_3314 | 322 |
| 810 | 3300035725 | Ga0373947_0002859 | Ga0373947_0002859_5171_6139 | 322 |
| 811 | 3300035725 | Ga0373947_0008223 | Ga0373947_0008223_3000_3968 | 322 |
| 812 | 3300035725 | Ga0373947_0012808 | Ga0373947_0012808_2782_3750 | 322 |
| 813 | 3300035725 | Ga0373947_0030611 | Ga0373947_0030611_2029_2997 | 322 |
| 814 | 3300035725 | Ga0373947_0040403 | Ga0373947_0040403_1482_2450 | 322 |
| 815 | 3300035725 | Ga0373947_0103748 | Ga0373947_0103748_140_1108 | 322 |
| 816 | 3300036401 | Ga0373937_0008251 | Ga0373937_0008251_5904_6872 | 322 |
| 817 | 3300036401 | Ga0373937_0030039 | Ga0373937_0030039_2817_3785 | 322 |
| 818 | 3300036401 | Ga0373937_0086774 | Ga0373937_0086774_150_1118 | 322 |
| 819 | 3300036401 | Ga0373937_0103040 | Ga0373937_0103040_1394_2362 | 322 |
| 820 | 3300036401 | Ga0373937_0111865 | Ga0373937_0111865_1186_2154 | 322 |
| 821 | 3300036401 | Ga0373937_0169621 | Ga0373937_0169621_727_1695 | 322 |
| 822 | 3300036401 | Ga0373937_0174649 | Ga0373937_0174649_308_1276 | 322 |
| 823 | 3300036401 | Ga0373937_0258853 | Ga0373937_0258853_510_1478 | 322 |
| 824 | 3300036712 | Ga0316584_0004453 | Ga0316584_0004453_3153_4121 | 322 |
| 825 | 3300037068 | Ga0373925_0008160 | Ga0373925_0008160_1524_2492 | 322 |
| 826 | 3300037068 | Ga0373925_0012044 | Ga0373925_0012044_3012_3980 | 322 |
| 827 | 3300037068 | Ga0373925_0030528 | Ga0373925_0030528_824_1792 | 322 |
| 828 | 3300037068 | Ga0373925_0035309 | Ga0373925_0035309_2302_3270 | 322 |
| 829 | 3300037068 | Ga0373925_0125228 | Ga0373925_0125228_340_1308 | 322 |
| 830 | 3300037068 | Ga0373925_0139611 | Ga0373925_0139611_292_1260 | 322 |
| 831 | 3300037068 | Ga0373925_0181220 | Ga0373925_0181220_364_1332 | 322 |
| 832 | 3300037068 | Ga0373925_0270584 | Ga0373925_0270584_251_1219 | 322 |
| 833 | 3300037418 | Ga0395900_0000361 | Ga0395900_0000361_41867_42835 | 322 |
| 834 | 3300037418 | Ga0395900_0034548 | Ga0395900_0034548_3112_4080 | 322 |
| 835 | 3300037418 | Ga0395900_0047403 | Ga0395900_0047403_1875_2843 | 322 |
| 836 | 3300037466 | Ga0395898_0020363 | Ga0395898_0020363_776_1744 | 322 |
| 837 | 3300037466 | Ga0395898_0132439 | Ga0395898_0132439_559_1527 | 322 |
| 838 | 3300037471 | Ga0395905_0003578 | Ga0395905_0003578_10888_11856 | 322 |
| 839 | 3300037471 | Ga0395905_0271700 | Ga0395905_0271700_591_1559 | 322 |
| 840 | 3300037471 | Ga0395905_0411017 | Ga0395905_0411017_216_1184 | 322 |
| 841 | 3300037853 | Ga0436364_0033868 | Ga0436364_0033868_426_1394 | 322 |
| 842 | 3300037853 | Ga0436364_0171330 | Ga0436364_0171330_332_1300 | 322 |
| 843 | 3300037853 | Ga0436364_1331450 | Ga0436364_1331450_1086_2054 | 322 |
| 844 | 3300038443 | Ga0395901_0005029 | Ga0395901_0005029_1796_2764 | 322 |
| 845 | 3300038443 | Ga0395901_0150364 | Ga0395901_0150364_146_1114 | 322 |
| 846 | 3300038443 | Ga0395901_0179118 | Ga0395901_0179118_58_1026 | 322 |
| 847 | 3300038443 | Ga0395901_0192872 | Ga0395901_0192872_48_1016 | 322 |
| 848 | 3300039437 | Ga0436365_0369699 | Ga0436365_0369699_472_1440 | 322 |
| 849 | 3300039437 | Ga0436365_0733835 | Ga0436365_0733835_161_1129 | 322 |
| 850 | 3300039437 | Ga0436365_1018795 | Ga0436365_1018795_434_1402 | 322 |
| 851 | 3300039437 | Ga0436365_1361494 | Ga0436365_1361494_6471_7439 | 322 |
| 852 | 3300039437 | Ga0436365_1556838 | Ga0436365_1556838_22_993 | 322 |
| 853 | 3300039438 | Ga0436360_0623528 | Ga0436360_0623528_19_987 | 322 |
| 854 | 3300039447 | Ga0436361_0266153 | Ga0436361_0266153_14_982 | 322 |
| 855 | 3300039450 | Ga0436363_1628749 | Ga0436363_1628749_822_1790 | 322 |
| 856 | 3300041408 | Ga0439453_0008825 | Ga0439453_0008825_58_1026 | 322 |
| 857 | 3300042012 | Ga0439455_0058595 | Ga0439455_0058595_18_986 | 322 |
| 858 | 3300044658 | Ga0466972_0000271 | Ga0466972_0000271_10573_11541 | 322 |
| 859 | 3300044658 | Ga0466972_0034153 | Ga0466972_0034153_284_1252 | 322 |
| 860 | 3300044683 | Ga0466965_0004372 | Ga0466965_0004372_5143_6111 | 322 |
| 861 | 3300044684 | Ga0466966_0004743 | Ga0466966_0004743_4052_5020 | 322 |
| 862 | 3300044684 | Ga0466966_0230914 | Ga0466966_0230914_15_983 | 322 |
| 863 | 3300044693 | Ga0466961_0000859 | Ga0466961_0000859_310_1278 | 322 |
| 864 | 3300044694 | Ga0466963_0077341 | Ga0466963_0077341_1081_2049 | 322 |
| 865 | 3300044735 | Ga0466968_0008864 | Ga0466968_0008864_808_1776 | 322 |
| 866 | 3300044842 | Ga0466957_0026509 | Ga0466957_0026509_396_1364 | 322 |
| 867 | 3300044842 | Ga0466957_0084796 | Ga0466957_0084796_273_1340 | 322 |
| 868 | 3300044842 | Ga0466957_0145095 | Ga0466957_0145095_271_1239 | 322 |
| 869 | 3300044842 | Ga0466957_0215789 | Ga0466957_0215789_160_1128 | 322 |
| 870 | 3300045049 | Ga0466959_0033478 | Ga0466959_0033478_115_1083 | 322 |
| 871 | 3300045049 | Ga0466959_0036020 | Ga0466959_0036020_88_1056 | 322 |
| 872 | 3300045049 | Ga0466959_0117515 | Ga0466959_0117515_462_1430 | 322 |
| 873 | 3300046452 | Ga0495617_048848 | Ga0495617_048848_430_1398 | 322 |
| 874 | 3300046454 | Ga0495592_0007563 | Ga0495592_0007563_5733_6701 | 322 |
| 875 | 3300046454 | Ga0495592_0013902 | Ga0495592_0013902_505_1473 | 322 |
| 876 | 3300046454 | Ga0495592_0150556 | Ga0495592_0150556_465_1433 | 322 |
| 877 | 3300046455 | Ga0495603_0000676 | Ga0495603_0000676_1520_2488 | 322 |
| 878 | 3300046455 | Ga0495603_0009006 | Ga0495603_0009006_4730_5698 | 322 |
| 879 | 3300046455 | Ga0495603_0031745 | Ga0495603_0031745_2005_2973 | 322 |
| 880 | 3300046455 | Ga0495603_0241912 | Ga0495603_0241912_38_1006 | 322 |
| 881 | 3300046459 | Ga0495629_0000176 | Ga0495629_0000176_2700_3668 | 322 |
| 882 | 3300046459 | Ga0495629_0003088 | Ga0495629_0003088_10146_11114 | 322 |
| 883 | 3300046459 | Ga0495629_0003357 | Ga0495629_0003357_2734_3702 | 322 |
| 884 | 3300046459 | Ga0495629_0012129 | Ga0495629_0012129_4925_5893 | 322 |
| 885 | 3300046459 | Ga0495629_0024799 | Ga0495629_0024799_2861_3829 | 322 |
| 886 | 3300046459 | Ga0495629_0081977 | Ga0495629_0081977_444_1412 | 322 |
| 887 | 3300046460 | Ga0495638_0019106 | Ga0495638_0019106_3013_3981 | 322 |
| 888 | 3300046461 | Ga0495641_0008578 | Ga0495641_0008578_4798_5766 | 322 |
| 889 | 3300046461 | Ga0495641_0012702 | Ga0495641_0012702_3337_4305 | 322 |
| 890 | 3300046462 | Ga0495651_0002298 | Ga0495651_0002298_7547_8515 | 322 |
| 891 | 3300046462 | Ga0495651_0009559 | Ga0495651_0009559_3631_4599 | 322 |
| 892 | 3300046462 | Ga0495651_0092718 | Ga0495651_0092718_98_1066 | 322 |
| 893 | 3300046463 | Ga0495653_0004529 | Ga0495653_0004529_5620_6588 | 322 |
| 894 | 3300046472 | Ga0495580_0004887 | Ga0495580_0004887_9888_10856 | 322 |
| 895 | 3300046472 | Ga0495580_0009272 | Ga0495580_0009272_1445_2413 | 322 |
| 896 | 3300046472 | Ga0495580_0013690 | Ga0495580_0013690_4704_5672 | 322 |
| 897 | 3300046472 | Ga0495580_0031326 | Ga0495580_0031326_1368_2336 | 322 |
| 898 | 3300046472 | Ga0495580_0084911 | Ga0495580_0084911_1063_2031 | 322 |
| 899 | 3300046473 | Ga0495582_0000177 | Ga0495582_0000177_33068_34036 | 322 |
| 900 | 3300046474 | Ga0495605_0090097 | Ga0495605_0090097_334_1302 | 322 |
| 901 | 3300046474 | Ga0495605_0107899 | Ga0495605_0107899_295_1263 | 322 |
| 902 | 3300046475 | Ga0495639_0000726 | Ga0495639_0000726_13695_14663 | 322 |
| 903 | 3300046475 | Ga0495639_0004110 | Ga0495639_0004110_395_1363 | 322 |
| 904 | 3300046475 | Ga0495639_0022248 | Ga0495639_0022248_1416_2384 | 322 |
| 905 | 3300046476 | Ga0495662_0000028 | Ga0495662_0000028_28627_29595 | 322 |
| 906 | 3300046476 | Ga0495662_0003064 | Ga0495662_0003064_6728_7696 | 322 |
| 907 | 3300046476 | Ga0495662_0017858 | Ga0495662_0017858_222_1190 | 322 |
| 908 | 3300046477 | Ga0495664_0008779 | Ga0495664_0008779_761_1729 | 322 |
| 909 | 3300046477 | Ga0495664_0025560 | Ga0495664_0025560_198_1166 | 322 |
| 910 | 3300046492 | Ga0495585_0054100 | Ga0495585_0054100_371_1339 | 322 |
| 911 | 3300046499 | Ga0495594_0000020 | Ga0495594_0000020_29441_30409 | 322 |
| 912 | 3300046499 | Ga0495594_0005321 | Ga0495594_0005321_1754_2722 | 322 |
| 913 | 3300046499 | Ga0495594_0052047 | Ga0495594_0052047_213_1181 | 322 |
| 914 | 3300046507 | Ga0495606_0001226 | Ga0495606_0001226_6905_7873 | 322 |
| 915 | 3300046507 | Ga0495606_0060335 | Ga0495606_0060335_122_1090 | 322 |
| 916 | 3300046511 | Ga0495608_0000721 | Ga0495608_0000721_21670_22638 | 322 |
| 917 | 3300046511 | Ga0495608_0078020 | Ga0495608_0078020_20_988 | 322 |
| 918 | 3300046511 | Ga0495608_0101820 | Ga0495608_0101820_248_1216 | 322 |
| 919 | 3300046511 | Ga0495608_0133537 | Ga0495608_0133537_340_1308 | 322 |
| 920 | 3300046514 | Ga0495618_0018572 | Ga0495618_0018572_695_1663 | 322 |
| 921 | 3300046515 | Ga0495620_0026112 | Ga0495620_0026112_301_1269 | 322 |
| 922 | 3300046515 | Ga0495620_0109991 | Ga0495620_0109991_32_1000 | 322 |
| 923 | 3300046516 | Ga0495628_0004786 | Ga0495628_0004786_7395_8363 | 322 |
| 924 | 3300046516 | Ga0495628_0074309 | Ga0495628_0074309_1448_2416 | 322 |
| 925 | 3300046516 | Ga0495628_0093530 | Ga0495628_0093530_733_1701 | 322 |
| 926 | 3300046516 | Ga0495628_0130981 | Ga0495628_0130981_394_1362 | 322 |
| 927 | 3300046517 | Ga0495630_0002476 | Ga0495630_0002476_10878_11846 | 322 |
| 928 | 3300046517 | Ga0495630_0225693 | Ga0495630_0225693_122_1090 | 322 |
| 929 | 3300046523 | Ga0495644_0002732 | Ga0495644_0002732_3407_4375 | 322 |
| 930 | 3300046523 | Ga0495644_0022480 | Ga0495644_0022480_977_1945 | 322 |
| 931 | 3300046524 | Ga0495648_0002422 | Ga0495648_0002422_15528_16496 | 322 |
| 932 | 3300046524 | Ga0495648_0008933 | Ga0495648_0008933_3643_4611 | 322 |
| 933 | 3300046524 | Ga0495648_0059123 | Ga0495648_0059123_694_1662 | 322 |
| 934 | 3300046524 | Ga0495648_0074244 | Ga0495648_0074244_955_1923 | 322 |
| 935 | 3300046525 | Ga0495663_0025921 | Ga0495663_0025921_569_1537 | 322 |
| 936 | 3300046526 | Ga0495666_0006077 | Ga0495666_0006077_294_1262 | 322 |
| 937 | 3300046526 | Ga0495666_0010823 | Ga0495666_0010823_368_1336 | 322 |
| 938 | 3300046529 | Ga0495652_0063452 | Ga0495652_0063452_174_1142 | 322 |
| 939 | 3300046529 | Ga0495652_0086353 | Ga0495652_0086353_702_1670 | 322 |
| 940 | 3300046529 | Ga0495652_0100838 | Ga0495652_0100838_388_1356 | 322 |
| 941 | 3300046530 | Ga0495654_0049895 | Ga0495654_0049895_223_1191 | 322 |
| 942 | 3300046530 | Ga0495654_0143360 | Ga0495654_0143360_52_1020 | 322 |
| 943 | 3300046531 | Ga0495665_0000057 | Ga0495665_0000057_17721_18689 | 322 |
| 944 | 3300046531 | Ga0495665_0009325 | Ga0495665_0009325_3543_4511 | 322 |
| 945 | 3300046531 | Ga0495665_0021145 | Ga0495665_0021145_2281_3249 | 322 |
| 946 | 3300046531 | Ga0495665_0032754 | Ga0495665_0032754_1655_2623 | 322 |
| 947 | 3300046531 | Ga0495665_0033665 | Ga0495665_0033665_1499_2467 | 322 |
| 948 | 3300046533 | Ga0495640_0001533 | Ga0495640_0001533_2665_3633 | 322 |
| 949 | 3300046533 | Ga0495640_0006411 | Ga0495640_0006411_4450_5418 | 322 |
| 950 | 3300046533 | Ga0495640_0031293 | Ga0495640_0031293_739_1707 | 322 |
| 951 | 3300046533 | Ga0495640_0051277 | Ga0495640_0051277_143_1111 | 322 |
| 952 | 3300046536 | Ga0495587_0000736 | Ga0495587_0000736_3052_4020 | 322 |
| 953 | 3300046539 | Ga0495621_0015238 | Ga0495621_0015238_31_999 | 322 |
| 954 | 3300046539 | Ga0495621_0018932 | Ga0495621_0018932_1160_2128 | 322 |
| 955 | 3300046543 | Ga0495645_0007114 | Ga0495645_0007114_6451_7419 | 322 |
| 956 | 3300046543 | Ga0495645_0038764 | Ga0495645_0038764_2448_3416 | 322 |
| 957 | 3300046557 | Ga0495622_0001520 | Ga0495622_0001520_1410_2378 | 322 |
| 958 | 3300046557 | Ga0495622_0093161 | Ga0495622_0093161_161_1129 | 322 |
| 959 | 3300046558 | Ga0495633_0009880 | Ga0495633_0009880_2940_3908 | 322 |
| 960 | 3300046559 | Ga0495667_0000319 | Ga0495667_0000319_2598_3566 | 322 |
| 961 | 3300046559 | Ga0495667_0008737 | Ga0495667_0008737_5505_6473 | 322 |
| 962 | 3300046559 | Ga0495667_0020907 | Ga0495667_0020907_1978_2946 | 322 |
| 963 | 3300046559 | Ga0495667_0036184 | Ga0495667_0036184_1253_2221 | 322 |
| 964 | 3300046615 | Ga0495656_0000064 | Ga0495656_0000064_16194_17162 | 322 |
| 965 | 3300046616 | Ga0495668_0036816 | Ga0495668_0036816_246_1214 | 322 |
| 966 | 3300046616 | Ga0495668_0062215 | Ga0495668_0062215_814_1782 | 322 |
| 967 | 3300046642 | Ga0495634_0008509 | Ga0495634_0008509_1934_2902 | 322 |
| 968 | 3300046642 | Ga0495634_0010828 | Ga0495634_0010828_146_1114 | 322 |
| 969 | 3300046642 | Ga0495634_0024302 | Ga0495634_0024302_190_1158 | 322 |
| 970 | 3300046642 | Ga0495634_0030256 | Ga0495634_0030256_1153_2121 | 322 |
| 971 | 3300046642 | Ga0495634_0105411 | Ga0495634_0105411_341_1309 | 322 |
| 972 | 3300046642 | Ga0495634_0233566 | Ga0495634_0233566_22_990 | 322 |
| 973 | 3300046660 | Ga0495625_0124200 | Ga0495625_0124200_551_1519 | 322 |
| 974 | 3300046663 | Ga0495635_0004372 | Ga0495635_0004372_3179_4147 | 322 |
| 975 | 3300046663 | Ga0495635_0008796 | Ga0495635_0008796_4430_5398 | 322 |
| 976 | 3300046663 | Ga0495635_0008850 | Ga0495635_0008850_4587_5555 | 322 |
| 977 | 3300046663 | Ga0495635_0049438 | Ga0495635_0049438_1351_2319 | 322 |
| 978 | 3300046663 | Ga0495635_0249464 | Ga0495635_0249464_176_1144 | 322 |
| 979 | 3300046664 | Ga0495659_0002437 | Ga0495659_0002437_4470_5438 | 322 |
| 980 | 3300046664 | Ga0495659_0020085 | Ga0495659_0020085_23_991 | 322 |
| 981 | 3300046674 | Ga0495588_0011011 | Ga0495588_0011011_142_1110 | 322 |
| 982 | 3300046674 | Ga0495588_0018632 | Ga0495588_0018632_1079_2047 | 322 |
| 983 | 3300046674 | Ga0495588_0040969 | Ga0495588_0040969_774_1742 | 322 |
| 984 | 3300046674 | Ga0495588_0105764 | Ga0495588_0105764_474_1442 | 322 |
| 985 | 3300046675 | Ga0495657_0001557 | Ga0495657_0001557_5747_6715 | 322 |
| 986 | 3300046675 | Ga0495657_0044896 | Ga0495657_0044896_474_1442 | 322 |
| 987 | 3300046675 | Ga0495657_0049297 | Ga0495657_0049297_1512_2480 | 322 |
| 988 | 3300046675 | Ga0495657_0049317 | Ga0495657_0049317_1603_2571 | 322 |
| 989 | 3300046678 | Ga0495599_0001378 | Ga0495599_0001378_7087_8055 | 322 |
| 990 | 3300046678 | Ga0495599_0021867 | Ga0495599_0021867_1818_2786 | 322 |
| 991 | 3300046678 | Ga0495599_0071568 | Ga0495599_0071568_327_1295 | 322 |
| 992 | 3300046679 | Ga0495623_0008240 | Ga0495623_0008240_3799_4767 | 322 |
| 993 | 3300046679 | Ga0495623_0010692 | Ga0495623_0010692_1083_2051 | 322 |
| 994 | 3300046680 | Ga0495646_0003336 | Ga0495646_0003336_638_1606 | 322 |
| 995 | 3300046680 | Ga0495646_0013387 | Ga0495646_0013387_3077_4045 | 322 |
| 996 | 3300046680 | Ga0495646_0016906 | Ga0495646_0016906_2231_3199 | 322 |
| 997 | 3300046680 | Ga0495646_0108359 | Ga0495646_0108359_320_1288 | 322 |
| 998 | 3300046681 | Ga0495647_0012769 | Ga0495647_0012769_499_1467 | 322 |
| 999 | 3300046681 | Ga0495647_0020139 | Ga0495647_0020139_1212_2180 | 322 |
| 1000 | 3300046681 | Ga0495647_0072707 | Ga0495647_0072707_383_1351 | 322 |
| 1001 | 3300046683 | Ga0495658_0003230 | Ga0495658_0003230_5731_6699 | 322 |
| 1002 | 3300046683 | Ga0495658_0010431 | Ga0495658_0010431_2154_3122 | 322 |
| 1003 | 3300046683 | Ga0495658_0043195 | Ga0495658_0043195_258_1226 | 322 |
| 1004 | 3300046684 | Ga0495669_0004325 | Ga0495669_0004325_4457_5425 | 322 |
| 1005 | 3300046689 | Ga0495613_0012712 | Ga0495613_0012712_906_1874 | 322 |
| 1006 | 3300046689 | Ga0495613_0013818 | Ga0495613_0013818_3018_3986 | 322 |
| 1007 | 3300046689 | Ga0495613_0033299 | Ga0495613_0033299_256_1224 | 322 |
| 1008 | 3300046689 | Ga0495613_0105399 | Ga0495613_0105399_597_1565 | 322 |
| 1009 | 3300046689 | Ga0495613_0247800 | Ga0495613_0247800_164_1132 | 322 |
| 1010 | 3300046690 | Ga0495624_0005807 | Ga0495624_0005807_1772_2740 | 322 |
| 1011 | 3300046690 | Ga0495624_0007826 | Ga0495624_0007826_5009_5977 | 322 |
| 1012 | 3300046690 | Ga0495624_0010764 | Ga0495624_0010764_960_1928 | 322 |
| 1013 | 3300046690 | Ga0495624_0029244 | Ga0495624_0029244_525_1493 | 322 |
| 1014 | 3300046690 | Ga0495624_0032844 | Ga0495624_0032844_743_1711 | 322 |
| 1015 | 3300046690 | Ga0495624_0054083 | Ga0495624_0054083_1128_2096 | 322 |
| 1016 | 3300046690 | Ga0495624_0059398 | Ga0495624_0059398_305_1273 | 322 |
| 1017 | 3300046691 | Ga0495670_0000258 | Ga0495670_0000258_23021_23989 | 322 |
| 1018 | 3300046691 | Ga0495670_0029296 | Ga0495670_0029296_414_1382 | 322 |
| 1019 | 3300046809 | Ga0495600_0000314 | Ga0495600_0000314_6222_7190 | 322 |
| 1020 | 3300046809 | Ga0495600_0001994 | Ga0495600_0001994_5203_6171 | 322 |
| 1021 | 3300046809 | Ga0495600_0047739 | Ga0495600_0047739_355_1323 | 322 |
| 1022 | 3300046809 | Ga0495600_0103975 | Ga0495600_0103975_353_1321 | 322 |
| 1023 | 3300046809 | Ga0495600_0203278 | Ga0495600_0203278_84_1052 | 322 |
| 1024 | 3300047315 | Ga0495581_0004028 | Ga0495581_0004028_5963_6931 | 322 |
| 1025 | 3300047315 | Ga0495581_0020045 | Ga0495581_0020045_181_1149 | 322 |
| 1026 | 3300047315 | Ga0495581_0047694 | Ga0495581_0047694_867_1835 | 322 |
| 1027 | 3300047317 | Ga0495604_0001137 | Ga0495604_0001137_18049_19017 | 322 |
| 1028 | 3300047317 | Ga0495604_0012931 | Ga0495604_0012931_4337_5305 | 322 |
| 1029 | 3300047317 | Ga0495604_0019823 | Ga0495604_0019823_3363_4331 | 322 |
| 1030 | 3300047317 | Ga0495604_0054739 | Ga0495604_0054739_175_1143 | 322 |
| 1031 | 3300047317 | Ga0495604_0284117 | Ga0495604_0284117_10_978 | 322 |
| 1032 | 3300047319 | Ga0495674_0088433 | Ga0495674_0088433_1314_2282 | 322 |
| 1033 | 3300047319 | Ga0495674_0144949 | Ga0495674_0144949_208_1176 | 322 |
| 1034 | 3300047319 | Ga0495674_0193450 | Ga0495674_0193450_509_1477 | 322 |
| 1035 | 3300047320 | Ga0495672_0011418 | Ga0495672_0011418_3760_4728 | 322 |
| 1036 | 3300047320 | Ga0495672_0061120 | Ga0495672_0061120_216_1184 | 322 |
| 1037 | 3300047320 | Ga0495672_0077248 | Ga0495672_0077248_222_1190 | 322 |
| 1038 | 3300047320 | Ga0495672_0169407 | Ga0495672_0169407_131_1099 | 322 |
| 1039 | 3300047321 | Ga0495676_0019882 | Ga0495676_0019882_3454_4422 | 322 |
| 1040 | 3300047321 | Ga0495676_0030061 | Ga0495676_0030061_1241_2209 | 322 |
| 1041 | 3300047322 | Ga0495680_0002499 | Ga0495680_0002499_3180_4148 | 322 |
| 1042 | 3300047322 | Ga0495680_0019888 | Ga0495680_0019888_1800_2768 | 322 |
| 1043 | 3300047322 | Ga0495680_0150915 | Ga0495680_0150915_514_1482 | 322 |
| 1044 | 3300047444 | Ga0495675_0002364 | Ga0495675_0002364_3082_4050 | 322 |
| 1045 | 3300047444 | Ga0495675_0115306 | Ga0495675_0115306_316_1284 | 322 |
| 1046 | 3300047471 | Ga0495684_0000023 | Ga0495684_0000023_88159_89127 | 322 |
| 1047 | 3300047471 | Ga0495684_0003050 | Ga0495684_0003050_2737_3705 | 322 |
| 1048 | 3300047471 | Ga0495684_0011309 | Ga0495684_0011309_4750_5718 | 322 |
| 1049 | 3300047471 | Ga0495684_0011436 | Ga0495684_0011436_1700_2668 | 322 |
| 1050 | 3300047471 | Ga0495684_0018741 | Ga0495684_0018741_3619_4587 | 322 |
| 1051 | 3300047471 | Ga0495684_0177272 | Ga0495684_0177272_264_1232 | 322 |
| 1052 | 3300047471 | Ga0495684_0190589 | Ga0495684_0190589_254_1222 | 322 |
| 1053 | 3300047471 | Ga0495684_0195250 | Ga0495684_0195250_255_1223 | 322 |
| 1054 | 3300047472 | Ga0495686_0035662 | Ga0495686_0035662_1711_2679 | 322 |
| 1055 | 3300047472 | Ga0495686_0175147 | Ga0495686_0175147_144_1112 | 322 |
| 1056 | 3300047673 | Ga0495593_0000165 | Ga0495593_0000165_17554_18522 | 322 |
| 1057 | 3300047673 | Ga0495593_0000221 | Ga0495593_0000221_28864_29832 | 322 |
| 1058 | 3300047673 | Ga0495593_0003546 | Ga0495593_0003546_3052_4020 | 322 |
| 1059 | 3300047673 | Ga0495593_0007451 | Ga0495593_0007451_40_1008 | 322 |
| 1060 | 3300047673 | Ga0495593_0047522 | Ga0495593_0047522_278_1246 | 322 |
| 1061 | 3300047673 | Ga0495593_0085274 | Ga0495593_0085274_29_997 | 322 |
| 1062 | 3300048088 | Ga0495602_0026464 | Ga0495602_0026464_4208_5176 | 322 |
| 1063 | 3300048088 | Ga0495602_0084652 | Ga0495602_0084652_1328_2296 | 322 |
| 1064 | 3300048088 | Ga0495602_0105766 | Ga0495602_0105766_1046_2014 | 322 |
| 1065 | 3300048088 | Ga0495602_0173238 | Ga0495602_0173238_304_1272 | 322 |
| 1066 | 3300048088 | Ga0495602_0247252 | Ga0495602_0247252_197_1165 | 322 |
| 1067 | 3300048089 | Ga0495614_0012122 | Ga0495614_0012122_1532_2500 | 322 |
| 1068 | 3300048089 | Ga0495614_0026074 | Ga0495614_0026074_1381_2349 | 322 |
| 1069 | 3300048089 | Ga0495614_0104589 | Ga0495614_0104589_115_1083 | 322 |
| 1070 | 3300048089 | Ga0495614_0118280 | Ga0495614_0118280_43_1011 | 322 |
| 1071 | 3300048091 | Ga0495626_0065183 | Ga0495626_0065183_97_1065 | 322 |
| 1072 | 3300048903 | Ga0496100_0114033 | Ga0496100_0114033_334_1302 | 322 |
| 1073 | 3300048904 | Ga0496101_0003066 | Ga0496101_0003066_7010_7978 | 322 |
| 1074 | 3300048905 | Ga0496102_0004610 | Ga0496102_0004610_8876_9844 | 322 |
| 1075 | 3300048905 | Ga0496102_0103280 | Ga0496102_0103280_387_1355 | 322 |
| 1076 | 3300048905 | Ga0496102_0115938 | Ga0496102_0115938_245_1213 | 322 |
| 1077 | 3300048905 | Ga0496102_0125281 | Ga0496102_0125281_72_1040 | 322 |
| 1078 | 3300048905 | Ga0496102_0321675 | Ga0496102_0321675_329_1297 | 322 |
| 1079 | 3300048906 | Ga0496103_0022889 | Ga0496103_0022889_651_1619 | 322 |
| 1080 | 3300048906 | Ga0496103_0025422 | Ga0496103_0025422_714_1682 | 322 |
| 1081 | 3300048907 | Ga0496104_0005886 | Ga0496104_0005886_3764_4732 | 322 |
| 1082 | 3300048907 | Ga0496104_0014294 | Ga0496104_0014294_1070_2038 | 322 |
| 1083 | 3300048907 | Ga0496104_0160498 | Ga0496104_0160498_593_1561 | 322 |
| 1084 | 3300048907 | Ga0496104_0336510 | Ga0496104_0336510_311_1279 | 322 |
| 1085 | 3300048908 | Ga0496105_0009152 | Ga0496105_0009152_4058_5026 | 322 |
| 1086 | 3300048908 | Ga0496105_0049567 | Ga0496105_0049567_994_1962 | 322 |
| 1087 | 3300048908 | Ga0496105_0106438 | Ga0496105_0106438_1180_2148 | 322 |
| 1088 | 3300048908 | Ga0496105_0163756 | Ga0496105_0163756_170_1138 | 322 |
| 1089 | 3300048908 | Ga0496105_0183766 | Ga0496105_0183766_603_1571 | 322 |
| 1090 | 3300048909 | Ga0496106_0000363 | Ga0496106_0000363_19213_20181 | 322 |
| 1091 | 3300048909 | Ga0496106_0018324 | Ga0496106_0018324_2336_3304 | 322 |
| 1092 | 3300048909 | Ga0496106_0018493 | Ga0496106_0018493_4042_5010 | 322 |
| 1093 | 3300048909 | Ga0496106_0039925 | Ga0496106_0039925_1822_2790 | 322 |
| 1094 | 3300048909 | Ga0496106_0082089 | Ga0496106_0082089_731_1699 | 322 |
| 1095 | 3300048910 | Ga0496107_0056799 | Ga0496107_0056799_1677_2645 | 322 |
| 1096 | 3300048910 | Ga0496107_0113218 | Ga0496107_0113218_511_1479 | 322 |
| 1097 | 3300048911 | Ga0496108_0000625 | Ga0496108_0000625_7587_8555 | 322 |
| 1098 | 3300048911 | Ga0496108_0012338 | Ga0496108_0012338_745_1713 | 322 |
| 1099 | 3300048911 | Ga0496108_0053812 | Ga0496108_0053812_1816_2784 | 322 |
| 1100 | 3300048911 | Ga0496108_0079513 | Ga0496108_0079513_477_1445 | 322 |
| 1101 | 3300048911 | Ga0496108_0157821 | Ga0496108_0157821_331_1299 | 322 |
| 1102 | 3300048912 | Ga0496109_0034392 | Ga0496109_0034392_378_1346 | 322 |
| 1103 | 3300048912 | Ga0496109_0035150 | Ga0496109_0035150_3314_4282 | 322 |
| 1104 | 3300048912 | Ga0496109_0078162 | Ga0496109_0078162_1135_2103 | 322 |
| 1105 | 3300048912 | Ga0496109_0092263 | Ga0496109_0092263_232_1200 | 322 |
| 1106 | 3300048912 | Ga0496109_0523395 | Ga0496109_0523395_137_1105 | 322 |
| 1107 | 3300048913 | Ga0496110_0023859 | Ga0496110_0023859_1200_2168 | 322 |
| 1108 | 3300048913 | Ga0496110_0029464 | Ga0496110_0029464_1055_2023 | 322 |
| 1109 | 3300048913 | Ga0496110_0123106 | Ga0496110_0123106_872_1840 | 322 |
| 1110 | 3300048914 | Ga0496111_0031776 | Ga0496111_0031776_1380_2348 | 322 |
| 1111 | 3300048914 | Ga0496111_0032439 | Ga0496111_0032439_1904_2872 | 322 |
| 1112 | 3300048914 | Ga0496111_0283191 | Ga0496111_0283191_140_1108 | 322 |
| 1113 | 3300048915 | Ga0496112_0000031 | Ga0496112_0000031_26227_27195 | 322 |
| 1114 | 3300048915 | Ga0496112_0015495 | Ga0496112_0015495_4501_5469 | 322 |
| 1115 | 3300048915 | Ga0496112_0032484 | Ga0496112_0032484_3343_4311 | 322 |
| 1116 | 3300048915 | Ga0496112_0102666 | Ga0496112_0102666_1708_2676 | 322 |
| 1117 | 3300048915 | Ga0496112_0139351 | Ga0496112_0139351_195_1163 | 322 |
| 1118 | 3300048915 | Ga0496112_0175574 | Ga0496112_0175574_394_1362 | 322 |
| 1119 | 3300048915 | Ga0496112_0410920 | Ga0496112_0410920_75_1043 | 322 |
| 1120 | 3300048916 | Ga0496113_0000087 | Ga0496113_0000087_237_1205 | 322 |
| 1121 | 3300048916 | Ga0496113_0076481 | Ga0496113_0076481_461_1429 | 322 |
| 1122 | 3300048917 | Ga0496114_0047001 | Ga0496114_0047001_1080_2048 | 322 |
| 1123 | 3300048918 | Ga0496115_0000713 | Ga0496115_0000713_12127_13095 | 322 |
| 1124 | 3300048918 | Ga0496115_0055903 | Ga0496115_0055903_148_1116 | 322 |
| 1125 | 3300048918 | Ga0496115_0093325 | Ga0496115_0093325_424_1392 | 322 |
| 1126 | 3300048919 | Ga0496116_0082401 | Ga0496116_0082401_160_1128 | 322 |
| 1127 | 3300048920 | Ga0496117_0075134 | Ga0496117_0075134_1071_2039 | 322 |
| 1128 | 3300048921 | Ga0496118_0002080 | Ga0496118_0002080_20051_21019 | 322 |
| 1129 | 3300048921 | Ga0496118_0102331 | Ga0496118_0102331_76_1047 | 322 |
| 1130 | 3300048923 | Ga0496120_0010096 | Ga0496120_0010096_35_1003 | 322 |
| 1131 | 3300048924 | Ga0496121_0000183 | Ga0496121_0000183_81074_82042 | 322 |
| 1132 | 3300048924 | Ga0496121_0000407 | Ga0496121_0000407_55941_56909 | 322 |
| 1133 | 3300048924 | Ga0496121_0001403 | Ga0496121_0001403_37078_38046 | 322 |
| 1134 | 3300048924 | Ga0496121_0020343 | Ga0496121_0020343_2908_3876 | 322 |
| 1135 | 3300048924 | Ga0496121_0027667 | Ga0496121_0027667_797_1771 | 322 |
| 1136 | 3300048924 | Ga0496121_0048678 | Ga0496121_0048678_2018_2986 | 322 |
| 1137 | 3300048924 | Ga0496121_0088209 | Ga0496121_0088209_839_1807 | 322 |
| 1138 | 3300048924 | Ga0496121_0108085 | Ga0496121_0108085_943_1911 | 322 |
| 1139 | 3300048924 | Ga0496121_0136647 | Ga0496121_0136647_836_1804 | 322 |
| 1140 | 3300048926 | Ga0496123_0028711 | Ga0496123_0028711_274_1242 | 322 |
| 1141 | 3300048926 | Ga0496123_0035502 | Ga0496123_0035502_2467_3435 | 322 |
| 1142 | 3300048926 | Ga0496123_0087889 | Ga0496123_0087889_395_1363 | 322 |
| 1143 | 3300048927 | Ga0496124_0010967 | Ga0496124_0010967_65_1033 | 322 |
| 1144 | 3300048927 | Ga0496124_0068590 | Ga0496124_0068590_567_1538 | 322 |
| 1145 | 3300048927 | Ga0496124_0240919 | Ga0496124_0240919_201_1169 | 322 |
| 1146 | 3300048928 | Ga0496125_0000090 | Ga0496125_0000090_133841_134809 | 322 |
| 1147 | 3300048928 | Ga0496125_0001219 | Ga0496125_0001219_9766_10740 | 322 |
| 1148 | 3300048928 | Ga0496125_0001713 | Ga0496125_0001713_16213_17181 | 322 |
| 1149 | 3300048928 | Ga0496125_0022884 | Ga0496125_0022884_3540_4511 | 322 |
| 1150 | 3300048928 | Ga0496125_0025195 | Ga0496125_0025195_3775_4746 | 322 |
| 1151 | 3300048928 | Ga0496125_0082459 | Ga0496125_0082459_696_1664 | 322 |
| 1152 | 3300048929 | Ga0496126_0008974 | Ga0496126_0008974_6449_7417 | 322 |
| 1153 | 3300048929 | Ga0496126_0010266 | Ga0496126_0010266_2063_3031 | 322 |
| 1154 | 3300048929 | Ga0496126_0028595 | Ga0496126_0028595_4032_5006 | 322 |
| 1155 | 3300048929 | Ga0496126_0043018 | Ga0496126_0043018_2142_3110 | 322 |
| 1156 | 3300048929 | Ga0496126_0059498 | Ga0496126_0059498_1534_2502 | 322 |
| 1157 | 3300048929 | Ga0496126_0079627 | Ga0496126_0079627_1908_2879 | 322 |
| 1158 | 3300048929 | Ga0496126_0090067 | Ga0496126_0090067_434_1402 | 322 |
| 1159 | 3300048929 | Ga0496126_0123540 | Ga0496126_0123540_1250_2218 | 322 |
| 1160 | 3300048929 | Ga0496126_0307307 | Ga0496126_0307307_253_1221 | 322 |
| 1161 | 3300049568 | Ga0501031_0008429 | Ga0501031_0008429_1714_2682 | 322 |
| 1162 | 3300049568 | Ga0501031_0013071 | Ga0501031_0013071_3714_4682 | 322 |
| 1163 | 3300049569 | Ga0501032_0000087 | Ga0501032_0000087_67644_68612 | 322 |
| 1164 | 3300049569 | Ga0501032_0005128 | Ga0501032_0005128_8692_9660 | 322 |
| 1165 | 3300049569 | Ga0501032_0016894 | Ga0501032_0016894_961_1929 | 322 |
| 1166 | 3300049569 | Ga0501032_0019804 | Ga0501032_0019804_1332_2300 | 322 |
| 1167 | 3300049569 | Ga0501032_0030627 | Ga0501032_0030627_742_1710 | 322 |
| 1168 | 3300049569 | Ga0501032_0034125 | Ga0501032_0034125_884_1852 | 322 |
| 1169 | 3300049570 | Ga0501033_0000181 | Ga0501033_0000181_42686_43654 | 322 |
| 1170 | 3300049570 | Ga0501033_0000510 | Ga0501033_0000510_17570_18538 | 322 |
| 1171 | 3300049570 | Ga0501033_0003261 | Ga0501033_0003261_10171_11139 | 322 |
| 1172 | 3300049571 | Ga0501034_0000021 | Ga0501034_0000021_205249_206217 | 322 |
| 1173 | 3300049571 | Ga0501034_0000211 | Ga0501034_0000211_85505_86473 | 322 |
| 1174 | 3300049571 | Ga0501034_0003829 | Ga0501034_0003829_14535_15503 | 322 |
| 1175 | 3300049571 | Ga0501034_0009992 | Ga0501034_0009992_7487_8455 | 322 |
| 1176 | 3300049571 | Ga0501034_0061016 | Ga0501034_0061016_1954_2922 | 322 |
| 1177 | 3300049571 | Ga0501034_0089287 | Ga0501034_0089287_1970_2938 | 322 |
| 1178 | 3300049571 | Ga0501034_0114284 | Ga0501034_0114284_894_1862 | 322 |
| 1179 | 3300049571 | Ga0501034_0435722 | Ga0501034_0435722_224_1192 | 322 |
| 1180 | 3300049572 | Ga0501036_0000069 | Ga0501036_0000069_40972_41940 | 322 |
| 1181 | 3300049572 | Ga0501036_0024390 | Ga0501036_0024390_3893_4861 | 322 |
| 1182 | 3300049572 | Ga0501036_0043219 | Ga0501036_0043219_2405_3373 | 322 |
| 1183 | 3300049572 | Ga0501036_0093787 | Ga0501036_0093787_1186_2154 | 322 |
| 1184 | 3300049572 | Ga0501036_0175379 | Ga0501036_0175379_391_1359 | 322 |
| 1185 | 3300049573 | Ga0501037_0000034 | Ga0501037_0000034_4417_5385 | 322 |
| 1186 | 3300049573 | Ga0501037_0002667 | Ga0501037_0002667_7152_8120 | 322 |
| 1187 | 3300049573 | Ga0501037_0010155 | Ga0501037_0010155_2177_3145 | 322 |
| 1188 | 3300049573 | Ga0501037_0033876 | Ga0501037_0033876_2195_3163 | 322 |
| 1189 | 3300049573 | Ga0501037_0063822 | Ga0501037_0063822_980_1948 | 322 |
| 1190 | 3300049574 | Ga0501038_0000628 | Ga0501038_0000628_14273_15241 | 322 |
| 1191 | 3300049574 | Ga0501038_0001570 | Ga0501038_0001570_5228_6196 | 322 |
| 1192 | 3300049574 | Ga0501038_0007511 | Ga0501038_0007511_4714_5682 | 322 |
| 1193 | 3300049574 | Ga0501038_0081851 | Ga0501038_0081851_566_1534 | 322 |
| 1194 | 3300049574 | Ga0501038_0264278 | Ga0501038_0264278_326_1294 | 322 |
| 1195 | 3300049575 | Ga0501039_0000931 | Ga0501039_0000931_15215_16183 | 322 |
| 1196 | 3300049575 | Ga0501039_0081486 | Ga0501039_0081486_28_996 | 322 |
| 1197 | 3300049575 | Ga0501039_0087487 | Ga0501039_0087487_67_1035 | 322 |
| 1198 | 3300049577 | Ga0501041_0166749 | Ga0501041_0166749_80_1048 | 322 |
| 1199 | 3300049578 | Ga0501042_0013413 | Ga0501042_0013413_643_1611 | 322 |
| 1200 | 3300049578 | Ga0501042_0026741 | Ga0501042_0026741_252_1220 | 322 |
| 1201 | 3300049578 | Ga0501042_0131408 | Ga0501042_0131408_626_1594 | 322 |
| 1202 | 3300049579 | Ga0501043_0000033 | Ga0501043_0000033_124372_125340 | 322 |
| 1203 | 3300049579 | Ga0501043_0009976 | Ga0501043_0009976_4218_5186 | 322 |
| 1204 | 3300049579 | Ga0501043_0012412 | Ga0501043_0012412_2682_3650 | 322 |
| 1205 | 3300049579 | Ga0501043_0023684 | Ga0501043_0023684_3281_4249 | 322 |
| 1206 | 3300049579 | Ga0501043_0030178 | Ga0501043_0030178_725_1693 | 322 |
| 1207 | 3300049579 | Ga0501043_0224348 | Ga0501043_0224348_309_1277 | 322 |
| 1208 | 3300049580 | Ga0501046_0000412 | Ga0501046_0000412_39198_40166 | 322 |
| 1209 | 3300049580 | Ga0501046_0002043 | Ga0501046_0002043_2488_3456 | 322 |
| 1210 | 3300049580 | Ga0501046_0039760 | Ga0501046_0039760_814_1782 | 322 |
| 1211 | 3300049580 | Ga0501046_0048020 | Ga0501046_0048020_1114_2082 | 322 |
| 1212 | 3300049580 | Ga0501046_0072996 | Ga0501046_0072996_498_1466 | 322 |
| 1213 | 3300049580 | Ga0501046_0084232 | Ga0501046_0084232_851_1819 | 322 |
| 1214 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_271024_271992 | 322 |
| 1215 | 3300049581 | Ga0501047_0000434 | Ga0501047_0000434_45391_46359 | 322 |
| 1216 | 3300049581 | Ga0501047_0007147 | Ga0501047_0007147_2839_3807 | 322 |
| 1217 | 3300049581 | Ga0501047_0048439 | Ga0501047_0048439_610_1578 | 322 |
| 1218 | 3300049581 | Ga0501047_0102401 | Ga0501047_0102401_174_1142 | 322 |
| 1219 | 3300049581 | Ga0501047_0226226 | Ga0501047_0226226_125_1093 | 322 |
| 1220 | 3300049582 | Ga0501048_0000290 | Ga0501048_0000290_10466_11434 | 322 |
| 1221 | 3300049582 | Ga0501048_0001809 | Ga0501048_0001809_10818_11786 | 322 |
| 1222 | 3300049582 | Ga0501048_0007260 | Ga0501048_0007260_4243_5211 | 322 |
| 1223 | 3300049582 | Ga0501048_0032399 | Ga0501048_0032399_2201_3169 | 322 |
| 1224 | 3300049583 | Ga0501067_0000067 | Ga0501067_0000067_12150_13118 | 322 |
| 1225 | 3300049583 | Ga0501067_0000477 | Ga0501067_0000477_11480_12448 | 322 |
| 1226 | 3300049583 | Ga0501067_0028186 | Ga0501067_0028186_193_1161 | 322 |
| 1227 | 3300049584 | Ga0501068_0000742 | Ga0501068_0000742_9641_10609 | 322 |
| 1228 | 3300049584 | Ga0501068_0001335 | Ga0501068_0001335_2855_3823 | 322 |
| 1229 | 3300049584 | Ga0501068_0018982 | Ga0501068_0018982_1339_2307 | 322 |
| 1230 | 3300049584 | Ga0501068_0023768 | Ga0501068_0023768_2440_3408 | 322 |
| 1231 | 3300049585 | Ga0501069_0004553 | Ga0501069_0004553_1798_2766 | 322 |
| 1232 | 3300049585 | Ga0501069_0022381 | Ga0501069_0022381_989_1957 | 322 |
| 1233 | 3300049585 | Ga0501069_0090686 | Ga0501069_0090686_262_1230 | 322 |
| 1234 | 3300049586 | Ga0501070_0002965 | Ga0501070_0002965_5077_6045 | 322 |
| 1235 | 3300049586 | Ga0501070_0068121 | Ga0501070_0068121_485_1453 | 322 |
| 1236 | 3300049586 | Ga0501070_0082127 | Ga0501070_0082127_626_1594 | 322 |
| 1237 | 3300049586 | Ga0501070_0106575 | Ga0501070_0106575_723_1691 | 322 |
| 1238 | 3300049587 | Ga0501071_0037987 | Ga0501071_0037987_2287_3255 | 322 |
| 1239 | 3300049588 | Ga0501072_0000515 | Ga0501072_0000515_6005_6973 | 322 |
| 1240 | 3300049588 | Ga0501072_0002718 | Ga0501072_0002718_243_1211 | 322 |
| 1241 | 3300049588 | Ga0501072_0032950 | Ga0501072_0032950_1536_2504 | 322 |
| 1242 | 3300049589 | Ga0501073_0000144 | Ga0501073_0000144_14452_15420 | 322 |
| 1243 | 3300049589 | Ga0501073_0032555 | Ga0501073_0032555_1712_2680 | 322 |
| 1244 | 3300049589 | Ga0501073_0038197 | Ga0501073_0038197_626_1594 | 322 |
| 1245 | 3300049589 | Ga0501073_0090037 | Ga0501073_0090037_706_1674 | 322 |
| 1246 | 3300049590 | Ga0501074_0000675 | Ga0501074_0000675_11890_12858 | 322 |
| 1247 | 3300049590 | Ga0501074_0001696 | Ga0501074_0001696_13618_14586 | 322 |
| 1248 | 3300049590 | Ga0501074_0013775 | Ga0501074_0013775_1115_2083 | 322 |
| 1249 | 3300049590 | Ga0501074_0016400 | Ga0501074_0016400_2045_3013 | 322 |
| 1250 | 3300049590 | Ga0501074_0025795 | Ga0501074_0025795_19_987 | 322 |
| 1251 | 3300049591 | Ga0501075_0028447 | Ga0501075_0028447_222_1190 | 322 |
| 1252 | 3300049592 | Ga0501076_0056868 | Ga0501076_0056868_242_1210 | 322 |
| 1253 | 3300049741 | Ga0501079_0007639 | Ga0501079_0007639_5786_6754 | 322 |
| 1254 | 3300049741 | Ga0501079_0013242 | Ga0501079_0013242_4945_5913 | 322 |
| 1255 | 3300049741 | Ga0501079_0127854 | Ga0501079_0127854_888_1856 | 322 |
| 1256 | 3300049741 | Ga0501079_0150611 | Ga0501079_0150611_808_1776 | 322 |
| 1257 | 3300049741 | Ga0501079_0266487 | Ga0501079_0266487_212_1180 | 322 |
| 1258 | 3300049742 | Ga0501080_0001018 | Ga0501080_0001018_477_1445 | 322 |
| 1259 | 3300049742 | Ga0501080_0005763 | Ga0501080_0005763_5568_6536 | 322 |
| 1260 | 3300049742 | Ga0501080_0031077 | Ga0501080_0031077_2222_3190 | 322 |
| 1261 | 3300049742 | Ga0501080_0032014 | Ga0501080_0032014_1186_2154 | 322 |
| 1262 | 3300049742 | Ga0501080_0054631 | Ga0501080_0054631_1656_2624 | 322 |
| 1263 | 3300049742 | Ga0501080_0107099 | Ga0501080_0107099_1365_2333 | 322 |
| 1264 | 3300049742 | Ga0501080_0116972 | Ga0501080_0116972_1488_2456 | 322 |
| 1265 | 3300049743 | Ga0501081_0071478 | Ga0501081_0071478_390_1358 | 322 |
| 1266 | 3300049744 | Ga0501083_0000192 | Ga0501083_0000192_17792_18760 | 322 |
| 1267 | 3300049744 | Ga0501083_0000756 | Ga0501083_0000756_5511_6479 | 322 |
| 1268 | 3300049744 | Ga0501083_0000803 | Ga0501083_0000803_16613_17581 | 322 |
| 1269 | 3300049744 | Ga0501083_0125118 | Ga0501083_0125118_618_1586 | 322 |
| 1270 | 3300049744 | Ga0501083_0138277 | Ga0501083_0138277_323_1291 | 322 |
| 1271 | 3300049822 | Ga0501035_0000323 | Ga0501035_0000323_43850_44818 | 322 |
| 1272 | 3300049822 | Ga0501035_0002209 | Ga0501035_0002209_7749_8717 | 322 |
| 1273 | 3300049822 | Ga0501035_0028072 | Ga0501035_0028072_2900_3868 | 322 |
| 1274 | 3300049822 | Ga0501035_0072007 | Ga0501035_0072007_1871_2839 | 322 |
| 1275 | 3300049823 | Ga0501044_0000181 | Ga0501044_0000181_56818_57786 | 322 |
| 1276 | 3300049823 | Ga0501044_0004415 | Ga0501044_0004415_7077_8045 | 322 |
| 1277 | 3300049823 | Ga0501044_0037155 | Ga0501044_0037155_1725_2693 | 322 |
| 1278 | 3300049823 | Ga0501044_0054245 | Ga0501044_0054245_462_1430 | 322 |
| 1279 | 3300049823 | Ga0501044_0083608 | Ga0501044_0083608_1509_2477 | 322 |
| 1280 | 3300049823 | Ga0501044_0104855 | Ga0501044_0104855_391_1359 | 322 |
| 1281 | 3300049823 | Ga0501044_0119143 | Ga0501044_0119143_666_1634 | 322 |
| 1282 | 3300049823 | Ga0501044_0119891 | Ga0501044_0119891_1355_2323 | 322 |
| 1283 | 3300049823 | Ga0501044_0193463 | Ga0501044_0193463_348_1316 | 322 |
| 1284 | 3300049823 | Ga0501044_0237831 | Ga0501044_0237831_574_1542 | 322 |
| 1285 | 3300049823 | Ga0501044_0288826 | Ga0501044_0288826_566_1534 | 322 |
| 1286 | 3300049823 | Ga0501044_0310631 | Ga0501044_0310631_426_1394 | 322 |
| 1287 | 3300049824 | Ga0501045_0006122 | Ga0501045_0006122_3633_4601 | 322 |
| 1288 | 3300049824 | Ga0501045_0110078 | Ga0501045_0110078_163_1131 | 322 |
| 1289 | 3300050490 | nmdc:mga03n38_894_c1 | nmdc:mga03n38_894_c1_539_1507 | 322 |
| 1290 | 3300050492 | nmdc:mga0yw44_103754_c1 | nmdc:mga0yw44_103754_c1_493_1461 | 322 |
| 1291 | 3300050492 | nmdc:mga0yw44_24388_c1 | nmdc:mga0yw44_24388_c1_2302_3270 | 322 |
| 1292 | 3300050493 | nmdc:mga0k408_2338_c1 | nmdc:mga0k408_2338_c1_7680_8648 | 322 |
| 1293 | 3300050493 | nmdc:mga0k408_8984_c1 | nmdc:mga0k408_8984_c1_2553_3521 | 322 |
| 1294 | 3300050494 | nmdc:mga06z11_43306_c1 | nmdc:mga06z11_43306_c1_900_1868 | 322 |
| 1295 | 3300050495 | nmdc:mga04h51_22683_c1 | nmdc:mga04h51_22683_c1_68_1036 | 322 |
| 1296 | 3300050496 | nmdc:mga07m45_20249_c1 | nmdc:mga07m45_20249_c1_315_1283 | 322 |
| 1297 | 3300050496 | nmdc:mga07m45_49122_c2 | nmdc:mga07m45_49122_c2_31_999 | 322 |
| 1298 | 3300050507 | nmdc:mga05p37_8896_c1 | nmdc:mga05p37_8896_c1_6762_7730 | 322 |
| 1299 | 3300050512 | nmdc:mga0n895_173857_c1 | nmdc:mga0n895_173857_c1_695_1663 | 322 |
| 1300 | 3300050514 | nmdc:mga08x19_4_c2 | nmdc:mga08x19_4_c2_29027_29995 | 322 |
| 1301 | 3300053077 | Ga0495601_0048214 | Ga0495601_0048214_761_1729 | 322 |
| 1302 | 3300053077 | Ga0495601_0065747 | Ga0495601_0065747_308_1276 | 322 |
| 1303 | 3300053077 | Ga0495601_0067781 | Ga0495601_0067781_333_1301 | 322 |
| 1304 | 3300053077 | Ga0495601_0095205 | Ga0495601_0095205_472_1440 | 322 |
| 1305 | 3300053084 | Ga0495595_0000218 | Ga0495595_0000218_81_1049 | 322 |
| 1306 | 3300053084 | Ga0495595_0015072 | Ga0495595_0015072_1450_2418 | 322 |
| 1307 | 3300053085 | Ga0495619_0000111 | Ga0495619_0000111_23660_24628 | 322 |
| 1308 | 3300053085 | Ga0495619_0003381 | Ga0495619_0003381_874_1842 | 322 |
| 1309 | 3300053085 | Ga0495619_0043944 | Ga0495619_0043944_1945_2913 | 322 |
| 1310 | 3300053085 | Ga0495619_0045960 | Ga0495619_0045960_865_1833 | 322 |
| 1311 | 3300053087 | Ga0500643_000015 | Ga0500643_000015_114634_115602 | 322 |
| 1312 | 3300053093 | Ga0500651_0061510 | Ga0500651_0061510_1202_2170 | 322 |
| 1313 | 3300053094 | Ga0500566_0000028 | Ga0500566_0000028_52458_53426 | 322 |
| 1314 | 3300053094 | Ga0500566_0000249 | Ga0500566_0000249_9534_10502 | 322 |
| 1315 | 3300053094 | Ga0500566_0001671 | Ga0500566_0001671_3359_4327 | 322 |
| 1316 | 3300053094 | Ga0500566_0006790 | Ga0500566_0006790_2250_3218 | 322 |
| 1317 | 3300053096 | Ga0500641_0010046 | Ga0500641_0010046_1823_2791 | 322 |
| 1318 | 3300053103 | Ga0500555_003873 | Ga0500555_003873_3043_4011 | 322 |
| 1319 | 3300053104 | Ga0500556_0000004 | Ga0500556_0000004_309693_310661 | 322 |
| 1320 | 3300053105 | Ga0500557_000110 | Ga0500557_000110_21747_22715 | 322 |
| 1321 | 3300053111 | Ga0500572_000420 | Ga0500572_000420_2801_3769 | 322 |
| 1322 | 3300053111 | Ga0500572_001411 | Ga0500572_001411_4666_5637 | 322 |
| 1323 | 3300053116 | Ga0500592_002327 | Ga0500592_002327_358_1326 | 322 |
| 1324 | 3300053117 | Ga0500593_019912 | Ga0500593_019912_262_1230 | 322 |
| 1325 | 3300053119 | Ga0500595_000590 | Ga0500595_000590_17417_18385 | 322 |
| 1326 | 3300053121 | Ga0500607_039728 | Ga0500607_039728_851_1819 | 322 |
| 1327 | 3300053122 | Ga0500608_008414 | Ga0500608_008414_1829_2797 | 322 |
| 1328 | 3300053122 | Ga0500608_040527 | Ga0500608_040527_906_1874 | 322 |
| 1329 | 3300053122 | Ga0500608_097487 | Ga0500608_097487_210_1178 | 322 |
| 1330 | 3300053125 | Ga0500618_009095 | Ga0500618_009095_1498_2466 | 322 |
| 1331 | 3300053130 | Ga0500642_0000036 | Ga0500642_0000036_80711_81679 | 322 |
| 1332 | 3300053130 | Ga0500642_0000086 | Ga0500642_0000086_23026_23994 | 322 |
| 1333 | 3300053130 | Ga0500642_0085036 | Ga0500642_0085036_71_1039 | 322 |
| 1334 | 3300053131 | Ga0500652_000837 | Ga0500652_000837_7911_8879 | 322 |
| 1335 | 3300053136 | Ga0500559_0000154 | Ga0500559_0000154_49714_50685 | 322 |
| 1336 | 3300053136 | Ga0500559_0003041 | Ga0500559_0003041_3305_4279 | 322 |
| 1337 | 3300053136 | Ga0500559_0004402 | Ga0500559_0004402_333_1301 | 322 |
| 1338 | 3300053139 | Ga0500568_0000599 | Ga0500568_0000599_16021_16989 | 322 |
| 1339 | 3300053139 | Ga0500568_0003668 | Ga0500568_0003668_3921_4889 | 322 |
| 1340 | 3300053139 | Ga0500568_0008132 | Ga0500568_0008132_917_1885 | 322 |
| 1341 | 3300053142 | Ga0500577_0000074 | Ga0500577_0000074_2335_3309 | 322 |
| 1342 | 3300053142 | Ga0500577_0069081 | Ga0500577_0069081_46_1014 | 322 |
| 1343 | 3300053145 | Ga0500586_003626 | Ga0500586_003626_196_1164 | 322 |
| 1344 | 3300053148 | Ga0500590_057344 | Ga0500590_057344_858_1826 | 322 |
| 1345 | 3300053148 | Ga0500590_069197 | Ga0500590_069197_215_1183 | 322 |
| 1346 | 3300053150 | Ga0500603_001125 | Ga0500603_001125_4915_5883 | 322 |
| 1347 | 3300053151 | Ga0500604_0002371 | Ga0500604_0002371_813_1781 | 322 |
| 1348 | 3300053151 | Ga0500604_0021396 | Ga0500604_0021396_649_1617 | 322 |
| 1349 | 3300053153 | Ga0500616_0000014 | Ga0500616_0000014_337027_337995 | 322 |
| 1350 | 3300053153 | Ga0500616_0000325 | Ga0500616_0000325_6713_7681 | 322 |
| 1351 | 3300053153 | Ga0500616_0007667 | Ga0500616_0007667_116_1084 | 322 |
| 1352 | 3300053154 | Ga0500619_002452 | Ga0500619_002452_548_1516 | 322 |
| 1353 | 3300053156 | Ga0500622_0003210 | Ga0500622_0003210_8097_9065 | 322 |
| 1354 | 3300053158 | Ga0500627_0019326 | Ga0500627_0019326_967_1935 | 322 |
| 1355 | 3300053158 | Ga0500627_0108383 | Ga0500627_0108383_167_1135 | 322 |
| 1356 | 3300053161 | Ga0500634_0031888 | Ga0500634_0031888_1625_2593 | 322 |
| 1357 | 3300053163 | Ga0500639_000001 | Ga0500639_000001_136837_137805 | 322 |
| 1358 | 3300053177 | Ga0500636_0000151 | Ga0500636_0000151_32761_33729 | 322 |
| 1359 | 3300053177 | Ga0500636_0005425 | Ga0500636_0005425_2967_3935 | 322 |
| 1360 | 3300053178 | Ga0500637_0000751 | Ga0500637_0000751_3435_4403 | 322 |
| 1361 | 3300053178 | Ga0500637_0111130 | Ga0500637_0111130_361_1329 | 322 |
| 1362 | 3300053737 | Ga0500601_000098 | Ga0500601_000098_3785_4753 | 322 |
| 1363 | 3300054114 | Ga0501084_0007759 | Ga0501084_0007759_4828_5796 | 322 |
| 1364 | 3300054114 | Ga0501084_0044564 | Ga0501084_0044564_107_1075 | 322 |
| 1365 | 3300054114 | Ga0501084_0068379 | Ga0501084_0068379_548_1516 | 322 |
| 1366 | 3300054114 | Ga0501084_0092897 | Ga0501084_0092897_1380_2348 | 322 |
| 1367 | 3300054114 | Ga0501084_0219092 | Ga0501084_0219092_513_1481 | 322 |
| 1368 | 3300060353 | Ga0501082_0000025 | Ga0501082_0000025_98271_99239 | 322 |
| 1369 | 3300060353 | Ga0501082_0010489 | Ga0501082_0010489_6623_7591 | 322 |
| 1370 | 3300060353 | Ga0501082_0041736 | Ga0501082_0041736_1551_2519 | 322 |
| 1371 | 3300060353 | Ga0501082_0263232 | Ga0501082_0263232_109_1077 | 322 |
| 1372 | 3300061719 | Ga0466962_0094305 | Ga0466962_0094305_359_1327 | 322 |
| 1373 | 3300031241 | Ga0265325_10000098 | Ga0265325_1000009837 | 323 |
| 1374 | 3300031249 | Ga0265339_10001071 | Ga0265339_1000107113 | 323 |
| 1375 | 3300031344 | Ga0265316_10024242 | Ga0265316_100242422 | 323 |
| 1376 | 3300031344 | Ga0265316_10315327 | Ga0265316_103153271 | 323 |
| 1377 | 3300031595 | Ga0265313_10009753 | Ga0265313_100097533 | 323 |
| 1378 | 3300048907 | Ga0496104_0077274 | Ga0496104_0077274_710_1753 | 327 |
| 1379 | iso_pu_bacteria | 8054563764 | 8054566525 | 328 |
| 1380 | 3300034819 | Ga0373958_0015432 | Ga0373958_0015432_250_1293 | 329 |
| 1381 | 3300048929 | Ga0496126_0008736 | Ga0496126_0008736_7689_8717 | 329 |
| 1382 | 3300049570 | Ga0501033_0081180 | Ga0501033_0081180_212_1252 | 329 |
| 1383 | 3300049581 | Ga0501047_0085492 | Ga0501047_0085492_889_1929 | 329 |
| 1384 | 3300049823 | Ga0501044_0162321 | Ga0501044_0162321_454_1494 | 329 |
| 1385 | 3300049572 | Ga0501036_0233897 | Ga0501036_0233897_414_1457 | 330 |
| 1386 | 3300053093 | Ga0500651_0001257 | Ga0500651_0001257_7984_9021 | 336 |
| 1387 | 3300053156 | Ga0500622_0117062 | Ga0500622_0117062_99_1136 | 336 |
| 1388 | 3300005347 | Ga0070668_100117981 | Ga0070668_1001179812 | 339 |
| 1389 | iso_pu_bacteria | 2917554339 | 2917556993 | 341 |
| 1390 | iso_pu_bacteria | 2922386360 | 2922390895 | 341 |
| 1391 | iso_pu_bacteria | 8006964411 | 8006965652 | 341 |
| 1392 | 3300005434 | Ga0070709_10001622 | Ga0070709_100016227 | 342 |
| 1393 | 3300005434 | Ga0070709_10149410 | Ga0070709_101494102 | 342 |
| 1394 | 3300005435 | Ga0070714_100022464 | Ga0070714_1000224642 | 342 |
| 1395 | 3300005436 | Ga0070713_100000004 | Ga0070713_100000004157 | 342 |
| 1396 | 3300005437 | Ga0070710_10116230 | Ga0070710_101162302 | 342 |
| 1397 | 3300005439 | Ga0070711_100076705 | Ga0070711_1000767052 | 342 |
| 1398 | 3300005535 | Ga0070684_100055068 | Ga0070684_1000550683 | 342 |
| 1399 | 3300005539 | Ga0068853_100023426 | Ga0068853_1000234262 | 342 |
| 1400 | 3300005545 | Ga0070695_100003134 | Ga0070695_1000031342 | 342 |
| 1401 | 3300005563 | Ga0068855_100045775 | Ga0068855_1000457752 | 342 |
| 1402 | 3300005564 | Ga0070664_100082541 | Ga0070664_1000825413 | 342 |
| 1403 | 3300005577 | Ga0068857_100000944 | Ga0068857_10000094419 | 342 |
| 1404 | 3300005614 | Ga0068856_100000144 | Ga0068856_10000014451 | 342 |
| 1405 | 3300005614 | Ga0068856_100001349 | Ga0068856_10000134912 | 342 |
| 1406 | 3300005616 | Ga0068852_100008781 | Ga0068852_1000087814 | 342 |
| 1407 | 3300006175 | Ga0070712_100000358 | Ga0070712_10000035812 | 342 |
| 1408 | 3300006237 | Ga0097621_100194270 | Ga0097621_1001942702 | 342 |
| 1409 | 3300006914 | Ga0075436_100009384 | Ga0075436_1000093843 | 342 |
| 1410 | 3300009093 | Ga0105240_10001917 | Ga0105240_1000191719 | 342 |
| 1411 | 3300009174 | Ga0105241_10001171 | Ga0105241_100011712 | 342 |
| 1412 | 3300009545 | Ga0105237_10003815 | Ga0105237_1000381512 | 342 |
| 1413 | 3300009551 | Ga0105238_10000639 | Ga0105238_1000063919 | 342 |
| 1414 | 3300010375 | Ga0105239_10106443 | Ga0105239_101064433 | 342 |
| 1415 | 3300013100 | Ga0157373_10013340 | Ga0157373_100133403 | 342 |
| 1416 | 3300013104 | Ga0157370_10007043 | Ga0157370_100070435 | 342 |
| 1417 | 3300013105 | Ga0157369_10039221 | Ga0157369_100392212 | 342 |
| 1418 | 3300013297 | Ga0157378_10104209 | Ga0157378_101042092 | 342 |
| 1419 | 3300013307 | Ga0157372_10038507 | Ga0157372_100385075 | 342 |
| 1420 | 3300025898 | Ga0207692_10123861 | Ga0207692_101238612 | 342 |
| 1421 | 3300025906 | Ga0207699_10000607 | Ga0207699_100006079 | 342 |
| 1422 | 3300025906 | Ga0207699_10224595 | Ga0207699_102245951 | 342 |
| 1423 | 3300025913 | Ga0207695_10010607 | Ga0207695_100106076 | 342 |
| 1424 | 3300025915 | Ga0207693_10001087 | Ga0207693_100010875 | 342 |
| 1425 | 3300025916 | Ga0207663_10247396 | Ga0207663_102473961 | 342 |
| 1426 | 3300025924 | Ga0207694_10026888 | Ga0207694_100268883 | 342 |
| 1427 | 3300025928 | Ga0207700_10000011 | Ga0207700_10000011150 | 342 |
| 1428 | 3300025929 | Ga0207664_10105526 | Ga0207664_101055263 | 342 |
| 1429 | 3300025945 | Ga0207679_10184476 | Ga0207679_101844762 | 342 |
| 1430 | 3300025949 | Ga0207667_10073167 | Ga0207667_100731672 | 342 |
| 1431 | 3300025981 | Ga0207640_10103261 | Ga0207640_101032611 | 342 |
| 1432 | 3300026035 | Ga0207703_10492404 | Ga0207703_104924041 | 342 |
| 1433 | 3300026078 | Ga0207702_10000226 | Ga0207702_100002269 | 342 |
| 1434 | 3300026078 | Ga0207702_10002060 | Ga0207702_100020606 | 342 |
| 1435 | 3300026116 | Ga0207674_10000261 | Ga0207674_1000026134 | 342 |
| 1436 | 3300026142 | Ga0207698_10019754 | Ga0207698_100197542 | 342 |
| 1437 | 3300048917 | Ga0496114_0294811 | Ga0496114_0294811_50_1078 | 342 |
| 1438 | 3300049585 | Ga0501069_0172576 | Ga0501069_0172576_185_1213 | 342 |
| 1439 | 3300050514 | nmdc:mga08x19_129_c1 | nmdc:mga08x19_129_c1_55582_56610 | 342 |
| 1440 | 3300050514 | nmdc:mga08x19_67627_c1 | nmdc:mga08x19_67627_c1_775_1803 | 342 |
| 1441 | 3300050510 | nmdc:mga06r32_135973_c1 | nmdc:mga06r32_135973_c1_861_1895 | 344 |
| 1442 | 3300050511 | nmdc:mga08y16_61354_c1 | nmdc:mga08y16_61354_c1_1270_2304 | 344 |
| 1443 | 3300006871 | Ga0075434_100082822 | Ga0075434_1000828222 | 345 |
| 1444 | 3300048907 | Ga0496104_0007966 | Ga0496104_0007966_6136_7173 | 345 |
| 1445 | 3300048909 | Ga0496106_0002373 | Ga0496106_0002373_9841_10878 | 345 |
| 1446 | 3300048910 | Ga0496107_0004064 | Ga0496107_0004064_3745_4782 | 345 |
| 1447 | 3300048911 | Ga0496108_0001361 | Ga0496108_0001361_4582_5619 | 345 |
| 1448 | 3300048912 | Ga0496109_0000909 | Ga0496109_0000909_17258_18295 | 345 |
| 1449 | 3300048915 | Ga0496112_0070476 | Ga0496112_0070476_301_1338 | 345 |
| 1450 | 3300050512 | nmdc:mga0n895_59753_c1 | nmdc:mga0n895_59753_c1_1605_2642 | 345 |
| 1451 | 3300001904 | JGI24736J21556_1013454 | JGI24736J21556_10134541 | 347 |
| 1452 | 3300001989 | JGI24739J22299_10015357 | JGI24739J22299_100153571 | 347 |
| 1453 | 3300001990 | JGI24737J22298_10004960 | JGI24737J22298_100049603 | 347 |
| 1454 | 3300005457 | Ga0070662_100051040 | Ga0070662_1000510401 | 347 |
| 1455 | 3300005563 | Ga0068855_100007226 | Ga0068855_1000072265 | 347 |
| 1456 | 3300005577 | Ga0068857_100003243 | Ga0068857_1000032436 | 347 |
| 1457 | 3300005578 | Ga0068854_100015602 | Ga0068854_1000156022 | 347 |
| 1458 | 3300005614 | Ga0068856_100003004 | Ga0068856_1000030048 | 347 |
| 1459 | 3300010375 | Ga0105239_10001513 | Ga0105239_1000151321 | 347 |
| 1460 | 3300025904 | Ga0207647_10010800 | Ga0207647_100108002 | 347 |
| 1461 | 3300025933 | Ga0207706_10069539 | Ga0207706_100695391 | 347 |
| 1462 | 3300026078 | Ga0207702_10000442 | Ga0207702_1000044215 | 347 |
| 1463 | 3300026078 | Ga0207702_10044911 | Ga0207702_100449112 | 347 |
| 1464 | 3300026116 | Ga0207674_10001614 | Ga0207674_100016142 | 347 |
| 1465 | 3300027907 | Ga0207428_10011461 | Ga0207428_100114617 | 347 |
| 1466 | 3300037418 | Ga0395900_0155460 | Ga0395900_0155460_202_1245 | 347 |
| 1467 | 3300048926 | Ga0496123_0000812 | Ga0496123_0000812_33393_34523 | 347 |
| 1468 | 3300048929 | Ga0496126_0162134 | Ga0496126_0162134_441_1484 | 347 |
| 1469 | 3300050511 | nmdc:mga08y16_29004_c1 | nmdc:mga08y16_29004_c1_149_1234 | 347 |
| 1470 | 3300053104 | Ga0500556_0000071 | Ga0500556_0000071_49103_50233 | 347 |
| 1471 | iso_pu_bacteria | 2507262055 | 2507508671 | 347 |
| 1472 | iso_pu_bacteria | 2508501009 | 2508542767 | 347 |
| 1473 | iso_pu_bacteria | 2508501042 | 2508691471 | 347 |
| 1474 | iso_pu_bacteria | 2919450847 | 2919454534 | 347 |
| 1475 | iso_pu_bacteria | 8001845381 | 8001849767 | 347 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6c4h-assembly1.cif.gz_v | conformation of methylated ggq in the peptidyl transferase center during translation termination (ptc region) | 0.9046 | 203 | 265 |
| 6c4h-assembly1.cif.gz_v | conformation of methylated ggq in the peptidyl transferase center during translation termination (ptc region) | 0.891 | 203 | 265 |
| 5u4j-assembly1.cif.gz_v | structural basis of co-translational quality control by arfa and rf2 bound to ribosome | 0.8541 | 97 | 296 |
| 6boh-assembly2.cif.gz_OC | antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome | 0.8508 | 93 | 197 |
| 5u4j-assembly1.cif.gz_v | structural basis of co-translational quality control by arfa and rf2 bound to ribosome | 0.8422 | 97 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6KST7_29_102_1.20.58.410 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Release factor | 1.009 | 2 | 41 | 1.20.58.410 |
| 1gqeA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9084 | 95 | 334 | 3.30.70.1660 |
| af_A0A1D6LBM0_75_157_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9076 | 206 | 270 | 3.30.160.20 |
| af_A0A0P0VBA3_76_148_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.905 | 206 | 265 | 3.30.160.20 |
| 6c4hv00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9046 | 203 | 265 | 3.30.160.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9KBZ4-F1-model_v4 | deleted | 0.9237 | 2 | 168 |
|
| AF-A0A6L7S4M9-F1-model_v4 | PCRF domain-containing protein | 0.9099 | 2 | 154 |
GO:0006415
|
| AF-A0A356MQ72-F1-model_v4 | Peptide chain release factor 2 | 0.8947 | 2 | 289 |
GO:0005737
GO:0016149 |
| AF-A0A4P8EIW0-F1-model_v4 | Peptide chain release factor 2 (RF-2) | 0.8906 | 2 | 343 |
GO:0005737
GO:0016149 |
| AF-A0A0F9BYB8-F1-model_v4 | Peptide chain release factor domain-containing protein | 0.8894 | 3 | 175 |
GO:0006415
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar