F494242

General Info

Members Datasets Scaffolds Average Seq Length
1475 693 1230 323

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876809366
Length 393
Sequence TSLVDALEGIGKVERELDDNVEMIALGEAENDEGVVVEAEGALKALKKEVARRELEALLSGEADRFDSYLEVHAGAGGTESQDWASMLLRMYTRWAEEHGFKIEYLEETPGEEAGIKSATIQISGHNAYGWLKTEAGVHRLVRISPFDSNARRHTSFSSVAIFPVVDDSIKIDIKESDVRTDTMRSGGAGGQHVNKTESAVRLTHIPTGVAVVCQAGRSQHKNRAQAWDMLRARLYEIELKRREXXXXXXXXXXXXXXXXXXXXXXXXQDRYRLGPPDPLLRAAALPDGERPAHRRADLRYIRRSRRRPGRVHGGDAGAARLRHHARRGRGCGLIHDQSGLHRARPHGPWHGRPLPRCRLFGCSLESQQGQGGRPDRARRTLGFISGGRCRWR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2534681786 Brucella suis 92/29 Isolate Unclassified
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2643221591 Devosia sp. Root685 Isolate Unclassified
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2751185800 Brucella pituitosa AA2 Isolate Unclassified
35 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
36 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
37 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
38 2791355199
39 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
40 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
41 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
42 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
43 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
44 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
45 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
46 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
47 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
48 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
49 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
50 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
51 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
52 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
53 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
54 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
55 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
56 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
57 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
58 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
59 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
60 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
61 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
62 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
63 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
64 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
65 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
66 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
67 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
68 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
69 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
70 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
71 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
72 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
73 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
74 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
75 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
76 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
77 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
78 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
79 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
80 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
81 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
82 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
83 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
84 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
85 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
86 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
87 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
88 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
89 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
90 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
91 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
92 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
93 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
94 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
95 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
96 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
97 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
98 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
99 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
100 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
101 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
102 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
103 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
104 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
105 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
106 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
107 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
108 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
109 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
110 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
111 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
112 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
113 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
114 2904699407
115 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
116 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
117 2906610324
118 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
119 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
120 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
121 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
122 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
123 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
124 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
125 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
126 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
127 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
128 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
129 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
130 2922368715
131 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
132 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
133 2922425934
134 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
135 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
136 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
137 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
138 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
139 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
140 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
141 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
142 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
143 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
144 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
145 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
146 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
147 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
148 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
149 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
150 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
151 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
152 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
153 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
154 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
155 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
156 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
157 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
158 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
159 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
160 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
161 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
162 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
163 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
164 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
165 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
166 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
167 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
168 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
169 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
170 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
171 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
172 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
173 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
174 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
175 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
176 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
177 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
178 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
179 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
180 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
181 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
182 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
183 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
184 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
185 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
186 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
187 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
188 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
189 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
190 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
191 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
192 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
193 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
194 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
195 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
196 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
197 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
198 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
199 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
200 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
201 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
202 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
203 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
204 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
205 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
206 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
207 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
208 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
209 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
210 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
211 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
212 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
213 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
214 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
215 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
216 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
217 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
218 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
219 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
220 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
221 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
222 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
223 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
224 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
225 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
226 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
227 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
228 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
229 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
230 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
231 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
232 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
233 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
234 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
235 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
236 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
237 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
238 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
239 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
240 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
241 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
242 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
243 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
244 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
245 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
246 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
247 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
248 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
249 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
250 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
251 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
252 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
253 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
254 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
255 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
256 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
257 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
258 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
259 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
260 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
261 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
262 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
263 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
264 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
265 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
266 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
267 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
268 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
269 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
270 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
271 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
272 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
273 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
274 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
275 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
276 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
277 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
278 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
279 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
280 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
281 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
282 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
283 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
284 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
285 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
286 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
287 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
289 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
290 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
291 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
292 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
293 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
294 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
295 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
296 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
297 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
298 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
299 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
300 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
301 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
302 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
303 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
304 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
305 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
306 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
307 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
308 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
309 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
310 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
311 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
312 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
313 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
314 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
315 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
316 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
317 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
318 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
319 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
320 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
321 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
322 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
323 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
324 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
325 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
326 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
329 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
331 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
332 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
333 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
334 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
388 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
389 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
390 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
391 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
392 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
396 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
397 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
398 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
399 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
400 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
401 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
402 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
403 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
404 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
405 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
406 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
407 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
408 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
409 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
410 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
411 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
412 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
413 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
414 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
415 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
416 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
417 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
418 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
419 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
420 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
421 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
422 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
423 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
424 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
426 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
427 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
428 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
429 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
430 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
431 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
432 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
433 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
434 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
435 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
436 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
437 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
438 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
439 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
440 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
441 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
442 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
443 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
444 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
445 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
446 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
447 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
448 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
449 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
450 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
451 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
452 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
453 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
454 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
455 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
456 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
457 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
458 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
459 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
460 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
461 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
462 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
463 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
464 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
465 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
466 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
467 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
468 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
469 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
470 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
471 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
472 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
473 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
474 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
475 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
476 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
477 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
478 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
479 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
480 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
481 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
482 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
483 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
484 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
485 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
486 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
487 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
488 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
489 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
490 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
491 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
492 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
493 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
494 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
495 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
496 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
497 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
498 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
499 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
500 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
501 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
502 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
503 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
504 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
505 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
506 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
507 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
508 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
509 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
510 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
511 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
512 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
513 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
514 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
515 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
516 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
517 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
518 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
519 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
520 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
521 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
522 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
523 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
524 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
525 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
526 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
527 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
528 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
529 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
530 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
531 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
532 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
533 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
534 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
535 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
536 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
537 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
538 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
539 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
540 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
541 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
542 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
543 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
544 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
545 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
546 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
547 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
548 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
549 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
550 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
551 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
552 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
553 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
554 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
555 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
556 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
557 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
558 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
559 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
560 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
561 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
562 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
563 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
564 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
565 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
566 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
567 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
568 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
569 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
570 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
571 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
572 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
575 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
576 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
577 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
578 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
579 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
580 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
581 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
582 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
583 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
584 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
585 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
586 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
587 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
588 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
589 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
590 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
591 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
592 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
593 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
594 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
595 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
596 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
597 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
598 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
599 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
600 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
601 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
602 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
603 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
604 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
605 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
606 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
607 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
608 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
609 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
610 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
611 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
612 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
613 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
614 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
615 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
616 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
617 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
618 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
619 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
620 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
621 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
622 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
623 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
624 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
625 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
626 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
627 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
628 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
629 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
630 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
631 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
632 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
633 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
634 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
635 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
636 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
637 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
638 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
639 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
640 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
641 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
642 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
643 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
644 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
645 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
646 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
647 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
648 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
649 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
650 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
651 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
652 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
653 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
654 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
655 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
656 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
657 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
658 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
659 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
660 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
661 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
662 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
663 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
664 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
665 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
666 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
667 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
668 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
669 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
670 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
671 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
672 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
673 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
674 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
675 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
676 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
677 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
678 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
679 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
680 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
681 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
682 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
683 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
684 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
685 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
686 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
687 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
688 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
689 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
690 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
691 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
692 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
693 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.54
Metatranscriptomes 0.14
Isolates 16.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.2
Nodule 12.34
Rhizoplane 4.54
Rhizosphere 65.08
Stem 0
Stem Tuber 0
Unclassified 9.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1013454 3300001904 Bacteria 1321
2 JGI24739J22299_10015357 3300001989 Bacteria 2780
3 JGI24737J22298_10004960 3300001990 Bacteria 4612
4 JGI24034J26672_10008216 3300002239 Bacteria 1523
5 JGI24742J22300_10013207 3300002244 Bacteria 1381
6 JGI25406J46586_10001258 3300003203 Bacteria 11887
7 JGI25153J46596_10001975 3300003215 Bacteria 12154
8 JGI25153J46596_10008987 3300003215 Bacteria 4705
9 JGI25153J46596_10013218 3300003215 Bacteria 3505
10 JGI25153J46596_10037847 3300003215 Bacteria 1528
11 Ga0007417J51691_1052383 3300003544 Bacteria 1219
12 JGI25404J52841_10006528 3300003659 Bacteria 2446
13 JGI25404J52841_10010095 3300003659 Bacteria 2027
14 JGI25404J52841_10010842 3300003659 Bacteria 1961
15 Ga0055539_1006204 3300003752 Bacteria 1532
16 Ga0055526_1000091 3300003771 Bacteria 82891
17 Ga0055526_1018462 3300003771 Bacteria 2601
18 Ga0065165_1001744 3300005262 Bacteria 21697
19 Ga0065165_1003890 3300005262 Bacteria 9887
20 Ga0065715_10033428 3300005293 Bacteria 1271
21 Ga0070658_10332403 3300005327 Bacteria 1299
22 Ga0070676_10044352 3300005328 Bacteria 2587
23 Ga0070683_100004422 3300005329 Bacteria 11587
24 Ga0070683_100134291 3300005329 Bacteria 2343
25 Ga0070683_100242948 3300005329 Bacteria 1713
26 Ga0070670_100028273 3300005331 Bacteria 4825
27 Ga0068869_100139520 3300005334 Bacteria 1870
28 Ga0070680_100095596 3300005336 Bacteria 2463
29 Ga0068868_100012415 3300005338 Bacteria 6226
30 Ga0068868_100185877 3300005338 Bacteria 1726
31 Ga0070660_100006727 3300005339 Bacteria 7975
32 Ga0070660_100084058 3300005339 Bacteria 2502
33 Ga0070660_100086085 3300005339 Bacteria 2472
34 Ga0070689_100117474 3300005340 Bacteria 2121
35 Ga0070691_10017160 3300005341 Bacteria 3331
36 Ga0070687_100007913 3300005343 Bacteria 4471
37 Ga0070661_100022107 3300005344 Bacteria 4549
38 Ga0070661_100022501 3300005344 Bacteria 4513
39 Ga0070661_100077160 3300005344 Bacteria 2456
40 Ga0070692_10075515 3300005345 Bacteria 1805
41 Ga0070668_100117981 3300005347 Bacteria 2118
42 Ga0070668_100258516 3300005347 Bacteria 1447
43 Ga0070669_100031521 3300005353 Bacteria 3829
44 Ga0070669_100134032 3300005353 Bacteria 1904
45 Ga0070674_100047021 3300005356 Bacteria 2954
46 Ga0070674_100084723 3300005356 Bacteria 2273
47 Ga0070688_100036593 3300005365 Bacteria 2987
48 Ga0070659_100247264 3300005366 Bacteria 1477
49 Ga0070659_100289974 3300005366 Bacteria 1363
50 Ga0070667_100071018 3300005367 Bacteria 2965
51 Ga0070709_10000102 3300005434 Bacteria 60511
52 Ga0070709_10001622 3300005434 Bacteria 12161
53 Ga0070709_10038944 3300005434 Bacteria 2914
54 Ga0070709_10064450 3300005434 Bacteria 2343
55 Ga0070709_10149410 3300005434 Bacteria 1613
56 Ga0070709_10176321 3300005434 Bacteria 1498
57 Ga0070709_10179990 3300005434 Bacteria 1484
58 Ga0070714_100022464 3300005435 Bacteria 5173
59 Ga0070714_100031763 3300005435 Bacteria 4408
60 Ga0070714_100086107 3300005435 Bacteria 2746
61 Ga0070714_100097986 3300005435 Bacteria 2578
62 Ga0070714_100107780 3300005435 Bacteria 2463
63 Ga0070713_100000004 3300005436 Bacteria 220768
64 Ga0070713_100009644 3300005436 Bacteria 6930
65 Ga0070713_100153064 3300005436 Bacteria 2053
66 Ga0070713_100184954 3300005436 Bacteria 1874
67 Ga0070710_10000246 3300005437 Bacteria 25491
68 Ga0070710_10108611 3300005437 Bacteria 1663
69 Ga0070710_10116230 3300005437 Bacteria 1613
70 Ga0070711_100003729 3300005439 Bacteria 8930
71 Ga0070711_100015465 3300005439 Bacteria 4831
72 Ga0070711_100072176 3300005439 Bacteria 2435
73 Ga0070711_100076705 3300005439 Bacteria 2370
74 Ga0070700_100084160 3300005441 Bacteria 2061
75 Ga0070700_100159554 3300005441 Bacteria 1551
76 Ga0070700_100198170 3300005441 Bacteria 1409
77 Ga0070663_100012278 3300005455 Bacteria 5412
78 Ga0070663_100077525 3300005455 Bacteria 2433
79 Ga0070663_100311355 3300005455 Bacteria 1263
80 Ga0070678_100005520 3300005456 Bacteria 7324
81 Ga0070678_100021678 3300005456 Bacteria 4242
82 Ga0070678_100040147 3300005456 Bacteria 3309
83 Ga0070662_100051040 3300005457 Bacteria 2985
84 Ga0070681_10013085 3300005458 Bacteria 8239
85 Ga0070681_10053331 3300005458 Bacteria 4029
86 Ga0070681_10088546 3300005458 Bacteria 3047
87 Ga0070681_10097274 3300005458 Bacteria 2891
88 Ga0070681_10107817 3300005458 Bacteria 2726
89 Ga0070681_10291591 3300005458 Bacteria 1542
90 Ga0070681_10362176 3300005458 Bacteria 1360
91 Ga0068867_100201855 3300005459 Bacteria 1592
92 Ga0070679_100089910 3300005530 Bacteria 3058
93 Ga0070679_100333709 3300005530 Bacteria 1465
94 Ga0070679_100379485 3300005530 Bacteria 1360
95 Ga0070679_100451640 3300005530 Bacteria 1230
96 Ga0070684_100018267 3300005535 Bacteria 5775
97 Ga0070684_100055068 3300005535 Bacteria 3466
98 Ga0070684_100125327 3300005535 Bacteria 2313
99 Ga0070684_100180759 3300005535 Bacteria 1918
100 Ga0070684_100261749 3300005535 Bacteria 1582
101 Ga0070697_100000429 3300005536 Bacteria 32198
102 Ga0070697_100024733 3300005536 Bacteria 4782
103 Ga0068853_100000869 3300005539 Bacteria 21124
104 Ga0068853_100006971 3300005539 Bacteria 9024
105 Ga0068853_100023426 3300005539 Bacteria 5169
106 Ga0068853_100128945 3300005539 Bacteria 2262
107 Ga0068853_100151947 3300005539 Bacteria 2084
108 Ga0068853_100337082 3300005539 Bacteria 1400
109 Ga0070686_100010855 3300005544 Bacteria 5152
110 Ga0070686_100015574 3300005544 Bacteria 4408
111 Ga0070686_100218276 3300005544 Bacteria 1377
112 Ga0070695_100003134 3300005545 Bacteria 9639
113 Ga0070695_100011981 3300005545 Bacteria 5195
114 Ga0070695_100051997 3300005545 Bacteria 2631
115 Ga0070693_100148211 3300005547 Bacteria 1483
116 Ga0070665_100020137 3300005548 Bacteria 6698
117 Ga0070665_100145789 3300005548 Bacteria 2370
118 Ga0070665_100192062 3300005548 Bacteria 2042
119 Ga0070665_100379380 3300005548 Bacteria 1421
120 Ga0070665_100476651 3300005548 Bacteria 1259
121 Ga0070704_100002047 3300005549 Bacteria 11182
122 Ga0068855_100007226 3300005563 Bacteria 13476
123 Ga0068855_100045775 3300005563 Bacteria 5173
124 Ga0068855_100079891 3300005563 Bacteria 3792
125 Ga0068855_100093456 3300005563 Bacteria 3468
126 Ga0068855_100101222 3300005563 Bacteria 3317
127 Ga0068855_100174019 3300005563 Bacteria 2437
128 Ga0068855_100379041 3300005563 Bacteria 1553
129 Ga0068855_100618949 3300005563 Bacteria 1166
130 Ga0070664_100056179 3300005564 Bacteria 3345
131 Ga0070664_100082541 3300005564 Bacteria 2772
132 Ga0068857_100000944 3300005577 Bacteria 22139
133 Ga0068857_100003243 3300005577 Bacteria 13510
134 Ga0068857_100068528 3300005577 Bacteria 3157
135 Ga0068857_100263689 3300005577 Bacteria 1582
136 Ga0068857_100303640 3300005577 Bacteria 1472
137 Ga0068854_100005134 3300005578 Bacteria 8253
138 Ga0068854_100015602 3300005578 Bacteria 5037
139 Ga0068854_100041156 3300005578 Bacteria 3264
140 Ga0068856_100000144 3300005614 Bacteria 72020
141 Ga0068856_100001349 3300005614 Bacteria 25791
142 Ga0068856_100003004 3300005614 Bacteria 17269
143 Ga0068856_100015680 3300005614 Bacteria 7327
144 Ga0068856_100027505 3300005614 Bacteria 5548
145 Ga0068856_100042065 3300005614 Bacteria 4494
146 Ga0068856_100127393 3300005614 Bacteria 2549
147 Ga0068852_100008781 3300005616 Bacteria 7476
148 Ga0068852_100022868 3300005616 Bacteria 5022
149 Ga0068852_100037474 3300005616 Bacteria 4066
150 Ga0068859_100445830 3300005617 Bacteria 1390
151 Ga0068864_100014660 3300005618 Bacteria 6511
152 Ga0068864_100091806 3300005618 Bacteria 2679
153 Ga0068864_100204427 3300005618 Bacteria 1816
154 Ga0068861_100236290 3300005719 Bacteria 1552
155 Ga0068851_10001219 3300005834 Bacteria 11171
156 Ga0068863_100042721 3300005841 Bacteria 4307
157 Ga0068863_100308169 3300005841 Bacteria 1536
158 Ga0068858_100015026 3300005842 Bacteria 7283
159 Ga0068858_100219928 3300005842 Bacteria 1798
160 Ga0068858_100286753 3300005842 Bacteria 1568
161 Ga0068858_100436675 3300005842 Bacteria 1260
162 Ga0068860_100001369 3300005843 Bacteria 26465
163 Ga0068860_100372443 3300005843 Bacteria 1408
164 Ga0068860_100410163 3300005843 Bacteria 1341
165 Ga0068862_100097391 3300005844 Bacteria 2568
166 Ga0068862_100125134 3300005844 Bacteria 2269
167 Ga0081455_10002234 3300005937 Bacteria 23056
168 Ga0081455_10004479 3300005937 Bacteria 15634
169 Ga0081455_10007376 3300005937 Bacteria 11594
170 Ga0081455_10079870 3300005937 Bacteria 2684
171 Ga0081538_10006633 3300005981 Bacteria 10147
172 Ga0081540_1003148 3300005983 Bacteria 13183
173 Ga0081540_1004298 3300005983 Bacteria 10912
174 Ga0081540_1005800 3300005983 Bacteria 9137
175 Ga0081540_1016355 3300005983 Bacteria 4646
176 Ga0081540_1050668 3300005983 Bacteria 2059
177 Ga0081540_1054025 3300005983 Bacteria 1966
178 Ga0081539_10000498 3300005985 Bacteria 82216
179 Ga0081539_10000616 3300005985 Bacteria 72108
180 Ga0081539_10008413 3300005985 Bacteria 9002
181 Ga0081539_10046173 3300005985 Bacteria 2498
182 Ga0081539_10107456 3300005985 Bacteria 1411
183 Ga0070717_10003922 3300006028 Bacteria 10709
184 Ga0070717_10150872 3300006028 Bacteria 2010
185 Ga0070717_10227968 3300006028 Bacteria 1639
186 Ga0070717_10245336 3300006028 Bacteria 1581
187 Ga0070717_10359963 3300006028 Bacteria 1302
188 Ga0075365_10102444 3300006038 Bacteria 1961
189 Ga0075368_10003816 3300006042 Bacteria 5067
190 Ga0075368_10050755 3300006042 Bacteria 1648
191 Ga0075363_100002036 3300006048 Bacteria 8065
192 Ga0075363_100015362 3300006048 Bacteria 3762
193 Ga0075364_10098331 3300006051 Bacteria 1947
194 Ga0075364_10127875 3300006051 Bacteria 1704
195 Ga0070715_10055100 3300006163 Bacteria 1724
196 Ga0070716_100004742 3300006173 Bacteria 6523
197 Ga0070716_100036119 3300006173 Bacteria 2722
198 Ga0070712_100000358 3300006175 Bacteria 25814
199 Ga0070712_100006021 3300006175 Bacteria 7505
200 Ga0070712_100009398 3300006175 Bacteria 6159
201 Ga0070712_100064276 3300006175 Bacteria 2602
202 Ga0075362_10027635 3300006177 Bacteria 2430
203 Ga0075362_10040719 3300006177 Bacteria 2046
204 Ga0075362_10068760 3300006177 Bacteria 1614
205 Ga0075367_10108180 3300006178 Bacteria 1704
206 Ga0075369_10062592 3300006186 Bacteria 1626
207 Ga0075369_10119058 3300006186 Bacteria 1194
208 Ga0075366_10007702 3300006195 Bacteria 5964
209 Ga0075366_10175615 3300006195 Bacteria 1300
210 Ga0097621_100194270 3300006237 Bacteria 1759
211 Ga0075370_10042918 3300006353 Bacteria 2555
212 Ga0075370_10070344 3300006353 Bacteria 2001
213 Ga0075370_10077535 3300006353 Bacteria 1907
214 Ga0068871_100239577 3300006358 Bacteria 1577
215 Ga0075428_100493568 3300006844 Bacteria 1310
216 Ga0075434_100082822 3300006871 Bacteria 3206
217 Ga0068865_100098159 3300006881 Bacteria 2140
218 Ga0068865_100166537 3300006881 Bacteria 1686
219 Ga0068865_100383018 3300006881 Bacteria 1147
220 Ga0075436_100009384 3300006914 Bacteria 6691
221 Ga0097620_100085658 3300006931 Bacteria 3197
222 Ga0097620_100445830 3300006931 Bacteria 1390
223 Ga0099824_1008576 3300006942 Bacteria 13016
224 Ga0099824_1012782 3300006942 Bacteria 8990
225 Ga0099822_1004091 3300006943 Bacteria 18896
226 Ga0075435_100185232 3300007076 Bacteria 1760
227 Ga0099794_10029937 3300007265 Bacteria 2539
228 Ga0099794_10051984 3300007265 Bacteria 1975
229 Ga0105250_10056103 3300009092 Bacteria 1581
230 Ga0105240_10001917 3300009093 Bacteria 34551
231 Ga0105240_10014223 3300009093 Bacteria 10871
232 Ga0105240_10055530 3300009093 Bacteria 4958
233 Ga0105245_10033500 3300009098 Bacteria 4554
234 Ga0105247_10012294 3300009101 Bacteria 5143
235 Ga0114129_10021007 3300009147 Bacteria 9272
236 Ga0105243_10014895 3300009148 Bacteria 5886
237 Ga0105241_10001171 3300009174 Bacteria 19971
238 Ga0105241_10007199 3300009174 Bacteria 8189
239 Ga0105248_10056530 3300009177 Bacteria 4402
240 Ga0105237_10003815 3300009545 Bacteria 17712
241 Ga0105237_10024567 3300009545 Bacteria 6162
242 Ga0105237_10090324 3300009545 Bacteria 3052
243 Ga0105237_10356549 3300009545 Bacteria 1467
244 Ga0105237_10447678 3300009545 Bacteria 1297
245 Ga0105238_10000639 3300009551 Bacteria 36877
246 Ga0105238_10000897 3300009551 Bacteria 30590
247 Ga0105238_10003968 3300009551 Bacteria 14675
248 Ga0105238_10018050 3300009551 Bacteria 7171
249 Ga0105238_10094937 3300009551 Bacteria 2970
250 Ga0105239_10001513 3300010375 Bacteria 30845
251 Ga0105239_10005537 3300010375 Bacteria 14786
252 Ga0105239_10100251 3300010375 Bacteria 3203
253 Ga0105239_10106443 3300010375 Bacteria 3107
254 Ga0105239_10313113 3300010375 Bacteria 1769
255 Ga0105239_10519995 3300010375 Bacteria 1354
256 Ga0105246_10001247 3300011119 Bacteria 14936
257 Ga0105246_10409549 3300011119 Bacteria 1128
258 Ga0157373_10013340 3300013100 Bacteria 6029
259 Ga0157371_10077493 3300013102 Bacteria 2354
260 Ga0157371_10092526 3300013102 Bacteria 2142
261 Ga0157370_10007043 3300013104 Bacteria 12273
262 Ga0157370_10027064 3300013104 Bacteria 5654
263 Ga0157369_10029906 3300013105 Bacteria 6014
264 Ga0157369_10039221 3300013105 Bacteria 5176
265 Ga0157369_10055013 3300013105 Bacteria 4296
266 Ga0157374_10060187 3300013296 Bacteria 3553
267 Ga0157374_10101153 3300013296 Bacteria 2764
268 Ga0157378_10104209 3300013297 Bacteria 2593
269 Ga0157372_10038507 3300013307 Bacteria 5276
270 Ga0163163_10065227 3300014325 Bacteria 3614
271 Ga0163163_10226000 3300014325 Bacteria 1921
272 Ga0157380_10169296 3300014326 Bacteria 1907
273 Ga0157379_10039891 3300014968 Bacteria 4190
274 Ga0157376_10011610 3300014969 Bacteria 6503
275 Ga0157376_10033518 3300014969 Bacteria 4135
276 Ga0214544_1000002 3300021320 Bacteria 753857
277 Ga0214542_1000001 3300021321 Bacteria 1018696
278 Ga0214542_1020125 3300021321 Bacteria 4998
279 Ga0214545_1000001 3300021324 Bacteria 1092817
280 Ga0214545_1019688 3300021324 Bacteria 5686
281 Ga0214543_1000001 3300021327 Bacteria 776921
282 Ga0209677_100639 3300025253 Bacteria 18592
283 Ga0209677_106368 3300025253 Bacteria 2808
284 Ga0209148_1000356 3300025254 Bacteria 58774
285 Ga0209233_1001736 3300025261 Bacteria 8414
286 Ga0209233_1008415 3300025261 Bacteria 3197
287 Ga0209455_1001391 3300025272 Bacteria 11010
288 Ga0209455_1001958 3300025272 Bacteria 8484
289 Ga0209455_1008852 3300025272 Bacteria 2694
290 Ga0209564_1000017 3300025295 Bacteria 594063
291 Ga0209564_1000810 3300025295 Bacteria 42727
292 Ga0209564_1004546 3300025295 Bacteria 8425
293 Ga0209564_1040998 3300025295 Bacteria 1248
294 Ga0209758_1000021 3300025297 Bacteria 697691
295 Ga0209758_1001018 3300025297 Bacteria 37092
296 Ga0209758_1002832 3300025297 Bacteria 16855
297 Ga0209758_1003606 3300025297 Bacteria 13855
298 Ga0209758_1006112 3300025297 Bacteria 8834
299 Ga0209758_1010040 3300025297 Bacteria 5747
300 Ga0209758_1022450 3300025297 Bacteria 2892
301 Ga0209256_1007804 3300025299 Bacteria 5151
302 Ga0207426_1000599 3300025302 Bacteria 47456
303 Ga0207426_1000960 3300025302 Bacteria 28422
304 Ga0207426_1012993 3300025302 Bacteria 3105
305 Ga0207426_1033688 3300025302 Bacteria 1649
306 Ga0209257_1002984 3300025304 Bacteria 15406
307 Ga0207656_10005751 3300025321 Bacteria 4410
308 Ga0207656_10036638 3300025321 Bacteria 2060
309 Ga0207682_10001895 3300025893 Bacteria 9497
310 Ga0207692_10000514 3300025898 Bacteria 13701
311 Ga0207692_10006093 3300025898 Bacteria 4878
312 Ga0207692_10123861 3300025898 Bacteria 1451
313 Ga0207692_10144008 3300025898 Bacteria 1358
314 Ga0207688_10081217 3300025901 Bacteria 1852
315 Ga0207647_10010800 3300025904 Bacteria 6428
316 Ga0207699_10000230 3300025906 Bacteria 31963
317 Ga0207699_10000607 3300025906 Bacteria 17517
318 Ga0207699_10061551 3300025906 Bacteria 2259
319 Ga0207699_10115584 3300025906 Bacteria 1727
320 Ga0207699_10224595 3300025906 Bacteria 1284
321 Ga0207645_10013748 3300025907 Bacteria 5434
322 Ga0207645_10029619 3300025907 Bacteria 3528
323 Ga0207705_10078317 3300025909 Bacteria 2405
324 Ga0207705_10157169 3300025909 Bacteria 1706
325 Ga0207654_10000337 3300025911 Bacteria 28090
326 Ga0207654_10069921 3300025911 Bacteria 2082
327 Ga0207707_10006249 3300025912 Bacteria 10402
328 Ga0207707_10021859 3300025912 Bacteria 5591
329 Ga0207707_10030821 3300025912 Bacteria 4692
330 Ga0207707_10278072 3300025912 Bacteria 1450
331 Ga0207707_10291078 3300025912 Bacteria 1413
332 Ga0207695_10000015 3300025913 Bacteria 803205
333 Ga0207695_10010607 3300025913 Bacteria 11263
334 Ga0207695_10036177 3300025913 Bacteria 5341
335 Ga0207695_10036612 3300025913 Bacteria 5303
336 Ga0207695_10204848 3300025913 Bacteria 1886
337 Ga0207695_10287141 3300025913 Bacteria 1538
338 Ga0207671_10012975 3300025914 Bacteria 6666
339 Ga0207671_10017413 3300025914 Bacteria 5541
340 Ga0207671_10030613 3300025914 Bacteria 4012
341 Ga0207671_10039046 3300025914 Bacteria 3517
342 Ga0207671_10046210 3300025914 Bacteria 3221
343 Ga0207671_10110789 3300025914 Bacteria 2088
344 Ga0207693_10001087 3300025915 Bacteria 24400
345 Ga0207693_10002443 3300025915 Bacteria 16136
346 Ga0207693_10013717 3300025915 Bacteria 6528
347 Ga0207693_10100300 3300025915 Bacteria 2270
348 Ga0207693_10106616 3300025915 Bacteria 2198
349 Ga0207693_10191996 3300025915 Bacteria 1607
350 Ga0207663_10052256 3300025916 Bacteria 2548
351 Ga0207663_10061257 3300025916 Bacteria 2387
352 Ga0207663_10247396 3300025916 Bacteria 1310
353 Ga0207660_10085029 3300025917 Bacteria 2333
354 Ga0207660_10156170 3300025917 Bacteria 1756
355 Ga0207660_10214989 3300025917 Bacteria 1507
356 Ga0207657_10000784 3300025919 Bacteria 33773
357 Ga0207657_10001921 3300025919 Bacteria 22438
358 Ga0207657_10084339 3300025919 Bacteria 2663
359 Ga0207657_10086958 3300025919 Bacteria 2615
360 Ga0207657_10193603 3300025919 Bacteria 1639
361 Ga0207649_10033623 3300025920 Bacteria 3065
362 Ga0207649_10286038 3300025920 Bacteria 1200
363 Ga0207652_10025865 3300025921 Bacteria 4884
364 Ga0207652_10029672 3300025921 Bacteria 4575
365 Ga0207652_10030541 3300025921 Bacteria 4513
366 Ga0207652_10090631 3300025921 Bacteria 2687
367 Ga0207646_10365184 3300025922 Bacteria 1304
368 Ga0207681_10082035 3300025923 Bacteria 2278
369 Ga0207694_10000082 3300025924 Bacteria 109787
370 Ga0207694_10026888 3300025924 Bacteria 4381
371 Ga0207694_10184894 3300025924 Bacteria 1691
372 Ga0207687_10013817 3300025927 Bacteria 5273
373 Ga0207687_10039262 3300025927 Bacteria 3241
374 Ga0207700_10000011 3300025928 Bacteria 266323
375 Ga0207700_10248977 3300025928 Bacteria 1517
376 Ga0207700_10353032 3300025928 Bacteria 1281
377 Ga0207664_10036404 3300025929 Bacteria 3805
378 Ga0207664_10105526 3300025929 Bacteria 2335
379 Ga0207664_10205363 3300025929 Bacteria 1702
380 Ga0207690_10061838 3300025932 Bacteria 2547
381 Ga0207690_10250251 3300025932 Bacteria 1368
382 Ga0207706_10069539 3300025933 Bacteria 3097
383 Ga0207709_10120006 3300025935 Bacteria 1774
384 Ga0207670_10001095 3300025936 Bacteria 14264
385 Ga0207670_10172708 3300025936 Bacteria 1622
386 Ga0207670_10217743 3300025936 Bacteria 1460
387 Ga0207669_10015062 3300025937 Bacteria 3889
388 Ga0207669_10024600 3300025937 Bacteria 3239
389 Ga0207669_10028991 3300025937 Bacteria 3054
390 Ga0207704_10182750 3300025938 Bacteria 1517
391 Ga0207665_10000192 3300025939 Bacteria 41165
392 Ga0207665_10045186 3300025939 Bacteria 2949
393 Ga0207665_10089804 3300025939 Bacteria 2128
394 Ga0207691_10070174 3300025940 Bacteria 3164
395 Ga0207691_10254469 3300025940 Bacteria 1515
396 Ga0207711_10040269 3300025941 Bacteria 3975
397 Ga0207711_10241632 3300025941 Bacteria 1656
398 Ga0207661_10007314 3300025944 Bacteria 7853
399 Ga0207679_10184476 3300025945 Bacteria 1729
400 Ga0207667_10002113 3300025949 Bacteria 24906
401 Ga0207667_10073167 3300025949 Bacteria 3561
402 Ga0207667_10113569 3300025949 Bacteria 2792
403 Ga0207651_10134505 3300025960 Bacteria 1899
404 Ga0207712_10261971 3300025961 Bacteria 1403
405 Ga0207640_10071361 3300025981 Bacteria 2339
406 Ga0207640_10103261 3300025981 Bacteria 2004
407 Ga0207640_10192095 3300025981 Bacteria 1540
408 Ga0207658_10027891 3300025986 Bacteria 3972
409 Ga0207658_10071529 3300025986 Bacteria 2627
410 Ga0207677_10017957 3300026023 Bacteria 4235
411 Ga0207677_10048420 3300026023 Bacteria 2862
412 Ga0207703_10075271 3300026035 Bacteria 2797
413 Ga0207703_10492404 3300026035 Bacteria 1150
414 Ga0207639_10034763 3300026041 Bacteria 3727
415 Ga0207639_10069221 3300026041 Bacteria 2753
416 Ga0207678_10007958 3300026067 Bacteria 9348
417 Ga0207678_10020639 3300026067 Bacteria 5775
418 Ga0207708_10051265 3300026075 Bacteria 3141
419 Ga0207702_10000002 3300026078 Bacteria 491507
420 Ga0207702_10000226 3300026078 Bacteria 65919
421 Ga0207702_10000442 3300026078 Bacteria 47074
422 Ga0207702_10002060 3300026078 Bacteria 19465
423 Ga0207702_10019299 3300026078 Bacteria 5641
424 Ga0207702_10044911 3300026078 Bacteria 3715
425 Ga0207641_10032278 3300026088 Bacteria 4347
426 Ga0207641_10252533 3300026088 Bacteria 1647
427 Ga0207648_10178965 3300026089 Bacteria 1876
428 Ga0207648_10246631 3300026089 Bacteria 1592
429 Ga0207648_10267675 3300026089 Bacteria 1526
430 Ga0207674_10000261 3300026116 Bacteria 66008
431 Ga0207674_10001614 3300026116 Bacteria 29042
432 Ga0207674_10011733 3300026116 Bacteria 9831
433 Ga0207674_10257826 3300026116 Bacteria 1691
434 Ga0207675_100124084 3300026118 Bacteria 2445
435 Ga0207675_100198557 3300026118 Bacteria 1926
436 Ga0207675_100251309 3300026118 Bacteria 1711
437 Ga0207683_10018855 3300026121 Bacteria 5886
438 Ga0207683_10020766 3300026121 Bacteria 5619
439 Ga0207683_10045508 3300026121 Bacteria 3838
440 Ga0207683_10255624 3300026121 Bacteria 1599
441 Ga0207683_10455501 3300026121 Bacteria 1180
442 Ga0207698_10019754 3300026142 Bacteria 4620
443 Ga0209389_1000008 3300027296 Bacteria 227385
444 Ga0209389_1000121 3300027296 Bacteria 70490
445 Ga0209589_1000003 3300027357 Bacteria 629130
446 Ga0209589_1002735 3300027357 Bacteria 30739
447 Ga0209489_100003 3300027361 Bacteria 663105
448 Ga0209489_101490 3300027361 Bacteria 48185
449 Ga0209489_103445 3300027361 Bacteria 30849
450 Ga0209700_100003 3300027363 Bacteria 663105
451 Ga0209700_100036 3300027363 Bacteria 187888
452 Ga0207428_10011461 3300027907 Bacteria 7835
453 Ga0207428_10078702 3300027907 Bacteria 2579
454 Ga0268266_10000908 3300028379 Bacteria 38174
455 Ga0268266_10008371 3300028379 Bacteria 9197
456 Ga0268266_10067894 3300028379 Bacteria 3086
457 Ga0268266_10125463 3300028379 Bacteria 2290
458 Ga0268266_10191132 3300028379 Bacteria 1869
459 Ga0268265_10144509 3300028380 Bacteria 1996
460 Ga0268265_10351527 3300028380 Bacteria 1346
461 Ga0268264_10000043 3300028381 Bacteria 371761
462 Ga0265337_1012538 3300028556 Bacteria 2877
463 Ga0265337_1015056 3300028556 Bacteria 2544
464 Ga0265326_10002188 3300028558 Bacteria 6631
465 Ga0265334_10002607 3300028573 Bacteria 8406
466 Ga0265334_10014246 3300028573 Bacteria 3314
467 Ga0265323_10003939 3300028653 Bacteria 6452
468 Ga0265322_10002310 3300028654 Bacteria 5913
469 Ga0265336_10001608 3300028666 Bacteria 10074
470 Ga0307517_10000063 3300028786 Bacteria 144304
471 Ga0307515_10100819 3300028794 Bacteria 3492
472 Ga0307515_10160523 3300028794 Bacteria 2295
473 Ga0265338_10000667 3300028800 Bacteria 59318
474 Ga0265338_10021413 3300028800 Bacteria 6743
475 Ga0265324_10003760 3300029957 Bacteria 7088
476 Ga0265330_10007489 3300031235 Bacteria 5314
477 Ga0265332_10035696 3300031238 Bacteria 2159
478 Ga0265320_10000953 3300031240 Bacteria 21567
479 Ga0265325_10000098 3300031241 Bacteria 61384
480 Ga0265325_10007037 3300031241 Bacteria 6782
481 Ga0265325_10014108 3300031241 Bacteria 4526
482 Ga0265325_10061548 3300031241 Bacteria 1903
483 Ga0265325_10082418 3300031241 Bacteria 1596
484 Ga0265340_10004938 3300031247 Bacteria 7414
485 Ga0265340_10015221 3300031247 Bacteria 4000
486 Ga0265340_10092226 3300031247 Bacteria 1414
487 Ga0265339_10000145 3300031249 Bacteria 58275
488 Ga0265339_10001071 3300031249 Bacteria 20801
489 Ga0265339_10002292 3300031249 Bacteria 13811
490 Ga0265339_10007152 3300031249 Bacteria 7244
491 Ga0265331_10005233 3300031250 Bacteria 7866
492 Ga0265331_10027187 3300031250 Bacteria 2870
493 Ga0265331_10058559 3300031250 Bacteria 1824
494 Ga0265316_10024242 3300031344 Bacteria 5090
495 Ga0265316_10040807 3300031344 Bacteria 3719
496 Ga0265316_10049430 3300031344 Bacteria 3313
497 Ga0265316_10315327 3300031344 Bacteria 1137
498 Ga0307509_10048183 3300031507 Bacteria 4578
499 Ga0265313_10000173 3300031595 Bacteria 68499
500 Ga0265313_10001153 3300031595 Bacteria 25235
501 Ga0265313_10009753 3300031595 Bacteria 6188
502 Ga0265313_10016846 3300031595 Bacteria 4186
503 Ga0265313_10064549 3300031595 Bacteria 1703
504 Ga0307508_10000010 3300031616 Bacteria 255747
505 Ga0307508_10058073 3300031616 Bacteria 3424
506 Ga0316579_10106656 3300031691 Bacteria 1343
507 Ga0265314_10000125 3300031711 Bacteria 118671
508 Ga0265314_10011664 3300031711 Bacteria 7231
509 Ga0265314_10041990 3300031711 Bacteria 3267
510 Ga0265342_10000110 3300031712 Bacteria 91145
511 Ga0265342_10003916 3300031712 Bacteria 11954
512 Ga0265342_10011179 3300031712 Bacteria 6160
513 Ga0265342_10019680 3300031712 Bacteria 4346
514 Ga0316578_10023053 3300031728 Bacteria 3481
515 Ga0307516_10083248 3300031730 Bacteria 3041
516 Ga0307516_10122318 3300031730 Bacteria 2391
517 Ga0307516_10302458 3300031730 Bacteria 1275
518 Ga0307416_100598822 3300032002 Bacteria 1182
519 Ga0307414_10098259 3300032004 Bacteria 2196
520 Ga0307414_10327816 3300032004 Bacteria 1306
521 Ga0307415_100019128 3300032126 Bacteria 4152
522 Ga0316593_10041240 3300032168 Bacteria 1536
523 Ga0307510_10006860 3300033180 Bacteria 13587
524 Ga0307510_10040547 3300033180 Bacteria 5110
525 Ga0307510_10082351 3300033180 Bacteria 3114
526 Ga0315911_1000001 3300033442 Bacteria 1088602
527 Ga0373930_0004300 3300034816 Bacteria 2309
528 Ga0373958_0001587 3300034819 Bacteria 3078
529 Ga0373958_0015432 3300034819 Bacteria 1350
530 Ga0373959_0010268 3300034820 Bacteria 1633
531 Ga0373926_0005541 3300035083 Bacteria 4164
532 Ga0373926_0059391 3300035083 Bacteria 1392
533 Ga0373934_0001152 3300035086 Bacteria 9636
534 Ga0373940_0006936 3300035088 Bacteria 2538
535 Ga0373944_0000364 3300035089 Bacteria 10277
536 Ga0373944_0001934 3300035089 Bacteria 5242
537 Ga0373952_0003964 3300035092 Bacteria 2676
538 Ga0373923_0005611 3300035111 Bacteria 4272
539 Ga0373936_0002224 3300035113 Bacteria 7245
540 Ga0373936_0007579 3300035113 Bacteria 4080
541 Ga0373936_0008721 3300035113 Bacteria 3819
542 Ga0373936_0032331 3300035113 Bacteria 2069
543 Ga0373936_0046255 3300035113 Bacteria 1754
544 Ga0373939_0014060 3300035114 Bacteria 2070
545 Ga0373939_0016255 3300035114 Bacteria 1959
546 Ga0373941_0025759 3300035115 Bacteria 1702
547 Ga0373945_0000604 3300035116 Bacteria 10308
548 Ga0373945_0019944 3300035116 Bacteria 2292
549 Ga0373945_0021270 3300035116 Bacteria 2228
550 Ga0373945_0053896 3300035116 Bacteria 1486
551 Ga0373954_0000976 3300035118 Bacteria 11241
552 Ga0373954_0049349 3300035118 Bacteria 1973
553 Ga0373954_0141110 3300035118 Bacteria 1175
554 Ga0373956_0009428 3300035119 Bacteria 3972
555 Ga0373956_0118025 3300035119 Bacteria 1238
556 Ga0373943_0001320 3300035170 Bacteria 11151
557 Ga0373943_0003503 3300035170 Bacteria 7149
558 Ga0373943_0026179 3300035170 Bacteria 2731
559 Ga0373943_0046365 3300035170 Bacteria 2121
560 Ga0373946_0022234 3300035171 Bacteria 2466
561 Ga0373946_0022683 3300035171 Bacteria 2446
562 Ga0373955_0000198 3300035172 Bacteria 24944
563 Ga0373955_0007268 3300035172 Bacteria 5084
564 Ga0373955_0007759 3300035172 Bacteria 4945
565 Ga0373955_0012193 3300035172 Bacteria 4127
566 Ga0373955_0069792 3300035172 Bacteria 1961
567 Ga0373955_0117205 3300035172 Bacteria 1545
568 Ga0373942_0017492 3300035207 Bacteria 1768
569 Ga0373962_0009654 3300035242 Bacteria 2395
570 Ga0316574_0000486 3300035398 Bacteria 16059
571 Ga0373924_0006081 3300035410 Bacteria 4311
572 Ga0373924_0013867 3300035410 Bacteria 3035
573 Ga0373924_0028954 3300035410 Bacteria 2210
574 Ga0373931_0000263 3300035691 Bacteria 22257
575 Ga0373931_0075155 3300035691 Bacteria 1852
576 Ga0373935_0000880 3300035692 Bacteria 16208
577 Ga0373935_0008666 3300035692 Bacteria 6088
578 Ga0373935_0052556 3300035692 Bacteria 2590
579 Ga0373935_0066064 3300035692 Bacteria 2322
580 Ga0373927_0000415 3300035695 Bacteria 32709
581 Ga0373927_0011994 3300035695 Bacteria 5765
582 Ga0373927_0012818 3300035695 Bacteria 5576
583 Ga0373927_0040906 3300035695 Bacteria 3007
584 Ga0373927_0055937 3300035695 Bacteria 2550
585 Ga0373927_0060421 3300035695 Bacteria 2452
586 Ga0373927_0090305 3300035695 Bacteria 1989
587 Ga0373927_0122069 3300035695 Bacteria 1700
588 Ga0373933_0000274 3300035724 Bacteria 33544
589 Ga0373933_0000475 3300035724 Bacteria 25100
590 Ga0373947_0002859 3300035725 Bacteria 10310
591 Ga0373947_0008223 3300035725 Bacteria 6015
592 Ga0373947_0012808 3300035725 Bacteria 4806
593 Ga0373947_0030611 3300035725 Bacteria 3163
594 Ga0373947_0040403 3300035725 Bacteria 2778
595 Ga0373947_0103748 3300035725 Bacteria 1790
596 Ga0373937_0008251 3300036401 Bacteria 9043
597 Ga0373937_0030039 3300036401 Bacteria 4922
598 Ga0373937_0086774 3300036401 Bacteria 2896
599 Ga0373937_0103040 3300036401 Bacteria 2650
600 Ga0373937_0111865 3300036401 Bacteria 2540
601 Ga0373937_0169621 3300036401 Bacteria 2047
602 Ga0373937_0174649 3300036401 Bacteria 2016
603 Ga0373937_0258853 3300036401 Bacteria 1641
604 Ga0316584_0004453 3300036712 Bacteria 9272
605 Ga0373925_0008160 3300037068 Bacteria 7624
606 Ga0373925_0012044 3300037068 Bacteria 6263
607 Ga0373925_0030528 3300037068 Bacteria 3956
608 Ga0373925_0035309 3300037068 Bacteria 3687
609 Ga0373925_0125228 3300037068 Bacteria 1998
610 Ga0373925_0139611 3300037068 Bacteria 1896
611 Ga0373925_0181220 3300037068 Bacteria 1667
612 Ga0373925_0270584 3300037068 Bacteria 1366
613 Ga0395900_0000361 3300037418 Bacteria 65918
614 Ga0395900_0034548 3300037418 Bacteria 5208
615 Ga0395900_0047403 3300037418 Bacteria 4424
616 Ga0395900_0155460 3300037418 Bacteria 2336
617 Ga0395900_0277052 3300037418 Bacteria 1670
618 Ga0395900_0554187 3300037418 Bacteria 1094
619 Ga0395898_0020363 3300037466 Bacteria 6737
620 Ga0395898_0132439 3300037466 Bacteria 2387
621 Ga0395905_0003578 3300037471 Bacteria 16545
622 Ga0395905_0271700 3300037471 Bacteria 1581
623 Ga0395905_0411017 3300037471 Bacteria 1248
624 Ga0436364_0033868 3300037853 Bacteria 1530
625 Ga0436364_0171330 3300037853 Bacteria 2443
626 Ga0436364_1331450 3300037853 Bacteria 3035
627 Ga0395901_0005029 3300038443 Bacteria 13349
628 Ga0395901_0150364 3300038443 Bacteria 2447
629 Ga0395901_0179118 3300038443 Bacteria 2223
630 Ga0395901_0192872 3300038443 Bacteria 2136
631 Ga0400483_139806 3300039062 Bacteria 21288
632 Ga0400483_175766 3300039062 Bacteria 10246
633 Ga0400483_205987 3300039062 Bacteria 15999
634 Ga0436365_0369699 3300039437 Bacteria 3107
635 Ga0436365_0733835 3300039437 Bacteria 1221
636 Ga0436365_1018795 3300039437 Bacteria 1622
637 Ga0436365_1361494 3300039437 Bacteria 15892
638 Ga0436365_1556838 3300039437 Bacteria 2735
639 Ga0436360_0623528 3300039438 Bacteria 2229
640 Ga0436361_0266153 3300039447 Bacteria 2518
641 Ga0436363_1628749 3300039450 Bacteria 3332
642 Ga0439453_0008825 3300041408 Bacteria 1628
643 Ga0439455_0058595 3300042012 Bacteria 1018
644 Ga0466972_0000271 3300044658 Bacteria 32697
645 Ga0466972_0034153 3300044658 Bacteria 2493
646 Ga0466965_0004372 3300044683 Bacteria 6283
647 Ga0466966_0004743 3300044684 Bacteria 8946
648 Ga0466966_0230914 3300044684 Bacteria 1116
649 Ga0466961_0000859 3300044693 Bacteria 18957
650 Ga0466963_0077341 3300044694 Bacteria 2248
651 Ga0466968_0008864 3300044735 Bacteria 3860
652 Ga0466957_0026509 3300044842 Bacteria 3439
653 Ga0466957_0084796 3300044842 Bacteria 1978
654 Ga0466957_0145095 3300044842 Bacteria 1532
655 Ga0466957_0215789 3300044842 Bacteria 1265
656 Ga0466959_0033478 3300045049 Bacteria 3800
657 Ga0466959_0036020 3300045049 Bacteria 3657
658 Ga0466959_0117515 3300045049 Bacteria 1893
659 Ga0495617_048848 3300046452 Bacteria 1408
660 Ga0495592_0007563 3300046454 Bacteria 8138
661 Ga0495592_0013902 3300046454 Bacteria 6115
662 Ga0495592_0150556 3300046454 Bacteria 1609
663 Ga0495603_0000676 3300046455 Bacteria 19328
664 Ga0495603_0009006 3300046455 Bacteria 6037
665 Ga0495603_0031745 3300046455 Bacteria 3180
666 Ga0495603_0241912 3300046455 Bacteria 1039
667 Ga0495629_0000176 3300046459 Bacteria 56922
668 Ga0495629_0003088 3300046459 Bacteria 12634
669 Ga0495629_0003357 3300046459 Bacteria 12088
670 Ga0495629_0012129 3300046459 Bacteria 6245
671 Ga0495629_0024799 3300046459 Bacteria 4269
672 Ga0495629_0081977 3300046459 Bacteria 2251
673 Ga0495638_0019106 3300046460 Bacteria 4538
674 Ga0495638_0068357 3300046460 Bacteria 2178
675 Ga0495641_0008578 3300046461 Bacteria 6198
676 Ga0495641_0012702 3300046461 Bacteria 4688
677 Ga0495651_0002298 3300046462 Bacteria 14746
678 Ga0495651_0009559 3300046462 Bacteria 7449
679 Ga0495651_0092718 3300046462 Bacteria 2262
680 Ga0495653_0004529 3300046463 Bacteria 11230
681 Ga0495580_0004887 3300046472 Bacteria 11206
682 Ga0495580_0009272 3300046472 Bacteria 7744
683 Ga0495580_0013690 3300046472 Bacteria 6180
684 Ga0495580_0031326 3300046472 Bacteria 3844
685 Ga0495580_0084911 3300046472 Bacteria 2205
686 Ga0495582_0000177 3300046473 Bacteria 34588
687 Ga0495605_0090097 3300046474 Bacteria 1423
688 Ga0495605_0107899 3300046474 Bacteria 1273
689 Ga0495639_0000726 3300046475 Bacteria 15095
690 Ga0495639_0004110 3300046475 Bacteria 6235
691 Ga0495639_0022248 3300046475 Bacteria 2780
692 Ga0495662_0000028 3300046476 Bacteria 51556
693 Ga0495662_0003064 3300046476 Bacteria 8427
694 Ga0495662_0017858 3300046476 Bacteria 3434
695 Ga0495664_0008779 3300046477 Bacteria 5647
696 Ga0495664_0025560 3300046477 Bacteria 3439
697 Ga0495585_0054100 3300046492 Bacteria 2220
698 Ga0495594_0000020 3300046499 Bacteria 80534
699 Ga0495594_0005321 3300046499 Bacteria 6610
700 Ga0495594_0052047 3300046499 Bacteria 2254
701 Ga0495606_0001226 3300046507 Bacteria 35910
702 Ga0495606_0060335 3300046507 Bacteria 2429
703 Ga0495608_0000721 3300046511 Bacteria 23015
704 Ga0495608_0078020 3300046511 Bacteria 2156
705 Ga0495608_0101820 3300046511 Bacteria 1851
706 Ga0495608_0133537 3300046511 Bacteria 1587
707 Ga0495618_0018572 3300046514 Bacteria 4270
708 Ga0495620_0026112 3300046515 Bacteria 2751
709 Ga0495620_0109991 3300046515 Bacteria 1093
710 Ga0495628_0004786 3300046516 Bacteria 11931
711 Ga0495628_0074309 3300046516 Bacteria 2648
712 Ga0495628_0093530 3300046516 Bacteria 2325
713 Ga0495628_0130981 3300046516 Bacteria 1918
714 Ga0495628_0317667 3300046516 Bacteria 1150
715 Ga0495630_0002476 3300046517 Bacteria 12804
716 Ga0495630_0225693 3300046517 Bacteria 1430
717 Ga0495632_0008927 3300046519 Bacteria 6088
718 Ga0495644_0002732 3300046523 Bacteria 7000
719 Ga0495644_0022480 3300046523 Bacteria 2404
720 Ga0495648_0002422 3300046524 Bacteria 17288
721 Ga0495648_0008933 3300046524 Bacteria 7831
722 Ga0495648_0059123 3300046524 Bacteria 2288
723 Ga0495648_0074244 3300046524 Bacteria 1960
724 Ga0495663_0025921 3300046525 Bacteria 1713
725 Ga0495666_0006077 3300046526 Bacteria 6079
726 Ga0495666_0010823 3300046526 Bacteria 4549
727 Ga0495652_0063452 3300046529 Bacteria 3110
728 Ga0495652_0086353 3300046529 Bacteria 2576
729 Ga0495652_0100838 3300046529 Bacteria 2341
730 Ga0495654_0049895 3300046530 Bacteria 2047
731 Ga0495654_0143360 3300046530 Bacteria 1063
732 Ga0495665_0000057 3300046531 Bacteria 44876
733 Ga0495665_0009325 3300046531 Bacteria 5314
734 Ga0495665_0021145 3300046531 Bacteria 3495
735 Ga0495665_0032754 3300046531 Bacteria 2780
736 Ga0495665_0033665 3300046531 Bacteria 2741
737 Ga0495640_0001533 3300046533 Bacteria 18200
738 Ga0495640_0006411 3300046533 Bacteria 9304
739 Ga0495640_0031293 3300046533 Bacteria 3799
740 Ga0495640_0051277 3300046533 Bacteria 2836
741 Ga0495587_0000736 3300046536 Bacteria 21940
742 Ga0495621_0015238 3300046539 Bacteria 2449
743 Ga0495621_0018932 3300046539 Bacteria 2242
744 Ga0495645_0007114 3300046543 Bacteria 7789
745 Ga0495645_0038764 3300046543 Bacteria 3475
746 Ga0495622_0001520 3300046557 Bacteria 11590
747 Ga0495622_0017143 3300046557 Bacteria 3372
748 Ga0495622_0093161 3300046557 Bacteria 1383
749 Ga0495633_0009880 3300046558 Bacteria 5241
750 Ga0495667_0000319 3300046559 Bacteria 30374
751 Ga0495667_0008737 3300046559 Bacteria 6882
752 Ga0495667_0020907 3300046559 Bacteria 4417
753 Ga0495667_0036184 3300046559 Bacteria 3296
754 Ga0495656_0000064 3300046615 Bacteria 48582
755 Ga0495668_0036816 3300046616 Bacteria 2740
756 Ga0495668_0060757 3300046616 Bacteria 2084
757 Ga0495668_0062215 3300046616 Bacteria 2057
758 Ga0495634_0008509 3300046642 Bacteria 7628
759 Ga0495634_0010828 3300046642 Bacteria 6668
760 Ga0495634_0024302 3300046642 Bacteria 4253
761 Ga0495634_0030256 3300046642 Bacteria 3741
762 Ga0495634_0105411 3300046642 Bacteria 1817
763 Ga0495634_0233566 3300046642 Bacteria 1130
764 Ga0495625_0124200 3300046660 Bacteria 1753
765 Ga0495625_0147310 3300046660 Bacteria 1584
766 Ga0495625_0211726 3300046660 Bacteria 1274
767 Ga0495635_0004372 3300046663 Bacteria 9784
768 Ga0495635_0008796 3300046663 Bacteria 7049
769 Ga0495635_0008850 3300046663 Bacteria 7027
770 Ga0495635_0049438 3300046663 Bacteria 2898
771 Ga0495635_0249464 3300046663 Bacteria 1197
772 Ga0495659_0002437 3300046664 Bacteria 6000
773 Ga0495659_0020085 3300046664 Bacteria 2240
774 Ga0495588_0011011 3300046674 Bacteria 4231
775 Ga0495588_0018632 3300046674 Bacteria 3388
776 Ga0495588_0040969 3300046674 Bacteria 2364
777 Ga0495588_0105764 3300046674 Bacteria 1481
778 Ga0495657_0001557 3300046675 Bacteria 19730
779 Ga0495657_0044896 3300046675 Bacteria 3001
780 Ga0495657_0049297 3300046675 Bacteria 2837
781 Ga0495657_0049317 3300046675 Bacteria 2836
782 Ga0495599_0001378 3300046678 Bacteria 13874
783 Ga0495599_0021867 3300046678 Bacteria 3993
784 Ga0495599_0071568 3300046678 Bacteria 2164
785 Ga0495623_0008240 3300046679 Bacteria 6779
786 Ga0495623_0010692 3300046679 Bacteria 5941
787 Ga0495646_0003336 3300046680 Bacteria 9986
788 Ga0495646_0013387 3300046680 Bacteria 5214
789 Ga0495646_0016906 3300046680 Bacteria 4632
790 Ga0495646_0108359 3300046680 Bacteria 1584
791 Ga0495647_0012769 3300046681 Bacteria 2897
792 Ga0495647_0020139 3300046681 Bacteria 2392
793 Ga0495647_0072707 3300046681 Bacteria 1380
794 Ga0495658_0003230 3300046683 Bacteria 8117
795 Ga0495658_0010431 3300046683 Bacteria 4648
796 Ga0495658_0043195 3300046683 Bacteria 2520
797 Ga0495669_0004325 3300046684 Bacteria 5861
798 Ga0495613_0012712 3300046689 Bacteria 6260
799 Ga0495613_0013818 3300046689 Bacteria 5990
800 Ga0495613_0033299 3300046689 Bacteria 3829
801 Ga0495613_0105399 3300046689 Bacteria 2035
802 Ga0495613_0247800 3300046689 Bacteria 1244
803 Ga0495624_0005807 3300046690 Bacteria 8837
804 Ga0495624_0007826 3300046690 Bacteria 7500
805 Ga0495624_0010764 3300046690 Bacteria 6305
806 Ga0495624_0029244 3300046690 Bacteria 3596
807 Ga0495624_0032844 3300046690 Bacteria 3363
808 Ga0495624_0054083 3300046690 Bacteria 2532
809 Ga0495624_0059398 3300046690 Bacteria 2400
810 Ga0495670_0000258 3300046691 Bacteria 24647
811 Ga0495670_0029296 3300046691 Bacteria 2732
812 Ga0495671_0024554 3300046692 Bacteria 3138
813 Ga0495600_0000314 3300046809 Bacteria 25635
814 Ga0495600_0001994 3300046809 Bacteria 11472
815 Ga0495600_0047739 3300046809 Bacteria 2793
816 Ga0495600_0103975 3300046809 Bacteria 1850
817 Ga0495600_0203278 3300046809 Bacteria 1271
818 Ga0495581_0004028 3300047315 Bacteria 8459
819 Ga0495581_0020045 3300047315 Bacteria 3882
820 Ga0495581_0047694 3300047315 Bacteria 2475
821 Ga0495604_0001137 3300047317 Bacteria 22068
822 Ga0495604_0012931 3300047317 Bacteria 6651
823 Ga0495604_0019823 3300047317 Bacteria 5379
824 Ga0495604_0054739 3300047317 Bacteria 3077
825 Ga0495604_0284117 3300047317 Bacteria 1117
826 Ga0495674_0088433 3300047319 Bacteria 2649
827 Ga0495674_0144949 3300047319 Bacteria 1994
828 Ga0495674_0193450 3300047319 Bacteria 1689
829 Ga0495672_0011418 3300047320 Bacteria 6271
830 Ga0495672_0061120 3300047320 Bacteria 2172
831 Ga0495672_0077248 3300047320 Bacteria 1867
832 Ga0495672_0169407 3300047320 Bacteria 1115
833 Ga0495676_0019882 3300047321 Bacteria 5902
834 Ga0495676_0030061 3300047321 Bacteria 4617
835 Ga0495680_0002499 3300047322 Bacteria 18805
836 Ga0495680_0019888 3300047322 Bacteria 5659
837 Ga0495680_0150915 3300047322 Bacteria 1694
838 Ga0495675_0002364 3300047444 Bacteria 11266
839 Ga0495675_0115306 3300047444 Bacteria 1675
840 Ga0495684_0000023 3300047471 Bacteria 133626
841 Ga0495684_0003050 3300047471 Bacteria 13176
842 Ga0495684_0011309 3300047471 Bacteria 6891
843 Ga0495684_0011436 3300047471 Bacteria 6853
844 Ga0495684_0018741 3300047471 Bacteria 5331
845 Ga0495684_0177272 3300047471 Bacteria 1582
846 Ga0495684_0190589 3300047471 Bacteria 1516
847 Ga0495684_0195250 3300047471 Bacteria 1494
848 Ga0495686_0035662 3300047472 Bacteria 3196
849 Ga0495686_0175147 3300047472 Bacteria 1246
850 Ga0495593_0000165 3300047673 Bacteria 33774
851 Ga0495593_0000221 3300047673 Bacteria 30321
852 Ga0495593_0003546 3300047673 Bacteria 9336
853 Ga0495593_0007451 3300047673 Bacteria 6402
854 Ga0495593_0047522 3300047673 Bacteria 2282
855 Ga0495593_0085274 3300047673 Bacteria 1630
856 Ga0495602_0026464 3300048088 Bacteria 5593
857 Ga0495602_0084652 3300048088 Bacteria 2652
858 Ga0495602_0105766 3300048088 Bacteria 2299
859 Ga0495602_0173238 3300048088 Bacteria 1673
860 Ga0495602_0247252 3300048088 Bacteria 1331
861 Ga0495614_0012122 3300048089 Bacteria 3786
862 Ga0495614_0026074 3300048089 Bacteria 2519
863 Ga0495614_0104589 3300048089 Bacteria 1240
864 Ga0495614_0118280 3300048089 Bacteria 1167
865 Ga0495626_0065183 3300048091 Bacteria 1649
866 Ga0496100_0114033 3300048903 Bacteria 1882
867 Ga0496101_0003066 3300048904 Bacteria 10322
868 Ga0496102_0004610 3300048905 Bacteria 11664
869 Ga0496102_0028901 3300048905 Bacteria 4955
870 Ga0496102_0103280 3300048905 Bacteria 2651
871 Ga0496102_0115938 3300048905 Bacteria 2499
872 Ga0496102_0125281 3300048905 Bacteria 2401
873 Ga0496102_0321675 3300048905 Bacteria 1457
874 Ga0496103_0022889 3300048906 Bacteria 3765
875 Ga0496103_0025422 3300048906 Bacteria 3579
876 Ga0496104_0005886 3300048907 Bacteria 10738
877 Ga0496104_0007966 3300048907 Bacteria 9396
878 Ga0496104_0014294 3300048907 Bacteria 7167
879 Ga0496104_0077274 3300048907 Bacteria 3172
880 Ga0496104_0160498 3300048907 Bacteria 2156
881 Ga0496104_0336510 3300048907 Bacteria 1422
882 Ga0496105_0009152 3300048908 Bacteria 7727
883 Ga0496105_0049567 3300048908 Bacteria 3467
884 Ga0496105_0106438 3300048908 Bacteria 2315
885 Ga0496105_0163756 3300048908 Bacteria 1825
886 Ga0496105_0183766 3300048908 Bacteria 1711
887 Ga0496106_0000363 3300048909 Bacteria 32218
888 Ga0496106_0002373 3300048909 Bacteria 14021
889 Ga0496106_0018324 3300048909 Bacteria 5174
890 Ga0496106_0018493 3300048909 Bacteria 5153
891 Ga0496106_0039925 3300048909 Bacteria 3514
892 Ga0496106_0082089 3300048909 Bacteria 2477
893 Ga0496107_0004064 3300048910 Bacteria 9851
894 Ga0496107_0056799 3300048910 Bacteria 2828
895 Ga0496107_0113218 3300048910 Bacteria 1995
896 Ga0496108_0000625 3300048911 Bacteria 27651
897 Ga0496108_0001361 3300048911 Bacteria 19211
898 Ga0496108_0012338 3300048911 Bacteria 6953
899 Ga0496108_0053812 3300048911 Bacteria 3376
900 Ga0496108_0079513 3300048911 Bacteria 2776
901 Ga0496108_0157821 3300048911 Bacteria 1959
902 Ga0496109_0000909 3300048912 Bacteria 24642
903 Ga0496109_0034392 3300048912 Bacteria 4564
904 Ga0496109_0035150 3300048912 Bacteria 4518
905 Ga0496109_0078162 3300048912 Bacteria 3046
906 Ga0496109_0092263 3300048912 Bacteria 2801
907 Ga0496109_0351915 3300048912 Bacteria 1391
908 Ga0496109_0523395 3300048912 Bacteria 1119
909 Ga0496110_0023859 3300048913 Bacteria 5207
910 Ga0496110_0029464 3300048913 Bacteria 4724
911 Ga0496110_0123106 3300048913 Bacteria 2338
912 Ga0496111_0031776 3300048914 Bacteria 3762
913 Ga0496111_0032439 3300048914 Bacteria 3724
914 Ga0496111_0283191 3300048914 Bacteria 1229
915 Ga0496112_0000031 3300048915 Bacteria 120022
916 Ga0496112_0015495 3300048915 Bacteria 7118
917 Ga0496112_0032484 3300048915 Bacteria 5068
918 Ga0496112_0070476 3300048915 Bacteria 3455
919 Ga0496112_0102666 3300048915 Bacteria 2829
920 Ga0496112_0139351 3300048915 Bacteria 2395
921 Ga0496112_0175574 3300048915 Bacteria 2107
922 Ga0496112_0410920 3300048915 Bacteria 1293
923 Ga0496113_0000087 3300048916 Bacteria 40247
924 Ga0496113_0076481 3300048916 Bacteria 2557
925 Ga0496114_0047001 3300048917 Bacteria 3588
926 Ga0496114_0294811 3300048917 Bacteria 1431
927 Ga0496115_0000713 3300048918 Bacteria 24637
928 Ga0496115_0040376 3300048918 Bacteria 3709
929 Ga0496115_0055903 3300048918 Bacteria 3171
930 Ga0496115_0093325 3300048918 Bacteria 2461
931 Ga0496116_0082401 3300048919 Bacteria 1990
932 Ga0496117_0051775 3300048920 Bacteria 2899
933 Ga0496117_0075134 3300048920 Bacteria 2246
934 Ga0496118_0002080 3300048921 Bacteria 28152
935 Ga0496118_0081179 3300048921 Bacteria 2278
936 Ga0496118_0102331 3300048921 Bacteria 1931
937 Ga0496119_0015210 3300048922 Bacteria 5951
938 Ga0496120_0010096 3300048923 Bacteria 6618
939 Ga0496121_0000183 3300048924 Bacteria 139168
940 Ga0496121_0000407 3300048924 Bacteria 85728
941 Ga0496121_0001403 3300048924 Bacteria 40795
942 Ga0496121_0020343 3300048924 Bacteria 6578
943 Ga0496121_0023725 3300048924 Bacteria 5895
944 Ga0496121_0027667 3300048924 Bacteria 5300
945 Ga0496121_0048678 3300048924 Bacteria 3604
946 Ga0496121_0052234 3300048924 Bacteria 3435
947 Ga0496121_0088209 3300048924 Bacteria 2432
948 Ga0496121_0108085 3300048924 Bacteria 2128
949 Ga0496121_0136647 3300048924 Bacteria 1825
950 Ga0496121_0256896 3300048924 Bacteria 1208
951 Ga0496123_0000812 3300048926 Bacteria 50414
952 Ga0496123_0028711 3300048926 Bacteria 4112
953 Ga0496123_0035502 3300048926 Bacteria 3550
954 Ga0496123_0087889 3300048926 Bacteria 1858
955 Ga0496124_0010967 3300048927 Bacteria 9111
956 Ga0496124_0068590 3300048927 Bacteria 2947
957 Ga0496124_0240919 3300048927 Bacteria 1345
958 Ga0496125_0000090 3300048928 Bacteria 214433
959 Ga0496125_0000602 3300048928 Bacteria 61264
960 Ga0496125_0001219 3300048928 Bacteria 38596
961 Ga0496125_0001713 3300048928 Bacteria 30526
962 Ga0496125_0022884 3300048928 Bacteria 5789
963 Ga0496125_0025195 3300048928 Bacteria 5453
964 Ga0496125_0082459 3300048928 Bacteria 2451
965 Ga0496125_0090461 3300048928 Bacteria 2297
966 Ga0496126_0008736 3300048929 Bacteria 10878
967 Ga0496126_0008974 3300048929 Bacteria 10702
968 Ga0496126_0010266 3300048929 Bacteria 9838
969 Ga0496126_0028595 3300048929 Bacteria 5310
970 Ga0496126_0043018 3300048929 Bacteria 4169
971 Ga0496126_0059498 3300048929 Bacteria 3440
972 Ga0496126_0079627 3300048929 Bacteria 2900
973 Ga0496126_0090067 3300048929 Bacteria 2699
974 Ga0496126_0123540 3300048929 Bacteria 2242
975 Ga0496126_0162134 3300048929 Bacteria 1910
976 Ga0496126_0274822 3300048929 Bacteria 1397
977 Ga0496126_0307307 3300048929 Bacteria 1306
978 Ga0501031_0008429 3300049568 Bacteria 6704
979 Ga0501031_0013071 3300049568 Bacteria 5416
980 Ga0501032_0000087 3300049569 Bacteria 79948
981 Ga0501032_0005128 3300049569 Bacteria 9769
982 Ga0501032_0011988 3300049569 Bacteria 6207
983 Ga0501032_0016894 3300049569 Bacteria 5129
984 Ga0501032_0019804 3300049569 Bacteria 4698
985 Ga0501032_0030627 3300049569 Bacteria 3692
986 Ga0501032_0034125 3300049569 Bacteria 3484
987 Ga0501033_0000181 3300049570 Bacteria 60365
988 Ga0501033_0000510 3300049570 Bacteria 36533
989 Ga0501033_0003261 3300049570 Bacteria 13432
990 Ga0501033_0081180 3300049570 Bacteria 2378
991 Ga0501033_0195265 3300049570 Bacteria 1447
992 Ga0501034_0000021 3300049571 Bacteria 266023
993 Ga0501034_0000211 3300049571 Bacteria 110858
994 Ga0501034_0003829 3300049571 Bacteria 16950
995 Ga0501034_0009992 3300049571 Bacteria 9915
996 Ga0501034_0061016 3300049571 Bacteria 3788
997 Ga0501034_0089287 3300049571 Bacteria 3080
998 Ga0501034_0114284 3300049571 Bacteria 2688
999 Ga0501034_0231765 3300049571 Bacteria 1795
1000 Ga0501034_0435722 3300049571 Bacteria 1230
1001 Ga0501036_0000069 3300049572 Bacteria 64331
1002 Ga0501036_0014141 3300049572 Bacteria 6638
1003 Ga0501036_0024390 3300049572 Bacteria 5098
1004 Ga0501036_0043219 3300049572 Bacteria 3815
1005 Ga0501036_0093787 3300049572 Bacteria 2536
1006 Ga0501036_0175379 3300049572 Bacteria 1805
1007 Ga0501036_0233897 3300049572 Bacteria 1542
1008 Ga0501037_0000034 3300049573 Bacteria 126321
1009 Ga0501037_0002667 3300049573 Bacteria 12862
1010 Ga0501037_0010155 3300049573 Bacteria 6908
1011 Ga0501037_0033876 3300049573 Bacteria 3771
1012 Ga0501037_0063822 3300049573 Bacteria 2685
1013 Ga0501037_0121741 3300049573 Bacteria 1876
1014 Ga0501038_0000628 3300049574 Bacteria 31365
1015 Ga0501038_0001570 3300049574 Bacteria 21153
1016 Ga0501038_0007511 3300049574 Bacteria 10051
1017 Ga0501038_0025032 3300049574 Bacteria 5321
1018 Ga0501038_0081851 3300049574 Bacteria 2719
1019 Ga0501038_0250242 3300049574 Bacteria 1404
1020 Ga0501038_0264278 3300049574 Bacteria 1359
1021 Ga0501039_0000931 3300049575 Bacteria 21350
1022 Ga0501039_0081486 3300049575 Bacteria 2519
1023 Ga0501039_0087487 3300049575 Bacteria 2427
1024 Ga0501039_0283717 3300049575 Bacteria 1302
1025 Ga0501041_0166749 3300049577 Bacteria 1378
1026 Ga0501042_0013413 3300049578 Bacteria 5576
1027 Ga0501042_0026741 3300049578 Bacteria 4053
1028 Ga0501042_0131408 3300049578 Bacteria 1804
1029 Ga0501042_0156475 3300049578 Bacteria 1644
1030 Ga0501043_0000033 3300049579 Bacteria 139500
1031 Ga0501043_0009976 3300049579 Bacteria 7449
1032 Ga0501043_0012412 3300049579 Bacteria 6663
1033 Ga0501043_0014386 3300049579 Bacteria 6195
1034 Ga0501043_0023684 3300049579 Bacteria 4815
1035 Ga0501043_0030178 3300049579 Bacteria 4259
1036 Ga0501043_0224348 3300049579 Bacteria 1453
1037 Ga0501046_0000412 3300049580 Bacteria 42614
1038 Ga0501046_0002043 3300049580 Bacteria 19173
1039 Ga0501046_0039760 3300049580 Bacteria 3764
1040 Ga0501046_0041076 3300049580 Bacteria 3692
1041 Ga0501046_0048020 3300049580 Bacteria 3382
1042 Ga0501046_0072996 3300049580 Bacteria 2663
1043 Ga0501046_0084232 3300049580 Bacteria 2452
1044 Ga0501047_0000010 3300049581 Bacteria 429357
1045 Ga0501047_0000434 3300049581 Bacteria 46522
1046 Ga0501047_0007147 3300049581 Bacteria 10488
1047 Ga0501047_0048439 3300049581 Bacteria 4103
1048 Ga0501047_0050922 3300049581 Bacteria 3999
1049 Ga0501047_0085492 3300049581 Bacteria 3031
1050 Ga0501047_0102401 3300049581 Bacteria 2743
1051 Ga0501047_0226226 3300049581 Bacteria 1725
1052 Ga0501048_0000290 3300049582 Bacteria 34170
1053 Ga0501048_0001809 3300049582 Bacteria 16245
1054 Ga0501048_0007260 3300049582 Bacteria 8404
1055 Ga0501048_0032399 3300049582 Bacteria 3777
1056 Ga0501048_0106814 3300049582 Bacteria 1976
1057 Ga0501067_0000067 3300049583 Bacteria 59367
1058 Ga0501067_0000477 3300049583 Bacteria 21826
1059 Ga0501067_0028186 3300049583 Bacteria 3111
1060 Ga0501068_0000742 3300049584 Bacteria 16718
1061 Ga0501068_0001335 3300049584 Bacteria 13079
1062 Ga0501068_0018982 3300049584 Bacteria 3985
1063 Ga0501068_0023768 3300049584 Bacteria 3594
1064 Ga0501069_0004553 3300049585 Bacteria 7165
1065 Ga0501069_0022381 3300049585 Bacteria 3438
1066 Ga0501069_0090686 3300049585 Bacteria 1728
1067 Ga0501069_0172576 3300049585 Bacteria 1248
1068 Ga0501070_0002965 3300049586 Bacteria 14789
1069 Ga0501070_0068121 3300049586 Bacteria 2946
1070 Ga0501070_0082127 3300049586 Bacteria 2667
1071 Ga0501070_0106575 3300049586 Bacteria 2316
1072 Ga0501071_0037987 3300049587 Bacteria 3440
1073 Ga0501071_0131572 3300049587 Bacteria 1859
1074 Ga0501072_0000515 3300049588 Bacteria 27822
1075 Ga0501072_0002718 3300049588 Bacteria 13281
1076 Ga0501072_0032950 3300049588 Bacteria 4058
1077 Ga0501072_0115580 3300049588 Bacteria 2136
1078 Ga0501073_0000144 3300049589 Bacteria 47087
1079 Ga0501073_0032555 3300049589 Bacteria 3717
1080 Ga0501073_0038197 3300049589 Bacteria 3407
1081 Ga0501073_0090037 3300049589 Bacteria 2133
1082 Ga0501074_0000675 3300049590 Bacteria 21305
1083 Ga0501074_0001696 3300049590 Bacteria 15006
1084 Ga0501074_0013775 3300049590 Bacteria 5881
1085 Ga0501074_0016400 3300049590 Bacteria 5380
1086 Ga0501074_0025795 3300049590 Bacteria 4264
1087 Ga0501075_0028447 3300049591 Bacteria 4126
1088 Ga0501076_0056868 3300049592 Bacteria 3105
1089 Ga0501079_0007639 3300049741 Bacteria 8189
1090 Ga0501079_0013242 3300049741 Bacteria 6289
1091 Ga0501079_0127854 3300049741 Bacteria 1977
1092 Ga0501079_0150611 3300049741 Bacteria 1813
1093 Ga0501079_0266487 3300049741 Bacteria 1339
1094 Ga0501080_0001018 3300049742 Bacteria 23056
1095 Ga0501080_0005763 3300049742 Bacteria 11078
1096 Ga0501080_0031077 3300049742 Bacteria 4976
1097 Ga0501080_0032014 3300049742 Bacteria 4902
1098 Ga0501080_0054631 3300049742 Bacteria 3719
1099 Ga0501080_0107099 3300049742 Bacteria 2591
1100 Ga0501080_0116972 3300049742 Bacteria 2471
1101 Ga0501080_0273644 3300049742 Bacteria 1536
1102 Ga0501081_0071478 3300049743 Bacteria 2419
1103 Ga0501081_0077444 3300049743 Bacteria 2324
1104 Ga0501083_0000192 3300049744 Bacteria 39270
1105 Ga0501083_0000756 3300049744 Bacteria 21111
1106 Ga0501083_0000803 3300049744 Bacteria 20575
1107 Ga0501083_0006485 3300049744 Bacteria 8301
1108 Ga0501083_0125118 3300049744 Bacteria 1685
1109 Ga0501083_0138277 3300049744 Bacteria 1595
1110 Ga0501035_0000323 3300049822 Bacteria 55329
1111 Ga0501035_0002209 3300049822 Bacteria 19332
1112 Ga0501035_0021197 3300049822 Bacteria 5973
1113 Ga0501035_0028072 3300049822 Bacteria 5139
1114 Ga0501035_0072007 3300049822 Bacteria 3059
1115 Ga0501044_0000181 3300049823 Bacteria 78075
1116 Ga0501044_0004415 3300049823 Bacteria 15735
1117 Ga0501044_0037155 3300049823 Bacteria 5091
1118 Ga0501044_0054245 3300049823 Bacteria 4122
1119 Ga0501044_0083608 3300049823 Bacteria 3228
1120 Ga0501044_0104855 3300049823 Bacteria 2840
1121 Ga0501044_0119143 3300049823 Bacteria 2642
1122 Ga0501044_0119891 3300049823 Bacteria 2632
1123 Ga0501044_0162321 3300049823 Bacteria 2210
1124 Ga0501044_0193463 3300049823 Bacteria 1995
1125 Ga0501044_0237831 3300049823 Bacteria 1766
1126 Ga0501044_0288826 3300049823 Bacteria 1572
1127 Ga0501044_0310631 3300049823 Bacteria 1503
1128 Ga0501045_0006122 3300049824 Bacteria 8335
1129 Ga0501045_0110078 3300049824 Bacteria 2042
1130 nmdc:mga03n38_894_c1 3300050490 Bacteria 8014
1131 nmdc:mga00v17_12176_c1 3300050491 Bacteria 3610
1132 nmdc:mga0yw44_103754_c1 3300050492 Bacteria 1814
1133 nmdc:mga0yw44_24388_c1 3300050492 Bacteria 3422
1134 nmdc:mga0k408_2338_c1 3300050493 Bacteria 10087
1135 nmdc:mga0k408_8984_c1 3300050493 Bacteria 5376
1136 nmdc:mga06z11_43306_c1 3300050494 Bacteria 2264
1137 nmdc:mga06z11_46170_c1 3300050494 Bacteria 2206
1138 nmdc:mga04h51_22683_c1 3300050495 Bacteria 1902
1139 nmdc:mga07m45_20249_c1 3300050496 Bacteria 3613
1140 nmdc:mga07m45_28805_c1 3300050496 Bacteria 2417
1141 nmdc:mga07m45_49122_c2 3300050496 Bacteria 1901
1142 nmdc:mga05p37_8896_c1 3300050507 Bacteria 11865
1143 nmdc:mga06r32_135973_c1 3300050510 Bacteria 2432
1144 nmdc:mga08y16_29004_c1 3300050511 Bacteria 5833
1145 nmdc:mga08y16_315278_c1 3300050511 Bacteria 1610
1146 nmdc:mga08y16_61354_c1 3300050511 Bacteria 3926
1147 nmdc:mga0n895_173857_c1 3300050512 Bacteria 2185
1148 nmdc:mga0n895_59753_c1 3300050512 Bacteria 3761
1149 nmdc:mga08x19_129_c1 3300050514 Bacteria 66982
1150 nmdc:mga08x19_193038_c1 3300050514 Bacteria 1394
1151 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
1152 nmdc:mga08x19_67627_c1 3300050514 Bacteria 2324
1153 Ga0495601_0048214 3300053077 Bacteria 2683
1154 Ga0495601_0065747 3300053077 Bacteria 2308
1155 Ga0495601_0067781 3300053077 Bacteria 2273
1156 Ga0495601_0095205 3300053077 Bacteria 1920
1157 Ga0495595_0000218 3300053084 Bacteria 23092
1158 Ga0495595_0015072 3300053084 Bacteria 3291
1159 Ga0495619_0000111 3300053085 Bacteria 61304
1160 Ga0495619_0003381 3300053085 Bacteria 10311
1161 Ga0495619_0043944 3300053085 Bacteria 2931
1162 Ga0495619_0045960 3300053085 Bacteria 2870
1163 Ga0500643_000015 3300053087 Bacteria 310312
1164 Ga0500651_0001257 3300053093 Bacteria 12627
1165 Ga0500651_0061510 3300053093 Bacteria 2345
1166 Ga0500566_0000028 3300053094 Bacteria 75589
1167 Ga0500566_0000249 3300053094 Bacteria 28873
1168 Ga0500566_0001671 3300053094 Bacteria 13028
1169 Ga0500566_0006790 3300053094 Bacteria 6779
1170 Ga0500641_0010046 3300053096 Bacteria 3412
1171 Ga0500555_003873 3300053103 Bacteria 4258
1172 Ga0500556_0000004 3300053104 Bacteria 666287
1173 Ga0500556_0000071 3300053104 Bacteria 100768
1174 Ga0500557_000110 3300053105 Bacteria 23691
1175 Ga0500572_000420 3300053111 Bacteria 14884
1176 Ga0500572_001411 3300053111 Bacteria 6595
1177 Ga0500592_002327 3300053116 Bacteria 3064
1178 Ga0500593_019912 3300053117 Bacteria 2937
1179 Ga0500595_000590 3300053119 Bacteria 21658
1180 Ga0500595_004506 3300053119 Bacteria 6233
1181 Ga0500607_039728 3300053121 Bacteria 2553
1182 Ga0500608_008414 3300053122 Bacteria 4334
1183 Ga0500608_040527 3300053122 Bacteria 2233
1184 Ga0500608_097487 3300053122 Bacteria 1366
1185 Ga0500618_009095 3300053125 Bacteria 2731
1186 Ga0500642_0000036 3300053130 Bacteria 104249
1187 Ga0500642_0000086 3300053130 Bacteria 48427
1188 Ga0500642_0085036 3300053130 Bacteria 1457
1189 Ga0500652_000837 3300053131 Bacteria 10198
1190 Ga0500559_0000154 3300053136 Bacteria 54106
1191 Ga0500559_0003041 3300053136 Bacteria 8382
1192 Ga0500559_0004402 3300053136 Bacteria 6694
1193 Ga0500568_0000599 3300053139 Bacteria 26179
1194 Ga0500568_0003668 3300053139 Bacteria 8441
1195 Ga0500568_0008132 3300053139 Bacteria 5085
1196 Ga0500577_0000074 3300053142 Bacteria 23109
1197 Ga0500577_0069081 3300053142 Bacteria 1381
1198 Ga0500586_003626 3300053145 Bacteria 3677
1199 Ga0500590_057344 3300053148 Bacteria 1965
1200 Ga0500590_069197 3300053148 Bacteria 1757
1201 Ga0500603_001125 3300053150 Bacteria 6243
1202 Ga0500604_0002371 3300053151 Bacteria 5152
1203 Ga0500604_0021396 3300053151 Bacteria 1828
1204 Ga0500616_0000014 3300053153 Bacteria 637918
1205 Ga0500616_0000325 3300053153 Bacteria 68300
1206 Ga0500616_0007667 3300053153 Bacteria 6817
1207 Ga0500619_002452 3300053154 Bacteria 3573
1208 Ga0500622_0003210 3300053156 Bacteria 11123
1209 Ga0500622_0117062 3300053156 Bacteria 1296
1210 Ga0500627_0019326 3300053158 Bacteria 2712
1211 Ga0500627_0108383 3300053158 Bacteria 1249
1212 Ga0500634_0031888 3300053161 Bacteria 2875
1213 Ga0500639_000001 3300053163 Bacteria 244795
1214 Ga0500636_0000151 3300053177 Bacteria 35998
1215 Ga0500636_0005425 3300053177 Bacteria 7278
1216 Ga0500636_0024548 3300053177 Bacteria 3566
1217 Ga0500637_0000751 3300053178 Bacteria 13000
1218 Ga0500637_0111130 3300053178 Bacteria 1589
1219 Ga0500601_000098 3300053737 Bacteria 18298
1220 Ga0501084_0007759 3300054114 Bacteria 8834
1221 Ga0501084_0044564 3300054114 Bacteria 3714
1222 Ga0501084_0068379 3300054114 Bacteria 2973
1223 Ga0501084_0092897 3300054114 Bacteria 2533
1224 Ga0501084_0219092 3300054114 Bacteria 1606
1225 Ga0501082_0000025 3300060353 Bacteria 103262
1226 Ga0501082_0010489 3300060353 Bacteria 7972
1227 Ga0501082_0041736 3300060353 Bacteria 3956
1228 Ga0501082_0058195 3300060353 Bacteria 3330
1229 Ga0501082_0263232 3300060353 Bacteria 1500
1230 Ga0466962_0094305 3300061719 Bacteria 1435

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0274822 Ga0496126_0274822_131_1183 304
2 3300002239 JGI24034J26672_10008216 JGI24034J26672_100082161 314
3 3300002244 JGI24742J22300_10013207 JGI24742J22300_100132071 314
4 3300005343 Ga0070687_100007913 Ga0070687_1000079134 314
5 3300005344 Ga0070661_100077160 Ga0070661_1000771602 314
6 3300005345 Ga0070692_10075515 Ga0070692_100755152 314
7 3300005365 Ga0070688_100036593 Ga0070688_1000365931 314
8 3300005535 Ga0070684_100261749 Ga0070684_1002617492 314
9 3300005544 Ga0070686_100010855 Ga0070686_1000108554 314
10 3300005616 Ga0068852_100022868 Ga0068852_1000228682 314
11 3300005618 Ga0068864_100014660 Ga0068864_1000146602 314
12 3300005842 Ga0068858_100015026 Ga0068858_1000150263 314
13 3300005843 Ga0068860_100410163 Ga0068860_1004101632 314
14 3300014968 Ga0157379_10039891 Ga0157379_100398912 314
15 iso_pu_bacteria 2876808645 2876809366 314
16 3300005328 Ga0070676_10044352 Ga0070676_100443522 315
17 3300005338 Ga0068868_100185877 Ga0068868_1001858772 315
18 3300005341 Ga0070691_10017160 Ga0070691_100171602 315
19 3300005353 Ga0070669_100134032 Ga0070669_1001340322 315
20 3300005356 Ga0070674_100084723 Ga0070674_1000847231 315
21 3300005366 Ga0070659_100247264 Ga0070659_1002472641 315
22 3300005545 Ga0070695_100051997 Ga0070695_1000519972 315
23 3300006042 Ga0075368_10050755 Ga0075368_100507552 315
24 3300014969 Ga0157376_10011610 Ga0157376_100116102 315
25 3300025907 Ga0207645_10013748 Ga0207645_100137483 315
26 3300025932 Ga0207690_10061838 Ga0207690_100618382 315
27 3300025940 Ga0207691_10070174 Ga0207691_100701742 315
28 3300025941 Ga0207711_10040269 Ga0207711_100402693 315
29 3300026023 Ga0207677_10048420 Ga0207677_100484202 315
30 3300028379 Ga0268266_10191132 Ga0268266_101911322 315
31 3300028380 Ga0268265_10351527 Ga0268265_103515271 315
32 3300039062 Ga0400483_139806 Ga0400483_139806_20180_21145 315
33 3300039062 Ga0400483_175766 Ga0400483_175766_2086_3051 315
34 3300039062 Ga0400483_205987 Ga0400483_205987_2206_3171 315
35 3300046660 Ga0495625_0211726 Ga0495625_0211726_237_1205 315
36 3300048905 Ga0496102_0028901 Ga0496102_0028901_212_1180 315
37 3300048912 Ga0496109_0351915 Ga0496109_0351915_168_1136 315
38 3300048918 Ga0496115_0040376 Ga0496115_0040376_2492_3460 315
39 3300049569 Ga0501032_0011988 Ga0501032_0011988_5144_6112 315
40 3300049571 Ga0501034_0231765 Ga0501034_0231765_758_1726 315
41 3300049572 Ga0501036_0014141 Ga0501036_0014141_2960_3928 315
42 3300049574 Ga0501038_0025032 Ga0501038_0025032_3764_4732 315
43 3300049579 Ga0501043_0014386 Ga0501043_0014386_4746_5714 315
44 3300049582 Ga0501048_0106814 Ga0501048_0106814_915_1883 315
45 3300049822 Ga0501035_0021197 Ga0501035_0021197_832_1800 315
46 3300050494 nmdc:mga06z11_46170_c1 nmdc:mga06z11_46170_c1_379_1347 315
47 3300050511 nmdc:mga08y16_315278_c1 nmdc:mga08y16_315278_c1_378_1346 315
48 3300053177 Ga0500636_0024548 Ga0500636_0024548_1123_2091 315
49 iso_pu_bacteria 2842333319 2842334661 315
50 3300005843 Ga0068860_100372443 Ga0068860_1003724432 316
51 3300028379 Ga0268266_10008371 Ga0268266_100083714 316
52 3300031247 Ga0265340_10015221 Ga0265340_100152212 316
53 3300031249 Ga0265339_10002292 Ga0265339_100022927 316
54 3300031250 Ga0265331_10058559 Ga0265331_100585592 316
55 3300031507 Ga0307509_10048183 Ga0307509_100481834 316
56 3300031712 Ga0265342_10000110 Ga0265342_1000011053 316
57 3300031730 Ga0307516_10302458 Ga0307516_103024582 316
58 3300037418 Ga0395900_0554187 Ga0395900_0554187_14_964 316
59 3300046460 Ga0495638_0068357 Ga0495638_0068357_109_1077 316
60 3300046519 Ga0495632_0008927 Ga0495632_0008927_4069_5037 316
61 3300046557 Ga0495622_0017143 Ga0495622_0017143_91_1059 316
62 3300046616 Ga0495668_0060757 Ga0495668_0060757_15_983 316
63 3300046660 Ga0495625_0147310 Ga0495625_0147310_340_1308 316
64 3300046692 Ga0495671_0024554 Ga0495671_0024554_1625_2593 316
65 3300048924 Ga0496121_0256896 Ga0496121_0256896_122_1090 316
66 3300049570 Ga0501033_0195265 Ga0501033_0195265_448_1416 316
67 3300049588 Ga0501072_0115580 Ga0501072_0115580_122_1090 316
68 3300053119 Ga0500595_004506 Ga0500595_004506_325_1293 316
69 iso_pu_bacteria 2897803580 2897804234 316
70 3300006195 Ga0075366_10175615 Ga0075366_101756152 317
71 3300031241 Ga0265325_10082418 Ga0265325_100824181 317
72 3300031247 Ga0265340_10092226 Ga0265340_100922262 317
73 3300031595 Ga0265313_10016846 Ga0265313_100168464 317
74 3300031712 Ga0265342_10019680 Ga0265342_100196804 317
75 iso_pu_bacteria 2534681786 2535484647 317
76 iso_pu_bacteria 2643221591 2643963306 317
77 iso_pu_bacteria 2751185800 2753359229 317
78 iso_pu_bacteria 2767802442 2770199435 317
79 iso_pu_bacteria 2840764183 2840767964 317
80 iso_pu_bacteria 2889790730 2889792134 317
81 iso_pu_bacteria 2889914905 2889917895 317
82 iso_pu_bacteria 2904578770 2904581611 317
83 iso_pu_bacteria 2919119836 2919122847 317
84 iso_pu_bacteria 8045864390 8045865250 317
85 iso_pu_bacteria 2508501128 2509150424 318
86 iso_pu_bacteria 2511231028 2511395516 318
87 iso_pu_bacteria 2513237092 2513623122 318
88 iso_pu_bacteria 2513237094 2513639053 318
89 iso_pu_bacteria 2513237095 2513645930 318
90 iso_pu_bacteria 2513237096 2513654657 318
91 iso_pu_bacteria 2513237098 2513673893 318
92 iso_pu_bacteria 2513237101 2513692441 318
93 iso_pu_bacteria 2513237102 2513700146 318
94 iso_pu_bacteria 2513237104 2513719535 318
95 iso_pu_bacteria 2513237137 2513855932 318
96 iso_pu_bacteria 2513237139 2513872686 318
97 iso_pu_bacteria 2513237141 2513889046 318
98 iso_pu_bacteria 2513237145 2513915163 318
99 iso_pu_bacteria 2513237161 2514011936 318
100 iso_pu_bacteria 2515154112 2515628278 318
101 iso_pu_bacteria 2517093001 2517101316 318
102 iso_pu_bacteria 2524023205 2524440485 318
103 iso_pu_bacteria 2524023210 2524469599 318
104 iso_pu_bacteria 2524023228 2524541159 318
105 iso_pu_bacteria 2528768022 2528851180 318
106 iso_pu_bacteria 2617270735 2617348932 318
107 iso_pu_bacteria 2617270741 2617375850 318
108 iso_pu_bacteria 2643221651 2644288678 318
109 iso_pu_bacteria 2667528175 2671122432 318
110 iso_pu_bacteria 2721755755 2723845177 318
111 iso_pu_bacteria 2728368998 2728751503 318
112 iso_pu_bacteria 2744054633 2745075246 318
113 iso_pu_bacteria 2791355196 2793062482 318
114 iso_pu_bacteria 2791355197 2793072059 318
115 iso_pu_bacteria 2791355199 2793080901 318
116 iso_pu_bacteria 2802429603 2805915416 318
117 iso_pu_bacteria 2816332527 2818238999 318
118 iso_pu_bacteria 2824600985 2824603486 318
119 iso_pu_bacteria 2824609381 2824617603 318
120 iso_pu_bacteria 2824617872 2824625709 318
121 iso_pu_bacteria 2824626560 2824634518 318
122 iso_pu_bacteria 2824635225 2824642034 318
123 iso_pu_bacteria 2824644064 2824650363 318
124 iso_pu_bacteria 2824653114 2824654728 318
125 iso_pu_bacteria 2824661429 2824667459 318
126 iso_pu_bacteria 2824671348 2824675822 318
127 iso_pu_bacteria 2824679649 2824686549 318
128 iso_pu_bacteria 2824687955 2824693110 318
129 iso_pu_bacteria 2824696289 2824701722 318
130 iso_pu_bacteria 2824704595 2824711901 318
131 iso_pu_bacteria 2824714736 2824720231 318
132 iso_pu_bacteria 2824723954 2824730582 318
133 iso_pu_bacteria 2824732956 2824739271 318
134 iso_pu_bacteria 2824746037 2824751594 318
135 iso_pu_bacteria 2824753945 2824762671 318
136 iso_pu_bacteria 2824763712 2824772767 318
137 iso_pu_bacteria 2824773399 2824777670 318
138 iso_pu_bacteria 2838122688 2838123837 318
139 iso_pu_bacteria 2841941048 2841944034 318
140 iso_pu_bacteria 2841949485 2841949937 318
141 iso_pu_bacteria 2841957949 2841958584 318
142 iso_pu_bacteria 2841966195 2841966355 318
143 iso_pu_bacteria 2841974524 2841975089 318
144 iso_pu_bacteria 2841983080 2841983339 318
145 iso_pu_bacteria 2842038055 2842039150 318
146 iso_pu_bacteria 2842045827 2842047903 318
147 iso_pu_bacteria 2844315083 2844319004 318
148 iso_pu_bacteria 2847930680 2847936129 318
149 iso_pu_bacteria 2847939898 2847946480 318
150 iso_pu_bacteria 2849076700 2849079399 318
151 iso_pu_bacteria 2857509624 2857514396 318
152 iso_pu_bacteria 2857524615 2857529218 318
153 iso_pu_bacteria 2874590934 2874593406 318
154 iso_pu_bacteria 2874604998 2874605109 318
155 iso_pu_bacteria 2874612657 2874615223 318
156 iso_pu_bacteria 2874620515 2874627184 318
157 iso_pu_bacteria 2874628541 2874631760 318
158 iso_pu_bacteria 2874645413 2874648961 318
159 iso_pu_bacteria 2876761206 2876767044 318
160 iso_pu_bacteria 2876771140 2876771988 318
161 iso_pu_bacteria 2876818435 2876822067 318
162 iso_pu_bacteria 2879074833 2879075580 318
163 iso_pu_bacteria 2879083081 2879090106 318
164 iso_pu_bacteria 2879099564 2879103274 318
165 iso_pu_bacteria 2879110137 2879113611 318
166 iso_pu_bacteria 2879127579 2879130010 318
167 iso_pu_bacteria 2879142872 2879147073 318
168 iso_pu_bacteria 2881364244 2881367022 318
169 iso_pu_bacteria 2881665667 2881671092 318
170 iso_pu_bacteria 2885366525 2885370553 318
171 iso_pu_bacteria 2885374607 2885376468 318
172 iso_pu_bacteria 2885383462 2885390587 318
173 iso_pu_bacteria 2885409591 2885412139 318
174 iso_pu_bacteria 2888378607 2888383974 318
175 iso_pu_bacteria 2888388044 2888393882 318
176 iso_pu_bacteria 2888419890 2888424385 318
177 iso_pu_bacteria 2889033259 2889039927 318
178 iso_pu_bacteria 2893066018 2893071332 318
179 iso_pu_bacteria 2903727486 2903729071 318
180 iso_pu_bacteria 2903748898 2903751732 318
181 iso_pu_bacteria 2903768456 2903773893 318
182 iso_pu_bacteria 2904666416 2904671297 318
183 iso_pu_bacteria 2904690495 2904698390 318
184 iso_pu_bacteria 2904699407 2904703356 318
185 iso_pu_bacteria 2904711408 2904714528 318
186 iso_pu_bacteria 2906602504 2906610117 318
187 iso_pu_bacteria 2906610324 2906618554 318
188 iso_pu_bacteria 2906626472 2906628585 318
189 iso_pu_bacteria 2906635258 2906635547 318
190 iso_pu_bacteria 2906643746 2906651182 318
191 iso_pu_bacteria 2906660503 2906666446 318
192 iso_pu_bacteria 2908739725 2908742766 318
193 iso_pu_bacteria 2908756301 2908761050 318
194 iso_pu_bacteria 2908775508 2908780093 318
195 iso_pu_bacteria 2919073203 2919076726 318
196 iso_pu_bacteria 2922361189 2922365273 318
197 iso_pu_bacteria 2922368715 2922374298 318
198 iso_pu_bacteria 2922393267 2922396392 318
199 iso_pu_bacteria 2922425934 2922430211 318
200 iso_pu_bacteria 2929615660 2929617972 318
201 iso_pu_bacteria 2929624759 2929627653 318
202 iso_pu_bacteria 2932784394 2932788245 318
203 iso_pu_bacteria 2932794094 2932797559 318
204 iso_pu_bacteria 2932801729 2932802875 318
205 iso_pu_bacteria 2932809354 2932810605 318
206 iso_pu_bacteria 2932818245 2932821249 318
207 iso_pu_bacteria 2932828146 2932831242 318
208 iso_pu_bacteria 2933577622 2933579901 318
209 iso_pu_bacteria 2935608549 2935608800 318
210 iso_pu_bacteria 2935616580 2935622962 318
211 iso_pu_bacteria 2935630451 2935631727 318
212 iso_pu_bacteria 2935638405 2935642322 318
213 iso_pu_bacteria 2935648319 2935649955 318
214 iso_pu_bacteria 2935656913 2935661893 318
215 iso_pu_bacteria 2935665750 2935668375 318
216 iso_pu_bacteria 2935675223 2935680508 318
217 iso_pu_bacteria 2935684952 2935692822 318
218 iso_pu_bacteria 2935694250 2935700991 318
219 iso_pu_bacteria 2935703347 2935706230 318
220 iso_pu_bacteria 2935713505 2935721453 318
221 iso_pu_bacteria 2935722832 2935730371 318
222 iso_pu_bacteria 2935732158 2935740384 318
223 iso_pu_bacteria 2935741537 2935749648 318
224 iso_pu_bacteria 2935750917 2935759039 318
225 iso_pu_bacteria 2935760218 2935762631 318
226 iso_pu_bacteria 2935769743 2935773212 318
227 iso_pu_bacteria 2935777560 2935778457 318
228 iso_pu_bacteria 2935785616 2935790423 318
229 iso_pu_bacteria 2935793552 2935798152 318
230 iso_pu_bacteria 2935801545 2935803230 318
231 iso_pu_bacteria 2935810662 2935814550 318
232 iso_pu_bacteria 2935819856 2935821960 318
233 iso_pu_bacteria 2935827899 2935831688 318
234 iso_pu_bacteria 2935837841 2935838556 318
235 iso_pu_bacteria 2935847175 2935847542 318
236 iso_pu_bacteria 2935855204 2935861210 318
237 iso_pu_bacteria 2935864058 2935865748 318
238 iso_pu_bacteria 2935873716 2935878249 318
239 iso_pu_bacteria 2935883170 2935885216 318
240 iso_pu_bacteria 2935908558 2935909191 318
241 iso_pu_bacteria 2935916978 2935919912 318
242 iso_pu_bacteria 2935926038 2935926235 318
243 iso_pu_bacteria 2935934488 2935934685 318
244 iso_pu_bacteria 2935942939 2935943135 318
245 iso_pu_bacteria 2935951376 2935951573 318
246 iso_pu_bacteria 2935959822 2935966401 318
247 iso_pu_bacteria 2935967501 2935967698 318
248 iso_pu_bacteria 2935975950 2935977102 318
249 iso_pu_bacteria 2935984226 2935988261 318
250 iso_pu_bacteria 2935992306 2935994562 318
251 iso_pu_bacteria 2936002035 2936007638 318
252 iso_pu_bacteria 2936011229 2936012562 318
253 iso_pu_bacteria 2936019824 2936021126 318
254 iso_pu_bacteria 2936028420 2936029855 318
255 iso_pu_bacteria 2936037263 2936040107 318
256 iso_pu_bacteria 2936046547 2936047320 318
257 iso_pu_bacteria 2936055302 2936057522 318
258 iso_pu_bacteria 2940556831 2940564956 318
259 iso_pu_bacteria 2941507105 2941511521 318
260 iso_pu_bacteria 2941515067 2941519222 318
261 iso_pu_bacteria 2941523033 2941526198 318
262 iso_pu_bacteria 2941531003 2941532673 318
263 iso_pu_bacteria 2941538514 2941538776 318
264 iso_pu_bacteria 3005474847 3005480145 318
265 iso_pu_bacteria 3005483717 3005487261 318
266 iso_pu_bacteria 3005506211 3005510253 318
267 iso_pu_bacteria 3005587118 3005591050 318
268 iso_pu_bacteria 3005594810 3005599150 318
269 iso_pu_bacteria 3005710791 3005714815 318
270 iso_pu_bacteria 3005718088 3005722245 318
271 iso_pu_bacteria 8006926726 8006929977 318
272 iso_pu_bacteria 8006933436 8006940743 318
273 iso_pu_bacteria 8006973647 8006980433 318
274 iso_pu_bacteria 8006984368 8006987134 318
275 iso_pu_bacteria 8006994254 8006998817 318
276 iso_pu_bacteria 8016511872 8016522432 318
277 iso_pu_bacteria 8016522445 8016529698 318
278 iso_pu_bacteria 8016530956 8016534918 318
279 iso_pu_bacteria 8016548790 8016553997 318
280 iso_pu_bacteria 8016566248 8016573261 318
281 iso_pu_bacteria 8016575299 8016577403 318
282 iso_pu_bacteria 8016583857 8016591886 318
283 iso_pu_bacteria 8016595262 8016600174 318
284 iso_pu_bacteria 8016603502 8016610577 318
285 iso_pu_bacteria 8016613128 8016614353 318
286 iso_pu_bacteria 8016622563 8016626632 318
287 iso_pu_bacteria 8016630954 8016640444 318
288 iso_pu_bacteria 8017057580 8017063131 318
289 iso_pu_bacteria 8019530166 8019534679 318
290 iso_pu_bacteria 8019538911 8019544794 318
291 iso_pu_bacteria 8019547302 8019553743 318
292 iso_pu_bacteria 8019555841 8019556826 318
293 iso_pu_bacteria 8019565922 8019568475 318
294 iso_pu_bacteria 8019586578 8019590354 318
295 iso_pu_bacteria 8019597564 8019600999 318
296 iso_pu_bacteria 8019619141 8019628045 318
297 iso_pu_bacteria 8019629233 8019634557 318
298 iso_pu_bacteria 8019648815 8019658302 318
299 iso_pu_bacteria 8019659431 8019662450 318
300 iso_pu_bacteria 8019668869 8019671948 318
301 iso_pu_bacteria 8019678201 8019684146 318
302 iso_pu_bacteria 8019687851 8019689983 318
303 iso_pu_bacteria 8055742211 8055746438 318
304 iso_pu_bacteria 8056673599 8056673952 318
305 iso_pu_bacteria 8056681323 8056686613 318
306 iso_pu_bacteria 8056689827 8056693601 318
307 iso_pu_bacteria 8056967851 8056967948 318
308 3300005367 Ga0070667_100071018 Ga0070667_1000710182 319
309 3300009148 Ga0105243_10014895 Ga0105243_100148955 319
310 3300025920 Ga0207649_10033623 Ga0207649_100336231 319
311 3300025986 Ga0207658_10027891 Ga0207658_100278912 319
312 3300032004 Ga0307414_10098259 Ga0307414_100982592 319
313 3300034819 Ga0373958_0001587 Ga0373958_0001587_1765_2793 319
314 3300034820 Ga0373959_0010268 Ga0373959_0010268_494_1522 319
315 3300035092 Ga0373952_0003964 Ga0373952_0003964_399_1427 319
316 3300035114 Ga0373939_0016255 Ga0373939_0016255_127_1155 319
317 3300049573 Ga0501037_0121741 Ga0501037_0121741_523_1482 319
318 3300049581 Ga0501047_0050922 Ga0501047_0050922_2148_3107 319
319 3300049742 Ga0501080_0273644 Ga0501080_0273644_322_1281 319
320 3300049744 Ga0501083_0006485 Ga0501083_0006485_1835_2794 319
321 3300050514 nmdc:mga08x19_193038_c1 nmdc:mga08x19_193038_c1_140_1168 319
322 3300003544 Ga0007417J51691_1052383 Ga0007417J51691_10523831 320
323 3300032004 Ga0307414_10327816 Ga0307414_103278162 320
324 3300048928 Ga0496125_0000602 Ga0496125_0000602_19139_20101 320
325 3300049575 Ga0501039_0283717 Ga0501039_0283717_75_1037 320
326 3300050491 nmdc:mga00v17_12176_c1 nmdc:mga00v17_12176_c1_2171_3133 320
327 3300050496 nmdc:mga07m45_28805_c1 nmdc:mga07m45_28805_c1_1392_2354 320
328 3300003771 Ga0055526_1000091 Ga0055526_100009128 321
329 3300005329 Ga0070683_100134291 Ga0070683_1001342913 321
330 3300005339 Ga0070660_100006727 Ga0070660_1000067276 321
331 3300005339 Ga0070660_100084058 Ga0070660_1000840581 321
332 3300005344 Ga0070661_100022107 Ga0070661_1000221073 321
333 3300005344 Ga0070661_100022501 Ga0070661_1000225012 321
334 3300005356 Ga0070674_100047021 Ga0070674_1000470212 321
335 3300005456 Ga0070678_100040147 Ga0070678_1000401473 321
336 3300005458 Ga0070681_10013085 Ga0070681_100130854 321
337 3300005459 Ga0068867_100201855 Ga0068867_1002018552 321
338 3300005563 Ga0068855_100174019 Ga0068855_1001740192 321
339 3300005564 Ga0070664_100056179 Ga0070664_1000561793 321
340 3300005578 Ga0068854_100041156 Ga0068854_1000411563 321
341 3300005614 Ga0068856_100015680 Ga0068856_1000156801 321
342 3300005616 Ga0068852_100037474 Ga0068852_1000374742 321
343 3300005618 Ga0068864_100204427 Ga0068864_1002044271 321
344 3300006881 Ga0068865_100098159 Ga0068865_1000981591 321
345 3300009551 Ga0105238_10094937 Ga0105238_100949372 321
346 3300011119 Ga0105246_10409549 Ga0105246_104095491 321
347 3300013102 Ga0157371_10077493 Ga0157371_100774932 321
348 3300013104 Ga0157370_10027064 Ga0157370_100270644 321
349 3300025253 Ga0209677_100639 Ga0209677_10063910 321
350 3300025261 Ga0209233_1001736 Ga0209233_10017364 321
351 3300025272 Ga0209455_1001958 Ga0209455_10019585 321
352 3300025295 Ga0209564_1000017 Ga0209564_1000017104 321
353 3300025907 Ga0207645_10029619 Ga0207645_100296192 321
354 3300025912 Ga0207707_10021859 Ga0207707_100218593 321
355 3300025913 Ga0207695_10036612 Ga0207695_100366122 321
356 3300025917 Ga0207660_10085029 Ga0207660_100850292 321
357 3300025919 Ga0207657_10084339 Ga0207657_100843392 321
358 3300025919 Ga0207657_10086958 Ga0207657_100869581 321
359 3300025937 Ga0207669_10028991 Ga0207669_100289913 321
360 3300025960 Ga0207651_10134505 Ga0207651_101345052 321
361 3300025981 Ga0207640_10071361 Ga0207640_100713612 321
362 3300026078 Ga0207702_10019299 Ga0207702_100192993 321
363 3300026089 Ga0207648_10246631 Ga0207648_102466311 321
364 3300026121 Ga0207683_10018855 Ga0207683_100188552 321
365 3300027907 Ga0207428_10078702 Ga0207428_100787023 321
366 3300037418 Ga0395900_0277052 Ga0395900_0277052_307_1272 321
367 3300046516 Ga0495628_0317667 Ga0495628_0317667_47_1012 321
368 3300048920 Ga0496117_0051775 Ga0496117_0051775_1070_2038 321
369 3300048921 Ga0496118_0081179 Ga0496118_0081179_105_1070 321
370 3300048922 Ga0496119_0015210 Ga0496119_0015210_4522_5487 321
371 3300048924 Ga0496121_0023725 Ga0496121_0023725_3613_4581 321
372 3300048924 Ga0496121_0052234 Ga0496121_0052234_2308_3276 321
373 3300048928 Ga0496125_0090461 Ga0496125_0090461_198_1166 321
374 3300049574 Ga0501038_0250242 Ga0501038_0250242_71_1036 321
375 3300049578 Ga0501042_0156475 Ga0501042_0156475_224_1189 321
376 3300049580 Ga0501046_0041076 Ga0501046_0041076_1382_2347 321
377 3300049587 Ga0501071_0131572 Ga0501071_0131572_135_1100 321
378 3300049743 Ga0501081_0077444 Ga0501081_0077444_1085_2050 321
379 3300060353 Ga0501082_0058195 Ga0501082_0058195_1573_2538 321
380 3300003203 JGI25406J46586_10001258 JGI25406J46586_100012587 322
381 3300003215 JGI25153J46596_10001975 JGI25153J46596_100019755 322
382 3300003215 JGI25153J46596_10008987 JGI25153J46596_100089875 322
383 3300003215 JGI25153J46596_10013218 JGI25153J46596_100132184 322
384 3300003215 JGI25153J46596_10037847 JGI25153J46596_100378472 322
385 3300003659 JGI25404J52841_10006528 JGI25404J52841_100065282 322
386 3300003659 JGI25404J52841_10010095 JGI25404J52841_100100952 322
387 3300003659 JGI25404J52841_10010842 JGI25404J52841_100108421 322
388 3300003752 Ga0055539_1006204 Ga0055539_10062042 322
389 3300003771 Ga0055526_1018462 Ga0055526_10184622 322
390 3300005262 Ga0065165_1001744 Ga0065165_100174415 322
391 3300005262 Ga0065165_1003890 Ga0065165_10038901 322
392 3300005293 Ga0065715_10033428 Ga0065715_100334282 322
393 3300005327 Ga0070658_10332403 Ga0070658_103324031 322
394 3300005329 Ga0070683_100004422 Ga0070683_1000044226 322
395 3300005329 Ga0070683_100242948 Ga0070683_1002429482 322
396 3300005331 Ga0070670_100028273 Ga0070670_1000282735 322
397 3300005334 Ga0068869_100139520 Ga0068869_1001395202 322
398 3300005336 Ga0070680_100095596 Ga0070680_1000955962 322
399 3300005338 Ga0068868_100012415 Ga0068868_1000124154 322
400 3300005339 Ga0070660_100086085 Ga0070660_1000860852 322
401 3300005340 Ga0070689_100117474 Ga0070689_1001174743 322
402 3300005347 Ga0070668_100258516 Ga0070668_1002585162 322
403 3300005353 Ga0070669_100031521 Ga0070669_1000315212 322
404 3300005366 Ga0070659_100289974 Ga0070659_1002899741 322
405 3300005434 Ga0070709_10000102 Ga0070709_1000010251 322
406 3300005434 Ga0070709_10038944 Ga0070709_100389442 322
407 3300005434 Ga0070709_10064450 Ga0070709_100644503 322
408 3300005434 Ga0070709_10176321 Ga0070709_101763212 322
409 3300005434 Ga0070709_10179990 Ga0070709_101799902 322
410 3300005435 Ga0070714_100031763 Ga0070714_1000317631 322
411 3300005435 Ga0070714_100086107 Ga0070714_1000861071 322
412 3300005435 Ga0070714_100097986 Ga0070714_1000979861 322
413 3300005435 Ga0070714_100107780 Ga0070714_1001077802 322
414 3300005436 Ga0070713_100009644 Ga0070713_1000096446 322
415 3300005436 Ga0070713_100153064 Ga0070713_1001530642 322
416 3300005436 Ga0070713_100184954 Ga0070713_1001849542 322
417 3300005437 Ga0070710_10000246 Ga0070710_100002467 322
418 3300005437 Ga0070710_10108611 Ga0070710_101086112 322
419 3300005439 Ga0070711_100003729 Ga0070711_1000037294 322
420 3300005439 Ga0070711_100015465 Ga0070711_1000154653 322
421 3300005439 Ga0070711_100072176 Ga0070711_1000721762 322
422 3300005441 Ga0070700_100084160 Ga0070700_1000841601 322
423 3300005441 Ga0070700_100159554 Ga0070700_1001595543 322
424 3300005441 Ga0070700_100198170 Ga0070700_1001981701 322
425 3300005455 Ga0070663_100012278 Ga0070663_1000122786 322
426 3300005455 Ga0070663_100077525 Ga0070663_1000775252 322
427 3300005455 Ga0070663_100311355 Ga0070663_1003113552 322
428 3300005456 Ga0070678_100005520 Ga0070678_1000055203 322
429 3300005456 Ga0070678_100021678 Ga0070678_1000216783 322
430 3300005458 Ga0070681_10053331 Ga0070681_100533312 322
431 3300005458 Ga0070681_10088546 Ga0070681_100885461 322
432 3300005458 Ga0070681_10097274 Ga0070681_100972742 322
433 3300005458 Ga0070681_10107817 Ga0070681_101078173 322
434 3300005458 Ga0070681_10291591 Ga0070681_102915911 322
435 3300005458 Ga0070681_10362176 Ga0070681_103621762 322
436 3300005530 Ga0070679_100089910 Ga0070679_1000899102 322
437 3300005530 Ga0070679_100333709 Ga0070679_1003337092 322
438 3300005530 Ga0070679_100379485 Ga0070679_1003794851 322
439 3300005530 Ga0070679_100451640 Ga0070679_1004516401 322
440 3300005535 Ga0070684_100018267 Ga0070684_1000182673 322
441 3300005535 Ga0070684_100125327 Ga0070684_1001253272 322
442 3300005535 Ga0070684_100180759 Ga0070684_1001807591 322
443 3300005536 Ga0070697_100000429 Ga0070697_10000042911 322
444 3300005536 Ga0070697_100024733 Ga0070697_1000247333 322
445 3300005539 Ga0068853_100000869 Ga0068853_10000086910 322
446 3300005539 Ga0068853_100006971 Ga0068853_1000069712 322
447 3300005539 Ga0068853_100128945 Ga0068853_1001289452 322
448 3300005539 Ga0068853_100151947 Ga0068853_1001519471 322
449 3300005539 Ga0068853_100337082 Ga0068853_1003370822 322
450 3300005544 Ga0070686_100015574 Ga0070686_1000155744 322
451 3300005544 Ga0070686_100218276 Ga0070686_1002182762 322
452 3300005545 Ga0070695_100011981 Ga0070695_1000119816 322
453 3300005547 Ga0070693_100148211 Ga0070693_1001482112 322
454 3300005548 Ga0070665_100020137 Ga0070665_1000201372 322
455 3300005548 Ga0070665_100145789 Ga0070665_1001457892 322
456 3300005548 Ga0070665_100192062 Ga0070665_1001920622 322
457 3300005548 Ga0070665_100379380 Ga0070665_1003793802 322
458 3300005548 Ga0070665_100476651 Ga0070665_1004766511 322
459 3300005549 Ga0070704_100002047 Ga0070704_10000204713 322
460 3300005563 Ga0068855_100079891 Ga0068855_1000798912 322
461 3300005563 Ga0068855_100093456 Ga0068855_1000934562 322
462 3300005563 Ga0068855_100101222 Ga0068855_1001012221 322
463 3300005563 Ga0068855_100379041 Ga0068855_1003790412 322
464 3300005563 Ga0068855_100618949 Ga0068855_1006189491 322
465 3300005577 Ga0068857_100068528 Ga0068857_1000685283 322
466 3300005577 Ga0068857_100263689 Ga0068857_1002636892 322
467 3300005577 Ga0068857_100303640 Ga0068857_1003036402 322
468 3300005578 Ga0068854_100005134 Ga0068854_1000051345 322
469 3300005614 Ga0068856_100027505 Ga0068856_1000275053 322
470 3300005614 Ga0068856_100042065 Ga0068856_1000420652 322
471 3300005614 Ga0068856_100127393 Ga0068856_1001273932 322
472 3300005617 Ga0068859_100445830 Ga0068859_1004458302 322
473 3300005618 Ga0068864_100091806 Ga0068864_1000918062 322
474 3300005719 Ga0068861_100236290 Ga0068861_1002362902 322
475 3300005834 Ga0068851_10001219 Ga0068851_100012193 322
476 3300005841 Ga0068863_100042721 Ga0068863_1000427211 322
477 3300005841 Ga0068863_100308169 Ga0068863_1003081692 322
478 3300005842 Ga0068858_100219928 Ga0068858_1002199282 322
479 3300005842 Ga0068858_100286753 Ga0068858_1002867532 322
480 3300005842 Ga0068858_100436675 Ga0068858_1004366752 322
481 3300005843 Ga0068860_100001369 Ga0068860_10000136923 322
482 3300005844 Ga0068862_100097391 Ga0068862_1000973911 322
483 3300005844 Ga0068862_100125134 Ga0068862_1001251343 322
484 3300005937 Ga0081455_10002234 Ga0081455_1000223419 322
485 3300005937 Ga0081455_10004479 Ga0081455_100044792 322
486 3300005937 Ga0081455_10007376 Ga0081455_100073762 322
487 3300005937 Ga0081455_10079870 Ga0081455_100798702 322
488 3300005981 Ga0081538_10006633 Ga0081538_100066335 322
489 3300005983 Ga0081540_1003148 Ga0081540_10031482 322
490 3300005983 Ga0081540_1004298 Ga0081540_10042982 322
491 3300005983 Ga0081540_1005800 Ga0081540_10058003 322
492 3300005983 Ga0081540_1016355 Ga0081540_10163554 322
493 3300005983 Ga0081540_1050668 Ga0081540_10506682 322
494 3300005983 Ga0081540_1054025 Ga0081540_10540252 322
495 3300005985 Ga0081539_10000498 Ga0081539_1000049874 322
496 3300005985 Ga0081539_10000616 Ga0081539_1000061624 322
497 3300005985 Ga0081539_10008413 Ga0081539_100084135 322
498 3300005985 Ga0081539_10046173 Ga0081539_100461733 322
499 3300005985 Ga0081539_10107456 Ga0081539_101074561 322
500 3300006028 Ga0070717_10003922 Ga0070717_100039226 322
501 3300006028 Ga0070717_10150872 Ga0070717_101508722 322
502 3300006028 Ga0070717_10227968 Ga0070717_102279683 322
503 3300006028 Ga0070717_10245336 Ga0070717_102453362 322
504 3300006028 Ga0070717_10359963 Ga0070717_103599632 322
505 3300006038 Ga0075365_10102444 Ga0075365_101024442 322
506 3300006042 Ga0075368_10003816 Ga0075368_100038164 322
507 3300006048 Ga0075363_100002036 Ga0075363_1000020362 322
508 3300006048 Ga0075363_100015362 Ga0075363_1000153624 322
509 3300006051 Ga0075364_10098331 Ga0075364_100983312 322
510 3300006051 Ga0075364_10127875 Ga0075364_101278752 322
511 3300006163 Ga0070715_10055100 Ga0070715_100551002 322
512 3300006173 Ga0070716_100004742 Ga0070716_1000047424 322
513 3300006173 Ga0070716_100036119 Ga0070716_1000361193 322
514 3300006175 Ga0070712_100006021 Ga0070712_1000060213 322
515 3300006175 Ga0070712_100009398 Ga0070712_1000093982 322
516 3300006175 Ga0070712_100064276 Ga0070712_1000642762 322
517 3300006177 Ga0075362_10027635 Ga0075362_100276352 322
518 3300006177 Ga0075362_10040719 Ga0075362_100407192 322
519 3300006177 Ga0075362_10068760 Ga0075362_100687602 322
520 3300006178 Ga0075367_10108180 Ga0075367_101081802 322
521 3300006186 Ga0075369_10062592 Ga0075369_100625922 322
522 3300006186 Ga0075369_10119058 Ga0075369_101190581 322
523 3300006195 Ga0075366_10007702 Ga0075366_100077024 322
524 3300006353 Ga0075370_10042918 Ga0075370_100429182 322
525 3300006353 Ga0075370_10070344 Ga0075370_100703442 322
526 3300006353 Ga0075370_10077535 Ga0075370_100775352 322
527 3300006358 Ga0068871_100239577 Ga0068871_1002395771 322
528 3300006844 Ga0075428_100493568 Ga0075428_1004935681 322
529 3300006881 Ga0068865_100166537 Ga0068865_1001665372 322
530 3300006881 Ga0068865_100383018 Ga0068865_1003830181 322
531 3300006931 Ga0097620_100085658 Ga0097620_1000856583 322
532 3300006931 Ga0097620_100445830 Ga0097620_1004458302 322
533 3300006942 Ga0099824_1008576 Ga0099824_10085766 322
534 3300006942 Ga0099824_1012782 Ga0099824_10127822 322
535 3300006943 Ga0099822_1004091 Ga0099822_10040916 322
536 3300007076 Ga0075435_100185232 Ga0075435_1001852321 322
537 3300007265 Ga0099794_10029937 Ga0099794_100299372 322
538 3300007265 Ga0099794_10051984 Ga0099794_100519842 322
539 3300009092 Ga0105250_10056103 Ga0105250_100561032 322
540 3300009093 Ga0105240_10014223 Ga0105240_100142232 322
541 3300009093 Ga0105240_10055530 Ga0105240_100555302 322
542 3300009098 Ga0105245_10033500 Ga0105245_100335003 322
543 3300009101 Ga0105247_10012294 Ga0105247_100122944 322
544 3300009147 Ga0114129_10021007 Ga0114129_100210072 322
545 3300009174 Ga0105241_10007199 Ga0105241_100071993 322
546 3300009177 Ga0105248_10056530 Ga0105248_100565302 322
547 3300009545 Ga0105237_10024567 Ga0105237_100245674 322
548 3300009545 Ga0105237_10090324 Ga0105237_100903242 322
549 3300009545 Ga0105237_10356549 Ga0105237_103565491 322
550 3300009545 Ga0105237_10447678 Ga0105237_104476782 322
551 3300009551 Ga0105238_10000897 Ga0105238_1000089722 322
552 3300009551 Ga0105238_10003968 Ga0105238_100039685 322
553 3300009551 Ga0105238_10018050 Ga0105238_100180504 322
554 3300010375 Ga0105239_10005537 Ga0105239_100055372 322
555 3300010375 Ga0105239_10100251 Ga0105239_101002513 322
556 3300010375 Ga0105239_10313113 Ga0105239_103131131 322
557 3300010375 Ga0105239_10519995 Ga0105239_105199951 322
558 3300011119 Ga0105246_10001247 Ga0105246_1000124710 322
559 3300013102 Ga0157371_10092526 Ga0157371_100925262 322
560 3300013105 Ga0157369_10029906 Ga0157369_100299064 322
561 3300013105 Ga0157369_10055013 Ga0157369_100550131 322
562 3300013296 Ga0157374_10060187 Ga0157374_100601872 322
563 3300013296 Ga0157374_10101153 Ga0157374_101011532 322
564 3300014325 Ga0163163_10065227 Ga0163163_100652272 322
565 3300014325 Ga0163163_10226000 Ga0163163_102260002 322
566 3300014326 Ga0157380_10169296 Ga0157380_101692962 322
567 3300014969 Ga0157376_10033518 Ga0157376_100335182 322
568 3300021320 Ga0214544_1000002 Ga0214544_1000002512 322
569 3300021321 Ga0214542_1000001 Ga0214542_1000001862 322
570 3300021321 Ga0214542_1020125 Ga0214542_10201253 322
571 3300021324 Ga0214545_1000001 Ga0214545_1000001928 322
572 3300021324 Ga0214545_1019688 Ga0214545_10196886 322
573 3300021327 Ga0214543_1000001 Ga0214543_1000001265 322
574 3300025253 Ga0209677_106368 Ga0209677_1063681 322
575 3300025254 Ga0209148_1000356 Ga0209148_100035632 322
576 3300025261 Ga0209233_1008415 Ga0209233_10084153 322
577 3300025272 Ga0209455_1001391 Ga0209455_10013918 322
578 3300025272 Ga0209455_1008852 Ga0209455_10088522 322
579 3300025295 Ga0209564_1000810 Ga0209564_100081010 322
580 3300025295 Ga0209564_1004546 Ga0209564_10045464 322
581 3300025295 Ga0209564_1040998 Ga0209564_10409982 322
582 3300025297 Ga0209758_1000021 Ga0209758_1000021628 322
583 3300025297 Ga0209758_1001018 Ga0209758_10010185 322
584 3300025297 Ga0209758_1002832 Ga0209758_10028329 322
585 3300025297 Ga0209758_1003606 Ga0209758_10036067 322
586 3300025297 Ga0209758_1006112 Ga0209758_10061123 322
587 3300025297 Ga0209758_1010040 Ga0209758_10100404 322
588 3300025297 Ga0209758_1022450 Ga0209758_10224502 322
589 3300025299 Ga0209256_1007804 Ga0209256_10078045 322
590 3300025302 Ga0207426_1000599 Ga0207426_10005992 322
591 3300025302 Ga0207426_1000960 Ga0207426_10009602 322
592 3300025302 Ga0207426_1012993 Ga0207426_10129931 322
593 3300025302 Ga0207426_1033688 Ga0207426_10336882 322
594 3300025304 Ga0209257_1002984 Ga0209257_100298412 322
595 3300025321 Ga0207656_10005751 Ga0207656_100057512 322
596 3300025321 Ga0207656_10036638 Ga0207656_100366382 322
597 3300025893 Ga0207682_10001895 Ga0207682_100018954 322
598 3300025898 Ga0207692_10000514 Ga0207692_100005142 322
599 3300025898 Ga0207692_10006093 Ga0207692_100060933 322
600 3300025898 Ga0207692_10144008 Ga0207692_101440082 322
601 3300025901 Ga0207688_10081217 Ga0207688_100812173 322
602 3300025906 Ga0207699_10000230 Ga0207699_1000023023 322
603 3300025906 Ga0207699_10061551 Ga0207699_100615512 322
604 3300025906 Ga0207699_10115584 Ga0207699_101155842 322
605 3300025909 Ga0207705_10078317 Ga0207705_100783172 322
606 3300025909 Ga0207705_10157169 Ga0207705_101571692 322
607 3300025911 Ga0207654_10000337 Ga0207654_1000033719 322
608 3300025911 Ga0207654_10069921 Ga0207654_100699211 322
609 3300025912 Ga0207707_10006249 Ga0207707_100062494 322
610 3300025912 Ga0207707_10030821 Ga0207707_100308212 322
611 3300025912 Ga0207707_10278072 Ga0207707_102780722 322
612 3300025912 Ga0207707_10291078 Ga0207707_102910782 322
613 3300025913 Ga0207695_10000015 Ga0207695_10000015177 322
614 3300025913 Ga0207695_10036177 Ga0207695_100361772 322
615 3300025913 Ga0207695_10204848 Ga0207695_102048482 322
616 3300025913 Ga0207695_10287141 Ga0207695_102871411 322
617 3300025914 Ga0207671_10012975 Ga0207671_100129756 322
618 3300025914 Ga0207671_10017413 Ga0207671_100174133 322
619 3300025914 Ga0207671_10030613 Ga0207671_100306133 322
620 3300025914 Ga0207671_10039046 Ga0207671_100390462 322
621 3300025914 Ga0207671_10046210 Ga0207671_100462102 322
622 3300025914 Ga0207671_10110789 Ga0207671_101107892 322
623 3300025915 Ga0207693_10002443 Ga0207693_100024432 322
624 3300025915 Ga0207693_10013717 Ga0207693_100137175 322
625 3300025915 Ga0207693_10100300 Ga0207693_101003001 322
626 3300025915 Ga0207693_10106616 Ga0207693_101066162 322
627 3300025915 Ga0207693_10191996 Ga0207693_101919962 322
628 3300025916 Ga0207663_10052256 Ga0207663_100522563 322
629 3300025916 Ga0207663_10061257 Ga0207663_100612573 322
630 3300025917 Ga0207660_10156170 Ga0207660_101561702 322
631 3300025917 Ga0207660_10214989 Ga0207660_102149891 322
632 3300025919 Ga0207657_10000784 Ga0207657_1000078427 322
633 3300025919 Ga0207657_10001921 Ga0207657_1000192116 322
634 3300025919 Ga0207657_10193603 Ga0207657_101936032 322
635 3300025920 Ga0207649_10286038 Ga0207649_102860382 322
636 3300025921 Ga0207652_10025865 Ga0207652_100258652 322
637 3300025921 Ga0207652_10029672 Ga0207652_100296722 322
638 3300025921 Ga0207652_10030541 Ga0207652_100305412 322
639 3300025921 Ga0207652_10090631 Ga0207652_100906313 322
640 3300025922 Ga0207646_10365184 Ga0207646_103651842 322
641 3300025923 Ga0207681_10082035 Ga0207681_100820352 322
642 3300025924 Ga0207694_10000082 Ga0207694_1000008232 322
643 3300025924 Ga0207694_10184894 Ga0207694_101848942 322
644 3300025927 Ga0207687_10013817 Ga0207687_100138172 322
645 3300025927 Ga0207687_10039262 Ga0207687_100392623 322
646 3300025928 Ga0207700_10248977 Ga0207700_102489771 322
647 3300025928 Ga0207700_10353032 Ga0207700_103530322 322
648 3300025929 Ga0207664_10036404 Ga0207664_100364041 322
649 3300025929 Ga0207664_10205363 Ga0207664_102053632 322
650 3300025932 Ga0207690_10250251 Ga0207690_102502512 322
651 3300025935 Ga0207709_10120006 Ga0207709_101200062 322
652 3300025936 Ga0207670_10001095 Ga0207670_1000109510 322
653 3300025936 Ga0207670_10172708 Ga0207670_101727082 322
654 3300025936 Ga0207670_10217743 Ga0207670_102177432 322
655 3300025937 Ga0207669_10015062 Ga0207669_100150622 322
656 3300025937 Ga0207669_10024600 Ga0207669_100246003 322
657 3300025938 Ga0207704_10182750 Ga0207704_101827501 322
658 3300025939 Ga0207665_10000192 Ga0207665_1000019219 322
659 3300025939 Ga0207665_10045186 Ga0207665_100451862 322
660 3300025939 Ga0207665_10089804 Ga0207665_100898043 322
661 3300025940 Ga0207691_10254469 Ga0207691_102544691 322
662 3300025941 Ga0207711_10241632 Ga0207711_102416321 322
663 3300025944 Ga0207661_10007314 Ga0207661_100073142 322
664 3300025949 Ga0207667_10002113 Ga0207667_1000211316 322
665 3300025949 Ga0207667_10113569 Ga0207667_101135692 322
666 3300025961 Ga0207712_10261971 Ga0207712_102619712 322
667 3300025981 Ga0207640_10192095 Ga0207640_101920952 322
668 3300025986 Ga0207658_10071529 Ga0207658_100715293 322
669 3300026023 Ga0207677_10017957 Ga0207677_100179572 322
670 3300026035 Ga0207703_10075271 Ga0207703_100752712 322
671 3300026041 Ga0207639_10034763 Ga0207639_100347632 322
672 3300026041 Ga0207639_10069221 Ga0207639_100692212 322
673 3300026067 Ga0207678_10007958 Ga0207678_100079584 322
674 3300026067 Ga0207678_10020639 Ga0207678_100206392 322
675 3300026075 Ga0207708_10051265 Ga0207708_100512653 322
676 3300026078 Ga0207702_10000002 Ga0207702_10000002388 322
677 3300026088 Ga0207641_10032278 Ga0207641_100322784 322
678 3300026088 Ga0207641_10252533 Ga0207641_102525332 322
679 3300026089 Ga0207648_10178965 Ga0207648_101789652 322
680 3300026089 Ga0207648_10267675 Ga0207648_102676751 322
681 3300026116 Ga0207674_10011733 Ga0207674_100117332 322
682 3300026116 Ga0207674_10257826 Ga0207674_102578261 322
683 3300026118 Ga0207675_100124084 Ga0207675_1001240842 322
684 3300026118 Ga0207675_100198557 Ga0207675_1001985572 322
685 3300026118 Ga0207675_100251309 Ga0207675_1002513091 322
686 3300026121 Ga0207683_10020766 Ga0207683_100207663 322
687 3300026121 Ga0207683_10045508 Ga0207683_100455082 322
688 3300026121 Ga0207683_10255624 Ga0207683_102556242 322
689 3300026121 Ga0207683_10455501 Ga0207683_104555011 322
690 3300027296 Ga0209389_1000008 Ga0209389_1000008215 322
691 3300027296 Ga0209389_1000121 Ga0209389_100012142 322
692 3300027357 Ga0209589_1000003 Ga0209589_1000003500 322
693 3300027357 Ga0209589_1002735 Ga0209589_100273517 322
694 3300027361 Ga0209489_100003 Ga0209489_100003551 322
695 3300027361 Ga0209489_101490 Ga0209489_1014905 322
696 3300027361 Ga0209489_103445 Ga0209489_10344517 322
697 3300027363 Ga0209700_100003 Ga0209700_100003551 322
698 3300027363 Ga0209700_100036 Ga0209700_100036102 322
699 3300028379 Ga0268266_10000908 Ga0268266_1000090819 322
700 3300028379 Ga0268266_10067894 Ga0268266_100678942 322
701 3300028379 Ga0268266_10125463 Ga0268266_101254632 322
702 3300028380 Ga0268265_10144509 Ga0268265_101445091 322
703 3300028381 Ga0268264_10000043 Ga0268264_1000004379 322
704 3300028556 Ga0265337_1012538 Ga0265337_10125383 322
705 3300028556 Ga0265337_1015056 Ga0265337_10150562 322
706 3300028558 Ga0265326_10002188 Ga0265326_100021885 322
707 3300028573 Ga0265334_10002607 Ga0265334_100026075 322
708 3300028573 Ga0265334_10014246 Ga0265334_100142462 322
709 3300028653 Ga0265323_10003939 Ga0265323_100039391 322
710 3300028654 Ga0265322_10002310 Ga0265322_100023104 322
711 3300028666 Ga0265336_10001608 Ga0265336_100016083 322
712 3300028786 Ga0307517_10000063 Ga0307517_10000063121 322
713 3300028794 Ga0307515_10100819 Ga0307515_101008194 322
714 3300028794 Ga0307515_10160523 Ga0307515_101605232 322
715 3300028800 Ga0265338_10000667 Ga0265338_1000066732 322
716 3300028800 Ga0265338_10021413 Ga0265338_100214136 322
717 3300029957 Ga0265324_10003760 Ga0265324_100037603 322
718 3300031235 Ga0265330_10007489 Ga0265330_100074891 322
719 3300031238 Ga0265332_10035696 Ga0265332_100356962 322
720 3300031240 Ga0265320_10000953 Ga0265320_100009538 322
721 3300031241 Ga0265325_10007037 Ga0265325_100070373 322
722 3300031241 Ga0265325_10014108 Ga0265325_100141083 322
723 3300031241 Ga0265325_10061548 Ga0265325_100615484 322
724 3300031247 Ga0265340_10004938 Ga0265340_100049382 322
725 3300031249 Ga0265339_10000145 Ga0265339_1000014553 322
726 3300031249 Ga0265339_10007152 Ga0265339_100071524 322
727 3300031250 Ga0265331_10005233 Ga0265331_100052336 322
728 3300031250 Ga0265331_10027187 Ga0265331_100271872 322
729 3300031344 Ga0265316_10040807 Ga0265316_100408075 322
730 3300031344 Ga0265316_10049430 Ga0265316_100494303 322
731 3300031595 Ga0265313_10000173 Ga0265313_1000017349 322
732 3300031595 Ga0265313_10001153 Ga0265313_100011532 322
733 3300031595 Ga0265313_10064549 Ga0265313_100645492 322
734 3300031616 Ga0307508_10000010 Ga0307508_100000103 322
735 3300031616 Ga0307508_10058073 Ga0307508_100580732 322
736 3300031691 Ga0316579_10106656 Ga0316579_101066561 322
737 3300031711 Ga0265314_10000125 Ga0265314_1000012575 322
738 3300031711 Ga0265314_10011664 Ga0265314_100116642 322
739 3300031711 Ga0265314_10041990 Ga0265314_100419903 322
740 3300031712 Ga0265342_10003916 Ga0265342_100039168 322
741 3300031712 Ga0265342_10011179 Ga0265342_100111794 322
742 3300031728 Ga0316578_10023053 Ga0316578_100230534 322
743 3300031730 Ga0307516_10083248 Ga0307516_100832483 322
744 3300031730 Ga0307516_10122318 Ga0307516_101223182 322
745 3300032002 Ga0307416_100598822 Ga0307416_1005988221 322
746 3300032126 Ga0307415_100019128 Ga0307415_1000191283 322
747 3300032168 Ga0316593_10041240 Ga0316593_100412401 322
748 3300033180 Ga0307510_10006860 Ga0307510_100068602 322
749 3300033180 Ga0307510_10040547 Ga0307510_100405473 322
750 3300033180 Ga0307510_10082351 Ga0307510_100823513 322
751 3300033442 Ga0315911_1000001 Ga0315911_1000001216 322
752 3300034816 Ga0373930_0004300 Ga0373930_0004300_446_1414 322
753 3300035083 Ga0373926_0005541 Ga0373926_0005541_2910_3878 322
754 3300035083 Ga0373926_0059391 Ga0373926_0059391_33_1001 322
755 3300035086 Ga0373934_0001152 Ga0373934_0001152_5363_6331 322
756 3300035088 Ga0373940_0006936 Ga0373940_0006936_533_1501 322
757 3300035089 Ga0373944_0000364 Ga0373944_0000364_8112_9080 322
758 3300035089 Ga0373944_0001934 Ga0373944_0001934_2569_3537 322
759 3300035111 Ga0373923_0005611 Ga0373923_0005611_3241_4209 322
760 3300035113 Ga0373936_0002224 Ga0373936_0002224_310_1278 322
761 3300035113 Ga0373936_0007579 Ga0373936_0007579_822_1790 322
762 3300035113 Ga0373936_0008721 Ga0373936_0008721_2537_3505 322
763 3300035113 Ga0373936_0032331 Ga0373936_0032331_954_1922 322
764 3300035113 Ga0373936_0046255 Ga0373936_0046255_610_1578 322
765 3300035114 Ga0373939_0014060 Ga0373939_0014060_838_1806 322
766 3300035115 Ga0373941_0025759 Ga0373941_0025759_257_1225 322
767 3300035116 Ga0373945_0000604 Ga0373945_0000604_9287_10255 322
768 3300035116 Ga0373945_0019944 Ga0373945_0019944_275_1243 322
769 3300035116 Ga0373945_0021270 Ga0373945_0021270_1090_2058 322
770 3300035116 Ga0373945_0053896 Ga0373945_0053896_309_1277 322
771 3300035118 Ga0373954_0000976 Ga0373954_0000976_5624_6592 322
772 3300035118 Ga0373954_0049349 Ga0373954_0049349_863_1831 322
773 3300035118 Ga0373954_0141110 Ga0373954_0141110_181_1149 322
774 3300035119 Ga0373956_0009428 Ga0373956_0009428_2922_3890 322
775 3300035119 Ga0373956_0118025 Ga0373956_0118025_24_992 322
776 3300035170 Ga0373943_0001320 Ga0373943_0001320_9876_10844 322
777 3300035170 Ga0373943_0003503 Ga0373943_0003503_5969_6937 322
778 3300035170 Ga0373943_0026179 Ga0373943_0026179_1476_2444 322
779 3300035170 Ga0373943_0046365 Ga0373943_0046365_19_987 322
780 3300035171 Ga0373946_0022234 Ga0373946_0022234_846_1814 322
781 3300035171 Ga0373946_0022683 Ga0373946_0022683_208_1176 322
782 3300035172 Ga0373955_0000198 Ga0373955_0000198_6819_7787 322
783 3300035172 Ga0373955_0007268 Ga0373955_0007268_2993_3961 322
784 3300035172 Ga0373955_0007759 Ga0373955_0007759_523_1491 322
785 3300035172 Ga0373955_0012193 Ga0373955_0012193_247_1215 322
786 3300035172 Ga0373955_0069792 Ga0373955_0069792_648_1616 322
787 3300035172 Ga0373955_0117205 Ga0373955_0117205_32_1000 322
788 3300035207 Ga0373942_0017492 Ga0373942_0017492_147_1115 322
789 3300035242 Ga0373962_0009654 Ga0373962_0009654_306_1274 322
790 3300035398 Ga0316574_0000486 Ga0316574_0000486_4276_5244 322
791 3300035410 Ga0373924_0006081 Ga0373924_0006081_507_1475 322
792 3300035410 Ga0373924_0013867 Ga0373924_0013867_1067_2035 322
793 3300035410 Ga0373924_0028954 Ga0373924_0028954_832_1800 322
794 3300035691 Ga0373931_0000263 Ga0373931_0000263_8443_9411 322
795 3300035691 Ga0373931_0075155 Ga0373931_0075155_526_1494 322
796 3300035692 Ga0373935_0000880 Ga0373935_0000880_14688_15656 322
797 3300035692 Ga0373935_0008666 Ga0373935_0008666_910_1878 322
798 3300035692 Ga0373935_0052556 Ga0373935_0052556_519_1487 322
799 3300035692 Ga0373935_0066064 Ga0373935_0066064_213_1181 322
800 3300035695 Ga0373927_0000415 Ga0373927_0000415_9741_10709 322
801 3300035695 Ga0373927_0011994 Ga0373927_0011994_1515_2483 322
802 3300035695 Ga0373927_0012818 Ga0373927_0012818_3132_4100 322
803 3300035695 Ga0373927_0040906 Ga0373927_0040906_600_1568 322
804 3300035695 Ga0373927_0055937 Ga0373927_0055937_669_1637 322
805 3300035695 Ga0373927_0060421 Ga0373927_0060421_1069_2037 322
806 3300035695 Ga0373927_0090305 Ga0373927_0090305_293_1261 322
807 3300035695 Ga0373927_0122069 Ga0373927_0122069_714_1682 322
808 3300035724 Ga0373933_0000274 Ga0373933_0000274_5847_6815 322
809 3300035724 Ga0373933_0000475 Ga0373933_0000475_2346_3314 322
810 3300035725 Ga0373947_0002859 Ga0373947_0002859_5171_6139 322
811 3300035725 Ga0373947_0008223 Ga0373947_0008223_3000_3968 322
812 3300035725 Ga0373947_0012808 Ga0373947_0012808_2782_3750 322
813 3300035725 Ga0373947_0030611 Ga0373947_0030611_2029_2997 322
814 3300035725 Ga0373947_0040403 Ga0373947_0040403_1482_2450 322
815 3300035725 Ga0373947_0103748 Ga0373947_0103748_140_1108 322
816 3300036401 Ga0373937_0008251 Ga0373937_0008251_5904_6872 322
817 3300036401 Ga0373937_0030039 Ga0373937_0030039_2817_3785 322
818 3300036401 Ga0373937_0086774 Ga0373937_0086774_150_1118 322
819 3300036401 Ga0373937_0103040 Ga0373937_0103040_1394_2362 322
820 3300036401 Ga0373937_0111865 Ga0373937_0111865_1186_2154 322
821 3300036401 Ga0373937_0169621 Ga0373937_0169621_727_1695 322
822 3300036401 Ga0373937_0174649 Ga0373937_0174649_308_1276 322
823 3300036401 Ga0373937_0258853 Ga0373937_0258853_510_1478 322
824 3300036712 Ga0316584_0004453 Ga0316584_0004453_3153_4121 322
825 3300037068 Ga0373925_0008160 Ga0373925_0008160_1524_2492 322
826 3300037068 Ga0373925_0012044 Ga0373925_0012044_3012_3980 322
827 3300037068 Ga0373925_0030528 Ga0373925_0030528_824_1792 322
828 3300037068 Ga0373925_0035309 Ga0373925_0035309_2302_3270 322
829 3300037068 Ga0373925_0125228 Ga0373925_0125228_340_1308 322
830 3300037068 Ga0373925_0139611 Ga0373925_0139611_292_1260 322
831 3300037068 Ga0373925_0181220 Ga0373925_0181220_364_1332 322
832 3300037068 Ga0373925_0270584 Ga0373925_0270584_251_1219 322
833 3300037418 Ga0395900_0000361 Ga0395900_0000361_41867_42835 322
834 3300037418 Ga0395900_0034548 Ga0395900_0034548_3112_4080 322
835 3300037418 Ga0395900_0047403 Ga0395900_0047403_1875_2843 322
836 3300037466 Ga0395898_0020363 Ga0395898_0020363_776_1744 322
837 3300037466 Ga0395898_0132439 Ga0395898_0132439_559_1527 322
838 3300037471 Ga0395905_0003578 Ga0395905_0003578_10888_11856 322
839 3300037471 Ga0395905_0271700 Ga0395905_0271700_591_1559 322
840 3300037471 Ga0395905_0411017 Ga0395905_0411017_216_1184 322
841 3300037853 Ga0436364_0033868 Ga0436364_0033868_426_1394 322
842 3300037853 Ga0436364_0171330 Ga0436364_0171330_332_1300 322
843 3300037853 Ga0436364_1331450 Ga0436364_1331450_1086_2054 322
844 3300038443 Ga0395901_0005029 Ga0395901_0005029_1796_2764 322
845 3300038443 Ga0395901_0150364 Ga0395901_0150364_146_1114 322
846 3300038443 Ga0395901_0179118 Ga0395901_0179118_58_1026 322
847 3300038443 Ga0395901_0192872 Ga0395901_0192872_48_1016 322
848 3300039437 Ga0436365_0369699 Ga0436365_0369699_472_1440 322
849 3300039437 Ga0436365_0733835 Ga0436365_0733835_161_1129 322
850 3300039437 Ga0436365_1018795 Ga0436365_1018795_434_1402 322
851 3300039437 Ga0436365_1361494 Ga0436365_1361494_6471_7439 322
852 3300039437 Ga0436365_1556838 Ga0436365_1556838_22_993 322
853 3300039438 Ga0436360_0623528 Ga0436360_0623528_19_987 322
854 3300039447 Ga0436361_0266153 Ga0436361_0266153_14_982 322
855 3300039450 Ga0436363_1628749 Ga0436363_1628749_822_1790 322
856 3300041408 Ga0439453_0008825 Ga0439453_0008825_58_1026 322
857 3300042012 Ga0439455_0058595 Ga0439455_0058595_18_986 322
858 3300044658 Ga0466972_0000271 Ga0466972_0000271_10573_11541 322
859 3300044658 Ga0466972_0034153 Ga0466972_0034153_284_1252 322
860 3300044683 Ga0466965_0004372 Ga0466965_0004372_5143_6111 322
861 3300044684 Ga0466966_0004743 Ga0466966_0004743_4052_5020 322
862 3300044684 Ga0466966_0230914 Ga0466966_0230914_15_983 322
863 3300044693 Ga0466961_0000859 Ga0466961_0000859_310_1278 322
864 3300044694 Ga0466963_0077341 Ga0466963_0077341_1081_2049 322
865 3300044735 Ga0466968_0008864 Ga0466968_0008864_808_1776 322
866 3300044842 Ga0466957_0026509 Ga0466957_0026509_396_1364 322
867 3300044842 Ga0466957_0084796 Ga0466957_0084796_273_1340 322
868 3300044842 Ga0466957_0145095 Ga0466957_0145095_271_1239 322
869 3300044842 Ga0466957_0215789 Ga0466957_0215789_160_1128 322
870 3300045049 Ga0466959_0033478 Ga0466959_0033478_115_1083 322
871 3300045049 Ga0466959_0036020 Ga0466959_0036020_88_1056 322
872 3300045049 Ga0466959_0117515 Ga0466959_0117515_462_1430 322
873 3300046452 Ga0495617_048848 Ga0495617_048848_430_1398 322
874 3300046454 Ga0495592_0007563 Ga0495592_0007563_5733_6701 322
875 3300046454 Ga0495592_0013902 Ga0495592_0013902_505_1473 322
876 3300046454 Ga0495592_0150556 Ga0495592_0150556_465_1433 322
877 3300046455 Ga0495603_0000676 Ga0495603_0000676_1520_2488 322
878 3300046455 Ga0495603_0009006 Ga0495603_0009006_4730_5698 322
879 3300046455 Ga0495603_0031745 Ga0495603_0031745_2005_2973 322
880 3300046455 Ga0495603_0241912 Ga0495603_0241912_38_1006 322
881 3300046459 Ga0495629_0000176 Ga0495629_0000176_2700_3668 322
882 3300046459 Ga0495629_0003088 Ga0495629_0003088_10146_11114 322
883 3300046459 Ga0495629_0003357 Ga0495629_0003357_2734_3702 322
884 3300046459 Ga0495629_0012129 Ga0495629_0012129_4925_5893 322
885 3300046459 Ga0495629_0024799 Ga0495629_0024799_2861_3829 322
886 3300046459 Ga0495629_0081977 Ga0495629_0081977_444_1412 322
887 3300046460 Ga0495638_0019106 Ga0495638_0019106_3013_3981 322
888 3300046461 Ga0495641_0008578 Ga0495641_0008578_4798_5766 322
889 3300046461 Ga0495641_0012702 Ga0495641_0012702_3337_4305 322
890 3300046462 Ga0495651_0002298 Ga0495651_0002298_7547_8515 322
891 3300046462 Ga0495651_0009559 Ga0495651_0009559_3631_4599 322
892 3300046462 Ga0495651_0092718 Ga0495651_0092718_98_1066 322
893 3300046463 Ga0495653_0004529 Ga0495653_0004529_5620_6588 322
894 3300046472 Ga0495580_0004887 Ga0495580_0004887_9888_10856 322
895 3300046472 Ga0495580_0009272 Ga0495580_0009272_1445_2413 322
896 3300046472 Ga0495580_0013690 Ga0495580_0013690_4704_5672 322
897 3300046472 Ga0495580_0031326 Ga0495580_0031326_1368_2336 322
898 3300046472 Ga0495580_0084911 Ga0495580_0084911_1063_2031 322
899 3300046473 Ga0495582_0000177 Ga0495582_0000177_33068_34036 322
900 3300046474 Ga0495605_0090097 Ga0495605_0090097_334_1302 322
901 3300046474 Ga0495605_0107899 Ga0495605_0107899_295_1263 322
902 3300046475 Ga0495639_0000726 Ga0495639_0000726_13695_14663 322
903 3300046475 Ga0495639_0004110 Ga0495639_0004110_395_1363 322
904 3300046475 Ga0495639_0022248 Ga0495639_0022248_1416_2384 322
905 3300046476 Ga0495662_0000028 Ga0495662_0000028_28627_29595 322
906 3300046476 Ga0495662_0003064 Ga0495662_0003064_6728_7696 322
907 3300046476 Ga0495662_0017858 Ga0495662_0017858_222_1190 322
908 3300046477 Ga0495664_0008779 Ga0495664_0008779_761_1729 322
909 3300046477 Ga0495664_0025560 Ga0495664_0025560_198_1166 322
910 3300046492 Ga0495585_0054100 Ga0495585_0054100_371_1339 322
911 3300046499 Ga0495594_0000020 Ga0495594_0000020_29441_30409 322
912 3300046499 Ga0495594_0005321 Ga0495594_0005321_1754_2722 322
913 3300046499 Ga0495594_0052047 Ga0495594_0052047_213_1181 322
914 3300046507 Ga0495606_0001226 Ga0495606_0001226_6905_7873 322
915 3300046507 Ga0495606_0060335 Ga0495606_0060335_122_1090 322
916 3300046511 Ga0495608_0000721 Ga0495608_0000721_21670_22638 322
917 3300046511 Ga0495608_0078020 Ga0495608_0078020_20_988 322
918 3300046511 Ga0495608_0101820 Ga0495608_0101820_248_1216 322
919 3300046511 Ga0495608_0133537 Ga0495608_0133537_340_1308 322
920 3300046514 Ga0495618_0018572 Ga0495618_0018572_695_1663 322
921 3300046515 Ga0495620_0026112 Ga0495620_0026112_301_1269 322
922 3300046515 Ga0495620_0109991 Ga0495620_0109991_32_1000 322
923 3300046516 Ga0495628_0004786 Ga0495628_0004786_7395_8363 322
924 3300046516 Ga0495628_0074309 Ga0495628_0074309_1448_2416 322
925 3300046516 Ga0495628_0093530 Ga0495628_0093530_733_1701 322
926 3300046516 Ga0495628_0130981 Ga0495628_0130981_394_1362 322
927 3300046517 Ga0495630_0002476 Ga0495630_0002476_10878_11846 322
928 3300046517 Ga0495630_0225693 Ga0495630_0225693_122_1090 322
929 3300046523 Ga0495644_0002732 Ga0495644_0002732_3407_4375 322
930 3300046523 Ga0495644_0022480 Ga0495644_0022480_977_1945 322
931 3300046524 Ga0495648_0002422 Ga0495648_0002422_15528_16496 322
932 3300046524 Ga0495648_0008933 Ga0495648_0008933_3643_4611 322
933 3300046524 Ga0495648_0059123 Ga0495648_0059123_694_1662 322
934 3300046524 Ga0495648_0074244 Ga0495648_0074244_955_1923 322
935 3300046525 Ga0495663_0025921 Ga0495663_0025921_569_1537 322
936 3300046526 Ga0495666_0006077 Ga0495666_0006077_294_1262 322
937 3300046526 Ga0495666_0010823 Ga0495666_0010823_368_1336 322
938 3300046529 Ga0495652_0063452 Ga0495652_0063452_174_1142 322
939 3300046529 Ga0495652_0086353 Ga0495652_0086353_702_1670 322
940 3300046529 Ga0495652_0100838 Ga0495652_0100838_388_1356 322
941 3300046530 Ga0495654_0049895 Ga0495654_0049895_223_1191 322
942 3300046530 Ga0495654_0143360 Ga0495654_0143360_52_1020 322
943 3300046531 Ga0495665_0000057 Ga0495665_0000057_17721_18689 322
944 3300046531 Ga0495665_0009325 Ga0495665_0009325_3543_4511 322
945 3300046531 Ga0495665_0021145 Ga0495665_0021145_2281_3249 322
946 3300046531 Ga0495665_0032754 Ga0495665_0032754_1655_2623 322
947 3300046531 Ga0495665_0033665 Ga0495665_0033665_1499_2467 322
948 3300046533 Ga0495640_0001533 Ga0495640_0001533_2665_3633 322
949 3300046533 Ga0495640_0006411 Ga0495640_0006411_4450_5418 322
950 3300046533 Ga0495640_0031293 Ga0495640_0031293_739_1707 322
951 3300046533 Ga0495640_0051277 Ga0495640_0051277_143_1111 322
952 3300046536 Ga0495587_0000736 Ga0495587_0000736_3052_4020 322
953 3300046539 Ga0495621_0015238 Ga0495621_0015238_31_999 322
954 3300046539 Ga0495621_0018932 Ga0495621_0018932_1160_2128 322
955 3300046543 Ga0495645_0007114 Ga0495645_0007114_6451_7419 322
956 3300046543 Ga0495645_0038764 Ga0495645_0038764_2448_3416 322
957 3300046557 Ga0495622_0001520 Ga0495622_0001520_1410_2378 322
958 3300046557 Ga0495622_0093161 Ga0495622_0093161_161_1129 322
959 3300046558 Ga0495633_0009880 Ga0495633_0009880_2940_3908 322
960 3300046559 Ga0495667_0000319 Ga0495667_0000319_2598_3566 322
961 3300046559 Ga0495667_0008737 Ga0495667_0008737_5505_6473 322
962 3300046559 Ga0495667_0020907 Ga0495667_0020907_1978_2946 322
963 3300046559 Ga0495667_0036184 Ga0495667_0036184_1253_2221 322
964 3300046615 Ga0495656_0000064 Ga0495656_0000064_16194_17162 322
965 3300046616 Ga0495668_0036816 Ga0495668_0036816_246_1214 322
966 3300046616 Ga0495668_0062215 Ga0495668_0062215_814_1782 322
967 3300046642 Ga0495634_0008509 Ga0495634_0008509_1934_2902 322
968 3300046642 Ga0495634_0010828 Ga0495634_0010828_146_1114 322
969 3300046642 Ga0495634_0024302 Ga0495634_0024302_190_1158 322
970 3300046642 Ga0495634_0030256 Ga0495634_0030256_1153_2121 322
971 3300046642 Ga0495634_0105411 Ga0495634_0105411_341_1309 322
972 3300046642 Ga0495634_0233566 Ga0495634_0233566_22_990 322
973 3300046660 Ga0495625_0124200 Ga0495625_0124200_551_1519 322
974 3300046663 Ga0495635_0004372 Ga0495635_0004372_3179_4147 322
975 3300046663 Ga0495635_0008796 Ga0495635_0008796_4430_5398 322
976 3300046663 Ga0495635_0008850 Ga0495635_0008850_4587_5555 322
977 3300046663 Ga0495635_0049438 Ga0495635_0049438_1351_2319 322
978 3300046663 Ga0495635_0249464 Ga0495635_0249464_176_1144 322
979 3300046664 Ga0495659_0002437 Ga0495659_0002437_4470_5438 322
980 3300046664 Ga0495659_0020085 Ga0495659_0020085_23_991 322
981 3300046674 Ga0495588_0011011 Ga0495588_0011011_142_1110 322
982 3300046674 Ga0495588_0018632 Ga0495588_0018632_1079_2047 322
983 3300046674 Ga0495588_0040969 Ga0495588_0040969_774_1742 322
984 3300046674 Ga0495588_0105764 Ga0495588_0105764_474_1442 322
985 3300046675 Ga0495657_0001557 Ga0495657_0001557_5747_6715 322
986 3300046675 Ga0495657_0044896 Ga0495657_0044896_474_1442 322
987 3300046675 Ga0495657_0049297 Ga0495657_0049297_1512_2480 322
988 3300046675 Ga0495657_0049317 Ga0495657_0049317_1603_2571 322
989 3300046678 Ga0495599_0001378 Ga0495599_0001378_7087_8055 322
990 3300046678 Ga0495599_0021867 Ga0495599_0021867_1818_2786 322
991 3300046678 Ga0495599_0071568 Ga0495599_0071568_327_1295 322
992 3300046679 Ga0495623_0008240 Ga0495623_0008240_3799_4767 322
993 3300046679 Ga0495623_0010692 Ga0495623_0010692_1083_2051 322
994 3300046680 Ga0495646_0003336 Ga0495646_0003336_638_1606 322
995 3300046680 Ga0495646_0013387 Ga0495646_0013387_3077_4045 322
996 3300046680 Ga0495646_0016906 Ga0495646_0016906_2231_3199 322
997 3300046680 Ga0495646_0108359 Ga0495646_0108359_320_1288 322
998 3300046681 Ga0495647_0012769 Ga0495647_0012769_499_1467 322
999 3300046681 Ga0495647_0020139 Ga0495647_0020139_1212_2180 322
1000 3300046681 Ga0495647_0072707 Ga0495647_0072707_383_1351 322
1001 3300046683 Ga0495658_0003230 Ga0495658_0003230_5731_6699 322
1002 3300046683 Ga0495658_0010431 Ga0495658_0010431_2154_3122 322
1003 3300046683 Ga0495658_0043195 Ga0495658_0043195_258_1226 322
1004 3300046684 Ga0495669_0004325 Ga0495669_0004325_4457_5425 322
1005 3300046689 Ga0495613_0012712 Ga0495613_0012712_906_1874 322
1006 3300046689 Ga0495613_0013818 Ga0495613_0013818_3018_3986 322
1007 3300046689 Ga0495613_0033299 Ga0495613_0033299_256_1224 322
1008 3300046689 Ga0495613_0105399 Ga0495613_0105399_597_1565 322
1009 3300046689 Ga0495613_0247800 Ga0495613_0247800_164_1132 322
1010 3300046690 Ga0495624_0005807 Ga0495624_0005807_1772_2740 322
1011 3300046690 Ga0495624_0007826 Ga0495624_0007826_5009_5977 322
1012 3300046690 Ga0495624_0010764 Ga0495624_0010764_960_1928 322
1013 3300046690 Ga0495624_0029244 Ga0495624_0029244_525_1493 322
1014 3300046690 Ga0495624_0032844 Ga0495624_0032844_743_1711 322
1015 3300046690 Ga0495624_0054083 Ga0495624_0054083_1128_2096 322
1016 3300046690 Ga0495624_0059398 Ga0495624_0059398_305_1273 322
1017 3300046691 Ga0495670_0000258 Ga0495670_0000258_23021_23989 322
1018 3300046691 Ga0495670_0029296 Ga0495670_0029296_414_1382 322
1019 3300046809 Ga0495600_0000314 Ga0495600_0000314_6222_7190 322
1020 3300046809 Ga0495600_0001994 Ga0495600_0001994_5203_6171 322
1021 3300046809 Ga0495600_0047739 Ga0495600_0047739_355_1323 322
1022 3300046809 Ga0495600_0103975 Ga0495600_0103975_353_1321 322
1023 3300046809 Ga0495600_0203278 Ga0495600_0203278_84_1052 322
1024 3300047315 Ga0495581_0004028 Ga0495581_0004028_5963_6931 322
1025 3300047315 Ga0495581_0020045 Ga0495581_0020045_181_1149 322
1026 3300047315 Ga0495581_0047694 Ga0495581_0047694_867_1835 322
1027 3300047317 Ga0495604_0001137 Ga0495604_0001137_18049_19017 322
1028 3300047317 Ga0495604_0012931 Ga0495604_0012931_4337_5305 322
1029 3300047317 Ga0495604_0019823 Ga0495604_0019823_3363_4331 322
1030 3300047317 Ga0495604_0054739 Ga0495604_0054739_175_1143 322
1031 3300047317 Ga0495604_0284117 Ga0495604_0284117_10_978 322
1032 3300047319 Ga0495674_0088433 Ga0495674_0088433_1314_2282 322
1033 3300047319 Ga0495674_0144949 Ga0495674_0144949_208_1176 322
1034 3300047319 Ga0495674_0193450 Ga0495674_0193450_509_1477 322
1035 3300047320 Ga0495672_0011418 Ga0495672_0011418_3760_4728 322
1036 3300047320 Ga0495672_0061120 Ga0495672_0061120_216_1184 322
1037 3300047320 Ga0495672_0077248 Ga0495672_0077248_222_1190 322
1038 3300047320 Ga0495672_0169407 Ga0495672_0169407_131_1099 322
1039 3300047321 Ga0495676_0019882 Ga0495676_0019882_3454_4422 322
1040 3300047321 Ga0495676_0030061 Ga0495676_0030061_1241_2209 322
1041 3300047322 Ga0495680_0002499 Ga0495680_0002499_3180_4148 322
1042 3300047322 Ga0495680_0019888 Ga0495680_0019888_1800_2768 322
1043 3300047322 Ga0495680_0150915 Ga0495680_0150915_514_1482 322
1044 3300047444 Ga0495675_0002364 Ga0495675_0002364_3082_4050 322
1045 3300047444 Ga0495675_0115306 Ga0495675_0115306_316_1284 322
1046 3300047471 Ga0495684_0000023 Ga0495684_0000023_88159_89127 322
1047 3300047471 Ga0495684_0003050 Ga0495684_0003050_2737_3705 322
1048 3300047471 Ga0495684_0011309 Ga0495684_0011309_4750_5718 322
1049 3300047471 Ga0495684_0011436 Ga0495684_0011436_1700_2668 322
1050 3300047471 Ga0495684_0018741 Ga0495684_0018741_3619_4587 322
1051 3300047471 Ga0495684_0177272 Ga0495684_0177272_264_1232 322
1052 3300047471 Ga0495684_0190589 Ga0495684_0190589_254_1222 322
1053 3300047471 Ga0495684_0195250 Ga0495684_0195250_255_1223 322
1054 3300047472 Ga0495686_0035662 Ga0495686_0035662_1711_2679 322
1055 3300047472 Ga0495686_0175147 Ga0495686_0175147_144_1112 322
1056 3300047673 Ga0495593_0000165 Ga0495593_0000165_17554_18522 322
1057 3300047673 Ga0495593_0000221 Ga0495593_0000221_28864_29832 322
1058 3300047673 Ga0495593_0003546 Ga0495593_0003546_3052_4020 322
1059 3300047673 Ga0495593_0007451 Ga0495593_0007451_40_1008 322
1060 3300047673 Ga0495593_0047522 Ga0495593_0047522_278_1246 322
1061 3300047673 Ga0495593_0085274 Ga0495593_0085274_29_997 322
1062 3300048088 Ga0495602_0026464 Ga0495602_0026464_4208_5176 322
1063 3300048088 Ga0495602_0084652 Ga0495602_0084652_1328_2296 322
1064 3300048088 Ga0495602_0105766 Ga0495602_0105766_1046_2014 322
1065 3300048088 Ga0495602_0173238 Ga0495602_0173238_304_1272 322
1066 3300048088 Ga0495602_0247252 Ga0495602_0247252_197_1165 322
1067 3300048089 Ga0495614_0012122 Ga0495614_0012122_1532_2500 322
1068 3300048089 Ga0495614_0026074 Ga0495614_0026074_1381_2349 322
1069 3300048089 Ga0495614_0104589 Ga0495614_0104589_115_1083 322
1070 3300048089 Ga0495614_0118280 Ga0495614_0118280_43_1011 322
1071 3300048091 Ga0495626_0065183 Ga0495626_0065183_97_1065 322
1072 3300048903 Ga0496100_0114033 Ga0496100_0114033_334_1302 322
1073 3300048904 Ga0496101_0003066 Ga0496101_0003066_7010_7978 322
1074 3300048905 Ga0496102_0004610 Ga0496102_0004610_8876_9844 322
1075 3300048905 Ga0496102_0103280 Ga0496102_0103280_387_1355 322
1076 3300048905 Ga0496102_0115938 Ga0496102_0115938_245_1213 322
1077 3300048905 Ga0496102_0125281 Ga0496102_0125281_72_1040 322
1078 3300048905 Ga0496102_0321675 Ga0496102_0321675_329_1297 322
1079 3300048906 Ga0496103_0022889 Ga0496103_0022889_651_1619 322
1080 3300048906 Ga0496103_0025422 Ga0496103_0025422_714_1682 322
1081 3300048907 Ga0496104_0005886 Ga0496104_0005886_3764_4732 322
1082 3300048907 Ga0496104_0014294 Ga0496104_0014294_1070_2038 322
1083 3300048907 Ga0496104_0160498 Ga0496104_0160498_593_1561 322
1084 3300048907 Ga0496104_0336510 Ga0496104_0336510_311_1279 322
1085 3300048908 Ga0496105_0009152 Ga0496105_0009152_4058_5026 322
1086 3300048908 Ga0496105_0049567 Ga0496105_0049567_994_1962 322
1087 3300048908 Ga0496105_0106438 Ga0496105_0106438_1180_2148 322
1088 3300048908 Ga0496105_0163756 Ga0496105_0163756_170_1138 322
1089 3300048908 Ga0496105_0183766 Ga0496105_0183766_603_1571 322
1090 3300048909 Ga0496106_0000363 Ga0496106_0000363_19213_20181 322
1091 3300048909 Ga0496106_0018324 Ga0496106_0018324_2336_3304 322
1092 3300048909 Ga0496106_0018493 Ga0496106_0018493_4042_5010 322
1093 3300048909 Ga0496106_0039925 Ga0496106_0039925_1822_2790 322
1094 3300048909 Ga0496106_0082089 Ga0496106_0082089_731_1699 322
1095 3300048910 Ga0496107_0056799 Ga0496107_0056799_1677_2645 322
1096 3300048910 Ga0496107_0113218 Ga0496107_0113218_511_1479 322
1097 3300048911 Ga0496108_0000625 Ga0496108_0000625_7587_8555 322
1098 3300048911 Ga0496108_0012338 Ga0496108_0012338_745_1713 322
1099 3300048911 Ga0496108_0053812 Ga0496108_0053812_1816_2784 322
1100 3300048911 Ga0496108_0079513 Ga0496108_0079513_477_1445 322
1101 3300048911 Ga0496108_0157821 Ga0496108_0157821_331_1299 322
1102 3300048912 Ga0496109_0034392 Ga0496109_0034392_378_1346 322
1103 3300048912 Ga0496109_0035150 Ga0496109_0035150_3314_4282 322
1104 3300048912 Ga0496109_0078162 Ga0496109_0078162_1135_2103 322
1105 3300048912 Ga0496109_0092263 Ga0496109_0092263_232_1200 322
1106 3300048912 Ga0496109_0523395 Ga0496109_0523395_137_1105 322
1107 3300048913 Ga0496110_0023859 Ga0496110_0023859_1200_2168 322
1108 3300048913 Ga0496110_0029464 Ga0496110_0029464_1055_2023 322
1109 3300048913 Ga0496110_0123106 Ga0496110_0123106_872_1840 322
1110 3300048914 Ga0496111_0031776 Ga0496111_0031776_1380_2348 322
1111 3300048914 Ga0496111_0032439 Ga0496111_0032439_1904_2872 322
1112 3300048914 Ga0496111_0283191 Ga0496111_0283191_140_1108 322
1113 3300048915 Ga0496112_0000031 Ga0496112_0000031_26227_27195 322
1114 3300048915 Ga0496112_0015495 Ga0496112_0015495_4501_5469 322
1115 3300048915 Ga0496112_0032484 Ga0496112_0032484_3343_4311 322
1116 3300048915 Ga0496112_0102666 Ga0496112_0102666_1708_2676 322
1117 3300048915 Ga0496112_0139351 Ga0496112_0139351_195_1163 322
1118 3300048915 Ga0496112_0175574 Ga0496112_0175574_394_1362 322
1119 3300048915 Ga0496112_0410920 Ga0496112_0410920_75_1043 322
1120 3300048916 Ga0496113_0000087 Ga0496113_0000087_237_1205 322
1121 3300048916 Ga0496113_0076481 Ga0496113_0076481_461_1429 322
1122 3300048917 Ga0496114_0047001 Ga0496114_0047001_1080_2048 322
1123 3300048918 Ga0496115_0000713 Ga0496115_0000713_12127_13095 322
1124 3300048918 Ga0496115_0055903 Ga0496115_0055903_148_1116 322
1125 3300048918 Ga0496115_0093325 Ga0496115_0093325_424_1392 322
1126 3300048919 Ga0496116_0082401 Ga0496116_0082401_160_1128 322
1127 3300048920 Ga0496117_0075134 Ga0496117_0075134_1071_2039 322
1128 3300048921 Ga0496118_0002080 Ga0496118_0002080_20051_21019 322
1129 3300048921 Ga0496118_0102331 Ga0496118_0102331_76_1047 322
1130 3300048923 Ga0496120_0010096 Ga0496120_0010096_35_1003 322
1131 3300048924 Ga0496121_0000183 Ga0496121_0000183_81074_82042 322
1132 3300048924 Ga0496121_0000407 Ga0496121_0000407_55941_56909 322
1133 3300048924 Ga0496121_0001403 Ga0496121_0001403_37078_38046 322
1134 3300048924 Ga0496121_0020343 Ga0496121_0020343_2908_3876 322
1135 3300048924 Ga0496121_0027667 Ga0496121_0027667_797_1771 322
1136 3300048924 Ga0496121_0048678 Ga0496121_0048678_2018_2986 322
1137 3300048924 Ga0496121_0088209 Ga0496121_0088209_839_1807 322
1138 3300048924 Ga0496121_0108085 Ga0496121_0108085_943_1911 322
1139 3300048924 Ga0496121_0136647 Ga0496121_0136647_836_1804 322
1140 3300048926 Ga0496123_0028711 Ga0496123_0028711_274_1242 322
1141 3300048926 Ga0496123_0035502 Ga0496123_0035502_2467_3435 322
1142 3300048926 Ga0496123_0087889 Ga0496123_0087889_395_1363 322
1143 3300048927 Ga0496124_0010967 Ga0496124_0010967_65_1033 322
1144 3300048927 Ga0496124_0068590 Ga0496124_0068590_567_1538 322
1145 3300048927 Ga0496124_0240919 Ga0496124_0240919_201_1169 322
1146 3300048928 Ga0496125_0000090 Ga0496125_0000090_133841_134809 322
1147 3300048928 Ga0496125_0001219 Ga0496125_0001219_9766_10740 322
1148 3300048928 Ga0496125_0001713 Ga0496125_0001713_16213_17181 322
1149 3300048928 Ga0496125_0022884 Ga0496125_0022884_3540_4511 322
1150 3300048928 Ga0496125_0025195 Ga0496125_0025195_3775_4746 322
1151 3300048928 Ga0496125_0082459 Ga0496125_0082459_696_1664 322
1152 3300048929 Ga0496126_0008974 Ga0496126_0008974_6449_7417 322
1153 3300048929 Ga0496126_0010266 Ga0496126_0010266_2063_3031 322
1154 3300048929 Ga0496126_0028595 Ga0496126_0028595_4032_5006 322
1155 3300048929 Ga0496126_0043018 Ga0496126_0043018_2142_3110 322
1156 3300048929 Ga0496126_0059498 Ga0496126_0059498_1534_2502 322
1157 3300048929 Ga0496126_0079627 Ga0496126_0079627_1908_2879 322
1158 3300048929 Ga0496126_0090067 Ga0496126_0090067_434_1402 322
1159 3300048929 Ga0496126_0123540 Ga0496126_0123540_1250_2218 322
1160 3300048929 Ga0496126_0307307 Ga0496126_0307307_253_1221 322
1161 3300049568 Ga0501031_0008429 Ga0501031_0008429_1714_2682 322
1162 3300049568 Ga0501031_0013071 Ga0501031_0013071_3714_4682 322
1163 3300049569 Ga0501032_0000087 Ga0501032_0000087_67644_68612 322
1164 3300049569 Ga0501032_0005128 Ga0501032_0005128_8692_9660 322
1165 3300049569 Ga0501032_0016894 Ga0501032_0016894_961_1929 322
1166 3300049569 Ga0501032_0019804 Ga0501032_0019804_1332_2300 322
1167 3300049569 Ga0501032_0030627 Ga0501032_0030627_742_1710 322
1168 3300049569 Ga0501032_0034125 Ga0501032_0034125_884_1852 322
1169 3300049570 Ga0501033_0000181 Ga0501033_0000181_42686_43654 322
1170 3300049570 Ga0501033_0000510 Ga0501033_0000510_17570_18538 322
1171 3300049570 Ga0501033_0003261 Ga0501033_0003261_10171_11139 322
1172 3300049571 Ga0501034_0000021 Ga0501034_0000021_205249_206217 322
1173 3300049571 Ga0501034_0000211 Ga0501034_0000211_85505_86473 322
1174 3300049571 Ga0501034_0003829 Ga0501034_0003829_14535_15503 322
1175 3300049571 Ga0501034_0009992 Ga0501034_0009992_7487_8455 322
1176 3300049571 Ga0501034_0061016 Ga0501034_0061016_1954_2922 322
1177 3300049571 Ga0501034_0089287 Ga0501034_0089287_1970_2938 322
1178 3300049571 Ga0501034_0114284 Ga0501034_0114284_894_1862 322
1179 3300049571 Ga0501034_0435722 Ga0501034_0435722_224_1192 322
1180 3300049572 Ga0501036_0000069 Ga0501036_0000069_40972_41940 322
1181 3300049572 Ga0501036_0024390 Ga0501036_0024390_3893_4861 322
1182 3300049572 Ga0501036_0043219 Ga0501036_0043219_2405_3373 322
1183 3300049572 Ga0501036_0093787 Ga0501036_0093787_1186_2154 322
1184 3300049572 Ga0501036_0175379 Ga0501036_0175379_391_1359 322
1185 3300049573 Ga0501037_0000034 Ga0501037_0000034_4417_5385 322
1186 3300049573 Ga0501037_0002667 Ga0501037_0002667_7152_8120 322
1187 3300049573 Ga0501037_0010155 Ga0501037_0010155_2177_3145 322
1188 3300049573 Ga0501037_0033876 Ga0501037_0033876_2195_3163 322
1189 3300049573 Ga0501037_0063822 Ga0501037_0063822_980_1948 322
1190 3300049574 Ga0501038_0000628 Ga0501038_0000628_14273_15241 322
1191 3300049574 Ga0501038_0001570 Ga0501038_0001570_5228_6196 322
1192 3300049574 Ga0501038_0007511 Ga0501038_0007511_4714_5682 322
1193 3300049574 Ga0501038_0081851 Ga0501038_0081851_566_1534 322
1194 3300049574 Ga0501038_0264278 Ga0501038_0264278_326_1294 322
1195 3300049575 Ga0501039_0000931 Ga0501039_0000931_15215_16183 322
1196 3300049575 Ga0501039_0081486 Ga0501039_0081486_28_996 322
1197 3300049575 Ga0501039_0087487 Ga0501039_0087487_67_1035 322
1198 3300049577 Ga0501041_0166749 Ga0501041_0166749_80_1048 322
1199 3300049578 Ga0501042_0013413 Ga0501042_0013413_643_1611 322
1200 3300049578 Ga0501042_0026741 Ga0501042_0026741_252_1220 322
1201 3300049578 Ga0501042_0131408 Ga0501042_0131408_626_1594 322
1202 3300049579 Ga0501043_0000033 Ga0501043_0000033_124372_125340 322
1203 3300049579 Ga0501043_0009976 Ga0501043_0009976_4218_5186 322
1204 3300049579 Ga0501043_0012412 Ga0501043_0012412_2682_3650 322
1205 3300049579 Ga0501043_0023684 Ga0501043_0023684_3281_4249 322
1206 3300049579 Ga0501043_0030178 Ga0501043_0030178_725_1693 322
1207 3300049579 Ga0501043_0224348 Ga0501043_0224348_309_1277 322
1208 3300049580 Ga0501046_0000412 Ga0501046_0000412_39198_40166 322
1209 3300049580 Ga0501046_0002043 Ga0501046_0002043_2488_3456 322
1210 3300049580 Ga0501046_0039760 Ga0501046_0039760_814_1782 322
1211 3300049580 Ga0501046_0048020 Ga0501046_0048020_1114_2082 322
1212 3300049580 Ga0501046_0072996 Ga0501046_0072996_498_1466 322
1213 3300049580 Ga0501046_0084232 Ga0501046_0084232_851_1819 322
1214 3300049581 Ga0501047_0000010 Ga0501047_0000010_271024_271992 322
1215 3300049581 Ga0501047_0000434 Ga0501047_0000434_45391_46359 322
1216 3300049581 Ga0501047_0007147 Ga0501047_0007147_2839_3807 322
1217 3300049581 Ga0501047_0048439 Ga0501047_0048439_610_1578 322
1218 3300049581 Ga0501047_0102401 Ga0501047_0102401_174_1142 322
1219 3300049581 Ga0501047_0226226 Ga0501047_0226226_125_1093 322
1220 3300049582 Ga0501048_0000290 Ga0501048_0000290_10466_11434 322
1221 3300049582 Ga0501048_0001809 Ga0501048_0001809_10818_11786 322
1222 3300049582 Ga0501048_0007260 Ga0501048_0007260_4243_5211 322
1223 3300049582 Ga0501048_0032399 Ga0501048_0032399_2201_3169 322
1224 3300049583 Ga0501067_0000067 Ga0501067_0000067_12150_13118 322
1225 3300049583 Ga0501067_0000477 Ga0501067_0000477_11480_12448 322
1226 3300049583 Ga0501067_0028186 Ga0501067_0028186_193_1161 322
1227 3300049584 Ga0501068_0000742 Ga0501068_0000742_9641_10609 322
1228 3300049584 Ga0501068_0001335 Ga0501068_0001335_2855_3823 322
1229 3300049584 Ga0501068_0018982 Ga0501068_0018982_1339_2307 322
1230 3300049584 Ga0501068_0023768 Ga0501068_0023768_2440_3408 322
1231 3300049585 Ga0501069_0004553 Ga0501069_0004553_1798_2766 322
1232 3300049585 Ga0501069_0022381 Ga0501069_0022381_989_1957 322
1233 3300049585 Ga0501069_0090686 Ga0501069_0090686_262_1230 322
1234 3300049586 Ga0501070_0002965 Ga0501070_0002965_5077_6045 322
1235 3300049586 Ga0501070_0068121 Ga0501070_0068121_485_1453 322
1236 3300049586 Ga0501070_0082127 Ga0501070_0082127_626_1594 322
1237 3300049586 Ga0501070_0106575 Ga0501070_0106575_723_1691 322
1238 3300049587 Ga0501071_0037987 Ga0501071_0037987_2287_3255 322
1239 3300049588 Ga0501072_0000515 Ga0501072_0000515_6005_6973 322
1240 3300049588 Ga0501072_0002718 Ga0501072_0002718_243_1211 322
1241 3300049588 Ga0501072_0032950 Ga0501072_0032950_1536_2504 322
1242 3300049589 Ga0501073_0000144 Ga0501073_0000144_14452_15420 322
1243 3300049589 Ga0501073_0032555 Ga0501073_0032555_1712_2680 322
1244 3300049589 Ga0501073_0038197 Ga0501073_0038197_626_1594 322
1245 3300049589 Ga0501073_0090037 Ga0501073_0090037_706_1674 322
1246 3300049590 Ga0501074_0000675 Ga0501074_0000675_11890_12858 322
1247 3300049590 Ga0501074_0001696 Ga0501074_0001696_13618_14586 322
1248 3300049590 Ga0501074_0013775 Ga0501074_0013775_1115_2083 322
1249 3300049590 Ga0501074_0016400 Ga0501074_0016400_2045_3013 322
1250 3300049590 Ga0501074_0025795 Ga0501074_0025795_19_987 322
1251 3300049591 Ga0501075_0028447 Ga0501075_0028447_222_1190 322
1252 3300049592 Ga0501076_0056868 Ga0501076_0056868_242_1210 322
1253 3300049741 Ga0501079_0007639 Ga0501079_0007639_5786_6754 322
1254 3300049741 Ga0501079_0013242 Ga0501079_0013242_4945_5913 322
1255 3300049741 Ga0501079_0127854 Ga0501079_0127854_888_1856 322
1256 3300049741 Ga0501079_0150611 Ga0501079_0150611_808_1776 322
1257 3300049741 Ga0501079_0266487 Ga0501079_0266487_212_1180 322
1258 3300049742 Ga0501080_0001018 Ga0501080_0001018_477_1445 322
1259 3300049742 Ga0501080_0005763 Ga0501080_0005763_5568_6536 322
1260 3300049742 Ga0501080_0031077 Ga0501080_0031077_2222_3190 322
1261 3300049742 Ga0501080_0032014 Ga0501080_0032014_1186_2154 322
1262 3300049742 Ga0501080_0054631 Ga0501080_0054631_1656_2624 322
1263 3300049742 Ga0501080_0107099 Ga0501080_0107099_1365_2333 322
1264 3300049742 Ga0501080_0116972 Ga0501080_0116972_1488_2456 322
1265 3300049743 Ga0501081_0071478 Ga0501081_0071478_390_1358 322
1266 3300049744 Ga0501083_0000192 Ga0501083_0000192_17792_18760 322
1267 3300049744 Ga0501083_0000756 Ga0501083_0000756_5511_6479 322
1268 3300049744 Ga0501083_0000803 Ga0501083_0000803_16613_17581 322
1269 3300049744 Ga0501083_0125118 Ga0501083_0125118_618_1586 322
1270 3300049744 Ga0501083_0138277 Ga0501083_0138277_323_1291 322
1271 3300049822 Ga0501035_0000323 Ga0501035_0000323_43850_44818 322
1272 3300049822 Ga0501035_0002209 Ga0501035_0002209_7749_8717 322
1273 3300049822 Ga0501035_0028072 Ga0501035_0028072_2900_3868 322
1274 3300049822 Ga0501035_0072007 Ga0501035_0072007_1871_2839 322
1275 3300049823 Ga0501044_0000181 Ga0501044_0000181_56818_57786 322
1276 3300049823 Ga0501044_0004415 Ga0501044_0004415_7077_8045 322
1277 3300049823 Ga0501044_0037155 Ga0501044_0037155_1725_2693 322
1278 3300049823 Ga0501044_0054245 Ga0501044_0054245_462_1430 322
1279 3300049823 Ga0501044_0083608 Ga0501044_0083608_1509_2477 322
1280 3300049823 Ga0501044_0104855 Ga0501044_0104855_391_1359 322
1281 3300049823 Ga0501044_0119143 Ga0501044_0119143_666_1634 322
1282 3300049823 Ga0501044_0119891 Ga0501044_0119891_1355_2323 322
1283 3300049823 Ga0501044_0193463 Ga0501044_0193463_348_1316 322
1284 3300049823 Ga0501044_0237831 Ga0501044_0237831_574_1542 322
1285 3300049823 Ga0501044_0288826 Ga0501044_0288826_566_1534 322
1286 3300049823 Ga0501044_0310631 Ga0501044_0310631_426_1394 322
1287 3300049824 Ga0501045_0006122 Ga0501045_0006122_3633_4601 322
1288 3300049824 Ga0501045_0110078 Ga0501045_0110078_163_1131 322
1289 3300050490 nmdc:mga03n38_894_c1 nmdc:mga03n38_894_c1_539_1507 322
1290 3300050492 nmdc:mga0yw44_103754_c1 nmdc:mga0yw44_103754_c1_493_1461 322
1291 3300050492 nmdc:mga0yw44_24388_c1 nmdc:mga0yw44_24388_c1_2302_3270 322
1292 3300050493 nmdc:mga0k408_2338_c1 nmdc:mga0k408_2338_c1_7680_8648 322
1293 3300050493 nmdc:mga0k408_8984_c1 nmdc:mga0k408_8984_c1_2553_3521 322
1294 3300050494 nmdc:mga06z11_43306_c1 nmdc:mga06z11_43306_c1_900_1868 322
1295 3300050495 nmdc:mga04h51_22683_c1 nmdc:mga04h51_22683_c1_68_1036 322
1296 3300050496 nmdc:mga07m45_20249_c1 nmdc:mga07m45_20249_c1_315_1283 322
1297 3300050496 nmdc:mga07m45_49122_c2 nmdc:mga07m45_49122_c2_31_999 322
1298 3300050507 nmdc:mga05p37_8896_c1 nmdc:mga05p37_8896_c1_6762_7730 322
1299 3300050512 nmdc:mga0n895_173857_c1 nmdc:mga0n895_173857_c1_695_1663 322
1300 3300050514 nmdc:mga08x19_4_c2 nmdc:mga08x19_4_c2_29027_29995 322
1301 3300053077 Ga0495601_0048214 Ga0495601_0048214_761_1729 322
1302 3300053077 Ga0495601_0065747 Ga0495601_0065747_308_1276 322
1303 3300053077 Ga0495601_0067781 Ga0495601_0067781_333_1301 322
1304 3300053077 Ga0495601_0095205 Ga0495601_0095205_472_1440 322
1305 3300053084 Ga0495595_0000218 Ga0495595_0000218_81_1049 322
1306 3300053084 Ga0495595_0015072 Ga0495595_0015072_1450_2418 322
1307 3300053085 Ga0495619_0000111 Ga0495619_0000111_23660_24628 322
1308 3300053085 Ga0495619_0003381 Ga0495619_0003381_874_1842 322
1309 3300053085 Ga0495619_0043944 Ga0495619_0043944_1945_2913 322
1310 3300053085 Ga0495619_0045960 Ga0495619_0045960_865_1833 322
1311 3300053087 Ga0500643_000015 Ga0500643_000015_114634_115602 322
1312 3300053093 Ga0500651_0061510 Ga0500651_0061510_1202_2170 322
1313 3300053094 Ga0500566_0000028 Ga0500566_0000028_52458_53426 322
1314 3300053094 Ga0500566_0000249 Ga0500566_0000249_9534_10502 322
1315 3300053094 Ga0500566_0001671 Ga0500566_0001671_3359_4327 322
1316 3300053094 Ga0500566_0006790 Ga0500566_0006790_2250_3218 322
1317 3300053096 Ga0500641_0010046 Ga0500641_0010046_1823_2791 322
1318 3300053103 Ga0500555_003873 Ga0500555_003873_3043_4011 322
1319 3300053104 Ga0500556_0000004 Ga0500556_0000004_309693_310661 322
1320 3300053105 Ga0500557_000110 Ga0500557_000110_21747_22715 322
1321 3300053111 Ga0500572_000420 Ga0500572_000420_2801_3769 322
1322 3300053111 Ga0500572_001411 Ga0500572_001411_4666_5637 322
1323 3300053116 Ga0500592_002327 Ga0500592_002327_358_1326 322
1324 3300053117 Ga0500593_019912 Ga0500593_019912_262_1230 322
1325 3300053119 Ga0500595_000590 Ga0500595_000590_17417_18385 322
1326 3300053121 Ga0500607_039728 Ga0500607_039728_851_1819 322
1327 3300053122 Ga0500608_008414 Ga0500608_008414_1829_2797 322
1328 3300053122 Ga0500608_040527 Ga0500608_040527_906_1874 322
1329 3300053122 Ga0500608_097487 Ga0500608_097487_210_1178 322
1330 3300053125 Ga0500618_009095 Ga0500618_009095_1498_2466 322
1331 3300053130 Ga0500642_0000036 Ga0500642_0000036_80711_81679 322
1332 3300053130 Ga0500642_0000086 Ga0500642_0000086_23026_23994 322
1333 3300053130 Ga0500642_0085036 Ga0500642_0085036_71_1039 322
1334 3300053131 Ga0500652_000837 Ga0500652_000837_7911_8879 322
1335 3300053136 Ga0500559_0000154 Ga0500559_0000154_49714_50685 322
1336 3300053136 Ga0500559_0003041 Ga0500559_0003041_3305_4279 322
1337 3300053136 Ga0500559_0004402 Ga0500559_0004402_333_1301 322
1338 3300053139 Ga0500568_0000599 Ga0500568_0000599_16021_16989 322
1339 3300053139 Ga0500568_0003668 Ga0500568_0003668_3921_4889 322
1340 3300053139 Ga0500568_0008132 Ga0500568_0008132_917_1885 322
1341 3300053142 Ga0500577_0000074 Ga0500577_0000074_2335_3309 322
1342 3300053142 Ga0500577_0069081 Ga0500577_0069081_46_1014 322
1343 3300053145 Ga0500586_003626 Ga0500586_003626_196_1164 322
1344 3300053148 Ga0500590_057344 Ga0500590_057344_858_1826 322
1345 3300053148 Ga0500590_069197 Ga0500590_069197_215_1183 322
1346 3300053150 Ga0500603_001125 Ga0500603_001125_4915_5883 322
1347 3300053151 Ga0500604_0002371 Ga0500604_0002371_813_1781 322
1348 3300053151 Ga0500604_0021396 Ga0500604_0021396_649_1617 322
1349 3300053153 Ga0500616_0000014 Ga0500616_0000014_337027_337995 322
1350 3300053153 Ga0500616_0000325 Ga0500616_0000325_6713_7681 322
1351 3300053153 Ga0500616_0007667 Ga0500616_0007667_116_1084 322
1352 3300053154 Ga0500619_002452 Ga0500619_002452_548_1516 322
1353 3300053156 Ga0500622_0003210 Ga0500622_0003210_8097_9065 322
1354 3300053158 Ga0500627_0019326 Ga0500627_0019326_967_1935 322
1355 3300053158 Ga0500627_0108383 Ga0500627_0108383_167_1135 322
1356 3300053161 Ga0500634_0031888 Ga0500634_0031888_1625_2593 322
1357 3300053163 Ga0500639_000001 Ga0500639_000001_136837_137805 322
1358 3300053177 Ga0500636_0000151 Ga0500636_0000151_32761_33729 322
1359 3300053177 Ga0500636_0005425 Ga0500636_0005425_2967_3935 322
1360 3300053178 Ga0500637_0000751 Ga0500637_0000751_3435_4403 322
1361 3300053178 Ga0500637_0111130 Ga0500637_0111130_361_1329 322
1362 3300053737 Ga0500601_000098 Ga0500601_000098_3785_4753 322
1363 3300054114 Ga0501084_0007759 Ga0501084_0007759_4828_5796 322
1364 3300054114 Ga0501084_0044564 Ga0501084_0044564_107_1075 322
1365 3300054114 Ga0501084_0068379 Ga0501084_0068379_548_1516 322
1366 3300054114 Ga0501084_0092897 Ga0501084_0092897_1380_2348 322
1367 3300054114 Ga0501084_0219092 Ga0501084_0219092_513_1481 322
1368 3300060353 Ga0501082_0000025 Ga0501082_0000025_98271_99239 322
1369 3300060353 Ga0501082_0010489 Ga0501082_0010489_6623_7591 322
1370 3300060353 Ga0501082_0041736 Ga0501082_0041736_1551_2519 322
1371 3300060353 Ga0501082_0263232 Ga0501082_0263232_109_1077 322
1372 3300061719 Ga0466962_0094305 Ga0466962_0094305_359_1327 322
1373 3300031241 Ga0265325_10000098 Ga0265325_1000009837 323
1374 3300031249 Ga0265339_10001071 Ga0265339_1000107113 323
1375 3300031344 Ga0265316_10024242 Ga0265316_100242422 323
1376 3300031344 Ga0265316_10315327 Ga0265316_103153271 323
1377 3300031595 Ga0265313_10009753 Ga0265313_100097533 323
1378 3300048907 Ga0496104_0077274 Ga0496104_0077274_710_1753 327
1379 iso_pu_bacteria 8054563764 8054566525 328
1380 3300034819 Ga0373958_0015432 Ga0373958_0015432_250_1293 329
1381 3300048929 Ga0496126_0008736 Ga0496126_0008736_7689_8717 329
1382 3300049570 Ga0501033_0081180 Ga0501033_0081180_212_1252 329
1383 3300049581 Ga0501047_0085492 Ga0501047_0085492_889_1929 329
1384 3300049823 Ga0501044_0162321 Ga0501044_0162321_454_1494 329
1385 3300049572 Ga0501036_0233897 Ga0501036_0233897_414_1457 330
1386 3300053093 Ga0500651_0001257 Ga0500651_0001257_7984_9021 336
1387 3300053156 Ga0500622_0117062 Ga0500622_0117062_99_1136 336
1388 3300005347 Ga0070668_100117981 Ga0070668_1001179812 339
1389 iso_pu_bacteria 2917554339 2917556993 341
1390 iso_pu_bacteria 2922386360 2922390895 341
1391 iso_pu_bacteria 8006964411 8006965652 341
1392 3300005434 Ga0070709_10001622 Ga0070709_100016227 342
1393 3300005434 Ga0070709_10149410 Ga0070709_101494102 342
1394 3300005435 Ga0070714_100022464 Ga0070714_1000224642 342
1395 3300005436 Ga0070713_100000004 Ga0070713_100000004157 342
1396 3300005437 Ga0070710_10116230 Ga0070710_101162302 342
1397 3300005439 Ga0070711_100076705 Ga0070711_1000767052 342
1398 3300005535 Ga0070684_100055068 Ga0070684_1000550683 342
1399 3300005539 Ga0068853_100023426 Ga0068853_1000234262 342
1400 3300005545 Ga0070695_100003134 Ga0070695_1000031342 342
1401 3300005563 Ga0068855_100045775 Ga0068855_1000457752 342
1402 3300005564 Ga0070664_100082541 Ga0070664_1000825413 342
1403 3300005577 Ga0068857_100000944 Ga0068857_10000094419 342
1404 3300005614 Ga0068856_100000144 Ga0068856_10000014451 342
1405 3300005614 Ga0068856_100001349 Ga0068856_10000134912 342
1406 3300005616 Ga0068852_100008781 Ga0068852_1000087814 342
1407 3300006175 Ga0070712_100000358 Ga0070712_10000035812 342
1408 3300006237 Ga0097621_100194270 Ga0097621_1001942702 342
1409 3300006914 Ga0075436_100009384 Ga0075436_1000093843 342
1410 3300009093 Ga0105240_10001917 Ga0105240_1000191719 342
1411 3300009174 Ga0105241_10001171 Ga0105241_100011712 342
1412 3300009545 Ga0105237_10003815 Ga0105237_1000381512 342
1413 3300009551 Ga0105238_10000639 Ga0105238_1000063919 342
1414 3300010375 Ga0105239_10106443 Ga0105239_101064433 342
1415 3300013100 Ga0157373_10013340 Ga0157373_100133403 342
1416 3300013104 Ga0157370_10007043 Ga0157370_100070435 342
1417 3300013105 Ga0157369_10039221 Ga0157369_100392212 342
1418 3300013297 Ga0157378_10104209 Ga0157378_101042092 342
1419 3300013307 Ga0157372_10038507 Ga0157372_100385075 342
1420 3300025898 Ga0207692_10123861 Ga0207692_101238612 342
1421 3300025906 Ga0207699_10000607 Ga0207699_100006079 342
1422 3300025906 Ga0207699_10224595 Ga0207699_102245951 342
1423 3300025913 Ga0207695_10010607 Ga0207695_100106076 342
1424 3300025915 Ga0207693_10001087 Ga0207693_100010875 342
1425 3300025916 Ga0207663_10247396 Ga0207663_102473961 342
1426 3300025924 Ga0207694_10026888 Ga0207694_100268883 342
1427 3300025928 Ga0207700_10000011 Ga0207700_10000011150 342
1428 3300025929 Ga0207664_10105526 Ga0207664_101055263 342
1429 3300025945 Ga0207679_10184476 Ga0207679_101844762 342
1430 3300025949 Ga0207667_10073167 Ga0207667_100731672 342
1431 3300025981 Ga0207640_10103261 Ga0207640_101032611 342
1432 3300026035 Ga0207703_10492404 Ga0207703_104924041 342
1433 3300026078 Ga0207702_10000226 Ga0207702_100002269 342
1434 3300026078 Ga0207702_10002060 Ga0207702_100020606 342
1435 3300026116 Ga0207674_10000261 Ga0207674_1000026134 342
1436 3300026142 Ga0207698_10019754 Ga0207698_100197542 342
1437 3300048917 Ga0496114_0294811 Ga0496114_0294811_50_1078 342
1438 3300049585 Ga0501069_0172576 Ga0501069_0172576_185_1213 342
1439 3300050514 nmdc:mga08x19_129_c1 nmdc:mga08x19_129_c1_55582_56610 342
1440 3300050514 nmdc:mga08x19_67627_c1 nmdc:mga08x19_67627_c1_775_1803 342
1441 3300050510 nmdc:mga06r32_135973_c1 nmdc:mga06r32_135973_c1_861_1895 344
1442 3300050511 nmdc:mga08y16_61354_c1 nmdc:mga08y16_61354_c1_1270_2304 344
1443 3300006871 Ga0075434_100082822 Ga0075434_1000828222 345
1444 3300048907 Ga0496104_0007966 Ga0496104_0007966_6136_7173 345
1445 3300048909 Ga0496106_0002373 Ga0496106_0002373_9841_10878 345
1446 3300048910 Ga0496107_0004064 Ga0496107_0004064_3745_4782 345
1447 3300048911 Ga0496108_0001361 Ga0496108_0001361_4582_5619 345
1448 3300048912 Ga0496109_0000909 Ga0496109_0000909_17258_18295 345
1449 3300048915 Ga0496112_0070476 Ga0496112_0070476_301_1338 345
1450 3300050512 nmdc:mga0n895_59753_c1 nmdc:mga0n895_59753_c1_1605_2642 345
1451 3300001904 JGI24736J21556_1013454 JGI24736J21556_10134541 347
1452 3300001989 JGI24739J22299_10015357 JGI24739J22299_100153571 347
1453 3300001990 JGI24737J22298_10004960 JGI24737J22298_100049603 347
1454 3300005457 Ga0070662_100051040 Ga0070662_1000510401 347
1455 3300005563 Ga0068855_100007226 Ga0068855_1000072265 347
1456 3300005577 Ga0068857_100003243 Ga0068857_1000032436 347
1457 3300005578 Ga0068854_100015602 Ga0068854_1000156022 347
1458 3300005614 Ga0068856_100003004 Ga0068856_1000030048 347
1459 3300010375 Ga0105239_10001513 Ga0105239_1000151321 347
1460 3300025904 Ga0207647_10010800 Ga0207647_100108002 347
1461 3300025933 Ga0207706_10069539 Ga0207706_100695391 347
1462 3300026078 Ga0207702_10000442 Ga0207702_1000044215 347
1463 3300026078 Ga0207702_10044911 Ga0207702_100449112 347
1464 3300026116 Ga0207674_10001614 Ga0207674_100016142 347
1465 3300027907 Ga0207428_10011461 Ga0207428_100114617 347
1466 3300037418 Ga0395900_0155460 Ga0395900_0155460_202_1245 347
1467 3300048926 Ga0496123_0000812 Ga0496123_0000812_33393_34523 347
1468 3300048929 Ga0496126_0162134 Ga0496126_0162134_441_1484 347
1469 3300050511 nmdc:mga08y16_29004_c1 nmdc:mga08y16_29004_c1_149_1234 347
1470 3300053104 Ga0500556_0000071 Ga0500556_0000071_49103_50233 347
1471 iso_pu_bacteria 2507262055 2507508671 347
1472 iso_pu_bacteria 2508501009 2508542767 347
1473 iso_pu_bacteria 2508501042 2508691471 347
1474 iso_pu_bacteria 2919450847 2919454534 347
1475 iso_pu_bacteria 8001845381 8001849767 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

168

256

0.92

PF03462

PCRF

PCRF domain

1

160

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c4h-assembly1.cif.gz_v conformation of methylated ggq in the peptidyl transferase center during translation termination (ptc region) 0.9046 203 265
6c4h-assembly1.cif.gz_v conformation of methylated ggq in the peptidyl transferase center during translation termination (ptc region) 0.891 203 265
5u4j-assembly1.cif.gz_v structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.8541 97 296
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.8508 93 197
5u4j-assembly1.cif.gz_v structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.8422 97 296
ID Description Score Start End Superfamily
af_A0A1D6KST7_29_102_1.20.58.410 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Release factor 1.009 2 41 1.20.58.410
1gqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9084 95 334 3.30.70.1660
af_A0A1D6LBM0_75_157_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9076 206 270 3.30.160.20
af_A0A0P0VBA3_76_148_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.905 206 265 3.30.160.20
6c4hv00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9046 203 265 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A7X9KBZ4-F1-model_v4 deleted 0.9237 2 168
AF-A0A6L7S4M9-F1-model_v4 PCRF domain-containing protein 0.9099 2 154 GO:0006415
AF-A0A356MQ72-F1-model_v4 Peptide chain release factor 2 0.8947 2 289 GO:0005737
GO:0016149
AF-A0A4P8EIW0-F1-model_v4 Peptide chain release factor 2 (RF-2) 0.8906 2 343 GO:0005737
GO:0016149
AF-A0A0F9BYB8-F1-model_v4 Peptide chain release factor domain-containing protein 0.8894 3 175 GO:0006415

Feature Viewer

pLDDT pTM Quality
76.29 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map