F494161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1465 | 514 | 1458 | 50 |
Family's Representative Sequence
| Representative Sequence | 3300046511|Ga0495608_0055390|Ga0495608_0055390_846_992 |
| Length | 48 |
| Sequence | MMDFVAELWRFMRARKKFWLLPILVMMVVFIVVLTKGTVFAPFIYTLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 3 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 4 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 5 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 6 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 7 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 121 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 136 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 160 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 165 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 166 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 167 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 168 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 169 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 245 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 248 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 249 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 250 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 251 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 254 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 255 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 256 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 257 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 259 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 262 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 263 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 265 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 266 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 269 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 270 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 271 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 272 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 275 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 277 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 287 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 290 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 293 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 300 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 301 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 302 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 304 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 305 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 306 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 308 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 310 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 311 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 312 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 313 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 314 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 315 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 316 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 317 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 318 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 319 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 320 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 321 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 322 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 323 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 324 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 325 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 326 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 329 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 330 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 331 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 332 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 333 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 334 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 335 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 336 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 337 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 338 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 339 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 340 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 341 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 342 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 343 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 344 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 345 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 346 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 347 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 348 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 349 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 350 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 351 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 352 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 353 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 354 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 410 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 411 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 412 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 413 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 416 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 417 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 418 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 419 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 420 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 421 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 422 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 423 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 424 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 425 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 426 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 427 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 460 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 461 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 462 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 463 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 473 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 476 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 477 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 481 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 483 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 484 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 485 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 486 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 487 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 489 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 490 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 491 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 492 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 493 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 494 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 495 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 496 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 497 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 498 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 499 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 500 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 501 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 502 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 503 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 506 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 508 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 509 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 510 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 511 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.29 |
| Metatranscriptomes | 1.23 |
| Isolates | 0.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.56 |
| Nodule | 0.14 |
| Rhizoplane | 2.94 |
| Rhizosphere | 83.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10019519 | 3300001990 | Bacteria | 2167 |
| 2 | JGI25406J46586_10000940 | 3300003203 | Bacteria | 13721 |
| 3 | JGI25406J46586_10021547 | 3300003203 | Bacteria | 2584 |
| 4 | JGI25406J46586_10030719 | 3300003203 | Bacteria | 2018 |
| 5 | JGI25153J46596_10002123 | 3300003215 | Bacteria | 11603 |
| 6 | rootH2_10190176 | 3300003320 | Bacteria | 2104 |
| 7 | JGI25404J52841_10013369 | 3300003659 | Bacteria | 1780 |
| 8 | JGI25405J52794_10090595 | 3300003911 | Bacteria | 677 |
| 9 | Ga0058862_12858404 | 3300004803 | Bacteria | 1080 |
| 10 | Ga0065712_10185320 | 3300005290 | Bacteria | 1172 |
| 11 | Ga0065715_10216814 | 3300005293 | Bacteria | 1289 |
| 12 | Ga0065715_10874724 | 3300005293 | Bacteria | 583 |
| 13 | Ga0070658_10006980 | 3300005327 | Bacteria | 9123 |
| 14 | Ga0070658_10131935 | 3300005327 | Bacteria | 2082 |
| 15 | Ga0070676_10251595 | 3300005328 | Bacteria | 1179 |
| 16 | Ga0070676_11003826 | 3300005328 | Bacteria | 627 |
| 17 | Ga0070683_100004443 | 3300005329 | Bacteria | 11562 |
| 18 | Ga0070683_100033923 | 3300005329 | Bacteria | 4658 |
| 19 | Ga0070683_100035249 | 3300005329 | Bacteria | 4573 |
| 20 | Ga0070683_100066371 | 3300005329 | Bacteria | 3361 |
| 21 | Ga0070683_100803745 | 3300005329 | Bacteria | 902 |
| 22 | Ga0070683_100912673 | 3300005329 | Bacteria | 843 |
| 23 | Ga0070690_100434208 | 3300005330 | Bacteria | 971 |
| 24 | Ga0070690_100482699 | 3300005330 | Bacteria | 924 |
| 25 | Ga0070690_100706536 | 3300005330 | Bacteria | 775 |
| 26 | Ga0070670_100027724 | 3300005331 | Bacteria | 4873 |
| 27 | Ga0070670_100162620 | 3300005331 | Bacteria | 1935 |
| 28 | Ga0070670_100430999 | 3300005331 | Bacteria | 1167 |
| 29 | Ga0070670_100440685 | 3300005331 | Bacteria | 1153 |
| 30 | Ga0070670_100610163 | 3300005331 | Bacteria | 977 |
| 31 | Ga0070677_10871200 | 3300005333 | Bacteria | 519 |
| 32 | Ga0068869_100000708 | 3300005334 | Bacteria | 18924 |
| 33 | Ga0070666_10016127 | 3300005335 | Bacteria | 4774 |
| 34 | Ga0070680_100274888 | 3300005336 | Bacteria | 1426 |
| 35 | Ga0070680_101621571 | 3300005336 | Bacteria | 561 |
| 36 | Ga0070680_101713781 | 3300005336 | Bacteria | 545 |
| 37 | Ga0070682_100039976 | 3300005337 | Bacteria | 2884 |
| 38 | Ga0070682_100094786 | 3300005337 | Bacteria | 1959 |
| 39 | Ga0070682_100162503 | 3300005337 | Bacteria | 1544 |
| 40 | Ga0070682_101020341 | 3300005337 | Bacteria | 688 |
| 41 | Ga0068868_100251129 | 3300005338 | Bacteria | 1489 |
| 42 | Ga0068868_101340941 | 3300005338 | Bacteria | 666 |
| 43 | Ga0068868_102038785 | 3300005338 | Bacteria | 545 |
| 44 | Ga0068868_102378353 | 3300005338 | Bacteria | 506 |
| 45 | Ga0068868_102390218 | 3300005338 | Bacteria | 505 |
| 46 | Ga0070660_100103462 | 3300005339 | Bacteria | 2258 |
| 47 | Ga0070660_100187370 | 3300005339 | Bacteria | 1675 |
| 48 | Ga0070660_101891519 | 3300005339 | Bacteria | 509 |
| 49 | Ga0070689_100147781 | 3300005340 | Bacteria | 1894 |
| 50 | Ga0070689_100242355 | 3300005340 | Bacteria | 1485 |
| 51 | Ga0070689_100293898 | 3300005340 | Bacteria | 1351 |
| 52 | Ga0070691_10124334 | 3300005341 | Bacteria | 1301 |
| 53 | Ga0070691_10365617 | 3300005341 | Bacteria | 805 |
| 54 | Ga0070687_101140673 | 3300005343 | Bacteria | 572 |
| 55 | Ga0070661_100043611 | 3300005344 | Bacteria | 3276 |
| 56 | Ga0070661_100056480 | 3300005344 | Bacteria | 2876 |
| 57 | Ga0070661_100669555 | 3300005344 | Bacteria | 844 |
| 58 | Ga0070661_101067422 | 3300005344 | Bacteria | 672 |
| 59 | Ga0070692_10100582 | 3300005345 | Bacteria | 1584 |
| 60 | Ga0070692_10388411 | 3300005345 | Bacteria | 878 |
| 61 | Ga0070692_11316610 | 3300005345 | Bacteria | 519 |
| 62 | Ga0070668_100009348 | 3300005347 | Bacteria | 7272 |
| 63 | Ga0070668_100120941 | 3300005347 | Bacteria | 2093 |
| 64 | Ga0070668_100429687 | 3300005347 | Bacteria | 1132 |
| 65 | Ga0070668_101055912 | 3300005347 | Bacteria | 732 |
| 66 | Ga0070668_101784614 | 3300005347 | Unclassified | 566 |
| 67 | Ga0070668_101953501 | 3300005347 | Bacteria | 541 |
| 68 | Ga0070669_100021100 | 3300005353 | Bacteria | 4655 |
| 69 | Ga0070669_100034441 | 3300005353 | Bacteria | 3666 |
| 70 | Ga0070669_100050479 | 3300005353 | Bacteria | 3039 |
| 71 | Ga0070669_100426557 | 3300005353 | Bacteria | 1089 |
| 72 | Ga0070669_100778364 | 3300005353 | Bacteria | 812 |
| 73 | Ga0070669_101457439 | 3300005353 | Bacteria | 595 |
| 74 | Ga0070669_101569385 | 3300005353 | Bacteria | 573 |
| 75 | Ga0070675_100066680 | 3300005354 | Bacteria | 2978 |
| 76 | Ga0070675_100306306 | 3300005354 | Bacteria | 1401 |
| 77 | Ga0070671_100628595 | 3300005355 | Bacteria | 929 |
| 78 | Ga0070671_101430619 | 3300005355 | Bacteria | 611 |
| 79 | Ga0070671_101661487 | 3300005355 | Bacteria | 567 |
| 80 | Ga0070674_100290609 | 3300005356 | Bacteria | 1299 |
| 81 | Ga0070674_101038574 | 3300005356 | Bacteria | 721 |
| 82 | Ga0070673_100050408 | 3300005364 | Bacteria | 3255 |
| 83 | Ga0070673_100176614 | 3300005364 | Bacteria | 1826 |
| 84 | Ga0070673_100452159 | 3300005364 | Bacteria | 1156 |
| 85 | Ga0070673_101620520 | 3300005364 | Bacteria | 612 |
| 86 | Ga0070688_100384736 | 3300005365 | Bacteria | 1035 |
| 87 | Ga0070688_100398958 | 3300005365 | Bacteria | 1017 |
| 88 | Ga0070688_100873219 | 3300005365 | Bacteria | 708 |
| 89 | Ga0070659_100110611 | 3300005366 | Bacteria | 2217 |
| 90 | Ga0070659_102041878 | 3300005366 | Bacteria | 515 |
| 91 | Ga0070667_100005347 | 3300005367 | Bacteria | 10725 |
| 92 | Ga0070667_100031455 | 3300005367 | Bacteria | 4425 |
| 93 | Ga0070667_100263592 | 3300005367 | Bacteria | 1543 |
| 94 | Ga0070667_100630757 | 3300005367 | Bacteria | 989 |
| 95 | Ga0070667_100772708 | 3300005367 | Bacteria | 891 |
| 96 | Ga0070667_101973085 | 3300005367 | Bacteria | 550 |
| 97 | Ga0070667_102266512 | 3300005367 | Bacteria | 511 |
| 98 | Ga0070709_10112676 | 3300005434 | Bacteria | 1831 |
| 99 | Ga0070709_10243301 | 3300005434 | Bacteria | 1293 |
| 100 | Ga0070709_10273829 | 3300005434 | Bacteria | 1224 |
| 101 | Ga0070709_10293176 | 3300005434 | Bacteria | 1186 |
| 102 | Ga0070714_100006563 | 3300005435 | Bacteria | 8999 |
| 103 | Ga0070714_100073056 | 3300005435 | Bacteria | 2971 |
| 104 | Ga0070714_100102355 | 3300005435 | Bacteria | 2525 |
| 105 | Ga0070714_100660723 | 3300005435 | Bacteria | 1007 |
| 106 | Ga0070714_100865746 | 3300005435 | Bacteria | 877 |
| 107 | Ga0070713_100027835 | 3300005436 | Bacteria | 4457 |
| 108 | Ga0070713_100031740 | 3300005436 | Bacteria | 4210 |
| 109 | Ga0070713_100047532 | 3300005436 | Bacteria | 3528 |
| 110 | Ga0070713_100060357 | 3300005436 | Bacteria | 3170 |
| 111 | Ga0070713_100216314 | 3300005436 | Bacteria | 1737 |
| 112 | Ga0070713_100227269 | 3300005436 | Bacteria | 1695 |
| 113 | Ga0070710_10077434 | 3300005437 | Bacteria | 1933 |
| 114 | Ga0070710_10196582 | 3300005437 | Bacteria | 1271 |
| 115 | Ga0070710_11222692 | 3300005437 | Bacteria | 556 |
| 116 | Ga0070701_10809268 | 3300005438 | Bacteria | 640 |
| 117 | Ga0070701_11207723 | 3300005438 | Bacteria | 537 |
| 118 | Ga0070711_101028427 | 3300005439 | Bacteria | 708 |
| 119 | Ga0070711_101118662 | 3300005439 | Bacteria | 679 |
| 120 | Ga0070711_101947352 | 3300005439 | Bacteria | 517 |
| 121 | Ga0070705_100672043 | 3300005440 | Bacteria | 810 |
| 122 | Ga0070705_101437375 | 3300005440 | Bacteria | 576 |
| 123 | Ga0070700_100888587 | 3300005441 | Bacteria | 725 |
| 124 | Ga0070700_100958214 | 3300005441 | Bacteria | 701 |
| 125 | Ga0070708_100252458 | 3300005445 | Bacteria | 1657 |
| 126 | Ga0070708_100270417 | 3300005445 | Bacteria | 1598 |
| 127 | Ga0070708_101540875 | 3300005445 | Bacteria | 619 |
| 128 | Ga0070663_101250849 | 3300005455 | Bacteria | 653 |
| 129 | Ga0070678_100038096 | 3300005456 | Bacteria | 3382 |
| 130 | Ga0070678_100343831 | 3300005456 | Bacteria | 1281 |
| 131 | Ga0070678_100496516 | 3300005456 | Bacteria | 1076 |
| 132 | Ga0070678_100566086 | 3300005456 | Bacteria | 1010 |
| 133 | Ga0070678_101876861 | 3300005456 | Bacteria | 566 |
| 134 | Ga0070662_100161909 | 3300005457 | Bacteria | 1751 |
| 135 | Ga0070662_100334207 | 3300005457 | Bacteria | 1238 |
| 136 | Ga0070681_10048012 | 3300005458 | Bacteria | 4267 |
| 137 | Ga0070681_10052271 | 3300005458 | Bacteria | 4074 |
| 138 | Ga0070681_11164486 | 3300005458 | Bacteria | 692 |
| 139 | Ga0070681_11432511 | 3300005458 | Bacteria | 615 |
| 140 | Ga0070681_11505719 | 3300005458 | Bacteria | 597 |
| 141 | Ga0068867_100026445 | 3300005459 | Bacteria | 4167 |
| 142 | Ga0068867_100086826 | 3300005459 | Bacteria | 2368 |
| 143 | Ga0068867_100192548 | 3300005459 | Bacteria | 1628 |
| 144 | Ga0068867_100617106 | 3300005459 | Bacteria | 948 |
| 145 | Ga0068867_101875773 | 3300005459 | Bacteria | 565 |
| 146 | Ga0070685_10342578 | 3300005466 | Bacteria | 1020 |
| 147 | Ga0070685_10413731 | 3300005466 | Bacteria | 937 |
| 148 | Ga0070685_10654335 | 3300005466 | Bacteria | 762 |
| 149 | Ga0070685_11123310 | 3300005466 | Bacteria | 595 |
| 150 | Ga0070706_100065125 | 3300005467 | Bacteria | 3370 |
| 151 | Ga0070707_100065107 | 3300005468 | Unclassified | 3501 |
| 152 | Ga0070707_101370156 | 3300005468 | Bacteria | 674 |
| 153 | Ga0070698_100058117 | 3300005471 | Bacteria | 3911 |
| 154 | Ga0070698_100090301 | 3300005471 | Bacteria | 3047 |
| 155 | Ga0070698_101609126 | 3300005471 | Unclassified | 602 |
| 156 | Ga0070699_100059857 | 3300005518 | Bacteria | 3299 |
| 157 | Ga0070679_100059679 | 3300005530 | Bacteria | 3801 |
| 158 | Ga0070679_100382826 | 3300005530 | Bacteria | 1353 |
| 159 | Ga0070679_100392092 | 3300005530 | Bacteria | 1335 |
| 160 | Ga0070679_100444240 | 3300005530 | Bacteria | 1242 |
| 161 | Ga0070679_101038979 | 3300005530 | Bacteria | 764 |
| 162 | Ga0070679_101304261 | 3300005530 | Bacteria | 672 |
| 163 | Ga0070684_100007463 | 3300005535 | Bacteria | 8503 |
| 164 | Ga0070684_100012697 | 3300005535 | Bacteria | 6760 |
| 165 | Ga0070684_100029010 | 3300005535 | Bacteria | 4685 |
| 166 | Ga0070684_100106264 | 3300005535 | Bacteria | 2512 |
| 167 | Ga0070684_100967433 | 3300005535 | Bacteria | 798 |
| 168 | Ga0070684_101395147 | 3300005535 | Bacteria | 660 |
| 169 | Ga0070697_100020437 | 3300005536 | Bacteria | 5237 |
| 170 | Ga0070697_100508271 | 3300005536 | Bacteria | 1054 |
| 171 | Ga0068853_100174646 | 3300005539 | Bacteria | 1945 |
| 172 | Ga0068853_100239099 | 3300005539 | Bacteria | 1664 |
| 173 | Ga0068853_100301289 | 3300005539 | Bacteria | 1482 |
| 174 | Ga0068853_100478387 | 3300005539 | Bacteria | 1174 |
| 175 | Ga0068853_100533732 | 3300005539 | Bacteria | 1110 |
| 176 | Ga0068853_100637485 | 3300005539 | Bacteria | 1014 |
| 177 | Ga0068853_101071634 | 3300005539 | Bacteria | 777 |
| 178 | Ga0068853_101948537 | 3300005539 | Bacteria | 570 |
| 179 | Ga0068853_101982387 | 3300005539 | Bacteria | 564 |
| 180 | Ga0070672_100010053 | 3300005543 | Bacteria | 6550 |
| 181 | Ga0070672_100334253 | 3300005543 | Bacteria | 1289 |
| 182 | Ga0070672_100538371 | 3300005543 | Bacteria | 1013 |
| 183 | Ga0070672_101073380 | 3300005543 | Bacteria | 715 |
| 184 | Ga0070686_101810100 | 3300005544 | Bacteria | 520 |
| 185 | Ga0070686_101841928 | 3300005544 | Bacteria | 516 |
| 186 | Ga0070695_101293325 | 3300005545 | Bacteria | 602 |
| 187 | Ga0070696_100310212 | 3300005546 | Bacteria | 1211 |
| 188 | Ga0070696_101611494 | 3300005546 | Bacteria | 558 |
| 189 | Ga0070693_100181407 | 3300005547 | Bacteria | 1355 |
| 190 | Ga0070693_100465017 | 3300005547 | Bacteria | 891 |
| 191 | Ga0070693_100969406 | 3300005547 | Unclassified | 641 |
| 192 | Ga0070693_100976858 | 3300005547 | Bacteria | 639 |
| 193 | Ga0070665_100020492 | 3300005548 | Bacteria | 6641 |
| 194 | Ga0070665_100271847 | 3300005548 | Bacteria | 1696 |
| 195 | Ga0070665_100385356 | 3300005548 | Bacteria | 1409 |
| 196 | Ga0070665_100783324 | 3300005548 | Bacteria | 967 |
| 197 | Ga0070665_101504249 | 3300005548 | Bacteria | 682 |
| 198 | Ga0070704_100216017 | 3300005549 | Bacteria | 1556 |
| 199 | Ga0068855_100025340 | 3300005563 | Bacteria | 7097 |
| 200 | Ga0068855_100168944 | 3300005563 | Bacteria | 2477 |
| 201 | Ga0068855_100187077 | 3300005563 | Bacteria | 2338 |
| 202 | Ga0068855_100713535 | 3300005563 | Bacteria | 1072 |
| 203 | Ga0068855_101178465 | 3300005563 | Bacteria | 797 |
| 204 | Ga0068855_101303329 | 3300005563 | Bacteria | 752 |
| 205 | Ga0068855_101603565 | 3300005563 | Bacteria | 666 |
| 206 | Ga0070664_100064589 | 3300005564 | Bacteria | 3122 |
| 207 | Ga0070664_100090167 | 3300005564 | Bacteria | 2653 |
| 208 | Ga0070664_100316783 | 3300005564 | Bacteria | 1412 |
| 209 | Ga0070664_100375151 | 3300005564 | Bacteria | 1297 |
| 210 | Ga0070664_100423770 | 3300005564 | Bacteria | 1219 |
| 211 | Ga0070664_101261183 | 3300005564 | Bacteria | 698 |
| 212 | Ga0068857_100041668 | 3300005577 | Bacteria | 4072 |
| 213 | Ga0068857_100096366 | 3300005577 | Bacteria | 2651 |
| 214 | Ga0068857_100541876 | 3300005577 | Bacteria | 1095 |
| 215 | Ga0068857_101286352 | 3300005577 | Bacteria | 709 |
| 216 | Ga0068854_100219364 | 3300005578 | Bacteria | 1504 |
| 217 | Ga0068854_100740106 | 3300005578 | Bacteria | 852 |
| 218 | Ga0068854_101699283 | 3300005578 | Bacteria | 577 |
| 219 | Ga0068856_100113034 | 3300005614 | Bacteria | 2714 |
| 220 | Ga0068856_100212884 | 3300005614 | Bacteria | 1948 |
| 221 | Ga0068856_100722067 | 3300005614 | Bacteria | 1017 |
| 222 | Ga0068856_101044042 | 3300005614 | Bacteria | 835 |
| 223 | Ga0068856_102147685 | 3300005614 | Bacteria | 568 |
| 224 | Ga0070702_100019857 | 3300005615 | Bacteria | 3512 |
| 225 | Ga0070702_100485335 | 3300005615 | Bacteria | 904 |
| 226 | Ga0070702_101062416 | 3300005615 | Bacteria | 645 |
| 227 | Ga0068852_100032353 | 3300005616 | Bacteria | 4330 |
| 228 | Ga0068852_100422225 | 3300005616 | Bacteria | 1315 |
| 229 | Ga0068852_100814121 | 3300005616 | Bacteria | 948 |
| 230 | Ga0068852_101030749 | 3300005616 | Bacteria | 842 |
| 231 | Ga0068852_101324341 | 3300005616 | Bacteria | 742 |
| 232 | Ga0068859_100001245 | 3300005617 | Bacteria | 25989 |
| 233 | Ga0068859_100184715 | 3300005617 | Bacteria | 2168 |
| 234 | Ga0068859_102411696 | 3300005617 | Bacteria | 580 |
| 235 | Ga0068864_100008273 | 3300005618 | Bacteria | 8583 |
| 236 | Ga0068864_100042879 | 3300005618 | Bacteria | 3872 |
| 237 | Ga0068864_102020404 | 3300005618 | Bacteria | 583 |
| 238 | Ga0068864_102266430 | 3300005618 | Bacteria | 549 |
| 239 | Ga0068866_10059936 | 3300005718 | Bacteria | 1971 |
| 240 | Ga0068866_10295868 | 3300005718 | Bacteria | 1009 |
| 241 | Ga0068866_10833761 | 3300005718 | Bacteria | 643 |
| 242 | Ga0068861_100006169 | 3300005719 | Bacteria | 8155 |
| 243 | Ga0068861_100749385 | 3300005719 | Bacteria | 912 |
| 244 | Ga0068861_100948810 | 3300005719 | Bacteria | 818 |
| 245 | Ga0068861_101210984 | 3300005719 | Bacteria | 731 |
| 246 | Ga0068851_10234929 | 3300005834 | Bacteria | 1035 |
| 247 | Ga0068870_10002331 | 3300005840 | Bacteria | 7896 |
| 248 | Ga0068870_10488874 | 3300005840 | Bacteria | 818 |
| 249 | Ga0068870_10661408 | 3300005840 | Bacteria | 717 |
| 250 | Ga0068870_11124370 | 3300005840 | Bacteria | 566 |
| 251 | Ga0068870_11242674 | 3300005840 | Bacteria | 541 |
| 252 | Ga0068863_100000873 | 3300005841 | Bacteria | 30215 |
| 253 | Ga0068863_100086250 | 3300005841 | Bacteria | 2974 |
| 254 | Ga0068863_100302684 | 3300005841 | Bacteria | 1551 |
| 255 | Ga0068863_101154561 | 3300005841 | Bacteria | 780 |
| 256 | Ga0068863_101478691 | 3300005841 | Bacteria | 688 |
| 257 | Ga0068858_100002812 | 3300005842 | Bacteria | 17501 |
| 258 | Ga0068858_100143105 | 3300005842 | Bacteria | 2245 |
| 259 | Ga0068858_100870038 | 3300005842 | Bacteria | 881 |
| 260 | Ga0068858_100949509 | 3300005842 | Bacteria | 842 |
| 261 | Ga0068858_100992624 | 3300005842 | Bacteria | 823 |
| 262 | Ga0068858_101085492 | 3300005842 | Unclassified | 786 |
| 263 | Ga0068858_101988129 | 3300005842 | Bacteria | 575 |
| 264 | Ga0068860_100000149 | 3300005843 | Bacteria | 113068 |
| 265 | Ga0068860_100012312 | 3300005843 | Bacteria | 8428 |
| 266 | Ga0068860_100521163 | 3300005843 | Bacteria | 1189 |
| 267 | Ga0068860_100792664 | 3300005843 | Bacteria | 961 |
| 268 | Ga0068860_101365343 | 3300005843 | Bacteria | 730 |
| 269 | Ga0068860_101617533 | 3300005843 | Bacteria | 670 |
| 270 | Ga0068860_101762671 | 3300005843 | Bacteria | 641 |
| 271 | Ga0068862_100012163 | 3300005844 | Bacteria | 7115 |
| 272 | Ga0068862_100131633 | 3300005844 | Bacteria | 2213 |
| 273 | Ga0068862_100222846 | 3300005844 | Bacteria | 1708 |
| 274 | Ga0068862_100371395 | 3300005844 | Bacteria | 1332 |
| 275 | Ga0068862_100406614 | 3300005844 | Bacteria | 1274 |
| 276 | Ga0068862_100559699 | 3300005844 | Bacteria | 1093 |
| 277 | Ga0068862_101773246 | 3300005844 | Unclassified | 626 |
| 278 | Ga0068862_102369173 | 3300005844 | Bacteria | 542 |
| 279 | Ga0081455_10001001 | 3300005937 | Bacteria | 35840 |
| 280 | Ga0081455_10007427 | 3300005937 | Bacteria | 11546 |
| 281 | Ga0081455_10090302 | 3300005937 | Bacteria | 2484 |
| 282 | Ga0081455_10091268 | 3300005937 | Bacteria | 2467 |
| 283 | Ga0081455_10128235 | 3300005937 | Bacteria | 1988 |
| 284 | Ga0081455_10910420 | 3300005937 | Bacteria | 547 |
| 285 | Ga0081538_10138715 | 3300005981 | Bacteria | 1126 |
| 286 | Ga0081540_1000003 | 3300005983 | Bacteria | 233942 |
| 287 | Ga0081540_1003189 | 3300005983 | Bacteria | 13057 |
| 288 | Ga0081540_1035955 | 3300005983 | Bacteria | 2649 |
| 289 | Ga0081540_1186596 | 3300005983 | Bacteria | 769 |
| 290 | Ga0081539_10000191 | 3300005985 | Bacteria | 142387 |
| 291 | Ga0081539_10001452 | 3300005985 | Bacteria | 40486 |
| 292 | Ga0081539_10001574 | 3300005985 | Bacteria | 37718 |
| 293 | Ga0081539_10007767 | 3300005985 | Bacteria | 9608 |
| 294 | Ga0070717_10002484 | 3300006028 | Bacteria | 13019 |
| 295 | Ga0070717_10003662 | 3300006028 | Bacteria | 11032 |
| 296 | Ga0070717_10060928 | 3300006028 | Bacteria | 3126 |
| 297 | Ga0070717_11202793 | 3300006028 | Bacteria | 690 |
| 298 | Ga0075365_10005466 | 3300006038 | Bacteria | 6856 |
| 299 | Ga0075365_10169119 | 3300006038 | Bacteria | 1525 |
| 300 | Ga0075365_10207547 | 3300006038 | Bacteria | 1373 |
| 301 | Ga0075365_10558838 | 3300006038 | Bacteria | 809 |
| 302 | Ga0075365_10597471 | 3300006038 | Bacteria | 780 |
| 303 | Ga0075365_10630465 | 3300006038 | Bacteria | 758 |
| 304 | Ga0075365_10675477 | 3300006038 | Bacteria | 730 |
| 305 | Ga0075368_10110543 | 3300006042 | Bacteria | 1133 |
| 306 | Ga0075368_10374334 | 3300006042 | Bacteria | 622 |
| 307 | Ga0075363_100067216 | 3300006048 | Bacteria | 1942 |
| 308 | Ga0075363_100141991 | 3300006048 | Bacteria | 1352 |
| 309 | Ga0075364_10035360 | 3300006051 | Bacteria | 3228 |
| 310 | Ga0075364_10174371 | 3300006051 | Bacteria | 1454 |
| 311 | Ga0075364_10503654 | 3300006051 | Bacteria | 828 |
| 312 | Ga0075432_10085982 | 3300006058 | Bacteria | 1146 |
| 313 | Ga0075432_10383668 | 3300006058 | Bacteria | 603 |
| 314 | Ga0070715_10410531 | 3300006163 | Bacteria | 755 |
| 315 | Ga0070715_10647226 | 3300006163 | Unclassified | 625 |
| 316 | Ga0070715_11047873 | 3300006163 | Bacteria | 511 |
| 317 | Ga0070716_100092196 | 3300006173 | Bacteria | 1836 |
| 318 | Ga0070716_100174999 | 3300006173 | Bacteria | 1404 |
| 319 | Ga0070716_101256805 | 3300006173 | Bacteria | 597 |
| 320 | Ga0070716_101463376 | 3300006173 | Bacteria | 557 |
| 321 | Ga0070712_100051865 | 3300006175 | Bacteria | 2859 |
| 322 | Ga0070712_100729473 | 3300006175 | Bacteria | 847 |
| 323 | Ga0075362_10002622 | 3300006177 | Bacteria | 6090 |
| 324 | Ga0075362_10003948 | 3300006177 | Bacteria | 5269 |
| 325 | Ga0075362_10004980 | 3300006177 | Bacteria | 4818 |
| 326 | Ga0075362_10067150 | 3300006177 | Bacteria | 1631 |
| 327 | Ga0075362_10104884 | 3300006177 | Bacteria | 1325 |
| 328 | Ga0075362_10527718 | 3300006177 | Bacteria | 605 |
| 329 | Ga0075367_10006371 | 3300006178 | Bacteria | 5956 |
| 330 | Ga0075367_10081795 | 3300006178 | Bacteria | 1955 |
| 331 | Ga0075367_10372777 | 3300006178 | Bacteria | 902 |
| 332 | Ga0075367_10484337 | 3300006178 | Bacteria | 784 |
| 333 | Ga0075369_10001306 | 3300006186 | Bacteria | 8479 |
| 334 | Ga0075369_10075756 | 3300006186 | Bacteria | 1486 |
| 335 | Ga0075369_10149250 | 3300006186 | Bacteria | 1068 |
| 336 | Ga0075366_10000880 | 3300006195 | Bacteria | 14505 |
| 337 | Ga0075366_10157169 | 3300006195 | Bacteria | 1377 |
| 338 | Ga0075366_10187591 | 3300006195 | Bacteria | 1256 |
| 339 | Ga0075366_10190723 | 3300006195 | Bacteria | 1245 |
| 340 | Ga0075366_10425519 | 3300006195 | Bacteria | 818 |
| 341 | Ga0097621_100278535 | 3300006237 | Bacteria | 1472 |
| 342 | Ga0097621_100663585 | 3300006237 | Bacteria | 958 |
| 343 | Ga0097621_100862381 | 3300006237 | Bacteria | 842 |
| 344 | Ga0097621_101373661 | 3300006237 | Bacteria | 668 |
| 345 | Ga0075370_10045498 | 3300006353 | Bacteria | 2482 |
| 346 | Ga0075370_10078629 | 3300006353 | Bacteria | 1894 |
| 347 | Ga0075370_10224866 | 3300006353 | Bacteria | 1109 |
| 348 | Ga0075370_10346164 | 3300006353 | Bacteria | 887 |
| 349 | Ga0075370_10435715 | 3300006353 | Bacteria | 788 |
| 350 | Ga0068871_100385436 | 3300006358 | Bacteria | 1246 |
| 351 | Ga0068871_100705272 | 3300006358 | Bacteria | 925 |
| 352 | Ga0075428_100045105 | 3300006844 | Bacteria | 4844 |
| 353 | Ga0075428_100080803 | 3300006844 | Bacteria | 3548 |
| 354 | Ga0075428_100561180 | 3300006844 | Unclassified | 1220 |
| 355 | Ga0075428_101171392 | 3300006844 | Bacteria | 811 |
| 356 | Ga0075428_102272686 | 3300006844 | Unclassified | 558 |
| 357 | Ga0075430_100084875 | 3300006846 | Bacteria | 2652 |
| 358 | Ga0075430_100118025 | 3300006846 | Bacteria | 2211 |
| 359 | Ga0075430_100812322 | 3300006846 | Unclassified | 771 |
| 360 | Ga0075431_100014415 | 3300006847 | Bacteria | 7996 |
| 361 | Ga0075431_100034312 | 3300006847 | Bacteria | 5227 |
| 362 | Ga0075431_102136570 | 3300006847 | Unclassified | 514 |
| 363 | Ga0075433_10003359 | 3300006852 | Bacteria | 12372 |
| 364 | Ga0075433_10018901 | 3300006852 | Bacteria | 5736 |
| 365 | Ga0075434_100017326 | 3300006871 | Bacteria | 6936 |
| 366 | Ga0075434_100020139 | 3300006871 | Bacteria | 6465 |
| 367 | Ga0075434_100067222 | 3300006871 | Bacteria | 3571 |
| 368 | Ga0075434_100193791 | 3300006871 | Bacteria | 2052 |
| 369 | Ga0075434_100522982 | 3300006871 | Bacteria | 1207 |
| 370 | Ga0075434_100525994 | 3300006871 | Bacteria | 1203 |
| 371 | Ga0075434_100866084 | 3300006871 | Bacteria | 919 |
| 372 | Ga0075434_100870128 | 3300006871 | Bacteria | 916 |
| 373 | Ga0075434_101077628 | 3300006871 | Bacteria | 817 |
| 374 | Ga0075429_100047982 | 3300006880 | Bacteria | 3714 |
| 375 | Ga0075429_100222872 | 3300006880 | Bacteria | 1652 |
| 376 | Ga0075429_100437713 | 3300006880 | Unclassified | 1146 |
| 377 | Ga0075429_100609623 | 3300006880 | Bacteria | 956 |
| 378 | Ga0068865_100266213 | 3300006881 | Bacteria | 1359 |
| 379 | Ga0075436_100270712 | 3300006914 | Bacteria | 1213 |
| 380 | Ga0075436_100921172 | 3300006914 | Unclassified | 654 |
| 381 | Ga0097620_100001245 | 3300006931 | Bacteria | 25989 |
| 382 | Ga0097620_100184722 | 3300006931 | Bacteria | 2168 |
| 383 | Ga0097620_102411355 | 3300006931 | Bacteria | 580 |
| 384 | Ga0075435_100235203 | 3300007076 | Bacteria | 1557 |
| 385 | Ga0075435_100531957 | 3300007076 | Bacteria | 1017 |
| 386 | Ga0075435_100619304 | 3300007076 | Bacteria | 939 |
| 387 | Ga0099794_10017466 | 3300007265 | Bacteria | 3199 |
| 388 | Ga0099795_10104454 | 3300007788 | Bacteria | 1115 |
| 389 | Ga0099795_10106440 | 3300007788 | Bacteria | 1106 |
| 390 | Ga0099795_10473198 | 3300007788 | Bacteria | 580 |
| 391 | Ga0105250_10108891 | 3300009092 | Bacteria | 1134 |
| 392 | Ga0105240_10075127 | 3300009093 | Bacteria | 4169 |
| 393 | Ga0105240_10357095 | 3300009093 | Bacteria | 1656 |
| 394 | Ga0105240_10822753 | 3300009093 | Bacteria | 1004 |
| 395 | Ga0105240_11779767 | 3300009093 | Bacteria | 642 |
| 396 | Ga0105240_11879762 | 3300009093 | Bacteria | 623 |
| 397 | Ga0111539_10015625 | 3300009094 | Bacteria | 9437 |
| 398 | Ga0111539_10046064 | 3300009094 | Bacteria | 5219 |
| 399 | Ga0111539_10068483 | 3300009094 | Bacteria | 4190 |
| 400 | Ga0111539_10089231 | 3300009094 | Bacteria | 3622 |
| 401 | Ga0111539_10645809 | 3300009094 | Bacteria | 1232 |
| 402 | Ga0111539_12192369 | 3300009094 | Bacteria | 641 |
| 403 | Ga0105245_10257845 | 3300009098 | Bacteria | 1696 |
| 404 | Ga0105245_10575581 | 3300009098 | Bacteria | 1150 |
| 405 | Ga0105245_10593084 | 3300009098 | Bacteria | 1134 |
| 406 | Ga0105245_11669470 | 3300009098 | Bacteria | 689 |
| 407 | Ga0105245_11764188 | 3300009098 | Bacteria | 671 |
| 408 | Ga0105245_11818477 | 3300009098 | Bacteria | 662 |
| 409 | Ga0105245_12994096 | 3300009098 | Bacteria | 524 |
| 410 | Ga0105245_13258386 | 3300009098 | Unclassified | 503 |
| 411 | Ga0105247_10041211 | 3300009101 | Bacteria | 2825 |
| 412 | Ga0105247_10070694 | 3300009101 | Bacteria | 2181 |
| 413 | Ga0105247_10324994 | 3300009101 | Bacteria | 1074 |
| 414 | Ga0105247_10464790 | 3300009101 | Bacteria | 915 |
| 415 | Ga0105247_10515367 | 3300009101 | Bacteria | 874 |
| 416 | Ga0105247_10562553 | 3300009101 | Bacteria | 840 |
| 417 | Ga0105247_11345847 | 3300009101 | Bacteria | 575 |
| 418 | Ga0105247_11452821 | 3300009101 | Bacteria | 557 |
| 419 | Ga0114129_10761458 | 3300009147 | Bacteria | 1239 |
| 420 | Ga0114129_11558884 | 3300009147 | Bacteria | 810 |
| 421 | Ga0114129_13123651 | 3300009147 | Bacteria | 541 |
| 422 | Ga0105243_10188988 | 3300009148 | Bacteria | 1797 |
| 423 | Ga0105243_11152555 | 3300009148 | Bacteria | 786 |
| 424 | Ga0105243_11241130 | 3300009148 | Bacteria | 760 |
| 425 | Ga0105243_11378026 | 3300009148 | Bacteria | 725 |
| 426 | Ga0105243_12463319 | 3300009148 | Bacteria | 559 |
| 427 | Ga0105241_10128324 | 3300009174 | Bacteria | 2050 |
| 428 | Ga0105241_10304189 | 3300009174 | Bacteria | 1369 |
| 429 | Ga0105241_11754185 | 3300009174 | Bacteria | 605 |
| 430 | Ga0105241_11767469 | 3300009174 | Bacteria | 602 |
| 431 | Ga0105241_11931794 | 3300009174 | Bacteria | 579 |
| 432 | Ga0105241_11989951 | 3300009174 | Bacteria | 572 |
| 433 | Ga0105242_11835702 | 3300009176 | Bacteria | 645 |
| 434 | Ga0105242_12797035 | 3300009176 | Bacteria | 538 |
| 435 | Ga0105248_10002517 | 3300009177 | Bacteria | 20397 |
| 436 | Ga0105248_10049520 | 3300009177 | Bacteria | 4712 |
| 437 | Ga0105248_11398025 | 3300009177 | Bacteria | 792 |
| 438 | Ga0105248_11404553 | 3300009177 | Bacteria | 790 |
| 439 | Ga0105248_12667761 | 3300009177 | Bacteria | 570 |
| 440 | Ga0105248_13334491 | 3300009177 | Bacteria | 510 |
| 441 | Ga0105237_10053338 | 3300009545 | Bacteria | 4056 |
| 442 | Ga0105237_10055453 | 3300009545 | Bacteria | 3969 |
| 443 | Ga0105237_10149240 | 3300009545 | Bacteria | 2334 |
| 444 | Ga0105237_10229785 | 3300009545 | Bacteria | 1856 |
| 445 | Ga0105237_10363524 | 3300009545 | Bacteria | 1451 |
| 446 | Ga0105237_10876228 | 3300009545 | Bacteria | 905 |
| 447 | Ga0105237_11547053 | 3300009545 | Bacteria | 670 |
| 448 | Ga0105237_11926353 | 3300009545 | Bacteria | 599 |
| 449 | Ga0105238_10257663 | 3300009551 | Bacteria | 1724 |
| 450 | Ga0105238_10345144 | 3300009551 | Bacteria | 1477 |
| 451 | Ga0105238_10793711 | 3300009551 | Bacteria | 962 |
| 452 | Ga0105238_11280213 | 3300009551 | Bacteria | 759 |
| 453 | Ga0105249_10117602 | 3300009553 | Bacteria | 2521 |
| 454 | Ga0105249_11197395 | 3300009553 | Bacteria | 831 |
| 455 | Ga0105249_11326698 | 3300009553 | Bacteria | 791 |
| 456 | Ga0105249_11365889 | 3300009553 | Bacteria | 780 |
| 457 | Ga0105249_12128511 | 3300009553 | Bacteria | 634 |
| 458 | Ga0105035_116424 | 3300009988 | Bacteria | 684 |
| 459 | Ga0099796_10095363 | 3300010159 | Bacteria | 1112 |
| 460 | Ga0099796_10119314 | 3300010159 | Bacteria | 1012 |
| 461 | Ga0099796_10533419 | 3300010159 | Bacteria | 527 |
| 462 | Ga0105239_10085772 | 3300010375 | Bacteria | 3471 |
| 463 | Ga0105239_10207156 | 3300010375 | Bacteria | 2197 |
| 464 | Ga0105239_10644134 | 3300010375 | Bacteria | 1210 |
| 465 | Ga0105239_12092602 | 3300010375 | Bacteria | 658 |
| 466 | Ga0105239_12483287 | 3300010375 | Bacteria | 604 |
| 467 | Ga0105239_12680615 | 3300010375 | Bacteria | 581 |
| 468 | Ga0105246_10225045 | 3300011119 | Bacteria | 1473 |
| 469 | Ga0105246_10772466 | 3300011119 | Bacteria | 850 |
| 470 | Ga0105246_10811141 | 3300011119 | Bacteria | 831 |
| 471 | Ga0157321_1017925 | 3300012487 | Bacteria | 622 |
| 472 | Ga0157373_10304337 | 3300013100 | Bacteria | 1132 |
| 473 | Ga0157373_10445422 | 3300013100 | Bacteria | 931 |
| 474 | Ga0157371_10037740 | 3300013102 | Bacteria | 3457 |
| 475 | Ga0157371_10202736 | 3300013102 | Bacteria | 1422 |
| 476 | Ga0157371_10806974 | 3300013102 | Bacteria | 707 |
| 477 | Ga0157370_10240766 | 3300013104 | Bacteria | 1674 |
| 478 | Ga0157370_10598302 | 3300013104 | Bacteria | 1010 |
| 479 | Ga0157370_10676620 | 3300013104 | Bacteria | 942 |
| 480 | Ga0157370_10728503 | 3300013104 | Bacteria | 904 |
| 481 | Ga0157370_10742744 | 3300013104 | Bacteria | 894 |
| 482 | Ga0157370_11861012 | 3300013104 | Bacteria | 540 |
| 483 | Ga0157370_12027016 | 3300013104 | Bacteria | 516 |
| 484 | Ga0157369_10059379 | 3300013105 | Bacteria | 4124 |
| 485 | Ga0157369_10273787 | 3300013105 | Bacteria | 1759 |
| 486 | Ga0157369_10288107 | 3300013105 | Bacteria | 1710 |
| 487 | Ga0157369_10484948 | 3300013105 | Bacteria | 1279 |
| 488 | Ga0157369_10524350 | 3300013105 | Bacteria | 1225 |
| 489 | Ga0157369_11040671 | 3300013105 | Bacteria | 838 |
| 490 | Ga0157374_10194493 | 3300013296 | Bacteria | 1985 |
| 491 | Ga0157374_10202392 | 3300013296 | Bacteria | 1944 |
| 492 | Ga0157374_10782565 | 3300013296 | Bacteria | 969 |
| 493 | Ga0157374_10797268 | 3300013296 | Bacteria | 960 |
| 494 | Ga0157374_11170581 | 3300013296 | Bacteria | 790 |
| 495 | Ga0157374_12908873 | 3300013296 | Unclassified | 506 |
| 496 | Ga0157378_10016126 | 3300013297 | Bacteria | 6543 |
| 497 | Ga0157378_10180605 | 3300013297 | Bacteria | 1985 |
| 498 | Ga0157378_10395136 | 3300013297 | Bacteria | 1361 |
| 499 | Ga0157378_10716397 | 3300013297 | Bacteria | 1021 |
| 500 | Ga0157378_11194236 | 3300013297 | Bacteria | 800 |
| 501 | Ga0157378_12561561 | 3300013297 | Bacteria | 562 |
| 502 | Ga0163162_10082452 | 3300013306 | Bacteria | 3288 |
| 503 | Ga0163162_10096960 | 3300013306 | Bacteria | 3037 |
| 504 | Ga0163162_10354072 | 3300013306 | Bacteria | 1601 |
| 505 | Ga0163162_10395900 | 3300013306 | Bacteria | 1514 |
| 506 | Ga0163162_11056463 | 3300013306 | Bacteria | 919 |
| 507 | Ga0163162_11410211 | 3300013306 | Bacteria | 793 |
| 508 | Ga0163162_12087887 | 3300013306 | Bacteria | 650 |
| 509 | Ga0163162_13246855 | 3300013306 | Bacteria | 521 |
| 510 | Ga0163162_13334989 | 3300013306 | Bacteria | 514 |
| 511 | Ga0157372_10044917 | 3300013307 | Bacteria | 4897 |
| 512 | Ga0157372_10237973 | 3300013307 | Bacteria | 2112 |
| 513 | Ga0157372_10538562 | 3300013307 | Bacteria | 1361 |
| 514 | Ga0157372_11478237 | 3300013307 | Bacteria | 783 |
| 515 | Ga0157372_12429284 | 3300013307 | Bacteria | 602 |
| 516 | Ga0157375_10222455 | 3300013308 | Bacteria | 2046 |
| 517 | Ga0157375_11454833 | 3300013308 | Bacteria | 808 |
| 518 | Ga0163163_10000812 | 3300014325 | Bacteria | 26556 |
| 519 | Ga0163163_10113227 | 3300014325 | Bacteria | 2743 |
| 520 | Ga0163163_10490016 | 3300014325 | Bacteria | 1291 |
| 521 | Ga0163163_11050982 | 3300014325 | Unclassified | 877 |
| 522 | Ga0163163_12660334 | 3300014325 | Bacteria | 558 |
| 523 | Ga0157380_11695684 | 3300014326 | Bacteria | 689 |
| 524 | Ga0157380_11916092 | 3300014326 | Bacteria | 653 |
| 525 | Ga0157380_12261617 | 3300014326 | Bacteria | 608 |
| 526 | Ga0182008_10244091 | 3300014497 | Bacteria | 925 |
| 527 | Ga0182008_10566222 | 3300014497 | Bacteria | 633 |
| 528 | Ga0182008_10846232 | 3300014497 | Bacteria | 534 |
| 529 | Ga0157377_10540151 | 3300014745 | Bacteria | 822 |
| 530 | Ga0157377_10888734 | 3300014745 | Bacteria | 665 |
| 531 | Ga0157377_11295171 | 3300014745 | Bacteria | 569 |
| 532 | Ga0157379_10000401 | 3300014968 | Bacteria | 35047 |
| 533 | Ga0157379_10398503 | 3300014968 | Bacteria | 1265 |
| 534 | Ga0157379_10666434 | 3300014968 | Bacteria | 975 |
| 535 | Ga0157379_10926495 | 3300014968 | Bacteria | 828 |
| 536 | Ga0157379_11014445 | 3300014968 | Bacteria | 792 |
| 537 | Ga0157379_11747140 | 3300014968 | Bacteria | 610 |
| 538 | Ga0157376_10058405 | 3300014969 | Bacteria | 3231 |
| 539 | Ga0157376_10452778 | 3300014969 | Bacteria | 1252 |
| 540 | Ga0157376_10596257 | 3300014969 | Bacteria | 1099 |
| 541 | Ga0157376_11840955 | 3300014969 | Bacteria | 642 |
| 542 | Ga0157376_12196332 | 3300014969 | Bacteria | 591 |
| 543 | Ga0157376_12687351 | 3300014969 | Bacteria | 538 |
| 544 | Ga0157376_13008035 | 3300014969 | Bacteria | 510 |
| 545 | Ga0163161_10229479 | 3300017792 | Bacteria | 1440 |
| 546 | Ga0163161_10572716 | 3300017792 | Bacteria | 928 |
| 547 | Ga0197907_11200871 | 3300020069 | Bacteria | 2421 |
| 548 | Ga0206356_10599982 | 3300020070 | Bacteria | 756 |
| 549 | Ga0206356_11246173 | 3300020070 | Unclassified | 544 |
| 550 | Ga0206349_1682998 | 3300020075 | Bacteria | 788 |
| 551 | Ga0206355_1179373 | 3300020076 | Bacteria | 1939 |
| 552 | Ga0206350_10626026 | 3300020080 | Bacteria | 4374 |
| 553 | Ga0206354_11293970 | 3300020081 | Bacteria | 1471 |
| 554 | Ga0206353_10193602 | 3300020082 | Bacteria | 897 |
| 555 | Ga0154015_1702973 | 3300020610 | Bacteria | 1198 |
| 556 | Ga0213873_10263288 | 3300021358 | Bacteria | 549 |
| 557 | Ga0213872_10400673 | 3300021361 | Bacteria | 556 |
| 558 | Ga0213874_10022748 | 3300021377 | Bacteria | 1742 |
| 559 | Ga0213876_10204990 | 3300021384 | Bacteria | 1048 |
| 560 | Ga0213871_10023878 | 3300021441 | Bacteria | 1543 |
| 561 | Ga0224712_10011865 | 3300022467 | Bacteria | 2719 |
| 562 | Ga0224712_10361874 | 3300022467 | Bacteria | 687 |
| 563 | Ga0209758_1000183 | 3300025297 | Bacteria | 140623 |
| 564 | Ga0209758_1022536 | 3300025297 | Bacteria | 2881 |
| 565 | Ga0209758_1064599 | 3300025297 | Bacteria | 1185 |
| 566 | Ga0207426_1102116 | 3300025302 | Bacteria | 738 |
| 567 | Ga0207697_10113298 | 3300025315 | Bacteria | 1162 |
| 568 | Ga0207697_10136582 | 3300025315 | Bacteria | 1061 |
| 569 | Ga0207656_10080629 | 3300025321 | Bacteria | 1462 |
| 570 | Ga0207656_10269096 | 3300025321 | Bacteria | 838 |
| 571 | Ga0207653_10038324 | 3300025885 | Bacteria | 1566 |
| 572 | Ga0207682_10283279 | 3300025893 | Bacteria | 775 |
| 573 | Ga0207692_10107183 | 3300025898 | Bacteria | 1544 |
| 574 | Ga0207692_10195267 | 3300025898 | Bacteria | 1187 |
| 575 | Ga0207692_10304093 | 3300025898 | Bacteria | 971 |
| 576 | Ga0207692_10457524 | 3300025898 | Bacteria | 804 |
| 577 | Ga0207692_10731483 | 3300025898 | Bacteria | 644 |
| 578 | Ga0207642_10030849 | 3300025899 | Bacteria | 2238 |
| 579 | Ga0207642_10468464 | 3300025899 | Bacteria | 766 |
| 580 | Ga0207710_10059715 | 3300025900 | Bacteria | 1727 |
| 581 | Ga0207710_10152875 | 3300025900 | Bacteria | 1120 |
| 582 | Ga0207710_10241257 | 3300025900 | Bacteria | 902 |
| 583 | Ga0207710_10441552 | 3300025900 | Bacteria | 671 |
| 584 | Ga0207710_10503179 | 3300025900 | Bacteria | 629 |
| 585 | Ga0207688_10264866 | 3300025901 | Bacteria | 1044 |
| 586 | Ga0207688_10465756 | 3300025901 | Bacteria | 789 |
| 587 | Ga0207688_10855520 | 3300025901 | Bacteria | 576 |
| 588 | Ga0207680_11004005 | 3300025903 | Bacteria | 598 |
| 589 | Ga0207685_10191741 | 3300025905 | Bacteria | 954 |
| 590 | Ga0207685_10574958 | 3300025905 | Bacteria | 602 |
| 591 | Ga0207699_10025581 | 3300025906 | Bacteria | 3242 |
| 592 | Ga0207699_10199589 | 3300025906 | Bacteria | 1355 |
| 593 | Ga0207699_10284276 | 3300025906 | Bacteria | 1150 |
| 594 | Ga0207699_10679423 | 3300025906 | Bacteria | 753 |
| 595 | Ga0207699_10870700 | 3300025906 | Bacteria | 664 |
| 596 | Ga0207699_11357232 | 3300025906 | Bacteria | 526 |
| 597 | Ga0207699_11370861 | 3300025906 | Bacteria | 523 |
| 598 | Ga0207699_11423756 | 3300025906 | Bacteria | 513 |
| 599 | Ga0207645_10074238 | 3300025907 | Bacteria | 2177 |
| 600 | Ga0207645_10214199 | 3300025907 | Bacteria | 1269 |
| 601 | Ga0207645_10291619 | 3300025907 | Bacteria | 1085 |
| 602 | Ga0207645_10321812 | 3300025907 | Bacteria | 1032 |
| 603 | Ga0207643_10022986 | 3300025908 | Bacteria | 3437 |
| 604 | Ga0207643_10147552 | 3300025908 | Bacteria | 1408 |
| 605 | Ga0207643_11093598 | 3300025908 | Bacteria | 514 |
| 606 | Ga0207643_11103461 | 3300025908 | Bacteria | 512 |
| 607 | Ga0207705_10087806 | 3300025909 | Bacteria | 2274 |
| 608 | Ga0207684_10057054 | 3300025910 | Bacteria | 3313 |
| 609 | Ga0207654_10276160 | 3300025911 | Bacteria | 1135 |
| 610 | Ga0207654_10284125 | 3300025911 | Bacteria | 1120 |
| 611 | Ga0207707_10019814 | 3300025912 | Bacteria | 5873 |
| 612 | Ga0207707_10027775 | 3300025912 | Bacteria | 4947 |
| 613 | Ga0207707_11157195 | 3300025912 | Bacteria | 628 |
| 614 | Ga0207707_11525684 | 3300025912 | Bacteria | 529 |
| 615 | Ga0207695_10054576 | 3300025913 | Bacteria | 4171 |
| 616 | Ga0207695_10340223 | 3300025913 | Bacteria | 1388 |
| 617 | Ga0207695_11330962 | 3300025913 | Bacteria | 599 |
| 618 | Ga0207671_10099942 | 3300025914 | Bacteria | 2196 |
| 619 | Ga0207671_10099958 | 3300025914 | Bacteria | 2196 |
| 620 | Ga0207671_10103991 | 3300025914 | Bacteria | 2154 |
| 621 | Ga0207671_10174515 | 3300025914 | Bacteria | 1670 |
| 622 | Ga0207671_10292548 | 3300025914 | Bacteria | 1286 |
| 623 | Ga0207671_10397523 | 3300025914 | Bacteria | 1096 |
| 624 | Ga0207693_10008445 | 3300025915 | Bacteria | 8428 |
| 625 | Ga0207693_10223615 | 3300025915 | Bacteria | 1479 |
| 626 | Ga0207663_10337156 | 3300025916 | Bacteria | 1138 |
| 627 | Ga0207663_10385522 | 3300025916 | Bacteria | 1068 |
| 628 | Ga0207663_10554305 | 3300025916 | Bacteria | 899 |
| 629 | Ga0207663_10953971 | 3300025916 | Bacteria | 687 |
| 630 | Ga0207663_10982780 | 3300025916 | Bacteria | 677 |
| 631 | Ga0207660_10017576 | 3300025917 | Bacteria | 4754 |
| 632 | Ga0207660_10263412 | 3300025917 | Bacteria | 1364 |
| 633 | Ga0207660_10742314 | 3300025917 | Bacteria | 801 |
| 634 | Ga0207657_10099624 | 3300025919 | Bacteria | 2413 |
| 635 | Ga0207657_10381680 | 3300025919 | Bacteria | 1109 |
| 636 | Ga0207649_10143932 | 3300025920 | Bacteria | 1634 |
| 637 | Ga0207649_10280444 | 3300025920 | Bacteria | 1211 |
| 638 | Ga0207649_10295375 | 3300025920 | Bacteria | 1183 |
| 639 | Ga0207649_10781425 | 3300025920 | Bacteria | 744 |
| 640 | Ga0207649_10966266 | 3300025920 | Bacteria | 669 |
| 641 | Ga0207652_10223971 | 3300025921 | Bacteria | 1695 |
| 642 | Ga0207652_10407074 | 3300025921 | Bacteria | 1227 |
| 643 | Ga0207652_10654237 | 3300025921 | Bacteria | 940 |
| 644 | Ga0207652_11076474 | 3300025921 | Bacteria | 704 |
| 645 | Ga0207652_11767678 | 3300025921 | Bacteria | 523 |
| 646 | Ga0207646_10020117 | 3300025922 | Bacteria | 6190 |
| 647 | Ga0207646_10223738 | 3300025922 | Bacteria | 1700 |
| 648 | Ga0207646_10624543 | 3300025922 | Bacteria | 966 |
| 649 | Ga0207681_10065491 | 3300025923 | Bacteria | 2512 |
| 650 | Ga0207681_10108734 | 3300025923 | Bacteria | 2013 |
| 651 | Ga0207681_10462411 | 3300025923 | Bacteria | 1034 |
| 652 | Ga0207681_10918781 | 3300025923 | Bacteria | 733 |
| 653 | Ga0207694_10168517 | 3300025924 | Bacteria | 1772 |
| 654 | Ga0207694_10426931 | 3300025924 | Bacteria | 1105 |
| 655 | Ga0207694_10437989 | 3300025924 | Bacteria | 1090 |
| 656 | Ga0207694_10712461 | 3300025924 | Bacteria | 846 |
| 657 | Ga0207650_10019282 | 3300025925 | Bacteria | 4790 |
| 658 | Ga0207650_10160698 | 3300025925 | Bacteria | 1780 |
| 659 | Ga0207650_10374865 | 3300025925 | Bacteria | 1174 |
| 660 | Ga0207650_10382323 | 3300025925 | Bacteria | 1163 |
| 661 | Ga0207650_10500076 | 3300025925 | Bacteria | 1016 |
| 662 | Ga0207650_10670211 | 3300025925 | Bacteria | 875 |
| 663 | Ga0207659_10051717 | 3300025926 | Bacteria | 2923 |
| 664 | Ga0207687_10984439 | 3300025927 | Bacteria | 723 |
| 665 | Ga0207687_11779417 | 3300025927 | Bacteria | 528 |
| 666 | Ga0207700_10011883 | 3300025928 | Bacteria | 5581 |
| 667 | Ga0207700_10050788 | 3300025928 | Bacteria | 3092 |
| 668 | Ga0207700_10099449 | 3300025928 | Bacteria | 2316 |
| 669 | Ga0207700_10117337 | 3300025928 | Bacteria | 2152 |
| 670 | Ga0207700_10233831 | 3300025928 | Bacteria | 1564 |
| 671 | Ga0207700_10249064 | 3300025928 | Bacteria | 1517 |
| 672 | Ga0207664_10018321 | 3300025929 | Bacteria | 5152 |
| 673 | Ga0207664_10104239 | 3300025929 | Bacteria | 2348 |
| 674 | Ga0207664_10145841 | 3300025929 | Bacteria | 2007 |
| 675 | Ga0207664_10231379 | 3300025929 | Bacteria | 1607 |
| 676 | Ga0207664_10725311 | 3300025929 | Bacteria | 894 |
| 677 | Ga0207644_10414810 | 3300025931 | Bacteria | 1102 |
| 678 | Ga0207644_10881724 | 3300025931 | Bacteria | 750 |
| 679 | Ga0207690_10019600 | 3300025932 | Bacteria | 4169 |
| 680 | Ga0207690_10695748 | 3300025932 | Bacteria | 835 |
| 681 | Ga0207706_10047908 | 3300025933 | Bacteria | 3780 |
| 682 | Ga0207706_10358299 | 3300025933 | Bacteria | 1267 |
| 683 | Ga0207706_11574436 | 3300025933 | Bacteria | 533 |
| 684 | Ga0207686_10230613 | 3300025934 | Bacteria | 1342 |
| 685 | Ga0207686_10308337 | 3300025934 | Bacteria | 1178 |
| 686 | Ga0207709_10071831 | 3300025935 | Bacteria | 2199 |
| 687 | Ga0207709_10506401 | 3300025935 | Bacteria | 943 |
| 688 | Ga0207709_11820810 | 3300025935 | Bacteria | 506 |
| 689 | Ga0207670_10058725 | 3300025936 | Bacteria | 2614 |
| 690 | Ga0207670_10115792 | 3300025936 | Bacteria | 1940 |
| 691 | Ga0207670_10173635 | 3300025936 | Bacteria | 1618 |
| 692 | Ga0207670_10223015 | 3300025936 | Bacteria | 1444 |
| 693 | Ga0207670_10393335 | 3300025936 | Bacteria | 1107 |
| 694 | Ga0207670_11664827 | 3300025936 | Bacteria | 543 |
| 695 | Ga0207669_10153160 | 3300025937 | Bacteria | 1618 |
| 696 | Ga0207669_10253231 | 3300025937 | Bacteria | 1312 |
| 697 | Ga0207669_11961854 | 3300025937 | Bacteria | 500 |
| 698 | Ga0207704_10548350 | 3300025938 | Bacteria | 939 |
| 699 | Ga0207704_10963653 | 3300025938 | Unclassified | 720 |
| 700 | Ga0207704_11566462 | 3300025938 | Bacteria | 566 |
| 701 | Ga0207665_10519596 | 3300025939 | Bacteria | 922 |
| 702 | Ga0207665_11231095 | 3300025939 | Bacteria | 597 |
| 703 | Ga0207691_10022379 | 3300025940 | Bacteria | 5961 |
| 704 | Ga0207691_10048272 | 3300025940 | Bacteria | 3904 |
| 705 | Ga0207691_10943404 | 3300025940 | Bacteria | 721 |
| 706 | Ga0207691_10952283 | 3300025940 | Bacteria | 717 |
| 707 | Ga0207711_10012928 | 3300025941 | Bacteria | 6934 |
| 708 | Ga0207711_10243288 | 3300025941 | Bacteria | 1650 |
| 709 | Ga0207711_12015424 | 3300025941 | Bacteria | 520 |
| 710 | Ga0207689_10000171 | 3300025942 | Bacteria | 56716 |
| 711 | Ga0207689_10676285 | 3300025942 | Bacteria | 870 |
| 712 | Ga0207661_10012723 | 3300025944 | Bacteria | 6129 |
| 713 | Ga0207661_10164372 | 3300025944 | Bacteria | 1927 |
| 714 | Ga0207661_10481810 | 3300025944 | Bacteria | 1132 |
| 715 | Ga0207661_10490613 | 3300025944 | Bacteria | 1122 |
| 716 | Ga0207661_10583060 | 3300025944 | Bacteria | 1026 |
| 717 | Ga0207661_10939988 | 3300025944 | Bacteria | 796 |
| 718 | Ga0207661_11011652 | 3300025944 | Bacteria | 765 |
| 719 | Ga0207661_12063635 | 3300025944 | Bacteria | 516 |
| 720 | Ga0207679_10034445 | 3300025945 | Bacteria | 3572 |
| 721 | Ga0207679_10244466 | 3300025945 | Bacteria | 1522 |
| 722 | Ga0207679_10249924 | 3300025945 | Bacteria | 1507 |
| 723 | Ga0207679_10349056 | 3300025945 | Bacteria | 1289 |
| 724 | Ga0207679_10695184 | 3300025945 | Bacteria | 922 |
| 725 | Ga0207667_10109147 | 3300025949 | Bacteria | 2854 |
| 726 | Ga0207667_10119359 | 3300025949 | Bacteria | 2718 |
| 727 | Ga0207667_10242401 | 3300025949 | Bacteria | 1844 |
| 728 | Ga0207667_10351611 | 3300025949 | Bacteria | 1503 |
| 729 | Ga0207667_10697254 | 3300025949 | Bacteria | 1018 |
| 730 | Ga0207651_10230043 | 3300025960 | Bacteria | 1504 |
| 731 | Ga0207651_10323237 | 3300025960 | Bacteria | 1290 |
| 732 | Ga0207651_11298725 | 3300025960 | Bacteria | 654 |
| 733 | Ga0207651_11465163 | 3300025960 | Bacteria | 615 |
| 734 | Ga0207651_11666480 | 3300025960 | Bacteria | 574 |
| 735 | Ga0207712_10238114 | 3300025961 | Bacteria | 1465 |
| 736 | Ga0207712_11345480 | 3300025961 | Bacteria | 639 |
| 737 | Ga0207668_10175746 | 3300025972 | Unclassified | 1684 |
| 738 | Ga0207668_10662468 | 3300025972 | Bacteria | 914 |
| 739 | Ga0207668_11229596 | 3300025972 | Bacteria | 673 |
| 740 | Ga0207668_11542490 | 3300025972 | Bacteria | 600 |
| 741 | Ga0207668_11905472 | 3300025972 | Bacteria | 536 |
| 742 | Ga0207640_10121501 | 3300025981 | Bacteria | 1872 |
| 743 | Ga0207640_10404867 | 3300025981 | Bacteria | 1112 |
| 744 | Ga0207640_11457509 | 3300025981 | Bacteria | 614 |
| 745 | Ga0207658_10036473 | 3300025986 | Bacteria | 3525 |
| 746 | Ga0207658_10461656 | 3300025986 | Unclassified | 1126 |
| 747 | Ga0207658_10569621 | 3300025986 | Bacteria | 1015 |
| 748 | Ga0207677_10165314 | 3300026023 | Bacteria | 1724 |
| 749 | Ga0207677_10977633 | 3300026023 | Bacteria | 767 |
| 750 | Ga0207677_11645097 | 3300026023 | Bacteria | 595 |
| 751 | Ga0207703_10000464 | 3300026035 | Bacteria | 42704 |
| 752 | Ga0207703_10461782 | 3300026035 | Bacteria | 1188 |
| 753 | Ga0207703_10480171 | 3300026035 | Bacteria | 1164 |
| 754 | Ga0207703_10495105 | 3300026035 | Bacteria | 1147 |
| 755 | Ga0207703_10583978 | 3300026035 | Bacteria | 1056 |
| 756 | Ga0207703_11657165 | 3300026035 | Bacteria | 615 |
| 757 | Ga0207703_11948419 | 3300026035 | Unclassified | 564 |
| 758 | Ga0207703_12285119 | 3300026035 | Bacteria | 517 |
| 759 | Ga0207639_10079336 | 3300026041 | Bacteria | 2594 |
| 760 | Ga0207639_10156367 | 3300026041 | Bacteria | 1916 |
| 761 | Ga0207639_10225846 | 3300026041 | Bacteria | 1620 |
| 762 | Ga0207639_10496085 | 3300026041 | Bacteria | 1115 |
| 763 | Ga0207639_10662177 | 3300026041 | Bacteria | 966 |
| 764 | Ga0207639_11338573 | 3300026041 | Bacteria | 672 |
| 765 | Ga0207678_11015145 | 3300026067 | Bacteria | 734 |
| 766 | Ga0207708_10456892 | 3300026075 | Bacteria | 1065 |
| 767 | Ga0207708_11873678 | 3300026075 | Bacteria | 526 |
| 768 | Ga0207702_10086799 | 3300026078 | Bacteria | 2729 |
| 769 | Ga0207702_10248372 | 3300026078 | Bacteria | 1670 |
| 770 | Ga0207702_10510534 | 3300026078 | Bacteria | 1172 |
| 771 | Ga0207702_10933250 | 3300026078 | Bacteria | 860 |
| 772 | Ga0207702_11711522 | 3300026078 | Bacteria | 622 |
| 773 | Ga0207702_12170194 | 3300026078 | Bacteria | 544 |
| 774 | Ga0207641_10032716 | 3300026088 | Bacteria | 4319 |
| 775 | Ga0207641_10033949 | 3300026088 | Bacteria | 4241 |
| 776 | Ga0207641_11589305 | 3300026088 | Bacteria | 656 |
| 777 | Ga0207641_11887704 | 3300026088 | Bacteria | 599 |
| 778 | Ga0207648_10004075 | 3300026089 | Bacteria | 15150 |
| 779 | Ga0207648_10244203 | 3300026089 | Bacteria | 1599 |
| 780 | Ga0207648_10321347 | 3300026089 | Unclassified | 1391 |
| 781 | Ga0207648_10384967 | 3300026089 | Bacteria | 1269 |
| 782 | Ga0207648_10817150 | 3300026089 | Bacteria | 868 |
| 783 | Ga0207676_10016916 | 3300026095 | Bacteria | 5280 |
| 784 | Ga0207676_10785895 | 3300026095 | Bacteria | 928 |
| 785 | Ga0207676_10840074 | 3300026095 | Bacteria | 898 |
| 786 | Ga0207676_11028923 | 3300026095 | Bacteria | 812 |
| 787 | Ga0207676_11782465 | 3300026095 | Bacteria | 614 |
| 788 | Ga0207674_10003778 | 3300026116 | Bacteria | 18471 |
| 789 | Ga0207674_10009315 | 3300026116 | Bacteria | 11243 |
| 790 | Ga0207674_10019754 | 3300026116 | Bacteria | 7291 |
| 791 | Ga0207674_10122256 | 3300026116 | Bacteria | 2569 |
| 792 | Ga0207674_10540826 | 3300026116 | Bacteria | 1125 |
| 793 | Ga0207674_10965182 | 3300026116 | Bacteria | 821 |
| 794 | Ga0207674_12226465 | 3300026116 | Bacteria | 511 |
| 795 | Ga0207675_100013122 | 3300026118 | Bacteria | 7732 |
| 796 | Ga0207675_100640535 | 3300026118 | Bacteria | 1068 |
| 797 | Ga0207675_100661262 | 3300026118 | Bacteria | 1051 |
| 798 | Ga0207675_100745497 | 3300026118 | Bacteria | 990 |
| 799 | Ga0207675_101118784 | 3300026118 | Bacteria | 807 |
| 800 | Ga0207675_102121635 | 3300026118 | Unclassified | 578 |
| 801 | Ga0207675_102568518 | 3300026118 | Bacteria | 519 |
| 802 | Ga0207683_10064958 | 3300026121 | Bacteria | 3217 |
| 803 | Ga0207683_10177746 | 3300026121 | Bacteria | 1929 |
| 804 | Ga0207683_10557105 | 3300026121 | Bacteria | 1060 |
| 805 | Ga0207683_10762643 | 3300026121 | Bacteria | 898 |
| 806 | Ga0207698_10018429 | 3300026142 | Bacteria | 4756 |
| 807 | Ga0207698_10103163 | 3300026142 | Bacteria | 2370 |
| 808 | Ga0207698_11308132 | 3300026142 | Bacteria | 740 |
| 809 | Ga0207698_11684942 | 3300026142 | Bacteria | 649 |
| 810 | Ga0207698_12005545 | 3300026142 | Unclassified | 593 |
| 811 | Ga0207698_12343020 | 3300026142 | Bacteria | 545 |
| 812 | Ga0207698_12527861 | 3300026142 | Bacteria | 524 |
| 813 | Ga0209588_1033693 | 3300027671 | Bacteria | 1643 |
| 814 | Ga0209588_1075701 | 3300027671 | Bacteria | 1087 |
| 815 | Ga0209813_10238556 | 3300027866 | Bacteria | 687 |
| 816 | Ga0207428_10016765 | 3300027907 | Bacteria | 6299 |
| 817 | Ga0207428_10021763 | 3300027907 | Bacteria | 5424 |
| 818 | Ga0207428_10031923 | 3300027907 | Bacteria | 4337 |
| 819 | Ga0207428_10526169 | 3300027907 | Bacteria | 857 |
| 820 | Ga0207428_10851416 | 3300027907 | Bacteria | 646 |
| 821 | Ga0268266_10005904 | 3300028379 | Bacteria | 11330 |
| 822 | Ga0268266_10066473 | 3300028379 | Bacteria | 3119 |
| 823 | Ga0268266_10092860 | 3300028379 | Bacteria | 2648 |
| 824 | Ga0268266_10538458 | 3300028379 | Bacteria | 1118 |
| 825 | Ga0268266_11217490 | 3300028379 | Bacteria | 728 |
| 826 | Ga0268266_11788426 | 3300028379 | Bacteria | 589 |
| 827 | Ga0268266_12350540 | 3300028379 | Bacteria | 504 |
| 828 | Ga0268265_10011945 | 3300028380 | Bacteria | 5875 |
| 829 | Ga0268265_10220537 | 3300028380 | Bacteria | 1659 |
| 830 | Ga0268265_10303297 | 3300028380 | Bacteria | 1439 |
| 831 | Ga0268265_10465074 | 3300028380 | Bacteria | 1184 |
| 832 | Ga0268265_10488372 | 3300028380 | Bacteria | 1158 |
| 833 | Ga0268265_12412420 | 3300028380 | Bacteria | 532 |
| 834 | Ga0268265_12585260 | 3300028380 | Bacteria | 513 |
| 835 | Ga0268264_10000084 | 3300028381 | Bacteria | 242128 |
| 836 | Ga0268264_10001515 | 3300028381 | Bacteria | 21648 |
| 837 | Ga0268264_10642713 | 3300028381 | Bacteria | 1049 |
| 838 | Ga0268264_11413595 | 3300028381 | Bacteria | 706 |
| 839 | Ga0268264_11735814 | 3300028381 | Bacteria | 634 |
| 840 | Ga0268264_11892679 | 3300028381 | Bacteria | 606 |
| 841 | Ga0307517_10578289 | 3300028786 | Bacteria | 557 |
| 842 | Ga0265338_10114917 | 3300028800 | Bacteria | 2159 |
| 843 | Ga0265338_10613556 | 3300028800 | Unclassified | 757 |
| 844 | Ga0265338_10668674 | 3300028800 | Bacteria | 719 |
| 845 | Ga0265324_10006763 | 3300029957 | Bacteria | 4732 |
| 846 | Ga0307511_10052815 | 3300030521 | Bacteria | 3232 |
| 847 | Ga0265328_10003733 | 3300031239 | Bacteria | 6711 |
| 848 | Ga0265328_10098047 | 3300031239 | Bacteria | 1085 |
| 849 | Ga0265325_10024269 | 3300031241 | Bacteria | 3301 |
| 850 | Ga0265325_10095155 | 3300031241 | Bacteria | 1464 |
| 851 | Ga0265325_10111380 | 3300031241 | Bacteria | 1330 |
| 852 | Ga0265340_10303826 | 3300031247 | Bacteria | 707 |
| 853 | Ga0265339_10044955 | 3300031249 | Bacteria | 2433 |
| 854 | Ga0265339_10226916 | 3300031249 | Bacteria | 911 |
| 855 | Ga0265331_10000247 | 3300031250 | Bacteria | 64888 |
| 856 | Ga0265331_10036305 | 3300031250 | Bacteria | 2420 |
| 857 | Ga0265331_10112612 | 3300031250 | Bacteria | 1247 |
| 858 | Ga0265327_10023457 | 3300031251 | Bacteria | 3654 |
| 859 | Ga0265316_10209861 | 3300031344 | Bacteria | 1441 |
| 860 | Ga0265316_10317948 | 3300031344 | Bacteria | 1131 |
| 861 | Ga0307509_10153689 | 3300031507 | Bacteria | 2211 |
| 862 | Ga0307509_10484231 | 3300031507 | Bacteria | 924 |
| 863 | Ga0307509_10693014 | 3300031507 | Bacteria | 685 |
| 864 | Ga0307408_100144864 | 3300031548 | Bacteria | 1869 |
| 865 | Ga0265313_10231007 | 3300031595 | Bacteria | 760 |
| 866 | Ga0307508_10000105 | 3300031616 | Bacteria | 99107 |
| 867 | Ga0307508_10239342 | 3300031616 | Bacteria | 1412 |
| 868 | Ga0307508_10432899 | 3300031616 | Bacteria | 907 |
| 869 | Ga0265314_10130504 | 3300031711 | Bacteria | 1568 |
| 870 | Ga0265314_10193618 | 3300031711 | Bacteria | 1208 |
| 871 | Ga0265342_10140469 | 3300031712 | Bacteria | 1347 |
| 872 | Ga0316578_10334185 | 3300031728 | Bacteria | 903 |
| 873 | Ga0307516_10670925 | 3300031730 | Bacteria | 692 |
| 874 | Ga0307405_10237908 | 3300031731 | Bacteria | 1347 |
| 875 | Ga0307413_11211737 | 3300031824 | Bacteria | 657 |
| 876 | Ga0307406_10579121 | 3300031901 | Bacteria | 922 |
| 877 | Ga0307416_100346498 | 3300032002 | Bacteria | 1501 |
| 878 | Ga0307411_11982867 | 3300032005 | Bacteria | 543 |
| 879 | Ga0307415_102194505 | 3300032126 | Bacteria | 540 |
| 880 | Ga0307510_10303858 | 3300033180 | Bacteria | 1057 |
| 881 | Ga0316215_1016362 | 3300033544 | Bacteria | 746 |
| 882 | Ga0373950_0063721 | 3300034818 | Bacteria | 744 |
| 883 | Ga0373959_0125493 | 3300034820 | Bacteria | 631 |
| 884 | Ga0373938_0002387 | 3300034957 | Bacteria | 3024 |
| 885 | Ga0373938_0115185 | 3300034957 | Bacteria | 688 |
| 886 | Ga0373926_0026586 | 3300035083 | Bacteria | 2025 |
| 887 | Ga0373928_0067222 | 3300035084 | Bacteria | 879 |
| 888 | Ga0373929_0029597 | 3300035085 | Bacteria | 1163 |
| 889 | Ga0373929_0146869 | 3300035085 | Bacteria | 630 |
| 890 | Ga0373929_0188123 | 3300035085 | Bacteria | 573 |
| 891 | Ga0373934_0015167 | 3300035086 | Bacteria | 2921 |
| 892 | Ga0373934_0135409 | 3300035086 | Bacteria | 1006 |
| 893 | Ga0373940_0336563 | 3300035088 | Bacteria | 527 |
| 894 | Ga0373944_0018895 | 3300035089 | Bacteria | 1973 |
| 895 | Ga0373949_0050956 | 3300035090 | Bacteria | 1043 |
| 896 | Ga0373951_0030626 | 3300035091 | Bacteria | 1267 |
| 897 | Ga0373951_0134474 | 3300035091 | Bacteria | 682 |
| 898 | Ga0373952_0215162 | 3300035092 | Bacteria | 568 |
| 899 | Ga0373923_0029232 | 3300035111 | Bacteria | 2208 |
| 900 | Ga0373923_0103330 | 3300035111 | Bacteria | 1259 |
| 901 | Ga0373923_0234032 | 3300035111 | Bacteria | 856 |
| 902 | Ga0373932_0273949 | 3300035112 | Bacteria | 622 |
| 903 | Ga0373936_0076639 | 3300035113 | Bacteria | 1386 |
| 904 | Ga0373936_0087248 | 3300035113 | Bacteria | 1305 |
| 905 | Ga0373936_0127000 | 3300035113 | Bacteria | 1093 |
| 906 | Ga0373936_0160980 | 3300035113 | Bacteria | 978 |
| 907 | Ga0373936_0200801 | 3300035113 | Bacteria | 880 |
| 908 | Ga0373939_0062831 | 3300035114 | Bacteria | 1188 |
| 909 | Ga0373939_0166417 | 3300035114 | Bacteria | 813 |
| 910 | Ga0373939_0185760 | 3300035114 | Bacteria | 778 |
| 911 | Ga0373941_0069709 | 3300035115 | Bacteria | 1164 |
| 912 | Ga0373941_0079932 | 3300035115 | Bacteria | 1102 |
| 913 | Ga0373941_0138650 | 3300035115 | Bacteria | 883 |
| 914 | Ga0373941_0434345 | 3300035115 | Bacteria | 548 |
| 915 | Ga0373945_0135627 | 3300035116 | Bacteria | 989 |
| 916 | Ga0373945_0185044 | 3300035116 | Bacteria | 859 |
| 917 | Ga0373953_0104021 | 3300035117 | Bacteria | 1197 |
| 918 | Ga0373953_0183285 | 3300035117 | Bacteria | 903 |
| 919 | Ga0373954_0034467 | 3300035118 | Bacteria | 2345 |
| 920 | Ga0373954_0053703 | 3300035118 | Bacteria | 1894 |
| 921 | Ga0373954_0676560 | 3300035118 | Bacteria | 512 |
| 922 | Ga0373956_0107278 | 3300035119 | Bacteria | 1298 |
| 923 | Ga0373956_0121293 | 3300035119 | Bacteria | 1221 |
| 924 | Ga0373957_0301896 | 3300035120 | Bacteria | 679 |
| 925 | Ga0373957_0353780 | 3300035120 | Bacteria | 628 |
| 926 | Ga0373960_0052412 | 3300035121 | Bacteria | 1214 |
| 927 | Ga0373960_0351672 | 3300035121 | Bacteria | 559 |
| 928 | Ga0373943_0056320 | 3300035170 | Bacteria | 1951 |
| 929 | Ga0373943_0121832 | 3300035170 | Bacteria | 1386 |
| 930 | Ga0373943_0310015 | 3300035170 | Bacteria | 898 |
| 931 | Ga0373946_0047551 | 3300035171 | Bacteria | 1782 |
| 932 | Ga0373946_0283397 | 3300035171 | Bacteria | 816 |
| 933 | Ga0373955_0059090 | 3300035172 | Bacteria | 2111 |
| 934 | Ga0373942_0386317 | 3300035207 | Bacteria | 500 |
| 935 | Ga0373961_0011686 | 3300035241 | Bacteria | 2182 |
| 936 | Ga0373961_0013644 | 3300035241 | Bacteria | 2052 |
| 937 | Ga0373961_0069950 | 3300035241 | Bacteria | 1084 |
| 938 | Ga0373962_0022174 | 3300035242 | Bacteria | 1681 |
| 939 | Ga0373962_0028668 | 3300035242 | Bacteria | 1512 |
| 940 | Ga0373924_0306384 | 3300035410 | Bacteria | 705 |
| 941 | Ga0373931_0000317 | 3300035691 | Bacteria | 20240 |
| 942 | Ga0373931_0004056 | 3300035691 | Bacteria | 6640 |
| 943 | Ga0373931_0193823 | 3300035691 | Bacteria | 1210 |
| 944 | Ga0373931_0223543 | 3300035691 | Bacteria | 1135 |
| 945 | Ga0373931_0496027 | 3300035691 | Bacteria | 787 |
| 946 | Ga0373931_0517315 | 3300035691 | Bacteria | 772 |
| 947 | Ga0373935_0101455 | 3300035692 | Bacteria | 1898 |
| 948 | Ga0373935_0136231 | 3300035692 | Bacteria | 1654 |
| 949 | Ga0373935_0166266 | 3300035692 | Bacteria | 1506 |
| 950 | Ga0373935_0544927 | 3300035692 | Bacteria | 845 |
| 951 | Ga0373935_0614359 | 3300035692 | Bacteria | 796 |
| 952 | Ga0373935_0948113 | 3300035692 | Bacteria | 638 |
| 953 | Ga0373935_1096472 | 3300035692 | Bacteria | 592 |
| 954 | Ga0373927_0024147 | 3300035695 | Bacteria | 3977 |
| 955 | Ga0373927_0116454 | 3300035695 | Bacteria | 1743 |
| 956 | Ga0373927_0153953 | 3300035695 | Bacteria | 1505 |
| 957 | Ga0373927_0292335 | 3300035695 | Bacteria | 1072 |
| 958 | Ga0373927_0312442 | 3300035695 | Bacteria | 1034 |
| 959 | Ga0373927_0578213 | 3300035695 | Bacteria | 742 |
| 960 | Ga0373927_0858655 | 3300035695 | Bacteria | 599 |
| 961 | Ga0373933_0017280 | 3300035724 | Bacteria | 4045 |
| 962 | Ga0373933_0087473 | 3300035724 | Bacteria | 1919 |
| 963 | Ga0373933_0884186 | 3300035724 | Bacteria | 588 |
| 964 | Ga0373947_0024091 | 3300035725 | Bacteria | 3544 |
| 965 | Ga0373947_0038743 | 3300035725 | Unclassified | 2834 |
| 966 | Ga0373947_0052625 | 3300035725 | Bacteria | 2453 |
| 967 | Ga0373947_0086745 | 3300035725 | Bacteria | 1946 |
| 968 | Ga0373947_0356324 | 3300035725 | Bacteria | 982 |
| 969 | Ga0373947_0664591 | 3300035725 | Bacteria | 711 |
| 970 | Ga0373937_0108821 | 3300036401 | Bacteria | 2577 |
| 971 | Ga0373937_0118391 | 3300036401 | Bacteria | 2467 |
| 972 | Ga0373937_0162129 | 3300036401 | Bacteria | 2096 |
| 973 | Ga0373937_0227375 | 3300036401 | Bacteria | 1756 |
| 974 | Ga0372808_001897 | 3300036459 | Bacteria | 2298 |
| 975 | Ga0373925_0042688 | 3300037068 | Bacteria | 3365 |
| 976 | Ga0373925_0075212 | 3300037068 | Bacteria | 2559 |
| 977 | Ga0373925_0077433 | 3300037068 | Bacteria | 2524 |
| 978 | Ga0373925_0079553 | 3300037068 | Bacteria | 2491 |
| 979 | Ga0373925_0112578 | 3300037068 | Bacteria | 2104 |
| 980 | Ga0373925_0491133 | 3300037068 | Bacteria | 1007 |
| 981 | Ga0373925_0708989 | 3300037068 | Bacteria | 829 |
| 982 | Ga0373925_0845393 | 3300037068 | Bacteria | 754 |
| 983 | Ga0395899_0002162 | 3300037312 | Bacteria | 16144 |
| 984 | Ga0395899_0021402 | 3300037312 | Bacteria | 4904 |
| 985 | Ga0395899_0302544 | 3300037312 | Bacteria | 1082 |
| 986 | Ga0395900_0004853 | 3300037418 | Bacteria | 14164 |
| 987 | Ga0395900_0005904 | 3300037418 | Bacteria | 12783 |
| 988 | Ga0395900_0064978 | 3300037418 | Bacteria | 3748 |
| 989 | Ga0395900_0240772 | 3300037418 | Bacteria | 1815 |
| 990 | Ga0395900_1047689 | 3300037418 | Bacteria | 734 |
| 991 | Ga0395898_0012089 | 3300037466 | Bacteria | 8938 |
| 992 | Ga0395898_0149599 | 3300037466 | Bacteria | 2234 |
| 993 | Ga0395898_0162409 | 3300037466 | Bacteria | 2137 |
| 994 | Ga0395905_0180874 | 3300037471 | Bacteria | 1980 |
| 995 | Ga0436364_0574078 | 3300037853 | Bacteria | 808 |
| 996 | Ga0436364_1015918 | 3300037853 | Bacteria | 632 |
| 997 | Ga0395901_0040678 | 3300038443 | Bacteria | 4815 |
| 998 | Ga0395901_0139607 | 3300038443 | Bacteria | 2547 |
| 999 | Ga0395901_0148919 | 3300038443 | Bacteria | 2460 |
| 1000 | Ga0395901_0195047 | 3300038443 | Bacteria | 2123 |
| 1001 | Ga0395901_0381956 | 3300038443 | Bacteria | 1449 |
| 1002 | Ga0436365_0368730 | 3300039437 | Bacteria | 2426 |
| 1003 | Ga0436365_0622183 | 3300039437 | Bacteria | 2404 |
| 1004 | Ga0436365_0820984 | 3300039437 | Bacteria | 1334 |
| 1005 | Ga0436365_0869883 | 3300039437 | Bacteria | 610 |
| 1006 | Ga0436365_0920296 | 3300039437 | Bacteria | 719 |
| 1007 | Ga0436365_1044564 | 3300039437 | Bacteria | 888 |
| 1008 | Ga0436365_1545720 | 3300039437 | Bacteria | 804 |
| 1009 | Ga0436365_1547297 | 3300039437 | Bacteria | 2194 |
| 1010 | Ga0436365_1649599 | 3300039437 | Bacteria | 1272 |
| 1011 | Ga0436365_1722483 | 3300039437 | Bacteria | 826 |
| 1012 | Ga0436360_0542064 | 3300039438 | Bacteria | 900 |
| 1013 | Ga0436360_0826367 | 3300039438 | Bacteria | 502 |
| 1014 | Ga0436360_1024581 | 3300039438 | Bacteria | 573 |
| 1015 | Ga0436360_1144799 | 3300039438 | Bacteria | 2164 |
| 1016 | Ga0436361_0035526 | 3300039447 | Bacteria | 683 |
| 1017 | Ga0436361_0175551 | 3300039447 | Bacteria | 3548 |
| 1018 | Ga0436361_0683077 | 3300039447 | Bacteria | 969 |
| 1019 | Ga0436361_0984910 | 3300039447 | Unclassified | 636 |
| 1020 | Ga0436361_1160036 | 3300039447 | Bacteria | 961 |
| 1021 | Ga0436363_0402227 | 3300039450 | Bacteria | 660 |
| 1022 | Ga0436363_0461653 | 3300039450 | Bacteria | 4929 |
| 1023 | Ga0436363_1236422 | 3300039450 | Bacteria | 1639 |
| 1024 | Ga0436363_1265235 | 3300039450 | Bacteria | 1084 |
| 1025 | Ga0436362_0026859 | 3300039453 | Bacteria | 692 |
| 1026 | Ga0436362_0272131 | 3300039453 | Bacteria | 877 |
| 1027 | Ga0436362_0339798 | 3300039453 | Bacteria | 615 |
| 1028 | Ga0436362_0965633 | 3300039453 | Bacteria | 626 |
| 1029 | Ga0439447_053466 | 3300041407 | Bacteria | 960 |
| 1030 | Ga0439466_0108367 | 3300041411 | Bacteria | 863 |
| 1031 | Ga0439465_0072857 | 3300041413 | Bacteria | 1153 |
| 1032 | Ga0451789_1040744 | 3300041443 | Bacteria | 1076 |
| 1033 | Ga0451793_1111873 | 3300041452 | Bacteria | 766 |
| 1034 | Ga0451797_1343343 | 3300041453 | Bacteria | 597 |
| 1035 | Ga0451795_1639049 | 3300041456 | Bacteria | 737 |
| 1036 | Ga0451800_0546300 | 3300041459 | Bacteria | 591 |
| 1037 | Ga0451804_0238532 | 3300041463 | Bacteria | 605 |
| 1038 | Ga0451807_1577102 | 3300041486 | Bacteria | 511 |
| 1039 | Ga0451807_1819751 | 3300041486 | Bacteria | 603 |
| 1040 | Ga0451839_0668696 | 3300041496 | Bacteria | 550 |
| 1041 | Ga0451849_0120354 | 3300041505 | Bacteria | 597 |
| 1042 | Ga0451849_0905281 | 3300041505 | Bacteria | 961 |
| 1043 | Ga0451853_1687619 | 3300041512 | Bacteria | 504 |
| 1044 | Ga0451853_2022784 | 3300041512 | Bacteria | 653 |
| 1045 | Ga0439441_078718 | 3300042001 | Bacteria | 715 |
| 1046 | Ga0439442_110396 | 3300042002 | Bacteria | 599 |
| 1047 | Ga0439442_144014 | 3300042002 | Bacteria | 528 |
| 1048 | Ga0439445_0094973 | 3300042004 | Bacteria | 842 |
| 1049 | Ga0439432_209705 | 3300042006 | Bacteria | 564 |
| 1050 | Ga0439434_0269612 | 3300042435 | Bacteria | 585 |
| 1051 | Ga0439435_0075194 | 3300042436 | Bacteria | 1006 |
| 1052 | Ga0439459_0003070 | 3300042438 | Bacteria | 2623 |
| 1053 | Ga0439459_0062672 | 3300042438 | Bacteria | 843 |
| 1054 | Ga0439464_0163929 | 3300042439 | Bacteria | 699 |
| 1055 | Ga0450893_0099443 | 3300042532 | Bacteria | 591 |
| 1056 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 1057 | Ga0451577_0132183 | 3300042876 | Bacteria | 2239 |
| 1058 | Ga0451577_0193602 | 3300042876 | Bacteria | 1834 |
| 1059 | Ga0451577_0209539 | 3300042876 | Bacteria | 1760 |
| 1060 | Ga0451577_0292611 | 3300042876 | Bacteria | 1476 |
| 1061 | Ga0466972_0506264 | 3300044658 | Bacteria | 569 |
| 1062 | Ga0453683_0006182 | 3300044673 | Bacteria | 8240 |
| 1063 | Ga0453683_0015557 | 3300044673 | Bacteria | 4924 |
| 1064 | Ga0466966_0894995 | 3300044684 | Bacteria | 535 |
| 1065 | Ga0466961_0086598 | 3300044693 | Bacteria | 1980 |
| 1066 | Ga0466963_0021148 | 3300044694 | Bacteria | 4100 |
| 1067 | Ga0466963_0080570 | 3300044694 | Bacteria | 2204 |
| 1068 | Ga0466963_0728197 | 3300044694 | Bacteria | 700 |
| 1069 | Ga0466964_0242465 | 3300044706 | Bacteria | 885 |
| 1070 | Ga0453684_0000015 | 3300044712 | Bacteria | 969198 |
| 1071 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 1072 | Ga0453684_0020836 | 3300044712 | Bacteria | 9849 |
| 1073 | Ga0453684_0517058 | 3300044712 | Bacteria | 1319 |
| 1074 | Ga0466968_0312566 | 3300044735 | Bacteria | 758 |
| 1075 | Ga0466968_0409195 | 3300044735 | Bacteria | 666 |
| 1076 | Ga0466968_0640833 | 3300044735 | Bacteria | 539 |
| 1077 | Ga0466957_0019808 | 3300044842 | Bacteria | 3960 |
| 1078 | Ga0451576_0000203 | 3300045051 | Bacteria | 149655 |
| 1079 | Ga0451576_0000863 | 3300045051 | Bacteria | 58426 |
| 1080 | Ga0451576_0003091 | 3300045051 | Bacteria | 23347 |
| 1081 | Ga0451576_0352313 | 3300045051 | Bacteria | 1541 |
| 1082 | Ga0451576_0514088 | 3300045051 | Bacteria | 1258 |
| 1083 | Ga0451576_2281211 | 3300045051 | Bacteria | 555 |
| 1084 | Ga0451576_2683832 | 3300045051 | Bacteria | 507 |
| 1085 | Ga0466967_0002809 | 3300045976 | Bacteria | 11043 |
| 1086 | Ga0466967_0444622 | 3300045976 | Bacteria | 1266 |
| 1087 | Ga0466967_0943300 | 3300045976 | Bacteria | 859 |
| 1088 | Ga0466967_1480479 | 3300045976 | Bacteria | 676 |
| 1089 | Ga0466967_1543262 | 3300045976 | Bacteria | 661 |
| 1090 | Ga0466967_2140231 | 3300045976 | Bacteria | 556 |
| 1091 | Ga0466967_2334817 | 3300045976 | Bacteria | 530 |
| 1092 | Ga0495603_0100902 | 3300046455 | Bacteria | 1685 |
| 1093 | Ga0495590_0130756 | 3300046457 | Bacteria | 903 |
| 1094 | Ga0495629_0104690 | 3300046459 | Bacteria | 1974 |
| 1095 | Ga0495629_0624215 | 3300046459 | Bacteria | 719 |
| 1096 | Ga0495638_0177511 | 3300046460 | Bacteria | 1218 |
| 1097 | Ga0495638_0306213 | 3300046460 | Bacteria | 854 |
| 1098 | Ga0495638_0312985 | 3300046460 | Bacteria | 842 |
| 1099 | Ga0495651_0742602 | 3300046462 | Bacteria | 609 |
| 1100 | Ga0495653_0101144 | 3300046463 | Bacteria | 2089 |
| 1101 | Ga0495653_0165483 | 3300046463 | Bacteria | 1531 |
| 1102 | Ga0495580_0013706 | 3300046472 | Bacteria | 6175 |
| 1103 | Ga0495580_0329207 | 3300046472 | Bacteria | 1037 |
| 1104 | Ga0495580_0884977 | 3300046472 | Bacteria | 575 |
| 1105 | Ga0495580_0941935 | 3300046472 | Bacteria | 553 |
| 1106 | Ga0495580_1013166 | 3300046472 | Bacteria | 529 |
| 1107 | Ga0495582_0046171 | 3300046473 | Bacteria | 2399 |
| 1108 | Ga0495582_0310633 | 3300046473 | Bacteria | 907 |
| 1109 | Ga0495605_0392253 | 3300046474 | Bacteria | 578 |
| 1110 | Ga0495639_0110802 | 3300046475 | Bacteria | 1302 |
| 1111 | Ga0495662_0010302 | 3300046476 | Bacteria | 4582 |
| 1112 | Ga0495662_0382379 | 3300046476 | Bacteria | 691 |
| 1113 | Ga0495664_0014771 | 3300046477 | Bacteria | 4432 |
| 1114 | Ga0495664_0113036 | 3300046477 | Bacteria | 1640 |
| 1115 | Ga0495664_0201077 | 3300046477 | Bacteria | 1207 |
| 1116 | Ga0495664_0383713 | 3300046477 | Bacteria | 844 |
| 1117 | Ga0495584_0381930 | 3300046491 | Bacteria | 716 |
| 1118 | Ga0495594_0255209 | 3300046499 | Bacteria | 999 |
| 1119 | Ga0495606_0105987 | 3300046507 | Bacteria | 1703 |
| 1120 | Ga0495608_0055390 | 3300046511 | Bacteria | 2621 |
| 1121 | Ga0495618_0274332 | 3300046514 | Bacteria | 1053 |
| 1122 | Ga0495628_0509100 | 3300046516 | Bacteria | 868 |
| 1123 | Ga0495630_0040788 | 3300046517 | Bacteria | 3468 |
| 1124 | Ga0495630_0608366 | 3300046517 | Bacteria | 838 |
| 1125 | Ga0495630_0711827 | 3300046517 | Bacteria | 768 |
| 1126 | Ga0495630_0909152 | 3300046517 | Bacteria | 670 |
| 1127 | Ga0495630_0987330 | 3300046517 | Bacteria | 640 |
| 1128 | Ga0495643_0140317 | 3300046522 | Bacteria | 1206 |
| 1129 | Ga0495644_0320088 | 3300046523 | Bacteria | 608 |
| 1130 | Ga0495666_0092268 | 3300046526 | Bacteria | 1429 |
| 1131 | Ga0495652_0105267 | 3300046529 | Bacteria | 2280 |
| 1132 | Ga0495665_0087128 | 3300046531 | Bacteria | 1641 |
| 1133 | Ga0495665_0102077 | 3300046531 | Bacteria | 1505 |
| 1134 | Ga0495640_0041700 | 3300046533 | Bacteria | 3206 |
| 1135 | Ga0495640_0334793 | 3300046533 | Bacteria | 936 |
| 1136 | Ga0495640_0967864 | 3300046533 | Bacteria | 502 |
| 1137 | Ga0495640_0967887 | 3300046533 | Bacteria | 502 |
| 1138 | Ga0495586_0051611 | 3300046535 | Bacteria | 2226 |
| 1139 | Ga0495586_0479206 | 3300046535 | Bacteria | 718 |
| 1140 | Ga0495587_0454348 | 3300046536 | Bacteria | 710 |
| 1141 | Ga0495645_0027722 | 3300046543 | Bacteria | 4115 |
| 1142 | Ga0495645_0069587 | 3300046543 | Bacteria | 2540 |
| 1143 | Ga0495645_0560322 | 3300046543 | Bacteria | 707 |
| 1144 | Ga0495622_0068342 | 3300046557 | Bacteria | 1641 |
| 1145 | Ga0495667_0040028 | 3300046559 | Bacteria | 3114 |
| 1146 | Ga0495667_0255806 | 3300046559 | Bacteria | 1114 |
| 1147 | Ga0495668_0055967 | 3300046616 | Bacteria | 2178 |
| 1148 | Ga0495634_0124638 | 3300046642 | Bacteria | 1647 |
| 1149 | Ga0495634_0249724 | 3300046642 | Bacteria | 1086 |
| 1150 | Ga0495634_0371248 | 3300046642 | Bacteria | 854 |
| 1151 | Ga0495634_0644864 | 3300046642 | Unclassified | 612 |
| 1152 | Ga0495634_0789494 | 3300046642 | Bacteria | 542 |
| 1153 | Ga0495611_0302797 | 3300046648 | Bacteria | 737 |
| 1154 | Ga0495635_0000082 | 3300046663 | Bacteria | 58319 |
| 1155 | Ga0495635_0007858 | 3300046663 | Bacteria | 7449 |
| 1156 | Ga0495635_0418785 | 3300046663 | Bacteria | 888 |
| 1157 | Ga0495657_0029197 | 3300046675 | Bacteria | 3870 |
| 1158 | Ga0495657_0357251 | 3300046675 | Bacteria | 864 |
| 1159 | Ga0495599_0211052 | 3300046678 | Bacteria | 1190 |
| 1160 | Ga0495599_0524964 | 3300046678 | Bacteria | 695 |
| 1161 | Ga0495599_0771340 | 3300046678 | Bacteria | 551 |
| 1162 | Ga0495623_0427013 | 3300046679 | Bacteria | 709 |
| 1163 | Ga0495623_0509093 | 3300046679 | Bacteria | 634 |
| 1164 | Ga0495646_0201999 | 3300046680 | Bacteria | 1082 |
| 1165 | Ga0495647_0126736 | 3300046681 | Bacteria | 1078 |
| 1166 | Ga0495647_0221857 | 3300046681 | Bacteria | 835 |
| 1167 | Ga0495647_0533491 | 3300046681 | Bacteria | 548 |
| 1168 | Ga0495658_0018744 | 3300046683 | Bacteria | 3603 |
| 1169 | Ga0495613_0107356 | 3300046689 | Bacteria | 2014 |
| 1170 | Ga0495613_0167055 | 3300046689 | Bacteria | 1563 |
| 1171 | Ga0495613_0248223 | 3300046689 | Bacteria | 1243 |
| 1172 | Ga0495624_0043952 | 3300046690 | Bacteria | 2849 |
| 1173 | Ga0495624_0170757 | 3300046690 | Bacteria | 1327 |
| 1174 | Ga0495624_0457305 | 3300046690 | Bacteria | 765 |
| 1175 | Ga0495624_0519326 | 3300046690 | Bacteria | 712 |
| 1176 | Ga0495624_0762580 | 3300046690 | Bacteria | 573 |
| 1177 | Ga0495671_0200171 | 3300046692 | Bacteria | 969 |
| 1178 | Ga0495671_0558766 | 3300046692 | Bacteria | 545 |
| 1179 | Ga0495600_0044373 | 3300046809 | Bacteria | 2900 |
| 1180 | Ga0495581_0078431 | 3300047315 | Bacteria | 1911 |
| 1181 | Ga0495581_0171710 | 3300047315 | Bacteria | 1268 |
| 1182 | Ga0495604_0047067 | 3300047317 | Bacteria | 3361 |
| 1183 | Ga0495604_0536057 | 3300047317 | Bacteria | 756 |
| 1184 | Ga0495604_0851316 | 3300047317 | Bacteria | 572 |
| 1185 | Ga0495674_0004477 | 3300047319 | Bacteria | 13445 |
| 1186 | Ga0495674_0313533 | 3300047319 | Bacteria | 1279 |
| 1187 | Ga0495674_0400956 | 3300047319 | Bacteria | 1107 |
| 1188 | Ga0495674_0588326 | 3300047319 | Bacteria | 883 |
| 1189 | Ga0495674_0627840 | 3300047319 | Bacteria | 849 |
| 1190 | Ga0495676_0414621 | 3300047321 | Bacteria | 892 |
| 1191 | Ga0495676_0624935 | 3300047321 | Bacteria | 700 |
| 1192 | Ga0495680_0000053 | 3300047322 | Bacteria | 94237 |
| 1193 | Ga0495680_0176291 | 3300047322 | Bacteria | 1546 |
| 1194 | Ga0495680_0528785 | 3300047322 | Bacteria | 797 |
| 1195 | Ga0495675_0039762 | 3300047444 | Bacteria | 2996 |
| 1196 | Ga0495675_0164407 | 3300047444 | Bacteria | 1366 |
| 1197 | Ga0495675_0762373 | 3300047444 | Bacteria | 538 |
| 1198 | Ga0495684_0004775 | 3300047471 | Bacteria | 10588 |
| 1199 | Ga0495684_0017082 | 3300047471 | Bacteria | 5589 |
| 1200 | Ga0495684_0064085 | 3300047471 | Bacteria | 2793 |
| 1201 | Ga0495684_0389357 | 3300047471 | Bacteria | 981 |
| 1202 | Ga0495684_0469339 | 3300047471 | Bacteria | 871 |
| 1203 | Ga0495593_0222643 | 3300047673 | Bacteria | 947 |
| 1204 | Ga0495593_0251714 | 3300047673 | Bacteria | 884 |
| 1205 | Ga0495602_0127031 | 3300048088 | Bacteria | 2041 |
| 1206 | Ga0495614_0638168 | 3300048089 | Bacteria | 513 |
| 1207 | Ga0496101_0719796 | 3300048904 | Bacteria | 788 |
| 1208 | Ga0496102_0125174 | 3300048905 | Bacteria | 2402 |
| 1209 | Ga0496102_0789570 | 3300048905 | Bacteria | 872 |
| 1210 | Ga0496102_0858763 | 3300048905 | Bacteria | 830 |
| 1211 | Ga0496102_1175772 | 3300048905 | Bacteria | 687 |
| 1212 | Ga0496102_1778335 | 3300048905 | Bacteria | 534 |
| 1213 | Ga0496103_0012360 | 3300048906 | Bacteria | 5064 |
| 1214 | Ga0496104_0232656 | 3300048907 | Bacteria | 1755 |
| 1215 | Ga0496104_0407065 | 3300048907 | Bacteria | 1273 |
| 1216 | Ga0496104_0666642 | 3300048907 | Bacteria | 949 |
| 1217 | Ga0496106_0008099 | 3300048909 | Bacteria | 7764 |
| 1218 | Ga0496108_0347601 | 3300048911 | Bacteria | 1294 |
| 1219 | Ga0496108_0608052 | 3300048911 | Bacteria | 952 |
| 1220 | Ga0496108_0674340 | 3300048911 | Bacteria | 898 |
| 1221 | Ga0496109_0185900 | 3300048912 | Bacteria | 1952 |
| 1222 | Ga0496109_0417709 | 3300048912 | Bacteria | 1267 |
| 1223 | Ga0496109_0500653 | 3300048912 | Bacteria | 1147 |
| 1224 | Ga0496109_0557691 | 3300048912 | Bacteria | 1081 |
| 1225 | Ga0496109_1539534 | 3300048912 | Bacteria | 600 |
| 1226 | Ga0496109_1596625 | 3300048912 | Bacteria | 587 |
| 1227 | Ga0496110_0075010 | 3300048913 | Bacteria | 3005 |
| 1228 | Ga0496110_0263698 | 3300048913 | Bacteria | 1568 |
| 1229 | Ga0496111_0876394 | 3300048914 | Bacteria | 647 |
| 1230 | Ga0496111_1327911 | 3300048914 | Bacteria | 506 |
| 1231 | Ga0496112_0024268 | 3300048915 | Bacteria | 5804 |
| 1232 | Ga0496112_0478293 | 3300048915 | Bacteria | 1182 |
| 1233 | Ga0496112_0847901 | 3300048915 | Bacteria | 837 |
| 1234 | Ga0496112_1167960 | 3300048915 | Bacteria | 687 |
| 1235 | Ga0496113_0023534 | 3300048916 | Bacteria | 4368 |
| 1236 | Ga0496113_0601457 | 3300048916 | Bacteria | 881 |
| 1237 | Ga0496114_0313535 | 3300048917 | Bacteria | 1386 |
| 1238 | Ga0496114_1319172 | 3300048917 | Bacteria | 609 |
| 1239 | Ga0496115_0042673 | 3300048918 | Bacteria | 3614 |
| 1240 | Ga0496115_0258938 | 3300048918 | Bacteria | 1431 |
| 1241 | Ga0496115_0994423 | 3300048918 | Bacteria | 641 |
| 1242 | Ga0496117_0054306 | 3300048920 | Bacteria | 2807 |
| 1243 | Ga0496118_0002057 | 3300048921 | Bacteria | 28367 |
| 1244 | Ga0496121_0000077 | 3300048924 | Bacteria | 235293 |
| 1245 | Ga0496121_0032758 | 3300048924 | Bacteria | 4717 |
| 1246 | Ga0496121_0053767 | 3300048924 | Bacteria | 3371 |
| 1247 | Ga0496124_0006148 | 3300048927 | Bacteria | 13170 |
| 1248 | Ga0496125_0044761 | 3300048928 | Bacteria | 3736 |
| 1249 | Ga0496126_0009366 | 3300048929 | Bacteria | 10408 |
| 1250 | Ga0496126_0018937 | 3300048929 | Bacteria | 6800 |
| 1251 | Ga0496126_0150968 | 3300048929 | Bacteria | 1991 |
| 1252 | Ga0496126_0318929 | 3300048929 | Bacteria | 1278 |
| 1253 | Ga0496126_0376505 | 3300048929 | Bacteria | 1156 |
| 1254 | Ga0501309_006054 | 3300049129 | Bacteria | 1463 |
| 1255 | Ga0501310_010792 | 3300049130 | Bacteria | 1025 |
| 1256 | Ga0501307_044908 | 3300049162 | Bacteria | 651 |
| 1257 | Ga0501032_0390118 | 3300049569 | Bacteria | 895 |
| 1258 | Ga0501033_0187960 | 3300049570 | Bacteria | 1479 |
| 1259 | Ga0501033_0775583 | 3300049570 | Bacteria | 649 |
| 1260 | Ga0501034_0000109 | 3300049571 | Bacteria | 151550 |
| 1261 | Ga0501034_0001751 | 3300049571 | Bacteria | 27824 |
| 1262 | Ga0501034_0053875 | 3300049571 | Bacteria | 4050 |
| 1263 | Ga0501034_0115699 | 3300049571 | Bacteria | 2670 |
| 1264 | Ga0501034_0574374 | 3300049571 | Bacteria | 1035 |
| 1265 | Ga0501036_0383455 | 3300049572 | Bacteria | 1173 |
| 1266 | Ga0501037_0287677 | 3300049573 | Bacteria | 1144 |
| 1267 | Ga0501038_0397428 | 3300049574 | Bacteria | 1067 |
| 1268 | Ga0501038_0719954 | 3300049574 | Bacteria | 746 |
| 1269 | Ga0501039_0614442 | 3300049575 | Bacteria | 852 |
| 1270 | Ga0501041_1107385 | 3300049577 | Unclassified | 510 |
| 1271 | Ga0501043_0125279 | 3300049579 | Bacteria | 2014 |
| 1272 | Ga0501046_0116625 | 3300049580 | Bacteria | 2035 |
| 1273 | Ga0501048_0297614 | 3300049582 | Bacteria | 1148 |
| 1274 | Ga0501048_0543739 | 3300049582 | Bacteria | 833 |
| 1275 | Ga0501067_0280248 | 3300049583 | Bacteria | 928 |
| 1276 | Ga0501067_0382168 | 3300049583 | Bacteria | 785 |
| 1277 | Ga0501067_0685041 | 3300049583 | Bacteria | 576 |
| 1278 | Ga0501068_0252362 | 3300049584 | Bacteria | 1124 |
| 1279 | Ga0501069_0923060 | 3300049585 | Bacteria | 532 |
| 1280 | Ga0501070_0136672 | 3300049586 | Bacteria | 2024 |
| 1281 | Ga0501070_0203456 | 3300049586 | Bacteria | 1626 |
| 1282 | Ga0501070_0685443 | 3300049586 | Bacteria | 811 |
| 1283 | Ga0501070_1237674 | 3300049586 | Bacteria | 572 |
| 1284 | Ga0501071_0577730 | 3300049587 | Bacteria | 864 |
| 1285 | Ga0501072_0307215 | 3300049588 | Bacteria | 1261 |
| 1286 | Ga0501072_0601028 | 3300049588 | Bacteria | 867 |
| 1287 | Ga0501073_0223858 | 3300049589 | Bacteria | 1300 |
| 1288 | Ga0501073_0384093 | 3300049589 | Bacteria | 970 |
| 1289 | Ga0501073_0413478 | 3300049589 | Bacteria | 932 |
| 1290 | Ga0501076_0297973 | 3300049592 | Unclassified | 1322 |
| 1291 | Ga0501076_1041855 | 3300049592 | Bacteria | 674 |
| 1292 | Ga0501079_0411430 | 3300049741 | Bacteria | 1061 |
| 1293 | Ga0501079_0865511 | 3300049741 | Bacteria | 712 |
| 1294 | Ga0501080_0299923 | 3300049742 | Bacteria | 1458 |
| 1295 | Ga0501080_0906495 | 3300049742 | Bacteria | 768 |
| 1296 | Ga0501080_1068868 | 3300049742 | Bacteria | 698 |
| 1297 | Ga0501080_1204437 | 3300049742 | Bacteria | 651 |
| 1298 | Ga0501080_1804565 | 3300049742 | Bacteria | 514 |
| 1299 | Ga0501081_0278248 | 3300049743 | Bacteria | 1225 |
| 1300 | Ga0501035_0889832 | 3300049822 | Bacteria | 706 |
| 1301 | Ga0501044_0235998 | 3300049823 | Bacteria | 1774 |
| 1302 | Ga0501045_0359472 | 3300049824 | Bacteria | 1083 |
| 1303 | Ga0501045_0419115 | 3300049824 | Bacteria | 996 |
| 1304 | nmdc:mga03683_132101_c1 | 3300050489 | Bacteria | 1117 |
| 1305 | nmdc:mga03683_148518_c1 | 3300050489 | Bacteria | 1057 |
| 1306 | nmdc:mga03683_15481_c1 | 3300050489 | Bacteria | 2847 |
| 1307 | nmdc:mga03683_169568_c1 | 3300050489 | Bacteria | 991 |
| 1308 | nmdc:mga03683_1825_c1 | 3300050489 | Bacteria | 6461 |
| 1309 | nmdc:mga03683_22746_c1 | 3300050489 | Bacteria | 2433 |
| 1310 | nmdc:mga03683_32482_c1 | 3300050489 | Bacteria | 2100 |
| 1311 | nmdc:mga03683_32979_c1 | 3300050489 | Bacteria | 2086 |
| 1312 | nmdc:mga03683_397443_c1 | 3300050489 | Bacteria | 658 |
| 1313 | nmdc:mga03683_461697_c1 | 3300050489 | Bacteria | 612 |
| 1314 | nmdc:mga03683_76855_c1 | 3300050489 | Bacteria | 986 |
| 1315 | nmdc:mga03n38_102713_c1 | 3300050490 | Bacteria | 1381 |
| 1316 | nmdc:mga03n38_951783_c1 | 3300050490 | Bacteria | 507 |
| 1317 | nmdc:mga00v17_207477_c1 | 3300050491 | Bacteria | 1267 |
| 1318 | nmdc:mga00v17_39264_c1 | 3300050491 | Bacteria | 2834 |
| 1319 | nmdc:mga0yw44_129575_c1 | 3300050492 | Bacteria | 1632 |
| 1320 | nmdc:mga0yw44_22312_c1 | 3300050492 | Bacteria | 3549 |
| 1321 | nmdc:mga0yw44_38472_c1 | 3300050492 | Bacteria | 2831 |
| 1322 | nmdc:mga0yw44_446005_c1 | 3300050492 | Bacteria | 877 |
| 1323 | nmdc:mga0yw44_467214_c1 | 3300050492 | Bacteria | 855 |
| 1324 | nmdc:mga0yw44_730278_c1 | 3300050492 | Bacteria | 673 |
| 1325 | nmdc:mga0k408_107710_c1 | 3300050493 | Bacteria | 1646 |
| 1326 | nmdc:mga0k408_162678_c1 | 3300050493 | Bacteria | 1330 |
| 1327 | nmdc:mga0k408_343354_c1 | 3300050493 | Bacteria | 890 |
| 1328 | nmdc:mga0k408_5567_c1 | 3300050493 | Bacteria | 6701 |
| 1329 | nmdc:mga0k408_609334_c1 | 3300050493 | Bacteria | 644 |
| 1330 | nmdc:mga06z11_101549_c1 | 3300050494 | Bacteria | 991 |
| 1331 | nmdc:mga06z11_127247_c1 | 3300050494 | Bacteria | 1427 |
| 1332 | nmdc:mga06z11_174175_c1 | 3300050494 | Bacteria | 1237 |
| 1333 | nmdc:mga06z11_261579_c1 | 3300050494 | Bacteria | 1021 |
| 1334 | nmdc:mga06z11_305409_c1 | 3300050494 | Bacteria | 947 |
| 1335 | nmdc:mga06z11_358863_c1 | 3300050494 | Bacteria | 873 |
| 1336 | nmdc:mga06z11_43471_c1 | 3300050494 | Bacteria | 2260 |
| 1337 | nmdc:mga06z11_5646_c1 | 3300050494 | Bacteria | 5039 |
| 1338 | nmdc:mga06z11_571794_c1 | 3300050494 | Bacteria | 687 |
| 1339 | nmdc:mga04h51_136829_c1 | 3300050495 | Bacteria | 926 |
| 1340 | nmdc:mga07m45_367567_c1 | 3300050496 | Bacteria | 836 |
| 1341 | nmdc:mga07m45_402050_c1 | 3300050496 | Bacteria | 795 |
| 1342 | nmdc:mga07m45_424909_c1 | 3300050496 | Bacteria | 771 |
| 1343 | nmdc:mga07m45_56464_c1 | 3300050496 | Bacteria | 2219 |
| 1344 | nmdc:mga07m45_760326_c1 | 3300050496 | Bacteria | 556 |
| 1345 | nmdc:mga07m45_803591_c1 | 3300050496 | Bacteria | 539 |
| 1346 | nmdc:mga05p37_733444_c1 | 3300050507 | Bacteria | 1092 |
| 1347 | nmdc:mga05p37_8689_c1 | 3300050507 | Bacteria | 12002 |
| 1348 | nmdc:mga09592_1156863_c1 | 3300050508 | Bacteria | 641 |
| 1349 | nmdc:mga09592_207576_c1 | 3300050508 | Bacteria | 1697 |
| 1350 | nmdc:mga09592_2383_c1 | 3300050508 | Bacteria | 15174 |
| 1351 | nmdc:mga0qj67_32605_c1 | 3300050509 | Bacteria | 4064 |
| 1352 | nmdc:mga0qj67_59574_c1 | 3300050509 | Bacteria | 3028 |
| 1353 | nmdc:mga0qj67_606036_c1 | 3300050509 | Unclassified | 876 |
| 1354 | nmdc:mga06r32_7094_c1 | 3300050510 | Bacteria | 10088 |
| 1355 | nmdc:mga06r32_96109_c1 | 3300050510 | Bacteria | 2901 |
| 1356 | nmdc:mga08y16_122656_c1 | 3300050511 | Bacteria | 2704 |
| 1357 | nmdc:mga08y16_13156_c1 | 3300050511 | Bacteria | 8706 |
| 1358 | nmdc:mga08y16_20207_c1 | 3300050511 | Bacteria | 7030 |
| 1359 | nmdc:mga08y16_245174_c1 | 3300050511 | Bacteria | 1851 |
| 1360 | nmdc:mga08y16_295626_c1 | 3300050511 | Bacteria | 1670 |
| 1361 | nmdc:mga08y16_996516_c1 | 3300050511 | Bacteria | 818 |
| 1362 | nmdc:mga0n895_1248009_c1 | 3300050512 | Bacteria | 716 |
| 1363 | nmdc:mga0n895_1346942_c1 | 3300050512 | Unclassified | 683 |
| 1364 | nmdc:mga0n895_17745_c1 | 3300050512 | Bacteria | 6567 |
| 1365 | nmdc:mga0n895_237294_c1 | 3300050512 | Bacteria | 1850 |
| 1366 | nmdc:mga0n895_293958_c1 | 3300050512 | Bacteria | 1647 |
| 1367 | nmdc:mga0n895_329968_c1 | 3300050512 | Bacteria | 1546 |
| 1368 | nmdc:mga0n895_40414_c1 | 3300050512 | Bacteria | 4530 |
| 1369 | nmdc:mga0n895_413359_c1 | 3300050512 | Bacteria | 1364 |
| 1370 | nmdc:mga0n895_64973_c1 | 3300050512 | Bacteria | 3611 |
| 1371 | nmdc:mga0rr50_549627_c1 | 3300050513 | Bacteria | 983 |
| 1372 | nmdc:mga0rr50_954746_c1 | 3300050513 | Bacteria | 731 |
| 1373 | nmdc:mga08x19_1063571_c1 | 3300050514 | Bacteria | 574 |
| 1374 | nmdc:mga08x19_1158850_c1 | 3300050514 | Bacteria | 548 |
| 1375 | nmdc:mga08x19_175174_c1 | 3300050514 | Bacteria | 1462 |
| 1376 | nmdc:mga08x19_463128_c1 | 3300050514 | Bacteria | 893 |
| 1377 | nmdc:mga08x19_916772_c1 | 3300050514 | Unclassified | 622 |
| 1378 | nmdc:mga0a205_36569_c1 | 3300050515 | Bacteria | 4718 |
| 1379 | nmdc:mga0a205_678075_c1 | 3300050515 | Bacteria | 881 |
| 1380 | nmdc:mga0a205_72159_c1 | 3300050515 | Bacteria | 3335 |
| 1381 | nmdc:mga0a205_803235_c1 | 3300050515 | Bacteria | 788 |
| 1382 | nmdc:mga0sz30_175604_c1 | 3300050516 | Bacteria | 950 |
| 1383 | nmdc:mga0sz30_239_c1 | 3300050516 | Bacteria | 21056 |
| 1384 | nmdc:mga0sz30_36367_c1 | 3300050516 | Bacteria | 2058 |
| 1385 | nmdc:mga0sz30_424010_c1 | 3300050516 | Bacteria | 597 |
| 1386 | nmdc:mga0sz30_486680_c1 | 3300050516 | Bacteria | 555 |
| 1387 | nmdc:mga0sz30_5231_c1 | 3300050516 | Bacteria | 577 |
| 1388 | Ga0495601_0084629 | 3300053077 | Bacteria | 2037 |
| 1389 | Ga0495601_0098753 | 3300053077 | Bacteria | 1884 |
| 1390 | Ga0495601_0236563 | 3300053077 | Bacteria | 1193 |
| 1391 | Ga0495601_0284716 | 3300053077 | Bacteria | 1078 |
| 1392 | Ga0495601_0347852 | 3300053077 | Bacteria | 964 |
| 1393 | Ga0495601_0470982 | 3300053077 | Bacteria | 812 |
| 1394 | Ga0495612_0028179 | 3300053078 | Bacteria | 2261 |
| 1395 | Ga0495612_0045922 | 3300053078 | Bacteria | 1788 |
| 1396 | Ga0495612_0147855 | 3300053078 | Bacteria | 1021 |
| 1397 | Ga0500610_0230325 | 3300053079 | Bacteria | 870 |
| 1398 | Ga0500610_0367761 | 3300053079 | Bacteria | 600 |
| 1399 | Ga0500635_0003286 | 3300053080 | Bacteria | 4058 |
| 1400 | Ga0495655_0066366 | 3300053083 | Bacteria | 998 |
| 1401 | Ga0495595_0233573 | 3300053084 | Bacteria | 919 |
| 1402 | Ga0495595_0283669 | 3300053084 | Bacteria | 832 |
| 1403 | Ga0495595_0652117 | 3300053084 | Bacteria | 539 |
| 1404 | Ga0495595_0711475 | 3300053084 | Bacteria | 515 |
| 1405 | Ga0495619_0020222 | 3300053085 | Bacteria | 4238 |
| 1406 | Ga0495619_0112948 | 3300053085 | Bacteria | 1857 |
| 1407 | Ga0495619_0229266 | 3300053085 | Bacteria | 1287 |
| 1408 | Ga0500643_019179 | 3300053087 | Bacteria | 2257 |
| 1409 | Ga0500643_157092 | 3300053087 | Bacteria | 610 |
| 1410 | Ga0500644_0007897 | 3300053088 | Bacteria | 2788 |
| 1411 | Ga0500644_0363605 | 3300053088 | Bacteria | 627 |
| 1412 | Ga0500647_0234975 | 3300053091 | Bacteria | 813 |
| 1413 | Ga0500583_0480932 | 3300053092 | Bacteria | 586 |
| 1414 | Ga0500583_0508775 | 3300053092 | Bacteria | 565 |
| 1415 | Ga0500651_0016352 | 3300053093 | Bacteria | 4563 |
| 1416 | Ga0500651_0731053 | 3300053093 | Bacteria | 527 |
| 1417 | Ga0500566_0071146 | 3300053094 | Bacteria | 1952 |
| 1418 | Ga0500566_0191433 | 3300053094 | Bacteria | 1041 |
| 1419 | Ga0500641_0000244 | 3300053096 | Bacteria | 20427 |
| 1420 | Ga0500555_078586 | 3300053103 | Bacteria | 861 |
| 1421 | Ga0500557_123515 | 3300053105 | Bacteria | 859 |
| 1422 | Ga0500558_162861 | 3300053106 | Bacteria | 816 |
| 1423 | Ga0500594_0108816 | 3300053118 | Bacteria | 860 |
| 1424 | Ga0500595_027620 | 3300053119 | Bacteria | 1942 |
| 1425 | Ga0500595_071275 | 3300053119 | Bacteria | 1031 |
| 1426 | Ga0500595_159895 | 3300053119 | Bacteria | 628 |
| 1427 | Ga0500597_244030 | 3300053120 | Bacteria | 738 |
| 1428 | Ga0500614_066050 | 3300053123 | Bacteria | 983 |
| 1429 | Ga0500642_0126365 | 3300053130 | Bacteria | 1198 |
| 1430 | Ga0500642_0143929 | 3300053130 | Bacteria | 1119 |
| 1431 | Ga0500642_0515829 | 3300053130 | Bacteria | 502 |
| 1432 | Ga0500652_216897 | 3300053131 | Bacteria | 771 |
| 1433 | Ga0500559_0104030 | 3300053136 | Bacteria | 1310 |
| 1434 | Ga0500577_0069185 | 3300053142 | Bacteria | 1380 |
| 1435 | Ga0500577_0182992 | 3300053142 | Bacteria | 900 |
| 1436 | Ga0500577_0218436 | 3300053142 | Bacteria | 825 |
| 1437 | Ga0500588_0175088 | 3300053146 | Bacteria | 787 |
| 1438 | Ga0500590_080916 | 3300053148 | Bacteria | 1595 |
| 1439 | Ga0500590_179822 | 3300053148 | Bacteria | 920 |
| 1440 | Ga0500590_258878 | 3300053148 | Bacteria | 685 |
| 1441 | Ga0500603_018179 | 3300053150 | Bacteria | 1690 |
| 1442 | Ga0500616_0000925 | 3300053153 | Bacteria | 32079 |
| 1443 | Ga0500616_0149582 | 3300053153 | Bacteria | 1082 |
| 1444 | Ga0500620_019185 | 3300053155 | Bacteria | 2005 |
| 1445 | Ga0500627_0155211 | 3300053158 | Bacteria | 1034 |
| 1446 | Ga0500638_285809 | 3300053162 | Bacteria | 644 |
| 1447 | Ga0500639_253271 | 3300053163 | Bacteria | 703 |
| 1448 | Ga0500636_0086777 | 3300053177 | Bacteria | 1796 |
| 1449 | Ga0500657_128973 | 3300053728 | Bacteria | 985 |
| 1450 | Ga0500609_025225 | 3300053731 | Bacteria | 814 |
| 1451 | Ga0500552_007586 | 3300053733 | Bacteria | 1257 |
| 1452 | Ga0500552_018616 | 3300053733 | Bacteria | 964 |
| 1453 | Ga0500596_005014 | 3300053735 | Bacteria | 2370 |
| 1454 | Ga0587115_033509 | 3300059626 | Bacteria | 774 |
| 1455 | Ga0587067_231921 | 3300059640 | Bacteria | 505 |
| 1456 | Ga0501082_1064267 | 3300060353 | Bacteria | 707 |
| 1457 | Ga0530510_0221050 | 3300061734 | Unclassified | 1408 |
| 1458 | Ga0530510_0974321 | 3300061734 | Bacteria | 649 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_1041855 | Ga0501076_1041855_473_604 | 43 |
| 2 | 3300049743 | Ga0501081_0278248 | Ga0501081_0278248_42_173 | 43 |
| 3 | iso_pu_bacteria | 2513237144 | 2513911411 | 45 |
| 4 | iso_pu_bacteria | 2838074704 | 2838080529 | 45 |
| 5 | 3300049742 | Ga0501080_1804565 | Ga0501080_1804565_21_161 | 46 |
| 6 | iso_pu_bacteria | 2513237101 | 2513692969 | 46 |
| 7 | iso_pu_bacteria | 2824704595 | 2824707025 | 46 |
| 8 | iso_pu_bacteria | 2824753945 | 2824757193 | 46 |
| 9 | iso_pu_bacteria | 2824763712 | 2824766791 | 46 |
| 10 | iso_pu_bacteria | 2904711408 | 2904720910 | 46 |
| 11 | 3300013100 | Ga0157373_10304337 | Ga0157373_103043372 | 47 |
| 12 | 3300013102 | Ga0157371_10202736 | Ga0157371_102027362 | 47 |
| 13 | 3300013104 | Ga0157370_12027016 | Ga0157370_120270162 | 47 |
| 14 | 3300013105 | Ga0157369_10273787 | Ga0157369_102737872 | 47 |
| 15 | 3300013105 | Ga0157369_11040671 | Ga0157369_110406712 | 47 |
| 16 | 3300014325 | Ga0163163_10113227 | Ga0163163_101132273 | 47 |
| 17 | 3300014968 | Ga0157379_10666434 | Ga0157379_106664342 | 47 |
| 18 | 3300014969 | Ga0157376_11840955 | Ga0157376_118409551 | 47 |
| 19 | 3300036401 | Ga0373937_0108821 | Ga0373937_0108821_1293_1436 | 47 |
| 20 | 3300046559 | Ga0495667_0255806 | Ga0495667_0255806_777_920 | 47 |
| 21 | 3300046675 | Ga0495657_0029197 | Ga0495657_0029197_1306_1449 | 47 |
| 22 | 3300047444 | Ga0495675_0039762 | Ga0495675_0039762_2385_2528 | 47 |
| 23 | 3300048088 | Ga0495602_0127031 | Ga0495602_0127031_1104_1247 | 47 |
| 24 | 3300048907 | Ga0496104_0232656 | Ga0496104_0232656_1533_1676 | 47 |
| 25 | 3300048907 | Ga0496104_0666642 | Ga0496104_0666642_74_217 | 47 |
| 26 | 3300048911 | Ga0496108_0347601 | Ga0496108_0347601_671_814 | 47 |
| 27 | 3300048913 | Ga0496110_0075010 | Ga0496110_0075010_1989_2132 | 47 |
| 28 | 3300048915 | Ga0496112_0024268 | Ga0496112_0024268_4728_4871 | 47 |
| 29 | 3300048915 | Ga0496112_1167960 | Ga0496112_1167960_91_234 | 47 |
| 30 | 3300048916 | Ga0496113_0023534 | Ga0496113_0023534_1675_1818 | 47 |
| 31 | 3300053084 | Ga0495595_0233573 | Ga0495595_0233573_20_163 | 47 |
| 32 | 3300046511 | Ga0495608_0055390 | Ga0495608_0055390_846_992 | 48 |
| 33 | 3300003203 | JGI25406J46586_10000940 | JGI25406J46586_1000094012 | 49 |
| 34 | 3300003203 | JGI25406J46586_10021547 | JGI25406J46586_100215473 | 49 |
| 35 | 3300003215 | JGI25153J46596_10002123 | JGI25153J46596_100021236 | 49 |
| 36 | 3300003320 | rootH2_10190176 | rootH2_101901764 | 49 |
| 37 | 3300003659 | JGI25404J52841_10013369 | JGI25404J52841_100133693 | 49 |
| 38 | 3300005290 | Ga0065712_10185320 | Ga0065712_101853202 | 49 |
| 39 | 3300005293 | Ga0065715_10216814 | Ga0065715_102168142 | 49 |
| 40 | 3300005328 | Ga0070676_10251595 | Ga0070676_102515952 | 49 |
| 41 | 3300005330 | Ga0070690_100482699 | Ga0070690_1004826992 | 49 |
| 42 | 3300005331 | Ga0070670_100027724 | Ga0070670_1000277242 | 49 |
| 43 | 3300005334 | Ga0068869_100000708 | Ga0068869_10000070816 | 49 |
| 44 | 3300005335 | Ga0070666_10016127 | Ga0070666_100161272 | 49 |
| 45 | 3300005338 | Ga0068868_102390218 | Ga0068868_1023902182 | 49 |
| 46 | 3300005340 | Ga0070689_100147781 | Ga0070689_1001477813 | 49 |
| 47 | 3300005340 | Ga0070689_100293898 | Ga0070689_1002938982 | 49 |
| 48 | 3300005343 | Ga0070687_101140673 | Ga0070687_1011406732 | 49 |
| 49 | 3300005347 | Ga0070668_100009348 | Ga0070668_1000093486 | 49 |
| 50 | 3300005353 | Ga0070669_100021100 | Ga0070669_1000211002 | 49 |
| 51 | 3300005353 | Ga0070669_100426557 | Ga0070669_1004265572 | 49 |
| 52 | 3300005353 | Ga0070669_100778364 | Ga0070669_1007783642 | 49 |
| 53 | 3300005356 | Ga0070674_101038574 | Ga0070674_1010385742 | 49 |
| 54 | 3300005364 | Ga0070673_100176614 | Ga0070673_1001766142 | 49 |
| 55 | 3300005366 | Ga0070659_102041878 | Ga0070659_1020418782 | 49 |
| 56 | 3300005367 | Ga0070667_100005347 | Ga0070667_1000053474 | 49 |
| 57 | 3300005367 | Ga0070667_101973085 | Ga0070667_1019730852 | 49 |
| 58 | 3300005434 | Ga0070709_10273829 | Ga0070709_102738292 | 49 |
| 59 | 3300005435 | Ga0070714_100006563 | Ga0070714_1000065636 | 49 |
| 60 | 3300005436 | Ga0070713_100031740 | Ga0070713_1000317404 | 49 |
| 61 | 3300005436 | Ga0070713_100227269 | Ga0070713_1002272692 | 49 |
| 62 | 3300005438 | Ga0070701_10809268 | Ga0070701_108092682 | 49 |
| 63 | 3300005439 | Ga0070711_101118662 | Ga0070711_1011186622 | 49 |
| 64 | 3300005440 | Ga0070705_100672043 | Ga0070705_1006720431 | 49 |
| 65 | 3300005445 | Ga0070708_101540875 | Ga0070708_1015408751 | 49 |
| 66 | 3300005457 | Ga0070662_100334207 | Ga0070662_1003342072 | 49 |
| 67 | 3300005459 | Ga0068867_100026445 | Ga0068867_1000264453 | 49 |
| 68 | 3300005535 | Ga0070684_100967433 | Ga0070684_1009674333 | 49 |
| 69 | 3300005539 | Ga0068853_100533732 | Ga0068853_1005337321 | 49 |
| 70 | 3300005539 | Ga0068853_100637485 | Ga0068853_1006374853 | 49 |
| 71 | 3300005543 | Ga0070672_101073380 | Ga0070672_1010733802 | 49 |
| 72 | 3300005545 | Ga0070695_101293325 | Ga0070695_1012933252 | 49 |
| 73 | 3300005546 | Ga0070696_100310212 | Ga0070696_1003102122 | 49 |
| 74 | 3300005547 | Ga0070693_100976858 | Ga0070693_1009768582 | 49 |
| 75 | 3300005548 | Ga0070665_100020492 | Ga0070665_1000204925 | 49 |
| 76 | 3300005549 | Ga0070704_100216017 | Ga0070704_1002160173 | 49 |
| 77 | 3300005563 | Ga0068855_100713535 | Ga0068855_1007135352 | 49 |
| 78 | 3300005563 | Ga0068855_101303329 | Ga0068855_1013033291 | 49 |
| 79 | 3300005564 | Ga0070664_100423770 | Ga0070664_1004237703 | 49 |
| 80 | 3300005577 | Ga0068857_100096366 | Ga0068857_1000963663 | 49 |
| 81 | 3300005578 | Ga0068854_100740106 | Ga0068854_1007401062 | 49 |
| 82 | 3300005578 | Ga0068854_101699283 | Ga0068854_1016992832 | 49 |
| 83 | 3300005614 | Ga0068856_100722067 | Ga0068856_1007220672 | 49 |
| 84 | 3300005615 | Ga0070702_100019857 | Ga0070702_1000198572 | 49 |
| 85 | 3300005616 | Ga0068852_101030749 | Ga0068852_1010307492 | 49 |
| 86 | 3300005617 | Ga0068859_100001245 | Ga0068859_10000124519 | 49 |
| 87 | 3300005618 | Ga0068864_100008273 | Ga0068864_1000082737 | 49 |
| 88 | 3300005718 | Ga0068866_10059936 | Ga0068866_100599362 | 49 |
| 89 | 3300005719 | Ga0068861_100006169 | Ga0068861_1000061694 | 49 |
| 90 | 3300005719 | Ga0068861_100948810 | Ga0068861_1009488102 | 49 |
| 91 | 3300005840 | Ga0068870_10002331 | Ga0068870_100023317 | 49 |
| 92 | 3300005840 | Ga0068870_10661408 | Ga0068870_106614082 | 49 |
| 93 | 3300005840 | Ga0068870_11242674 | Ga0068870_112426742 | 49 |
| 94 | 3300005841 | Ga0068863_100000873 | Ga0068863_1000008735 | 49 |
| 95 | 3300005841 | Ga0068863_101478691 | Ga0068863_1014786912 | 49 |
| 96 | 3300005842 | Ga0068858_100002812 | Ga0068858_1000028122 | 49 |
| 97 | 3300005843 | Ga0068860_100012312 | Ga0068860_1000123127 | 49 |
| 98 | 3300005843 | Ga0068860_100792664 | Ga0068860_1007926642 | 49 |
| 99 | 3300005843 | Ga0068860_101762671 | Ga0068860_1017626712 | 49 |
| 100 | 3300005844 | Ga0068862_100012163 | Ga0068862_1000121635 | 49 |
| 101 | 3300005844 | Ga0068862_100559699 | Ga0068862_1005596992 | 49 |
| 102 | 3300005937 | Ga0081455_10090302 | Ga0081455_100903024 | 49 |
| 103 | 3300005937 | Ga0081455_10128235 | Ga0081455_101282352 | 49 |
| 104 | 3300005983 | Ga0081540_1000003 | Ga0081540_1000003134 | 49 |
| 105 | 3300005983 | Ga0081540_1003189 | Ga0081540_10031892 | 49 |
| 106 | 3300005983 | Ga0081540_1035955 | Ga0081540_10359554 | 49 |
| 107 | 3300005985 | Ga0081539_10000191 | Ga0081539_10000191123 | 49 |
| 108 | 3300005985 | Ga0081539_10001574 | Ga0081539_1000157418 | 49 |
| 109 | 3300006038 | Ga0075365_10675477 | Ga0075365_106754772 | 49 |
| 110 | 3300006058 | Ga0075432_10383668 | Ga0075432_103836682 | 49 |
| 111 | 3300006173 | Ga0070716_101463376 | Ga0070716_1014633762 | 49 |
| 112 | 3300006175 | Ga0070712_100051865 | Ga0070712_1000518653 | 49 |
| 113 | 3300006195 | Ga0075366_10425519 | Ga0075366_104255191 | 49 |
| 114 | 3300006237 | Ga0097621_101373661 | Ga0097621_1013736612 | 49 |
| 115 | 3300006353 | Ga0075370_10435715 | Ga0075370_104357152 | 49 |
| 116 | 3300006844 | Ga0075428_100045105 | Ga0075428_1000451053 | 49 |
| 117 | 3300006844 | Ga0075428_100080803 | Ga0075428_1000808032 | 49 |
| 118 | 3300006846 | Ga0075430_100084875 | Ga0075430_1000848752 | 49 |
| 119 | 3300006846 | Ga0075430_100118025 | Ga0075430_1001180253 | 49 |
| 120 | 3300006847 | Ga0075431_100014415 | Ga0075431_1000144156 | 49 |
| 121 | 3300006847 | Ga0075431_100034312 | Ga0075431_1000343123 | 49 |
| 122 | 3300006852 | Ga0075433_10018901 | Ga0075433_100189012 | 49 |
| 123 | 3300006871 | Ga0075434_100017326 | Ga0075434_1000173263 | 49 |
| 124 | 3300006871 | Ga0075434_100522982 | Ga0075434_1005229822 | 49 |
| 125 | 3300006871 | Ga0075434_100525994 | Ga0075434_1005259942 | 49 |
| 126 | 3300006871 | Ga0075434_101077628 | Ga0075434_1010776282 | 49 |
| 127 | 3300006880 | Ga0075429_100047982 | Ga0075429_1000479823 | 49 |
| 128 | 3300006880 | Ga0075429_100222872 | Ga0075429_1002228722 | 49 |
| 129 | 3300006914 | Ga0075436_100921172 | Ga0075436_1009211722 | 49 |
| 130 | 3300006931 | Ga0097620_100001245 | Ga0097620_10000124519 | 49 |
| 131 | 3300007076 | Ga0075435_100531957 | Ga0075435_1005319572 | 49 |
| 132 | 3300007076 | Ga0075435_100619304 | Ga0075435_1006193042 | 49 |
| 133 | 3300007788 | Ga0099795_10104454 | Ga0099795_101044542 | 49 |
| 134 | 3300007788 | Ga0099795_10106440 | Ga0099795_101064401 | 49 |
| 135 | 3300007788 | Ga0099795_10473198 | Ga0099795_104731982 | 49 |
| 136 | 3300009094 | Ga0111539_10015625 | Ga0111539_100156256 | 49 |
| 137 | 3300009094 | Ga0111539_10046064 | Ga0111539_100460647 | 49 |
| 138 | 3300009094 | Ga0111539_10645809 | Ga0111539_106458092 | 49 |
| 139 | 3300009098 | Ga0105245_10257845 | Ga0105245_102578452 | 49 |
| 140 | 3300009101 | Ga0105247_10070694 | Ga0105247_100706942 | 49 |
| 141 | 3300009101 | Ga0105247_10464790 | Ga0105247_104647902 | 49 |
| 142 | 3300009101 | Ga0105247_11452821 | Ga0105247_114528212 | 49 |
| 143 | 3300009147 | Ga0114129_10761458 | Ga0114129_107614582 | 49 |
| 144 | 3300009147 | Ga0114129_13123651 | Ga0114129_131236512 | 49 |
| 145 | 3300009148 | Ga0105243_10188988 | Ga0105243_101889882 | 49 |
| 146 | 3300009148 | Ga0105243_11378026 | Ga0105243_113780262 | 49 |
| 147 | 3300009148 | Ga0105243_12463319 | Ga0105243_124633192 | 49 |
| 148 | 3300009174 | Ga0105241_10304189 | Ga0105241_103041893 | 49 |
| 149 | 3300009176 | Ga0105242_11835702 | Ga0105242_118357022 | 49 |
| 150 | 3300009176 | Ga0105242_12797035 | Ga0105242_127970352 | 49 |
| 151 | 3300009177 | Ga0105248_10002517 | Ga0105248_1000251715 | 49 |
| 152 | 3300009545 | Ga0105237_10876228 | Ga0105237_108762281 | 49 |
| 153 | 3300009545 | Ga0105237_11547053 | Ga0105237_115470532 | 49 |
| 154 | 3300009553 | Ga0105249_10117602 | Ga0105249_101176022 | 49 |
| 155 | 3300009553 | Ga0105249_11365889 | Ga0105249_113658892 | 49 |
| 156 | 3300009553 | Ga0105249_12128511 | Ga0105249_121285112 | 49 |
| 157 | 3300010159 | Ga0099796_10533419 | Ga0099796_105334192 | 49 |
| 158 | 3300010375 | Ga0105239_10207156 | Ga0105239_102071562 | 49 |
| 159 | 3300011119 | Ga0105246_10811141 | Ga0105246_108111412 | 49 |
| 160 | 3300012487 | Ga0157321_1017925 | Ga0157321_10179252 | 49 |
| 161 | 3300013296 | Ga0157374_10782565 | Ga0157374_107825651 | 49 |
| 162 | 3300013296 | Ga0157374_10797268 | Ga0157374_107972682 | 49 |
| 163 | 3300013296 | Ga0157374_12908873 | Ga0157374_129088731 | 49 |
| 164 | 3300013297 | Ga0157378_10016126 | Ga0157378_100161264 | 49 |
| 165 | 3300013297 | Ga0157378_10180605 | Ga0157378_101806053 | 49 |
| 166 | 3300013306 | Ga0163162_10096960 | Ga0163162_100969602 | 49 |
| 167 | 3300013306 | Ga0163162_11410211 | Ga0163162_114102112 | 49 |
| 168 | 3300013306 | Ga0163162_13246855 | Ga0163162_132468552 | 49 |
| 169 | 3300013306 | Ga0163162_13334989 | Ga0163162_133349892 | 49 |
| 170 | 3300013308 | Ga0157375_10222455 | Ga0157375_102224553 | 49 |
| 171 | 3300014325 | Ga0163163_10000812 | Ga0163163_100008122 | 49 |
| 172 | 3300014325 | Ga0163163_10490016 | Ga0163163_104900162 | 49 |
| 173 | 3300014326 | Ga0157380_11695684 | Ga0157380_116956842 | 49 |
| 174 | 3300014326 | Ga0157380_11916092 | Ga0157380_119160922 | 49 |
| 175 | 3300014745 | Ga0157377_10888734 | Ga0157377_108887342 | 49 |
| 176 | 3300014745 | Ga0157377_11295171 | Ga0157377_112951712 | 49 |
| 177 | 3300014968 | Ga0157379_10000401 | Ga0157379_1000040129 | 49 |
| 178 | 3300014968 | Ga0157379_10398503 | Ga0157379_103985032 | 49 |
| 179 | 3300014968 | Ga0157379_11747140 | Ga0157379_117471402 | 49 |
| 180 | 3300014969 | Ga0157376_12687351 | Ga0157376_126873512 | 49 |
| 181 | 3300014969 | Ga0157376_13008035 | Ga0157376_130080352 | 49 |
| 182 | 3300017792 | Ga0163161_10572716 | Ga0163161_105727162 | 49 |
| 183 | 3300025297 | Ga0209758_1000183 | Ga0209758_100018328 | 49 |
| 184 | 3300025297 | Ga0209758_1064599 | Ga0209758_10645993 | 49 |
| 185 | 3300025302 | Ga0207426_1102116 | Ga0207426_11021162 | 49 |
| 186 | 3300025898 | Ga0207692_10195267 | Ga0207692_101952672 | 49 |
| 187 | 3300025898 | Ga0207692_10731483 | Ga0207692_107314832 | 49 |
| 188 | 3300025900 | Ga0207710_10241257 | Ga0207710_102412572 | 49 |
| 189 | 3300025900 | Ga0207710_10441552 | Ga0207710_104415522 | 49 |
| 190 | 3300025901 | Ga0207688_10264866 | Ga0207688_102648662 | 49 |
| 191 | 3300025901 | Ga0207688_10855520 | Ga0207688_108555201 | 49 |
| 192 | 3300025905 | Ga0207685_10574958 | Ga0207685_105749582 | 49 |
| 193 | 3300025906 | Ga0207699_10284276 | Ga0207699_102842762 | 49 |
| 194 | 3300025906 | Ga0207699_11423756 | Ga0207699_114237562 | 49 |
| 195 | 3300025907 | Ga0207645_10291619 | Ga0207645_102916192 | 49 |
| 196 | 3300025908 | Ga0207643_10022986 | Ga0207643_100229862 | 49 |
| 197 | 3300025908 | Ga0207643_11103461 | Ga0207643_111034612 | 49 |
| 198 | 3300025915 | Ga0207693_10008445 | Ga0207693_100084456 | 49 |
| 199 | 3300025916 | Ga0207663_10953971 | Ga0207663_109539711 | 49 |
| 200 | 3300025923 | Ga0207681_10065491 | Ga0207681_100654912 | 49 |
| 201 | 3300025925 | Ga0207650_10019282 | Ga0207650_100192825 | 49 |
| 202 | 3300025928 | Ga0207700_10233831 | Ga0207700_102338312 | 49 |
| 203 | 3300025928 | Ga0207700_10249064 | Ga0207700_102490642 | 49 |
| 204 | 3300025929 | Ga0207664_10104239 | Ga0207664_101042392 | 49 |
| 205 | 3300025929 | Ga0207664_10231379 | Ga0207664_102313793 | 49 |
| 206 | 3300025932 | Ga0207690_10695748 | Ga0207690_106957482 | 49 |
| 207 | 3300025933 | Ga0207706_10358299 | Ga0207706_103582992 | 49 |
| 208 | 3300025934 | Ga0207686_10308337 | Ga0207686_103083372 | 49 |
| 209 | 3300025935 | Ga0207709_10071831 | Ga0207709_100718313 | 49 |
| 210 | 3300025936 | Ga0207670_10058725 | Ga0207670_100587252 | 49 |
| 211 | 3300025936 | Ga0207670_10115792 | Ga0207670_101157923 | 49 |
| 212 | 3300025937 | Ga0207669_11961854 | Ga0207669_119618542 | 49 |
| 213 | 3300025938 | Ga0207704_11566462 | Ga0207704_115664621 | 49 |
| 214 | 3300025939 | Ga0207665_10519596 | Ga0207665_105195962 | 49 |
| 215 | 3300025940 | Ga0207691_10943404 | Ga0207691_109434042 | 49 |
| 216 | 3300025941 | Ga0207711_10012928 | Ga0207711_100129284 | 49 |
| 217 | 3300025942 | Ga0207689_10000171 | Ga0207689_1000017149 | 49 |
| 218 | 3300025945 | Ga0207679_10249924 | Ga0207679_102499243 | 49 |
| 219 | 3300025960 | Ga0207651_10323237 | Ga0207651_103232372 | 49 |
| 220 | 3300025960 | Ga0207651_11298725 | Ga0207651_112987252 | 49 |
| 221 | 3300025961 | Ga0207712_10238114 | Ga0207712_102381142 | 49 |
| 222 | 3300025972 | Ga0207668_10662468 | Ga0207668_106624682 | 49 |
| 223 | 3300025972 | Ga0207668_11905472 | Ga0207668_119054722 | 49 |
| 224 | 3300025981 | Ga0207640_11457509 | Ga0207640_114575092 | 49 |
| 225 | 3300025986 | Ga0207658_10036473 | Ga0207658_100364733 | 49 |
| 226 | 3300026035 | Ga0207703_10000464 | Ga0207703_1000046428 | 49 |
| 227 | 3300026035 | Ga0207703_11948419 | Ga0207703_119484191 | 49 |
| 228 | 3300026041 | Ga0207639_10496085 | Ga0207639_104960853 | 49 |
| 229 | 3300026088 | Ga0207641_10033949 | Ga0207641_100339492 | 49 |
| 230 | 3300026089 | Ga0207648_10004075 | Ga0207648_1000407512 | 49 |
| 231 | 3300026089 | Ga0207648_10817150 | Ga0207648_108171502 | 49 |
| 232 | 3300026095 | Ga0207676_10016916 | Ga0207676_100169162 | 49 |
| 233 | 3300026095 | Ga0207676_11028923 | Ga0207676_110289232 | 49 |
| 234 | 3300026116 | Ga0207674_10009315 | Ga0207674_100093159 | 49 |
| 235 | 3300026118 | Ga0207675_100013122 | Ga0207675_1000131224 | 49 |
| 236 | 3300026118 | Ga0207675_100640535 | Ga0207675_1006405352 | 49 |
| 237 | 3300026118 | Ga0207675_102568518 | Ga0207675_1025685182 | 49 |
| 238 | 3300026142 | Ga0207698_11308132 | Ga0207698_113081322 | 49 |
| 239 | 3300026142 | Ga0207698_12343020 | Ga0207698_123430202 | 49 |
| 240 | 3300027907 | Ga0207428_10016765 | Ga0207428_100167653 | 49 |
| 241 | 3300027907 | Ga0207428_10021763 | Ga0207428_100217636 | 49 |
| 242 | 3300028379 | Ga0268266_10092860 | Ga0268266_100928603 | 49 |
| 243 | 3300028379 | Ga0268266_10538458 | Ga0268266_105384582 | 49 |
| 244 | 3300028379 | Ga0268266_12350540 | Ga0268266_123505402 | 49 |
| 245 | 3300028380 | Ga0268265_10011945 | Ga0268265_100119453 | 49 |
| 246 | 3300028380 | Ga0268265_10488372 | Ga0268265_104883722 | 49 |
| 247 | 3300028380 | Ga0268265_12585260 | Ga0268265_125852602 | 49 |
| 248 | 3300028381 | Ga0268264_10001515 | Ga0268264_100015154 | 49 |
| 249 | 3300028381 | Ga0268264_10642713 | Ga0268264_106427132 | 49 |
| 250 | 3300028381 | Ga0268264_11413595 | Ga0268264_114135952 | 49 |
| 251 | 3300028800 | Ga0265338_10114917 | Ga0265338_101149172 | 49 |
| 252 | 3300028800 | Ga0265338_10613556 | Ga0265338_106135562 | 49 |
| 253 | 3300028800 | Ga0265338_10668674 | Ga0265338_106686742 | 49 |
| 254 | 3300029957 | Ga0265324_10006763 | Ga0265324_100067633 | 49 |
| 255 | 3300031239 | Ga0265328_10003733 | Ga0265328_100037336 | 49 |
| 256 | 3300031239 | Ga0265328_10098047 | Ga0265328_100980472 | 49 |
| 257 | 3300031241 | Ga0265325_10024269 | Ga0265325_100242693 | 49 |
| 258 | 3300031241 | Ga0265325_10111380 | Ga0265325_101113802 | 49 |
| 259 | 3300031249 | Ga0265339_10044955 | Ga0265339_100449553 | 49 |
| 260 | 3300031249 | Ga0265339_10226916 | Ga0265339_102269162 | 49 |
| 261 | 3300031250 | Ga0265331_10000247 | Ga0265331_1000024745 | 49 |
| 262 | 3300031250 | Ga0265331_10036305 | Ga0265331_100363051 | 49 |
| 263 | 3300031250 | Ga0265331_10112612 | Ga0265331_101126121 | 49 |
| 264 | 3300031251 | Ga0265327_10023457 | Ga0265327_100234572 | 49 |
| 265 | 3300031344 | Ga0265316_10209861 | Ga0265316_102098612 | 49 |
| 266 | 3300031595 | Ga0265313_10231007 | Ga0265313_102310072 | 49 |
| 267 | 3300031711 | Ga0265314_10130504 | Ga0265314_101305042 | 49 |
| 268 | 3300031712 | Ga0265342_10140469 | Ga0265342_101404692 | 49 |
| 269 | 3300035113 | Ga0373936_0200801 | Ga0373936_0200801_332_481 | 49 |
| 270 | 3300035114 | Ga0373939_0185760 | Ga0373939_0185760_285_434 | 49 |
| 271 | 3300035118 | Ga0373954_0676560 | Ga0373954_0676560_335_484 | 49 |
| 272 | 3300035170 | Ga0373943_0056320 | Ga0373943_0056320_1745_1894 | 49 |
| 273 | 3300035691 | Ga0373931_0193823 | Ga0373931_0193823_570_719 | 49 |
| 274 | 3300035691 | Ga0373931_0223543 | Ga0373931_0223543_83_232 | 49 |
| 275 | 3300035691 | Ga0373931_0517315 | Ga0373931_0517315_155_304 | 49 |
| 276 | 3300035692 | Ga0373935_0544927 | Ga0373935_0544927_440_589 | 49 |
| 277 | 3300035695 | Ga0373927_0578213 | Ga0373927_0578213_54_203 | 49 |
| 278 | 3300035695 | Ga0373927_0858655 | Ga0373927_0858655_133_282 | 49 |
| 279 | 3300035725 | Ga0373947_0086745 | Ga0373947_0086745_36_185 | 49 |
| 280 | 3300035725 | Ga0373947_0664591 | Ga0373947_0664591_397_546 | 49 |
| 281 | 3300037068 | Ga0373925_0042688 | Ga0373925_0042688_559_708 | 49 |
| 282 | 3300037068 | Ga0373925_0845393 | Ga0373925_0845393_189_338 | 49 |
| 283 | 3300037853 | Ga0436364_0574078 | Ga0436364_0574078_95_244 | 49 |
| 284 | 3300039437 | Ga0436365_0820984 | Ga0436365_0820984_953_1102 | 49 |
| 285 | 3300039437 | Ga0436365_0869883 | Ga0436365_0869883_417_566 | 49 |
| 286 | 3300039450 | Ga0436363_0402227 | Ga0436363_0402227_418_567 | 49 |
| 287 | 3300041452 | Ga0451793_1111873 | Ga0451793_1111873_441_590 | 49 |
| 288 | 3300041512 | Ga0451853_2022784 | Ga0451853_2022784_219_368 | 49 |
| 289 | 3300042876 | Ga0451577_0132183 | Ga0451577_0132183_1812_1961 | 49 |
| 290 | 3300042876 | Ga0451577_0193602 | Ga0451577_0193602_1628_1777 | 49 |
| 291 | 3300042876 | Ga0451577_0209539 | Ga0451577_0209539_442_591 | 49 |
| 292 | 3300042876 | Ga0451577_0292611 | Ga0451577_0292611_930_1079 | 49 |
| 293 | 3300044658 | Ga0466972_0506264 | Ga0466972_0506264_205_354 | 49 |
| 294 | 3300044673 | Ga0453683_0006182 | Ga0453683_0006182_4429_4578 | 49 |
| 295 | 3300044673 | Ga0453683_0015557 | Ga0453683_0015557_1130_1279 | 49 |
| 296 | 3300044684 | Ga0466966_0894995 | Ga0466966_0894995_350_499 | 49 |
| 297 | 3300044712 | Ga0453684_0000015 | Ga0453684_0000015_860097_860246 | 49 |
| 298 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_839917_840066 | 49 |
| 299 | 3300044712 | Ga0453684_0020836 | Ga0453684_0020836_3556_3705 | 49 |
| 300 | 3300044712 | Ga0453684_0517058 | Ga0453684_0517058_955_1104 | 49 |
| 301 | 3300044735 | Ga0466968_0312566 | Ga0466968_0312566_578_727 | 49 |
| 302 | 3300044735 | Ga0466968_0640833 | Ga0466968_0640833_247_396 | 49 |
| 303 | 3300045051 | Ga0451576_0000203 | Ga0451576_0000203_84447_84596 | 49 |
| 304 | 3300045051 | Ga0451576_0000863 | Ga0451576_0000863_21811_21960 | 49 |
| 305 | 3300045051 | Ga0451576_0003091 | Ga0451576_0003091_21574_21723 | 49 |
| 306 | 3300045051 | Ga0451576_0514088 | Ga0451576_0514088_409_558 | 49 |
| 307 | 3300045051 | Ga0451576_2281211 | Ga0451576_2281211_135_284 | 49 |
| 308 | 3300045051 | Ga0451576_2683832 | Ga0451576_2683832_347_496 | 49 |
| 309 | 3300045976 | Ga0466967_2140231 | Ga0466967_2140231_83_232 | 49 |
| 310 | 3300046459 | Ga0495629_0104690 | Ga0495629_0104690_1760_1909 | 49 |
| 311 | 3300046460 | Ga0495638_0177511 | Ga0495638_0177511_153_302 | 49 |
| 312 | 3300046460 | Ga0495638_0306213 | Ga0495638_0306213_198_347 | 49 |
| 313 | 3300046472 | Ga0495580_0884977 | Ga0495580_0884977_178_327 | 49 |
| 314 | 3300046472 | Ga0495580_0941935 | Ga0495580_0941935_226_375 | 49 |
| 315 | 3300046473 | Ga0495582_0310633 | Ga0495582_0310633_203_352 | 49 |
| 316 | 3300046474 | Ga0495605_0392253 | Ga0495605_0392253_170_319 | 49 |
| 317 | 3300046476 | Ga0495662_0382379 | Ga0495662_0382379_16_165 | 49 |
| 318 | 3300046477 | Ga0495664_0201077 | Ga0495664_0201077_208_357 | 49 |
| 319 | 3300046517 | Ga0495630_0711827 | Ga0495630_0711827_199_348 | 49 |
| 320 | 3300046522 | Ga0495643_0140317 | Ga0495643_0140317_475_624 | 49 |
| 321 | 3300046523 | Ga0495644_0320088 | Ga0495644_0320088_382_531 | 49 |
| 322 | 3300046533 | Ga0495640_0967864 | Ga0495640_0967864_207_356 | 49 |
| 323 | 3300046616 | Ga0495668_0055967 | Ga0495668_0055967_829_978 | 49 |
| 324 | 3300046642 | Ga0495634_0249724 | Ga0495634_0249724_299_448 | 49 |
| 325 | 3300046642 | Ga0495634_0371248 | Ga0495634_0371248_139_288 | 49 |
| 326 | 3300046642 | Ga0495634_0644864 | Ga0495634_0644864_446_595 | 49 |
| 327 | 3300046648 | Ga0495611_0302797 | Ga0495611_0302797_373_522 | 49 |
| 328 | 3300046678 | Ga0495599_0524964 | Ga0495599_0524964_436_585 | 49 |
| 329 | 3300046679 | Ga0495623_0427013 | Ga0495623_0427013_374_523 | 49 |
| 330 | 3300046681 | Ga0495647_0533491 | Ga0495647_0533491_106_255 | 49 |
| 331 | 3300046690 | Ga0495624_0170757 | Ga0495624_0170757_475_624 | 49 |
| 332 | 3300046690 | Ga0495624_0457305 | Ga0495624_0457305_170_319 | 49 |
| 333 | 3300046690 | Ga0495624_0762580 | Ga0495624_0762580_212_361 | 49 |
| 334 | 3300046692 | Ga0495671_0558766 | Ga0495671_0558766_187_336 | 49 |
| 335 | 3300047319 | Ga0495674_0313533 | Ga0495674_0313533_56_205 | 49 |
| 336 | 3300047471 | Ga0495684_0389357 | Ga0495684_0389357_269_418 | 49 |
| 337 | 3300047471 | Ga0495684_0469339 | Ga0495684_0469339_269_418 | 49 |
| 338 | 3300047673 | Ga0495593_0222643 | Ga0495593_0222643_639_788 | 49 |
| 339 | 3300048905 | Ga0496102_0125174 | Ga0496102_0125174_471_620 | 49 |
| 340 | 3300048906 | Ga0496103_0012360 | Ga0496103_0012360_793_942 | 49 |
| 341 | 3300048907 | Ga0496104_0407065 | Ga0496104_0407065_780_929 | 49 |
| 342 | 3300048911 | Ga0496108_0608052 | Ga0496108_0608052_431_580 | 49 |
| 343 | 3300048912 | Ga0496109_0417709 | Ga0496109_0417709_228_377 | 49 |
| 344 | 3300048912 | Ga0496109_1596625 | Ga0496109_1596625_403_552 | 49 |
| 345 | 3300048913 | Ga0496110_0263698 | Ga0496110_0263698_1224_1373 | 49 |
| 346 | 3300048914 | Ga0496111_1327911 | Ga0496111_1327911_85_234 | 49 |
| 347 | 3300048918 | Ga0496115_0042673 | Ga0496115_0042673_1997_2146 | 49 |
| 348 | 3300048918 | Ga0496115_0994423 | Ga0496115_0994423_426_575 | 49 |
| 349 | 3300049574 | Ga0501038_0397428 | Ga0501038_0397428_224_373 | 49 |
| 350 | 3300049583 | Ga0501067_0280248 | Ga0501067_0280248_411_560 | 49 |
| 351 | 3300049583 | Ga0501067_0382168 | Ga0501067_0382168_111_260 | 49 |
| 352 | 3300049583 | Ga0501067_0685041 | Ga0501067_0685041_373_522 | 49 |
| 353 | 3300049585 | Ga0501069_0923060 | Ga0501069_0923060_250_399 | 49 |
| 354 | 3300049589 | Ga0501073_0384093 | Ga0501073_0384093_68_217 | 49 |
| 355 | 3300049589 | Ga0501073_0413478 | Ga0501073_0413478_419_568 | 49 |
| 356 | 3300049742 | Ga0501080_0906495 | Ga0501080_0906495_61_210 | 49 |
| 357 | 3300050494 | nmdc:mga06z11_571794_c1 | nmdc:mga06z11_571794_c1_101_250 | 49 |
| 358 | 3300050496 | nmdc:mga07m45_424909_c1 | nmdc:mga07m45_424909_c1_309_458 | 49 |
| 359 | 3300050507 | nmdc:mga05p37_8689_c1 | nmdc:mga05p37_8689_c1_8653_8802 | 49 |
| 360 | 3300050508 | nmdc:mga09592_207576_c1 | nmdc:mga09592_207576_c1_524_673 | 49 |
| 361 | 3300050508 | nmdc:mga09592_2383_c1 | nmdc:mga09592_2383_c1_6576_6725 | 49 |
| 362 | 3300050509 | nmdc:mga0qj67_32605_c1 | nmdc:mga0qj67_32605_c1_2115_2264 | 49 |
| 363 | 3300050509 | nmdc:mga0qj67_59574_c1 | nmdc:mga0qj67_59574_c1_1855_2004 | 49 |
| 364 | 3300050510 | nmdc:mga06r32_7094_c1 | nmdc:mga06r32_7094_c1_1979_2128 | 49 |
| 365 | 3300050510 | nmdc:mga06r32_96109_c1 | nmdc:mga06r32_96109_c1_2148_2297 | 49 |
| 366 | 3300050511 | nmdc:mga08y16_13156_c1 | nmdc:mga08y16_13156_c1_2995_3144 | 49 |
| 367 | 3300050511 | nmdc:mga08y16_20207_c1 | nmdc:mga08y16_20207_c1_3620_3769 | 49 |
| 368 | 3300050512 | nmdc:mga0n895_1248009_c1 | nmdc:mga0n895_1248009_c1_184_333 | 49 |
| 369 | 3300050512 | nmdc:mga0n895_237294_c1 | nmdc:mga0n895_237294_c1_1458_1607 | 49 |
| 370 | 3300050512 | nmdc:mga0n895_293958_c1 | nmdc:mga0n895_293958_c1_303_452 | 49 |
| 371 | 3300050512 | nmdc:mga0n895_40414_c1 | nmdc:mga0n895_40414_c1_2451_2600 | 49 |
| 372 | 3300050512 | nmdc:mga0n895_413359_c1 | nmdc:mga0n895_413359_c1_1028_1177 | 49 |
| 373 | 3300050513 | nmdc:mga0rr50_549627_c1 | nmdc:mga0rr50_549627_c1_405_554 | 49 |
| 374 | 3300050513 | nmdc:mga0rr50_954746_c1 | nmdc:mga0rr50_954746_c1_378_527 | 49 |
| 375 | 3300050514 | nmdc:mga08x19_1063571_c1 | nmdc:mga08x19_1063571_c1_55_204 | 49 |
| 376 | 3300050514 | nmdc:mga08x19_1158850_c1 | nmdc:mga08x19_1158850_c1_16_165 | 49 |
| 377 | 3300050514 | nmdc:mga08x19_916772_c1 | nmdc:mga08x19_916772_c1_444_593 | 49 |
| 378 | 3300050515 | nmdc:mga0a205_36569_c1 | nmdc:mga0a205_36569_c1_2587_2736 | 49 |
| 379 | 3300050516 | nmdc:mga0sz30_175604_c1 | nmdc:mga0sz30_175604_c1_672_821 | 49 |
| 380 | 3300053077 | Ga0495601_0098753 | Ga0495601_0098753_676_825 | 49 |
| 381 | 3300053078 | Ga0495612_0028179 | Ga0495612_0028179_16_165 | 49 |
| 382 | 3300053079 | Ga0500610_0367761 | Ga0500610_0367761_361_510 | 49 |
| 383 | 3300053084 | Ga0495595_0283669 | Ga0495595_0283669_276_425 | 49 |
| 384 | 3300053084 | Ga0495595_0711475 | Ga0495595_0711475_314_463 | 49 |
| 385 | 3300053085 | Ga0495619_0020222 | Ga0495619_0020222_584_733 | 49 |
| 386 | 3300053088 | Ga0500644_0363605 | Ga0500644_0363605_114_263 | 49 |
| 387 | 3300053118 | Ga0500594_0108816 | Ga0500594_0108816_695_844 | 49 |
| 388 | 3300053130 | Ga0500642_0515829 | Ga0500642_0515829_89_238 | 49 |
| 389 | 3300053142 | Ga0500577_0069185 | Ga0500577_0069185_1048_1197 | 49 |
| 390 | 3300053142 | Ga0500577_0182992 | Ga0500577_0182992_299_448 | 49 |
| 391 | 3300053153 | Ga0500616_0149582 | Ga0500616_0149582_440_589 | 49 |
| 392 | 3300003203 | JGI25406J46586_10030719 | JGI25406J46586_100307192 | 50 |
| 393 | 3300003911 | JGI25405J52794_10090595 | JGI25405J52794_100905952 | 50 |
| 394 | 3300004803 | Ga0058862_12858404 | Ga0058862_128584042 | 50 |
| 395 | 3300005293 | Ga0065715_10874724 | Ga0065715_108747242 | 50 |
| 396 | 3300005327 | Ga0070658_10131935 | Ga0070658_101319352 | 50 |
| 397 | 3300005328 | Ga0070676_11003826 | Ga0070676_110038262 | 50 |
| 398 | 3300005329 | Ga0070683_100004443 | Ga0070683_1000044432 | 50 |
| 399 | 3300005329 | Ga0070683_100033923 | Ga0070683_1000339234 | 50 |
| 400 | 3300005329 | Ga0070683_100912673 | Ga0070683_1009126732 | 50 |
| 401 | 3300005330 | Ga0070690_100434208 | Ga0070690_1004342082 | 50 |
| 402 | 3300005330 | Ga0070690_100706536 | Ga0070690_1007065362 | 50 |
| 403 | 3300005331 | Ga0070670_100162620 | Ga0070670_1001626202 | 50 |
| 404 | 3300005331 | Ga0070670_100430999 | Ga0070670_1004309991 | 50 |
| 405 | 3300005331 | Ga0070670_100610163 | Ga0070670_1006101632 | 50 |
| 406 | 3300005333 | Ga0070677_10871200 | Ga0070677_108712002 | 50 |
| 407 | 3300005336 | Ga0070680_100274888 | Ga0070680_1002748883 | 50 |
| 408 | 3300005336 | Ga0070680_101621571 | Ga0070680_1016215712 | 50 |
| 409 | 3300005337 | Ga0070682_100039976 | Ga0070682_1000399762 | 50 |
| 410 | 3300005337 | Ga0070682_100162503 | Ga0070682_1001625032 | 50 |
| 411 | 3300005337 | Ga0070682_101020341 | Ga0070682_1010203412 | 50 |
| 412 | 3300005338 | Ga0068868_100251129 | Ga0068868_1002511292 | 50 |
| 413 | 3300005338 | Ga0068868_101340941 | Ga0068868_1013409412 | 50 |
| 414 | 3300005339 | Ga0070660_100187370 | Ga0070660_1001873703 | 50 |
| 415 | 3300005339 | Ga0070660_101891519 | Ga0070660_1018915192 | 50 |
| 416 | 3300005340 | Ga0070689_100242355 | Ga0070689_1002423552 | 50 |
| 417 | 3300005341 | Ga0070691_10124334 | Ga0070691_101243342 | 50 |
| 418 | 3300005341 | Ga0070691_10365617 | Ga0070691_103656172 | 50 |
| 419 | 3300005344 | Ga0070661_100043611 | Ga0070661_1000436113 | 50 |
| 420 | 3300005344 | Ga0070661_100669555 | Ga0070661_1006695551 | 50 |
| 421 | 3300005344 | Ga0070661_101067422 | Ga0070661_1010674222 | 50 |
| 422 | 3300005345 | Ga0070692_10388411 | Ga0070692_103884112 | 50 |
| 423 | 3300005345 | Ga0070692_11316610 | Ga0070692_113166102 | 50 |
| 424 | 3300005347 | Ga0070668_100429687 | Ga0070668_1004296872 | 50 |
| 425 | 3300005347 | Ga0070668_101055912 | Ga0070668_1010559121 | 50 |
| 426 | 3300005347 | Ga0070668_101784614 | Ga0070668_1017846141 | 50 |
| 427 | 3300005347 | Ga0070668_101953501 | Ga0070668_1019535011 | 50 |
| 428 | 3300005353 | Ga0070669_100034441 | Ga0070669_1000344415 | 50 |
| 429 | 3300005353 | Ga0070669_100050479 | Ga0070669_1000504794 | 50 |
| 430 | 3300005353 | Ga0070669_101457439 | Ga0070669_1014574392 | 50 |
| 431 | 3300005354 | Ga0070675_100066680 | Ga0070675_1000666802 | 50 |
| 432 | 3300005354 | Ga0070675_100306306 | Ga0070675_1003063062 | 50 |
| 433 | 3300005355 | Ga0070671_101430619 | Ga0070671_1014306192 | 50 |
| 434 | 3300005355 | Ga0070671_101661487 | Ga0070671_1016614872 | 50 |
| 435 | 3300005364 | Ga0070673_100050408 | Ga0070673_1000504082 | 50 |
| 436 | 3300005364 | Ga0070673_100452159 | Ga0070673_1004521593 | 50 |
| 437 | 3300005364 | Ga0070673_101620520 | Ga0070673_1016205202 | 50 |
| 438 | 3300005365 | Ga0070688_100384736 | Ga0070688_1003847362 | 50 |
| 439 | 3300005365 | Ga0070688_100398958 | Ga0070688_1003989583 | 50 |
| 440 | 3300005365 | Ga0070688_100873219 | Ga0070688_1008732191 | 50 |
| 441 | 3300005367 | Ga0070667_100630757 | Ga0070667_1006307572 | 50 |
| 442 | 3300005367 | Ga0070667_100772708 | Ga0070667_1007727082 | 50 |
| 443 | 3300005367 | Ga0070667_102266512 | Ga0070667_1022665122 | 50 |
| 444 | 3300005434 | Ga0070709_10112676 | Ga0070709_101126762 | 50 |
| 445 | 3300005434 | Ga0070709_10243301 | Ga0070709_102433013 | 50 |
| 446 | 3300005434 | Ga0070709_10293176 | Ga0070709_102931762 | 50 |
| 447 | 3300005435 | Ga0070714_100073056 | Ga0070714_1000730562 | 50 |
| 448 | 3300005435 | Ga0070714_100102355 | Ga0070714_1001023553 | 50 |
| 449 | 3300005435 | Ga0070714_100660723 | Ga0070714_1006607232 | 50 |
| 450 | 3300005435 | Ga0070714_100865746 | Ga0070714_1008657462 | 50 |
| 451 | 3300005436 | Ga0070713_100027835 | Ga0070713_1000278355 | 50 |
| 452 | 3300005436 | Ga0070713_100047532 | Ga0070713_1000475324 | 50 |
| 453 | 3300005436 | Ga0070713_100060357 | Ga0070713_1000603574 | 50 |
| 454 | 3300005436 | Ga0070713_100216314 | Ga0070713_1002163142 | 50 |
| 455 | 3300005437 | Ga0070710_10077434 | Ga0070710_100774342 | 50 |
| 456 | 3300005437 | Ga0070710_10196582 | Ga0070710_101965823 | 50 |
| 457 | 3300005437 | Ga0070710_11222692 | Ga0070710_112226922 | 50 |
| 458 | 3300005438 | Ga0070701_11207723 | Ga0070701_112077232 | 50 |
| 459 | 3300005439 | Ga0070711_101028427 | Ga0070711_1010284271 | 50 |
| 460 | 3300005439 | Ga0070711_101947352 | Ga0070711_1019473521 | 50 |
| 461 | 3300005440 | Ga0070705_101437375 | Ga0070705_1014373752 | 50 |
| 462 | 3300005441 | Ga0070700_100888587 | Ga0070700_1008885872 | 50 |
| 463 | 3300005441 | Ga0070700_100958214 | Ga0070700_1009582142 | 50 |
| 464 | 3300005445 | Ga0070708_100252458 | Ga0070708_1002524581 | 50 |
| 465 | 3300005445 | Ga0070708_100270417 | Ga0070708_1002704172 | 50 |
| 466 | 3300005455 | Ga0070663_101250849 | Ga0070663_1012508492 | 50 |
| 467 | 3300005456 | Ga0070678_100038096 | Ga0070678_1000380962 | 50 |
| 468 | 3300005456 | Ga0070678_100343831 | Ga0070678_1003438313 | 50 |
| 469 | 3300005456 | Ga0070678_100496516 | Ga0070678_1004965162 | 50 |
| 470 | 3300005456 | Ga0070678_100566086 | Ga0070678_1005660862 | 50 |
| 471 | 3300005456 | Ga0070678_101876861 | Ga0070678_1018768611 | 50 |
| 472 | 3300005458 | Ga0070681_10048012 | Ga0070681_100480123 | 50 |
| 473 | 3300005458 | Ga0070681_10052271 | Ga0070681_100522713 | 50 |
| 474 | 3300005458 | Ga0070681_11164486 | Ga0070681_111644862 | 50 |
| 475 | 3300005458 | Ga0070681_11432511 | Ga0070681_114325112 | 50 |
| 476 | 3300005458 | Ga0070681_11505719 | Ga0070681_115057192 | 50 |
| 477 | 3300005459 | Ga0068867_100192548 | Ga0068867_1001925482 | 50 |
| 478 | 3300005459 | Ga0068867_100617106 | Ga0068867_1006171062 | 50 |
| 479 | 3300005459 | Ga0068867_101875773 | Ga0068867_1018757732 | 50 |
| 480 | 3300005466 | Ga0070685_10342578 | Ga0070685_103425782 | 50 |
| 481 | 3300005466 | Ga0070685_10413731 | Ga0070685_104137311 | 50 |
| 482 | 3300005466 | Ga0070685_10654335 | Ga0070685_106543352 | 50 |
| 483 | 3300005466 | Ga0070685_11123310 | Ga0070685_111233102 | 50 |
| 484 | 3300005467 | Ga0070706_100065125 | Ga0070706_1000651253 | 50 |
| 485 | 3300005468 | Ga0070707_100065107 | Ga0070707_1000651072 | 50 |
| 486 | 3300005468 | Ga0070707_101370156 | Ga0070707_1013701561 | 50 |
| 487 | 3300005471 | Ga0070698_100058117 | Ga0070698_1000581178 | 50 |
| 488 | 3300005471 | Ga0070698_100090301 | Ga0070698_1000903013 | 50 |
| 489 | 3300005471 | Ga0070698_101609126 | Ga0070698_1016091261 | 50 |
| 490 | 3300005518 | Ga0070699_100059857 | Ga0070699_1000598572 | 50 |
| 491 | 3300005530 | Ga0070679_100059679 | Ga0070679_1000596794 | 50 |
| 492 | 3300005530 | Ga0070679_100382826 | Ga0070679_1003828262 | 50 |
| 493 | 3300005530 | Ga0070679_100392092 | Ga0070679_1003920923 | 50 |
| 494 | 3300005530 | Ga0070679_100444240 | Ga0070679_1004442402 | 50 |
| 495 | 3300005530 | Ga0070679_101038979 | Ga0070679_1010389791 | 50 |
| 496 | 3300005535 | Ga0070684_100007463 | Ga0070684_1000074634 | 50 |
| 497 | 3300005535 | Ga0070684_100106264 | Ga0070684_1001062643 | 50 |
| 498 | 3300005535 | Ga0070684_101395147 | Ga0070684_1013951472 | 50 |
| 499 | 3300005536 | Ga0070697_100020437 | Ga0070697_1000204372 | 50 |
| 500 | 3300005536 | Ga0070697_100508271 | Ga0070697_1005082712 | 50 |
| 501 | 3300005539 | Ga0068853_100174646 | Ga0068853_1001746463 | 50 |
| 502 | 3300005539 | Ga0068853_100239099 | Ga0068853_1002390992 | 50 |
| 503 | 3300005539 | Ga0068853_100478387 | Ga0068853_1004783872 | 50 |
| 504 | 3300005539 | Ga0068853_101071634 | Ga0068853_1010716342 | 50 |
| 505 | 3300005539 | Ga0068853_101948537 | Ga0068853_1019485372 | 50 |
| 506 | 3300005539 | Ga0068853_101982387 | Ga0068853_1019823872 | 50 |
| 507 | 3300005543 | Ga0070672_100010053 | Ga0070672_1000100536 | 50 |
| 508 | 3300005544 | Ga0070686_101810100 | Ga0070686_1018101001 | 50 |
| 509 | 3300005544 | Ga0070686_101841928 | Ga0070686_1018419282 | 50 |
| 510 | 3300005546 | Ga0070696_101611494 | Ga0070696_1016114942 | 50 |
| 511 | 3300005547 | Ga0070693_100181407 | Ga0070693_1001814072 | 50 |
| 512 | 3300005547 | Ga0070693_100465017 | Ga0070693_1004650172 | 50 |
| 513 | 3300005547 | Ga0070693_100969406 | Ga0070693_1009694062 | 50 |
| 514 | 3300005548 | Ga0070665_100271847 | Ga0070665_1002718472 | 50 |
| 515 | 3300005548 | Ga0070665_100385356 | Ga0070665_1003853562 | 50 |
| 516 | 3300005548 | Ga0070665_100783324 | Ga0070665_1007833242 | 50 |
| 517 | 3300005548 | Ga0070665_101504249 | Ga0070665_1015042492 | 50 |
| 518 | 3300005563 | Ga0068855_100025340 | Ga0068855_1000253405 | 50 |
| 519 | 3300005563 | Ga0068855_100168944 | Ga0068855_1001689443 | 50 |
| 520 | 3300005563 | Ga0068855_100187077 | Ga0068855_1001870772 | 50 |
| 521 | 3300005563 | Ga0068855_101178465 | Ga0068855_1011784652 | 50 |
| 522 | 3300005563 | Ga0068855_101603565 | Ga0068855_1016035652 | 50 |
| 523 | 3300005564 | Ga0070664_100316783 | Ga0070664_1003167832 | 50 |
| 524 | 3300005564 | Ga0070664_101261183 | Ga0070664_1012611832 | 50 |
| 525 | 3300005577 | Ga0068857_100541876 | Ga0068857_1005418762 | 50 |
| 526 | 3300005577 | Ga0068857_101286352 | Ga0068857_1012863522 | 50 |
| 527 | 3300005578 | Ga0068854_100219364 | Ga0068854_1002193642 | 50 |
| 528 | 3300005614 | Ga0068856_100113034 | Ga0068856_1001130342 | 50 |
| 529 | 3300005614 | Ga0068856_100212884 | Ga0068856_1002128842 | 50 |
| 530 | 3300005614 | Ga0068856_101044042 | Ga0068856_1010440422 | 50 |
| 531 | 3300005615 | Ga0070702_101062416 | Ga0070702_1010624162 | 50 |
| 532 | 3300005616 | Ga0068852_100814121 | Ga0068852_1008141212 | 50 |
| 533 | 3300005616 | Ga0068852_101324341 | Ga0068852_1013243412 | 50 |
| 534 | 3300005617 | Ga0068859_100184715 | Ga0068859_1001847152 | 50 |
| 535 | 3300005617 | Ga0068859_102411696 | Ga0068859_1024116962 | 50 |
| 536 | 3300005618 | Ga0068864_102020404 | Ga0068864_1020204042 | 50 |
| 537 | 3300005618 | Ga0068864_102266430 | Ga0068864_1022664301 | 50 |
| 538 | 3300005718 | Ga0068866_10833761 | Ga0068866_108337612 | 50 |
| 539 | 3300005719 | Ga0068861_101210984 | Ga0068861_1012109842 | 50 |
| 540 | 3300005840 | Ga0068870_10488874 | Ga0068870_104888742 | 50 |
| 541 | 3300005840 | Ga0068870_11124370 | Ga0068870_111243702 | 50 |
| 542 | 3300005841 | Ga0068863_100086250 | Ga0068863_1000862503 | 50 |
| 543 | 3300005841 | Ga0068863_101154561 | Ga0068863_1011545612 | 50 |
| 544 | 3300005842 | Ga0068858_100143105 | Ga0068858_1001431052 | 50 |
| 545 | 3300005842 | Ga0068858_100870038 | Ga0068858_1008700382 | 50 |
| 546 | 3300005842 | Ga0068858_100949509 | Ga0068858_1009495092 | 50 |
| 547 | 3300005842 | Ga0068858_101988129 | Ga0068858_1019881292 | 50 |
| 548 | 3300005843 | Ga0068860_100000149 | Ga0068860_10000014965 | 50 |
| 549 | 3300005843 | Ga0068860_100521163 | Ga0068860_1005211632 | 50 |
| 550 | 3300005843 | Ga0068860_101617533 | Ga0068860_1016175332 | 50 |
| 551 | 3300005844 | Ga0068862_100131633 | Ga0068862_1001316332 | 50 |
| 552 | 3300005844 | Ga0068862_100222846 | Ga0068862_1002228463 | 50 |
| 553 | 3300005844 | Ga0068862_100371395 | Ga0068862_1003713952 | 50 |
| 554 | 3300005844 | Ga0068862_100406614 | Ga0068862_1004066142 | 50 |
| 555 | 3300005844 | Ga0068862_101773246 | Ga0068862_1017732462 | 50 |
| 556 | 3300005844 | Ga0068862_102369173 | Ga0068862_1023691732 | 50 |
| 557 | 3300005937 | Ga0081455_10001001 | Ga0081455_1000100121 | 50 |
| 558 | 3300005937 | Ga0081455_10007427 | Ga0081455_100074272 | 50 |
| 559 | 3300005937 | Ga0081455_10091268 | Ga0081455_100912684 | 50 |
| 560 | 3300005937 | Ga0081455_10910420 | Ga0081455_109104202 | 50 |
| 561 | 3300005981 | Ga0081538_10138715 | Ga0081538_101387152 | 50 |
| 562 | 3300005983 | Ga0081540_1186596 | Ga0081540_11865962 | 50 |
| 563 | 3300005985 | Ga0081539_10001452 | Ga0081539_100014522 | 50 |
| 564 | 3300005985 | Ga0081539_10007767 | Ga0081539_1000776710 | 50 |
| 565 | 3300006028 | Ga0070717_10002484 | Ga0070717_1000248414 | 50 |
| 566 | 3300006028 | Ga0070717_10003662 | Ga0070717_1000366211 | 50 |
| 567 | 3300006028 | Ga0070717_10060928 | Ga0070717_100609284 | 50 |
| 568 | 3300006028 | Ga0070717_11202793 | Ga0070717_112027932 | 50 |
| 569 | 3300006038 | Ga0075365_10005466 | Ga0075365_100054668 | 50 |
| 570 | 3300006038 | Ga0075365_10169119 | Ga0075365_101691192 | 50 |
| 571 | 3300006038 | Ga0075365_10207547 | Ga0075365_102075472 | 50 |
| 572 | 3300006038 | Ga0075365_10558838 | Ga0075365_105588382 | 50 |
| 573 | 3300006038 | Ga0075365_10597471 | Ga0075365_105974712 | 50 |
| 574 | 3300006038 | Ga0075365_10630465 | Ga0075365_106304652 | 50 |
| 575 | 3300006042 | Ga0075368_10110543 | Ga0075368_101105433 | 50 |
| 576 | 3300006042 | Ga0075368_10374334 | Ga0075368_103743342 | 50 |
| 577 | 3300006048 | Ga0075363_100067216 | Ga0075363_1000672162 | 50 |
| 578 | 3300006048 | Ga0075363_100141991 | Ga0075363_1001419913 | 50 |
| 579 | 3300006051 | Ga0075364_10035360 | Ga0075364_100353602 | 50 |
| 580 | 3300006051 | Ga0075364_10174371 | Ga0075364_101743713 | 50 |
| 581 | 3300006051 | Ga0075364_10503654 | Ga0075364_105036542 | 50 |
| 582 | 3300006058 | Ga0075432_10085982 | Ga0075432_100859822 | 50 |
| 583 | 3300006163 | Ga0070715_10410531 | Ga0070715_104105311 | 50 |
| 584 | 3300006163 | Ga0070715_10647226 | Ga0070715_106472261 | 50 |
| 585 | 3300006163 | Ga0070715_11047873 | Ga0070715_110478732 | 50 |
| 586 | 3300006173 | Ga0070716_100092196 | Ga0070716_1000921963 | 50 |
| 587 | 3300006173 | Ga0070716_100174999 | Ga0070716_1001749993 | 50 |
| 588 | 3300006173 | Ga0070716_101256805 | Ga0070716_1012568052 | 50 |
| 589 | 3300006175 | Ga0070712_100729473 | Ga0070712_1007294732 | 50 |
| 590 | 3300006177 | Ga0075362_10002622 | Ga0075362_100026223 | 50 |
| 591 | 3300006177 | Ga0075362_10003948 | Ga0075362_100039482 | 50 |
| 592 | 3300006177 | Ga0075362_10004980 | Ga0075362_100049807 | 50 |
| 593 | 3300006177 | Ga0075362_10067150 | Ga0075362_100671502 | 50 |
| 594 | 3300006177 | Ga0075362_10104884 | Ga0075362_101048843 | 50 |
| 595 | 3300006177 | Ga0075362_10527718 | Ga0075362_105277182 | 50 |
| 596 | 3300006178 | Ga0075367_10006371 | Ga0075367_100063712 | 50 |
| 597 | 3300006178 | Ga0075367_10081795 | Ga0075367_100817953 | 50 |
| 598 | 3300006178 | Ga0075367_10372777 | Ga0075367_103727772 | 50 |
| 599 | 3300006178 | Ga0075367_10484337 | Ga0075367_104843371 | 50 |
| 600 | 3300006186 | Ga0075369_10001306 | Ga0075369_100013063 | 50 |
| 601 | 3300006186 | Ga0075369_10075756 | Ga0075369_100757564 | 50 |
| 602 | 3300006186 | Ga0075369_10149250 | Ga0075369_101492503 | 50 |
| 603 | 3300006195 | Ga0075366_10000880 | Ga0075366_1000088011 | 50 |
| 604 | 3300006195 | Ga0075366_10157169 | Ga0075366_101571692 | 50 |
| 605 | 3300006195 | Ga0075366_10187591 | Ga0075366_101875913 | 50 |
| 606 | 3300006195 | Ga0075366_10190723 | Ga0075366_101907233 | 50 |
| 607 | 3300006237 | Ga0097621_100278535 | Ga0097621_1002785352 | 50 |
| 608 | 3300006237 | Ga0097621_100663585 | Ga0097621_1006635852 | 50 |
| 609 | 3300006237 | Ga0097621_100862381 | Ga0097621_1008623812 | 50 |
| 610 | 3300006353 | Ga0075370_10045498 | Ga0075370_100454982 | 50 |
| 611 | 3300006353 | Ga0075370_10078629 | Ga0075370_100786292 | 50 |
| 612 | 3300006353 | Ga0075370_10224866 | Ga0075370_102248662 | 50 |
| 613 | 3300006353 | Ga0075370_10346164 | Ga0075370_103461642 | 50 |
| 614 | 3300006358 | Ga0068871_100385436 | Ga0068871_1003854362 | 50 |
| 615 | 3300006358 | Ga0068871_100705272 | Ga0068871_1007052722 | 50 |
| 616 | 3300006844 | Ga0075428_100561180 | Ga0075428_1005611802 | 50 |
| 617 | 3300006844 | Ga0075428_101171392 | Ga0075428_1011713922 | 50 |
| 618 | 3300006844 | Ga0075428_102272686 | Ga0075428_1022726862 | 50 |
| 619 | 3300006846 | Ga0075430_100812322 | Ga0075430_1008123222 | 50 |
| 620 | 3300006847 | Ga0075431_102136570 | Ga0075431_1021365702 | 50 |
| 621 | 3300006852 | Ga0075433_10003359 | Ga0075433_100033598 | 50 |
| 622 | 3300006871 | Ga0075434_100020139 | Ga0075434_1000201392 | 50 |
| 623 | 3300006871 | Ga0075434_100067222 | Ga0075434_1000672223 | 50 |
| 624 | 3300006871 | Ga0075434_100193791 | Ga0075434_1001937913 | 50 |
| 625 | 3300006871 | Ga0075434_100866084 | Ga0075434_1008660842 | 50 |
| 626 | 3300006880 | Ga0075429_100437713 | Ga0075429_1004377133 | 50 |
| 627 | 3300006880 | Ga0075429_100609623 | Ga0075429_1006096233 | 50 |
| 628 | 3300006881 | Ga0068865_100266213 | Ga0068865_1002662132 | 50 |
| 629 | 3300006914 | Ga0075436_100270712 | Ga0075436_1002707122 | 50 |
| 630 | 3300006931 | Ga0097620_100184722 | Ga0097620_1001847222 | 50 |
| 631 | 3300006931 | Ga0097620_102411355 | Ga0097620_1024113552 | 50 |
| 632 | 3300007076 | Ga0075435_100235203 | Ga0075435_1002352033 | 50 |
| 633 | 3300007265 | Ga0099794_10017466 | Ga0099794_100174662 | 50 |
| 634 | 3300009092 | Ga0105250_10108891 | Ga0105250_101088912 | 50 |
| 635 | 3300009093 | Ga0105240_10075127 | Ga0105240_100751272 | 50 |
| 636 | 3300009093 | Ga0105240_10357095 | Ga0105240_103570953 | 50 |
| 637 | 3300009093 | Ga0105240_10822753 | Ga0105240_108227532 | 50 |
| 638 | 3300009093 | Ga0105240_11779767 | Ga0105240_117797672 | 50 |
| 639 | 3300009093 | Ga0105240_11879762 | Ga0105240_118797622 | 50 |
| 640 | 3300009094 | Ga0111539_10068483 | Ga0111539_100684835 | 50 |
| 641 | 3300009094 | Ga0111539_10089231 | Ga0111539_100892313 | 50 |
| 642 | 3300009094 | Ga0111539_12192369 | Ga0111539_121923692 | 50 |
| 643 | 3300009098 | Ga0105245_10575581 | Ga0105245_105755813 | 50 |
| 644 | 3300009098 | Ga0105245_10593084 | Ga0105245_105930843 | 50 |
| 645 | 3300009098 | Ga0105245_11669470 | Ga0105245_116694702 | 50 |
| 646 | 3300009098 | Ga0105245_11764188 | Ga0105245_117641882 | 50 |
| 647 | 3300009098 | Ga0105245_11818477 | Ga0105245_118184772 | 50 |
| 648 | 3300009098 | Ga0105245_12994096 | Ga0105245_129940961 | 50 |
| 649 | 3300009101 | Ga0105247_10041211 | Ga0105247_100412113 | 50 |
| 650 | 3300009101 | Ga0105247_10324994 | Ga0105247_103249942 | 50 |
| 651 | 3300009101 | Ga0105247_10515367 | Ga0105247_105153672 | 50 |
| 652 | 3300009101 | Ga0105247_10562553 | Ga0105247_105625532 | 50 |
| 653 | 3300009101 | Ga0105247_11345847 | Ga0105247_113458472 | 50 |
| 654 | 3300009147 | Ga0114129_11558884 | Ga0114129_115588842 | 50 |
| 655 | 3300009148 | Ga0105243_11152555 | Ga0105243_111525552 | 50 |
| 656 | 3300009148 | Ga0105243_11241130 | Ga0105243_112411302 | 50 |
| 657 | 3300009174 | Ga0105241_10128324 | Ga0105241_101283242 | 50 |
| 658 | 3300009174 | Ga0105241_11754185 | Ga0105241_117541851 | 50 |
| 659 | 3300009174 | Ga0105241_11767469 | Ga0105241_117674691 | 50 |
| 660 | 3300009174 | Ga0105241_11931794 | Ga0105241_119317942 | 50 |
| 661 | 3300009174 | Ga0105241_11989951 | Ga0105241_119899512 | 50 |
| 662 | 3300009177 | Ga0105248_11398025 | Ga0105248_113980253 | 50 |
| 663 | 3300009177 | Ga0105248_11404553 | Ga0105248_114045532 | 50 |
| 664 | 3300009177 | Ga0105248_12667761 | Ga0105248_126677611 | 50 |
| 665 | 3300009177 | Ga0105248_13334491 | Ga0105248_133344912 | 50 |
| 666 | 3300009545 | Ga0105237_10053338 | Ga0105237_100533382 | 50 |
| 667 | 3300009545 | Ga0105237_10055453 | Ga0105237_100554535 | 50 |
| 668 | 3300009545 | Ga0105237_10149240 | Ga0105237_101492403 | 50 |
| 669 | 3300009545 | Ga0105237_10229785 | Ga0105237_102297852 | 50 |
| 670 | 3300009545 | Ga0105237_10363524 | Ga0105237_103635242 | 50 |
| 671 | 3300009545 | Ga0105237_11926353 | Ga0105237_119263532 | 50 |
| 672 | 3300009551 | Ga0105238_10257663 | Ga0105238_102576632 | 50 |
| 673 | 3300009551 | Ga0105238_10345144 | Ga0105238_103451442 | 50 |
| 674 | 3300009551 | Ga0105238_10793711 | Ga0105238_107937112 | 50 |
| 675 | 3300009551 | Ga0105238_11280213 | Ga0105238_112802131 | 50 |
| 676 | 3300009553 | Ga0105249_11197395 | Ga0105249_111973952 | 50 |
| 677 | 3300009553 | Ga0105249_11326698 | Ga0105249_113266982 | 50 |
| 678 | 3300009988 | Ga0105035_116424 | Ga0105035_1164242 | 50 |
| 679 | 3300010159 | Ga0099796_10095363 | Ga0099796_100953632 | 50 |
| 680 | 3300010159 | Ga0099796_10119314 | Ga0099796_101193142 | 50 |
| 681 | 3300010375 | Ga0105239_10085772 | Ga0105239_100857722 | 50 |
| 682 | 3300010375 | Ga0105239_10644134 | Ga0105239_106441343 | 50 |
| 683 | 3300010375 | Ga0105239_12092602 | Ga0105239_120926022 | 50 |
| 684 | 3300010375 | Ga0105239_12483287 | Ga0105239_124832872 | 50 |
| 685 | 3300010375 | Ga0105239_12680615 | Ga0105239_126806151 | 50 |
| 686 | 3300011119 | Ga0105246_10225045 | Ga0105246_102250453 | 50 |
| 687 | 3300011119 | Ga0105246_10772466 | Ga0105246_107724662 | 50 |
| 688 | 3300013100 | Ga0157373_10445422 | Ga0157373_104454222 | 50 |
| 689 | 3300013102 | Ga0157371_10037740 | Ga0157371_100377402 | 50 |
| 690 | 3300013102 | Ga0157371_10806974 | Ga0157371_108069742 | 50 |
| 691 | 3300013104 | Ga0157370_10240766 | Ga0157370_102407662 | 50 |
| 692 | 3300013104 | Ga0157370_10598302 | Ga0157370_105983022 | 50 |
| 693 | 3300013104 | Ga0157370_10676620 | Ga0157370_106766202 | 50 |
| 694 | 3300013104 | Ga0157370_10728503 | Ga0157370_107285032 | 50 |
| 695 | 3300013104 | Ga0157370_10742744 | Ga0157370_107427442 | 50 |
| 696 | 3300013104 | Ga0157370_11861012 | Ga0157370_118610121 | 50 |
| 697 | 3300013105 | Ga0157369_10059379 | Ga0157369_100593792 | 50 |
| 698 | 3300013105 | Ga0157369_10288107 | Ga0157369_102881072 | 50 |
| 699 | 3300013105 | Ga0157369_10484948 | Ga0157369_104849482 | 50 |
| 700 | 3300013105 | Ga0157369_10524350 | Ga0157369_105243501 | 50 |
| 701 | 3300013296 | Ga0157374_10194493 | Ga0157374_101944933 | 50 |
| 702 | 3300013296 | Ga0157374_10202392 | Ga0157374_102023922 | 50 |
| 703 | 3300013296 | Ga0157374_11170581 | Ga0157374_111705812 | 50 |
| 704 | 3300013297 | Ga0157378_10395136 | Ga0157378_103951361 | 50 |
| 705 | 3300013297 | Ga0157378_10716397 | Ga0157378_107163972 | 50 |
| 706 | 3300013297 | Ga0157378_11194236 | Ga0157378_111942362 | 50 |
| 707 | 3300013297 | Ga0157378_12561561 | Ga0157378_125615612 | 50 |
| 708 | 3300013306 | Ga0163162_10082452 | Ga0163162_100824524 | 50 |
| 709 | 3300013306 | Ga0163162_10354072 | Ga0163162_103540723 | 50 |
| 710 | 3300013306 | Ga0163162_10395900 | Ga0163162_103959003 | 50 |
| 711 | 3300013306 | Ga0163162_11056463 | Ga0163162_110564634 | 50 |
| 712 | 3300013306 | Ga0163162_12087887 | Ga0163162_120878872 | 50 |
| 713 | 3300013307 | Ga0157372_10044917 | Ga0157372_100449174 | 50 |
| 714 | 3300013307 | Ga0157372_10237973 | Ga0157372_102379733 | 50 |
| 715 | 3300013307 | Ga0157372_10538562 | Ga0157372_105385621 | 50 |
| 716 | 3300013307 | Ga0157372_11478237 | Ga0157372_114782372 | 50 |
| 717 | 3300013307 | Ga0157372_12429284 | Ga0157372_124292841 | 50 |
| 718 | 3300013308 | Ga0157375_11454833 | Ga0157375_114548331 | 50 |
| 719 | 3300014325 | Ga0163163_11050982 | Ga0163163_110509821 | 50 |
| 720 | 3300014325 | Ga0163163_12660334 | Ga0163163_126603342 | 50 |
| 721 | 3300014326 | Ga0157380_12261617 | Ga0157380_122616171 | 50 |
| 722 | 3300014497 | Ga0182008_10244091 | Ga0182008_102440912 | 50 |
| 723 | 3300014497 | Ga0182008_10566222 | Ga0182008_105662222 | 50 |
| 724 | 3300014497 | Ga0182008_10846232 | Ga0182008_108462322 | 50 |
| 725 | 3300014745 | Ga0157377_10540151 | Ga0157377_105401512 | 50 |
| 726 | 3300014968 | Ga0157379_10926495 | Ga0157379_109264952 | 50 |
| 727 | 3300014968 | Ga0157379_11014445 | Ga0157379_110144451 | 50 |
| 728 | 3300014969 | Ga0157376_10058405 | Ga0157376_100584055 | 50 |
| 729 | 3300014969 | Ga0157376_10452778 | Ga0157376_104527782 | 50 |
| 730 | 3300014969 | Ga0157376_10596257 | Ga0157376_105962573 | 50 |
| 731 | 3300014969 | Ga0157376_12196332 | Ga0157376_121963322 | 50 |
| 732 | 3300017792 | Ga0163161_10229479 | Ga0163161_102294793 | 50 |
| 733 | 3300020069 | Ga0197907_11200871 | Ga0197907_112008712 | 50 |
| 734 | 3300020070 | Ga0206356_10599982 | Ga0206356_105999821 | 50 |
| 735 | 3300020070 | Ga0206356_11246173 | Ga0206356_112461731 | 50 |
| 736 | 3300020075 | Ga0206349_1682998 | Ga0206349_16829981 | 50 |
| 737 | 3300020076 | Ga0206355_1179373 | Ga0206355_11793732 | 50 |
| 738 | 3300020080 | Ga0206350_10626026 | Ga0206350_106260264 | 50 |
| 739 | 3300020081 | Ga0206354_11293970 | Ga0206354_112939702 | 50 |
| 740 | 3300020082 | Ga0206353_10193602 | Ga0206353_101936022 | 50 |
| 741 | 3300020610 | Ga0154015_1702973 | Ga0154015_17029732 | 50 |
| 742 | 3300021358 | Ga0213873_10263288 | Ga0213873_102632882 | 50 |
| 743 | 3300021361 | Ga0213872_10400673 | Ga0213872_104006732 | 50 |
| 744 | 3300021377 | Ga0213874_10022748 | Ga0213874_100227482 | 50 |
| 745 | 3300021384 | Ga0213876_10204990 | Ga0213876_102049902 | 50 |
| 746 | 3300021441 | Ga0213871_10023878 | Ga0213871_100238781 | 50 |
| 747 | 3300022467 | Ga0224712_10011865 | Ga0224712_100118652 | 50 |
| 748 | 3300022467 | Ga0224712_10361874 | Ga0224712_103618741 | 50 |
| 749 | 3300025297 | Ga0209758_1022536 | Ga0209758_10225362 | 50 |
| 750 | 3300025315 | Ga0207697_10136582 | Ga0207697_101365823 | 50 |
| 751 | 3300025885 | Ga0207653_10038324 | Ga0207653_100383242 | 50 |
| 752 | 3300025893 | Ga0207682_10283279 | Ga0207682_102832792 | 50 |
| 753 | 3300025898 | Ga0207692_10107183 | Ga0207692_101071832 | 50 |
| 754 | 3300025898 | Ga0207692_10304093 | Ga0207692_103040932 | 50 |
| 755 | 3300025898 | Ga0207692_10457524 | Ga0207692_104575242 | 50 |
| 756 | 3300025899 | Ga0207642_10468464 | Ga0207642_104684642 | 50 |
| 757 | 3300025900 | Ga0207710_10059715 | Ga0207710_100597152 | 50 |
| 758 | 3300025900 | Ga0207710_10152875 | Ga0207710_101528752 | 50 |
| 759 | 3300025900 | Ga0207710_10503179 | Ga0207710_105031792 | 50 |
| 760 | 3300025901 | Ga0207688_10465756 | Ga0207688_104657562 | 50 |
| 761 | 3300025903 | Ga0207680_11004005 | Ga0207680_110040052 | 50 |
| 762 | 3300025905 | Ga0207685_10191741 | Ga0207685_101917412 | 50 |
| 763 | 3300025906 | Ga0207699_10025581 | Ga0207699_100255812 | 50 |
| 764 | 3300025906 | Ga0207699_10199589 | Ga0207699_101995893 | 50 |
| 765 | 3300025906 | Ga0207699_10679423 | Ga0207699_106794232 | 50 |
| 766 | 3300025906 | Ga0207699_10870700 | Ga0207699_108707002 | 50 |
| 767 | 3300025906 | Ga0207699_11357232 | Ga0207699_113572322 | 50 |
| 768 | 3300025906 | Ga0207699_11370861 | Ga0207699_113708612 | 50 |
| 769 | 3300025907 | Ga0207645_10214199 | Ga0207645_102141992 | 50 |
| 770 | 3300025907 | Ga0207645_10321812 | Ga0207645_103218123 | 50 |
| 771 | 3300025908 | Ga0207643_10147552 | Ga0207643_101475522 | 50 |
| 772 | 3300025908 | Ga0207643_11093598 | Ga0207643_110935981 | 50 |
| 773 | 3300025910 | Ga0207684_10057054 | Ga0207684_100570545 | 50 |
| 774 | 3300025911 | Ga0207654_10276160 | Ga0207654_102761602 | 50 |
| 775 | 3300025911 | Ga0207654_10284125 | Ga0207654_102841252 | 50 |
| 776 | 3300025912 | Ga0207707_10019814 | Ga0207707_100198142 | 50 |
| 777 | 3300025912 | Ga0207707_10027775 | Ga0207707_100277754 | 50 |
| 778 | 3300025912 | Ga0207707_11157195 | Ga0207707_111571951 | 50 |
| 779 | 3300025913 | Ga0207695_10054576 | Ga0207695_100545764 | 50 |
| 780 | 3300025913 | Ga0207695_10340223 | Ga0207695_103402232 | 50 |
| 781 | 3300025913 | Ga0207695_11330962 | Ga0207695_113309622 | 50 |
| 782 | 3300025914 | Ga0207671_10099942 | Ga0207671_100999421 | 50 |
| 783 | 3300025914 | Ga0207671_10099958 | Ga0207671_100999582 | 50 |
| 784 | 3300025914 | Ga0207671_10103991 | Ga0207671_101039912 | 50 |
| 785 | 3300025914 | Ga0207671_10174515 | Ga0207671_101745152 | 50 |
| 786 | 3300025914 | Ga0207671_10292548 | Ga0207671_102925481 | 50 |
| 787 | 3300025914 | Ga0207671_10397523 | Ga0207671_103975232 | 50 |
| 788 | 3300025915 | Ga0207693_10223615 | Ga0207693_102236152 | 50 |
| 789 | 3300025916 | Ga0207663_10337156 | Ga0207663_103371562 | 50 |
| 790 | 3300025916 | Ga0207663_10385522 | Ga0207663_103855222 | 50 |
| 791 | 3300025916 | Ga0207663_10554305 | Ga0207663_105543052 | 50 |
| 792 | 3300025916 | Ga0207663_10982780 | Ga0207663_109827802 | 50 |
| 793 | 3300025917 | Ga0207660_10017576 | Ga0207660_100175762 | 50 |
| 794 | 3300025917 | Ga0207660_10263412 | Ga0207660_102634122 | 50 |
| 795 | 3300025917 | Ga0207660_10742314 | Ga0207660_107423142 | 50 |
| 796 | 3300025919 | Ga0207657_10099624 | Ga0207657_100996243 | 50 |
| 797 | 3300025920 | Ga0207649_10280444 | Ga0207649_102804442 | 50 |
| 798 | 3300025920 | Ga0207649_10295375 | Ga0207649_102953753 | 50 |
| 799 | 3300025920 | Ga0207649_10781425 | Ga0207649_107814252 | 50 |
| 800 | 3300025920 | Ga0207649_10966266 | Ga0207649_109662662 | 50 |
| 801 | 3300025921 | Ga0207652_10407074 | Ga0207652_104070742 | 50 |
| 802 | 3300025921 | Ga0207652_10654237 | Ga0207652_106542372 | 50 |
| 803 | 3300025921 | Ga0207652_11076474 | Ga0207652_110764742 | 50 |
| 804 | 3300025921 | Ga0207652_11767678 | Ga0207652_117676782 | 50 |
| 805 | 3300025922 | Ga0207646_10020117 | Ga0207646_100201172 | 50 |
| 806 | 3300025922 | Ga0207646_10223738 | Ga0207646_102237382 | 50 |
| 807 | 3300025922 | Ga0207646_10624543 | Ga0207646_106245432 | 50 |
| 808 | 3300025923 | Ga0207681_10108734 | Ga0207681_101087343 | 50 |
| 809 | 3300025923 | Ga0207681_10462411 | Ga0207681_104624112 | 50 |
| 810 | 3300025923 | Ga0207681_10918781 | Ga0207681_109187811 | 50 |
| 811 | 3300025924 | Ga0207694_10168517 | Ga0207694_101685172 | 50 |
| 812 | 3300025924 | Ga0207694_10426931 | Ga0207694_104269312 | 50 |
| 813 | 3300025924 | Ga0207694_10437989 | Ga0207694_104379892 | 50 |
| 814 | 3300025924 | Ga0207694_10712461 | Ga0207694_107124612 | 50 |
| 815 | 3300025925 | Ga0207650_10374865 | Ga0207650_103748652 | 50 |
| 816 | 3300025925 | Ga0207650_10500076 | Ga0207650_105000762 | 50 |
| 817 | 3300025925 | Ga0207650_10670211 | Ga0207650_106702112 | 50 |
| 818 | 3300025926 | Ga0207659_10051717 | Ga0207659_100517174 | 50 |
| 819 | 3300025927 | Ga0207687_10984439 | Ga0207687_109844392 | 50 |
| 820 | 3300025927 | Ga0207687_11779417 | Ga0207687_117794172 | 50 |
| 821 | 3300025928 | Ga0207700_10011883 | Ga0207700_100118832 | 50 |
| 822 | 3300025928 | Ga0207700_10050788 | Ga0207700_100507884 | 50 |
| 823 | 3300025928 | Ga0207700_10099449 | Ga0207700_100994492 | 50 |
| 824 | 3300025928 | Ga0207700_10117337 | Ga0207700_101173373 | 50 |
| 825 | 3300025929 | Ga0207664_10018321 | Ga0207664_100183216 | 50 |
| 826 | 3300025929 | Ga0207664_10145841 | Ga0207664_101458412 | 50 |
| 827 | 3300025929 | Ga0207664_10725311 | Ga0207664_107253112 | 50 |
| 828 | 3300025931 | Ga0207644_10414810 | Ga0207644_104148102 | 50 |
| 829 | 3300025933 | Ga0207706_11574436 | Ga0207706_115744362 | 50 |
| 830 | 3300025935 | Ga0207709_11820810 | Ga0207709_118208102 | 50 |
| 831 | 3300025936 | Ga0207670_10173635 | Ga0207670_101736353 | 50 |
| 832 | 3300025936 | Ga0207670_10223015 | Ga0207670_102230153 | 50 |
| 833 | 3300025936 | Ga0207670_10393335 | Ga0207670_103933352 | 50 |
| 834 | 3300025936 | Ga0207670_11664827 | Ga0207670_116648272 | 50 |
| 835 | 3300025937 | Ga0207669_10153160 | Ga0207669_101531602 | 50 |
| 836 | 3300025938 | Ga0207704_10548350 | Ga0207704_105483501 | 50 |
| 837 | 3300025938 | Ga0207704_10963653 | Ga0207704_109636532 | 50 |
| 838 | 3300025939 | Ga0207665_11231095 | Ga0207665_112310952 | 50 |
| 839 | 3300025940 | Ga0207691_10048272 | Ga0207691_100482722 | 50 |
| 840 | 3300025940 | Ga0207691_10952283 | Ga0207691_109522832 | 50 |
| 841 | 3300025941 | Ga0207711_12015424 | Ga0207711_120154241 | 50 |
| 842 | 3300025942 | Ga0207689_10676285 | Ga0207689_106762852 | 50 |
| 843 | 3300025944 | Ga0207661_10481810 | Ga0207661_104818102 | 50 |
| 844 | 3300025944 | Ga0207661_10583060 | Ga0207661_105830602 | 50 |
| 845 | 3300025944 | Ga0207661_10939988 | Ga0207661_109399882 | 50 |
| 846 | 3300025944 | Ga0207661_11011652 | Ga0207661_110116522 | 50 |
| 847 | 3300025944 | Ga0207661_12063635 | Ga0207661_120636352 | 50 |
| 848 | 3300025945 | Ga0207679_10349056 | Ga0207679_103490562 | 50 |
| 849 | 3300025949 | Ga0207667_10109147 | Ga0207667_101091475 | 50 |
| 850 | 3300025949 | Ga0207667_10119359 | Ga0207667_101193592 | 50 |
| 851 | 3300025949 | Ga0207667_10242401 | Ga0207667_102424013 | 50 |
| 852 | 3300025949 | Ga0207667_10351611 | Ga0207667_103516112 | 50 |
| 853 | 3300025949 | Ga0207667_10697254 | Ga0207667_106972542 | 50 |
| 854 | 3300025960 | Ga0207651_10230043 | Ga0207651_102300432 | 50 |
| 855 | 3300025960 | Ga0207651_11465163 | Ga0207651_114651632 | 50 |
| 856 | 3300025960 | Ga0207651_11666480 | Ga0207651_116664802 | 50 |
| 857 | 3300025961 | Ga0207712_11345480 | Ga0207712_113454802 | 50 |
| 858 | 3300025972 | Ga0207668_10175746 | Ga0207668_101757462 | 50 |
| 859 | 3300025972 | Ga0207668_11542490 | Ga0207668_115424902 | 50 |
| 860 | 3300025981 | Ga0207640_10121501 | Ga0207640_101215014 | 50 |
| 861 | 3300025986 | Ga0207658_10461656 | Ga0207658_104616562 | 50 |
| 862 | 3300025986 | Ga0207658_10569621 | Ga0207658_105696212 | 50 |
| 863 | 3300026023 | Ga0207677_10165314 | Ga0207677_101653141 | 50 |
| 864 | 3300026023 | Ga0207677_10977633 | Ga0207677_109776332 | 50 |
| 865 | 3300026035 | Ga0207703_10461782 | Ga0207703_104617822 | 50 |
| 866 | 3300026035 | Ga0207703_10480171 | Ga0207703_104801712 | 50 |
| 867 | 3300026035 | Ga0207703_10583978 | Ga0207703_105839782 | 50 |
| 868 | 3300026035 | Ga0207703_11657165 | Ga0207703_116571652 | 50 |
| 869 | 3300026035 | Ga0207703_12285119 | Ga0207703_122851192 | 50 |
| 870 | 3300026041 | Ga0207639_10079336 | Ga0207639_100793364 | 50 |
| 871 | 3300026041 | Ga0207639_10225846 | Ga0207639_102258462 | 50 |
| 872 | 3300026041 | Ga0207639_10662177 | Ga0207639_106621772 | 50 |
| 873 | 3300026041 | Ga0207639_11338573 | Ga0207639_113385732 | 50 |
| 874 | 3300026075 | Ga0207708_10456892 | Ga0207708_104568922 | 50 |
| 875 | 3300026075 | Ga0207708_11873678 | Ga0207708_118736782 | 50 |
| 876 | 3300026078 | Ga0207702_10086799 | Ga0207702_100867992 | 50 |
| 877 | 3300026078 | Ga0207702_10248372 | Ga0207702_102483722 | 50 |
| 878 | 3300026078 | Ga0207702_10510534 | Ga0207702_105105341 | 50 |
| 879 | 3300026078 | Ga0207702_10933250 | Ga0207702_109332502 | 50 |
| 880 | 3300026078 | Ga0207702_11711522 | Ga0207702_117115222 | 50 |
| 881 | 3300026088 | Ga0207641_10032716 | Ga0207641_100327165 | 50 |
| 882 | 3300026088 | Ga0207641_11589305 | Ga0207641_115893052 | 50 |
| 883 | 3300026088 | Ga0207641_11887704 | Ga0207641_118877041 | 50 |
| 884 | 3300026089 | Ga0207648_10244203 | Ga0207648_102442032 | 50 |
| 885 | 3300026089 | Ga0207648_10321347 | Ga0207648_103213472 | 50 |
| 886 | 3300026095 | Ga0207676_10785895 | Ga0207676_107858951 | 50 |
| 887 | 3300026095 | Ga0207676_10840074 | Ga0207676_108400743 | 50 |
| 888 | 3300026095 | Ga0207676_11782465 | Ga0207676_117824651 | 50 |
| 889 | 3300026116 | Ga0207674_10019754 | Ga0207674_1001975410 | 50 |
| 890 | 3300026116 | Ga0207674_10122256 | Ga0207674_101222562 | 50 |
| 891 | 3300026116 | Ga0207674_10540826 | Ga0207674_105408263 | 50 |
| 892 | 3300026116 | Ga0207674_10965182 | Ga0207674_109651822 | 50 |
| 893 | 3300026116 | Ga0207674_12226465 | Ga0207674_122264652 | 50 |
| 894 | 3300026118 | Ga0207675_100661262 | Ga0207675_1006612623 | 50 |
| 895 | 3300026118 | Ga0207675_100745497 | Ga0207675_1007454972 | 50 |
| 896 | 3300026118 | Ga0207675_101118784 | Ga0207675_1011187842 | 50 |
| 897 | 3300026118 | Ga0207675_102121635 | Ga0207675_1021216352 | 50 |
| 898 | 3300026121 | Ga0207683_10064958 | Ga0207683_100649585 | 50 |
| 899 | 3300026121 | Ga0207683_10177746 | Ga0207683_101777462 | 50 |
| 900 | 3300026121 | Ga0207683_10557105 | Ga0207683_105571052 | 50 |
| 901 | 3300026121 | Ga0207683_10762643 | Ga0207683_107626433 | 50 |
| 902 | 3300026142 | Ga0207698_10103163 | Ga0207698_101031633 | 50 |
| 903 | 3300026142 | Ga0207698_11684942 | Ga0207698_116849422 | 50 |
| 904 | 3300026142 | Ga0207698_12005545 | Ga0207698_120055452 | 50 |
| 905 | 3300026142 | Ga0207698_12527861 | Ga0207698_125278611 | 50 |
| 906 | 3300027671 | Ga0209588_1033693 | Ga0209588_10336933 | 50 |
| 907 | 3300027671 | Ga0209588_1075701 | Ga0209588_10757012 | 50 |
| 908 | 3300027866 | Ga0209813_10238556 | Ga0209813_102385561 | 50 |
| 909 | 3300027907 | Ga0207428_10031923 | Ga0207428_100319232 | 50 |
| 910 | 3300027907 | Ga0207428_10526169 | Ga0207428_105261692 | 50 |
| 911 | 3300027907 | Ga0207428_10851416 | Ga0207428_108514162 | 50 |
| 912 | 3300028379 | Ga0268266_10005904 | Ga0268266_1000590411 | 50 |
| 913 | 3300028379 | Ga0268266_10066473 | Ga0268266_100664732 | 50 |
| 914 | 3300028379 | Ga0268266_11217490 | Ga0268266_112174902 | 50 |
| 915 | 3300028379 | Ga0268266_11788426 | Ga0268266_117884262 | 50 |
| 916 | 3300028380 | Ga0268265_10220537 | Ga0268265_102205371 | 50 |
| 917 | 3300028380 | Ga0268265_10303297 | Ga0268265_103032972 | 50 |
| 918 | 3300028380 | Ga0268265_10465074 | Ga0268265_104650742 | 50 |
| 919 | 3300028380 | Ga0268265_12412420 | Ga0268265_124124202 | 50 |
| 920 | 3300028381 | Ga0268264_10000084 | Ga0268264_10000084102 | 50 |
| 921 | 3300028381 | Ga0268264_11735814 | Ga0268264_117358142 | 50 |
| 922 | 3300028381 | Ga0268264_11892679 | Ga0268264_118926792 | 50 |
| 923 | 3300028786 | Ga0307517_10578289 | Ga0307517_105782892 | 50 |
| 924 | 3300030521 | Ga0307511_10052815 | Ga0307511_100528153 | 50 |
| 925 | 3300031241 | Ga0265325_10095155 | Ga0265325_100951552 | 50 |
| 926 | 3300031247 | Ga0265340_10303826 | Ga0265340_103038261 | 50 |
| 927 | 3300031344 | Ga0265316_10317948 | Ga0265316_103179481 | 50 |
| 928 | 3300031507 | Ga0307509_10153689 | Ga0307509_101536892 | 50 |
| 929 | 3300031507 | Ga0307509_10484231 | Ga0307509_104842311 | 50 |
| 930 | 3300031507 | Ga0307509_10693014 | Ga0307509_106930141 | 50 |
| 931 | 3300031548 | Ga0307408_100144864 | Ga0307408_1001448642 | 50 |
| 932 | 3300031616 | Ga0307508_10000105 | Ga0307508_1000010552 | 50 |
| 933 | 3300031616 | Ga0307508_10239342 | Ga0307508_102393422 | 50 |
| 934 | 3300031616 | Ga0307508_10432899 | Ga0307508_104328992 | 50 |
| 935 | 3300031711 | Ga0265314_10193618 | Ga0265314_101936182 | 50 |
| 936 | 3300031728 | Ga0316578_10334185 | Ga0316578_103341852 | 50 |
| 937 | 3300031730 | Ga0307516_10670925 | Ga0307516_106709252 | 50 |
| 938 | 3300031731 | Ga0307405_10237908 | Ga0307405_102379082 | 50 |
| 939 | 3300031824 | Ga0307413_11211737 | Ga0307413_112117372 | 50 |
| 940 | 3300031901 | Ga0307406_10579121 | Ga0307406_105791213 | 50 |
| 941 | 3300032002 | Ga0307416_100346498 | Ga0307416_1003464982 | 50 |
| 942 | 3300032005 | Ga0307411_11982867 | Ga0307411_119828672 | 50 |
| 943 | 3300032126 | Ga0307415_102194505 | Ga0307415_1021945052 | 50 |
| 944 | 3300033180 | Ga0307510_10303858 | Ga0307510_103038582 | 50 |
| 945 | 3300033544 | Ga0316215_1016362 | Ga0316215_10163622 | 50 |
| 946 | 3300034818 | Ga0373950_0063721 | Ga0373950_0063721_112_264 | 50 |
| 947 | 3300034820 | Ga0373959_0125493 | Ga0373959_0125493_135_287 | 50 |
| 948 | 3300034957 | Ga0373938_0002387 | Ga0373938_0002387_1064_1216 | 50 |
| 949 | 3300034957 | Ga0373938_0115185 | Ga0373938_0115185_106_258 | 50 |
| 950 | 3300035083 | Ga0373926_0026586 | Ga0373926_0026586_1463_1615 | 50 |
| 951 | 3300035084 | Ga0373928_0067222 | Ga0373928_0067222_363_515 | 50 |
| 952 | 3300035085 | Ga0373929_0029597 | Ga0373929_0029597_97_249 | 50 |
| 953 | 3300035085 | Ga0373929_0146869 | Ga0373929_0146869_11_163 | 50 |
| 954 | 3300035085 | Ga0373929_0188123 | Ga0373929_0188123_192_344 | 50 |
| 955 | 3300035086 | Ga0373934_0015167 | Ga0373934_0015167_1407_1559 | 50 |
| 956 | 3300035086 | Ga0373934_0135409 | Ga0373934_0135409_504_656 | 50 |
| 957 | 3300035088 | Ga0373940_0336563 | Ga0373940_0336563_192_344 | 50 |
| 958 | 3300035089 | Ga0373944_0018895 | Ga0373944_0018895_392_544 | 50 |
| 959 | 3300035090 | Ga0373949_0050956 | Ga0373949_0050956_75_227 | 50 |
| 960 | 3300035091 | Ga0373951_0030626 | Ga0373951_0030626_1078_1230 | 50 |
| 961 | 3300035091 | Ga0373951_0134474 | Ga0373951_0134474_394_546 | 50 |
| 962 | 3300035092 | Ga0373952_0215162 | Ga0373952_0215162_265_417 | 50 |
| 963 | 3300035111 | Ga0373923_0029232 | Ga0373923_0029232_276_428 | 50 |
| 964 | 3300035111 | Ga0373923_0103330 | Ga0373923_0103330_588_740 | 50 |
| 965 | 3300035111 | Ga0373923_0234032 | Ga0373923_0234032_679_831 | 50 |
| 966 | 3300035112 | Ga0373932_0273949 | Ga0373932_0273949_297_449 | 50 |
| 967 | 3300035113 | Ga0373936_0076639 | Ga0373936_0076639_288_440 | 50 |
| 968 | 3300035113 | Ga0373936_0087248 | Ga0373936_0087248_348_500 | 50 |
| 969 | 3300035113 | Ga0373936_0127000 | Ga0373936_0127000_572_724 | 50 |
| 970 | 3300035113 | Ga0373936_0160980 | Ga0373936_0160980_208_360 | 50 |
| 971 | 3300035114 | Ga0373939_0062831 | Ga0373939_0062831_487_639 | 50 |
| 972 | 3300035114 | Ga0373939_0166417 | Ga0373939_0166417_635_787 | 50 |
| 973 | 3300035115 | Ga0373941_0069709 | Ga0373941_0069709_71_223 | 50 |
| 974 | 3300035115 | Ga0373941_0079932 | Ga0373941_0079932_740_892 | 50 |
| 975 | 3300035115 | Ga0373941_0138650 | Ga0373941_0138650_463_615 | 50 |
| 976 | 3300035115 | Ga0373941_0434345 | Ga0373941_0434345_257_409 | 50 |
| 977 | 3300035116 | Ga0373945_0135627 | Ga0373945_0135627_634_786 | 50 |
| 978 | 3300035116 | Ga0373945_0185044 | Ga0373945_0185044_541_693 | 50 |
| 979 | 3300035117 | Ga0373953_0104021 | Ga0373953_0104021_539_691 | 50 |
| 980 | 3300035117 | Ga0373953_0183285 | Ga0373953_0183285_674_826 | 50 |
| 981 | 3300035118 | Ga0373954_0034467 | Ga0373954_0034467_1653_1805 | 50 |
| 982 | 3300035118 | Ga0373954_0053703 | Ga0373954_0053703_1210_1362 | 50 |
| 983 | 3300035119 | Ga0373956_0107278 | Ga0373956_0107278_790_942 | 50 |
| 984 | 3300035119 | Ga0373956_0121293 | Ga0373956_0121293_518_670 | 50 |
| 985 | 3300035120 | Ga0373957_0301896 | Ga0373957_0301896_464_616 | 50 |
| 986 | 3300035120 | Ga0373957_0353780 | Ga0373957_0353780_307_459 | 50 |
| 987 | 3300035121 | Ga0373960_0052412 | Ga0373960_0052412_546_698 | 50 |
| 988 | 3300035121 | Ga0373960_0351672 | Ga0373960_0351672_11_163 | 50 |
| 989 | 3300035170 | Ga0373943_0121832 | Ga0373943_0121832_1044_1196 | 50 |
| 990 | 3300035170 | Ga0373943_0310015 | Ga0373943_0310015_311_463 | 50 |
| 991 | 3300035171 | Ga0373946_0047551 | Ga0373946_0047551_557_709 | 50 |
| 992 | 3300035171 | Ga0373946_0283397 | Ga0373946_0283397_311_463 | 50 |
| 993 | 3300035172 | Ga0373955_0059090 | Ga0373955_0059090_1094_1246 | 50 |
| 994 | 3300035207 | Ga0373942_0386317 | Ga0373942_0386317_226_378 | 50 |
| 995 | 3300035241 | Ga0373961_0011686 | Ga0373961_0011686_1646_1798 | 50 |
| 996 | 3300035241 | Ga0373961_0013644 | Ga0373961_0013644_1812_1964 | 50 |
| 997 | 3300035241 | Ga0373961_0069950 | Ga0373961_0069950_476_628 | 50 |
| 998 | 3300035242 | Ga0373962_0022174 | Ga0373962_0022174_330_482 | 50 |
| 999 | 3300035242 | Ga0373962_0028668 | Ga0373962_0028668_616_768 | 50 |
| 1000 | 3300035410 | Ga0373924_0306384 | Ga0373924_0306384_252_404 | 50 |
| 1001 | 3300035691 | Ga0373931_0000317 | Ga0373931_0000317_273_425 | 50 |
| 1002 | 3300035691 | Ga0373931_0004056 | Ga0373931_0004056_2834_2986 | 50 |
| 1003 | 3300035691 | Ga0373931_0496027 | Ga0373931_0496027_139_291 | 50 |
| 1004 | 3300035692 | Ga0373935_0101455 | Ga0373935_0101455_767_919 | 50 |
| 1005 | 3300035692 | Ga0373935_0136231 | Ga0373935_0136231_553_705 | 50 |
| 1006 | 3300035692 | Ga0373935_0166266 | Ga0373935_0166266_20_172 | 50 |
| 1007 | 3300035692 | Ga0373935_0614359 | Ga0373935_0614359_240_392 | 50 |
| 1008 | 3300035692 | Ga0373935_0948113 | Ga0373935_0948113_366_518 | 50 |
| 1009 | 3300035692 | Ga0373935_1096472 | Ga0373935_1096472_332_484 | 50 |
| 1010 | 3300035695 | Ga0373927_0024147 | Ga0373927_0024147_2293_2445 | 50 |
| 1011 | 3300035695 | Ga0373927_0116454 | Ga0373927_0116454_276_428 | 50 |
| 1012 | 3300035695 | Ga0373927_0153953 | Ga0373927_0153953_19_171 | 50 |
| 1013 | 3300035695 | Ga0373927_0292335 | Ga0373927_0292335_865_1017 | 50 |
| 1014 | 3300035695 | Ga0373927_0312442 | Ga0373927_0312442_551_703 | 50 |
| 1015 | 3300035724 | Ga0373933_0017280 | Ga0373933_0017280_3629_3781 | 50 |
| 1016 | 3300035724 | Ga0373933_0087473 | Ga0373933_0087473_517_669 | 50 |
| 1017 | 3300035724 | Ga0373933_0884186 | Ga0373933_0884186_243_395 | 50 |
| 1018 | 3300035725 | Ga0373947_0024091 | Ga0373947_0024091_1312_1464 | 50 |
| 1019 | 3300035725 | Ga0373947_0038743 | Ga0373947_0038743_51_203 | 50 |
| 1020 | 3300035725 | Ga0373947_0052625 | Ga0373947_0052625_511_663 | 50 |
| 1021 | 3300035725 | Ga0373947_0356324 | Ga0373947_0356324_362_514 | 50 |
| 1022 | 3300036401 | Ga0373937_0118391 | Ga0373937_0118391_61_213 | 50 |
| 1023 | 3300036401 | Ga0373937_0162129 | Ga0373937_0162129_1154_1306 | 50 |
| 1024 | 3300036401 | Ga0373937_0227375 | Ga0373937_0227375_188_340 | 50 |
| 1025 | 3300036459 | Ga0372808_001897 | Ga0372808_001897_1695_1847 | 50 |
| 1026 | 3300037068 | Ga0373925_0075212 | Ga0373925_0075212_952_1104 | 50 |
| 1027 | 3300037068 | Ga0373925_0077433 | Ga0373925_0077433_288_440 | 50 |
| 1028 | 3300037068 | Ga0373925_0079553 | Ga0373925_0079553_2318_2470 | 50 |
| 1029 | 3300037068 | Ga0373925_0112578 | Ga0373925_0112578_466_618 | 50 |
| 1030 | 3300037068 | Ga0373925_0491133 | Ga0373925_0491133_16_168 | 50 |
| 1031 | 3300037068 | Ga0373925_0708989 | Ga0373925_0708989_401_553 | 50 |
| 1032 | 3300037312 | Ga0395899_0002162 | Ga0395899_0002162_428_580 | 50 |
| 1033 | 3300037312 | Ga0395899_0021402 | Ga0395899_0021402_1123_1275 | 50 |
| 1034 | 3300037312 | Ga0395899_0302544 | Ga0395899_0302544_140_292 | 50 |
| 1035 | 3300037418 | Ga0395900_0004853 | Ga0395900_0004853_1003_1155 | 50 |
| 1036 | 3300037418 | Ga0395900_0005904 | Ga0395900_0005904_12113_12265 | 50 |
| 1037 | 3300037418 | Ga0395900_0064978 | Ga0395900_0064978_1795_1947 | 50 |
| 1038 | 3300037418 | Ga0395900_0240772 | Ga0395900_0240772_631_783 | 50 |
| 1039 | 3300037418 | Ga0395900_1047689 | Ga0395900_1047689_415_567 | 50 |
| 1040 | 3300037466 | Ga0395898_0012089 | Ga0395898_0012089_1944_2096 | 50 |
| 1041 | 3300037466 | Ga0395898_0149599 | Ga0395898_0149599_1171_1323 | 50 |
| 1042 | 3300037466 | Ga0395898_0162409 | Ga0395898_0162409_929_1081 | 50 |
| 1043 | 3300037471 | Ga0395905_0180874 | Ga0395905_0180874_1413_1565 | 50 |
| 1044 | 3300037853 | Ga0436364_1015918 | Ga0436364_1015918_415_567 | 50 |
| 1045 | 3300038443 | Ga0395901_0040678 | Ga0395901_0040678_3795_3947 | 50 |
| 1046 | 3300038443 | Ga0395901_0139607 | Ga0395901_0139607_1855_2007 | 50 |
| 1047 | 3300038443 | Ga0395901_0148919 | Ga0395901_0148919_1274_1426 | 50 |
| 1048 | 3300038443 | Ga0395901_0195047 | Ga0395901_0195047_1354_1506 | 50 |
| 1049 | 3300038443 | Ga0395901_0381956 | Ga0395901_0381956_431_583 | 50 |
| 1050 | 3300039437 | Ga0436365_0368730 | Ga0436365_0368730_2152_2304 | 50 |
| 1051 | 3300039437 | Ga0436365_0622183 | Ga0436365_0622183_851_1003 | 50 |
| 1052 | 3300039437 | Ga0436365_0920296 | Ga0436365_0920296_489_641 | 50 |
| 1053 | 3300039437 | Ga0436365_1044564 | Ga0436365_1044564_579_731 | 50 |
| 1054 | 3300039437 | Ga0436365_1545720 | Ga0436365_1545720_458_610 | 50 |
| 1055 | 3300039437 | Ga0436365_1547297 | Ga0436365_1547297_710_862 | 50 |
| 1056 | 3300039437 | Ga0436365_1649599 | Ga0436365_1649599_102_254 | 50 |
| 1057 | 3300039437 | Ga0436365_1722483 | Ga0436365_1722483_172_324 | 50 |
| 1058 | 3300039438 | Ga0436360_0542064 | Ga0436360_0542064_383_535 | 50 |
| 1059 | 3300039438 | Ga0436360_0826367 | Ga0436360_0826367_286_438 | 50 |
| 1060 | 3300039438 | Ga0436360_1024581 | Ga0436360_1024581_85_237 | 50 |
| 1061 | 3300039438 | Ga0436360_1144799 | Ga0436360_1144799_1818_1970 | 50 |
| 1062 | 3300039447 | Ga0436361_0035526 | Ga0436361_0035526_336_488 | 50 |
| 1063 | 3300039447 | Ga0436361_0175551 | Ga0436361_0175551_1900_2052 | 50 |
| 1064 | 3300039447 | Ga0436361_0683077 | Ga0436361_0683077_124_276 | 50 |
| 1065 | 3300039447 | Ga0436361_0984910 | Ga0436361_0984910_91_243 | 50 |
| 1066 | 3300039447 | Ga0436361_1160036 | Ga0436361_1160036_454_606 | 50 |
| 1067 | 3300039450 | Ga0436363_0461653 | Ga0436363_0461653_2147_2299 | 50 |
| 1068 | 3300039450 | Ga0436363_1236422 | Ga0436363_1236422_193_345 | 50 |
| 1069 | 3300039450 | Ga0436363_1265235 | Ga0436363_1265235_782_934 | 50 |
| 1070 | 3300039453 | Ga0436362_0026859 | Ga0436362_0026859_170_322 | 50 |
| 1071 | 3300039453 | Ga0436362_0272131 | Ga0436362_0272131_691_843 | 50 |
| 1072 | 3300039453 | Ga0436362_0339798 | Ga0436362_0339798_282_434 | 50 |
| 1073 | 3300039453 | Ga0436362_0965633 | Ga0436362_0965633_431_583 | 50 |
| 1074 | 3300041407 | Ga0439447_053466 | Ga0439447_053466_678_830 | 50 |
| 1075 | 3300041411 | Ga0439466_0108367 | Ga0439466_0108367_265_417 | 50 |
| 1076 | 3300041413 | Ga0439465_0072857 | Ga0439465_0072857_139_291 | 50 |
| 1077 | 3300041443 | Ga0451789_1040744 | Ga0451789_1040744_515_667 | 50 |
| 1078 | 3300041453 | Ga0451797_1343343 | Ga0451797_1343343_217_369 | 50 |
| 1079 | 3300041456 | Ga0451795_1639049 | Ga0451795_1639049_262_414 | 50 |
| 1080 | 3300041459 | Ga0451800_0546300 | Ga0451800_0546300_194_346 | 50 |
| 1081 | 3300041463 | Ga0451804_0238532 | Ga0451804_0238532_379_531 | 50 |
| 1082 | 3300041486 | Ga0451807_1577102 | Ga0451807_1577102_345_497 | 50 |
| 1083 | 3300041486 | Ga0451807_1819751 | Ga0451807_1819751_203_355 | 50 |
| 1084 | 3300041496 | Ga0451839_0668696 | Ga0451839_0668696_316_468 | 50 |
| 1085 | 3300041505 | Ga0451849_0120354 | Ga0451849_0120354_229_381 | 50 |
| 1086 | 3300041505 | Ga0451849_0905281 | Ga0451849_0905281_106_258 | 50 |
| 1087 | 3300041512 | Ga0451853_1687619 | Ga0451853_1687619_13_165 | 50 |
| 1088 | 3300042001 | Ga0439441_078718 | Ga0439441_078718_293_445 | 50 |
| 1089 | 3300042002 | Ga0439442_110396 | Ga0439442_110396_401_553 | 50 |
| 1090 | 3300042002 | Ga0439442_144014 | Ga0439442_144014_190_342 | 50 |
| 1091 | 3300042004 | Ga0439445_0094973 | Ga0439445_0094973_108_260 | 50 |
| 1092 | 3300042006 | Ga0439432_209705 | Ga0439432_209705_41_193 | 50 |
| 1093 | 3300042435 | Ga0439434_0269612 | Ga0439434_0269612_22_174 | 50 |
| 1094 | 3300042436 | Ga0439435_0075194 | Ga0439435_0075194_546_698 | 50 |
| 1095 | 3300042438 | Ga0439459_0003070 | Ga0439459_0003070_975_1127 | 50 |
| 1096 | 3300042438 | Ga0439459_0062672 | Ga0439459_0062672_360_512 | 50 |
| 1097 | 3300042439 | Ga0439464_0163929 | Ga0439464_0163929_415_567 | 50 |
| 1098 | 3300042532 | Ga0450893_0099443 | Ga0450893_0099443_161_313 | 50 |
| 1099 | 3300044693 | Ga0466961_0086598 | Ga0466961_0086598_1671_1823 | 50 |
| 1100 | 3300044694 | Ga0466963_0021148 | Ga0466963_0021148_1787_1939 | 50 |
| 1101 | 3300044694 | Ga0466963_0080570 | Ga0466963_0080570_1046_1198 | 50 |
| 1102 | 3300044694 | Ga0466963_0728197 | Ga0466963_0728197_134_286 | 50 |
| 1103 | 3300044706 | Ga0466964_0242465 | Ga0466964_0242465_302_454 | 50 |
| 1104 | 3300044735 | Ga0466968_0409195 | Ga0466968_0409195_267_419 | 50 |
| 1105 | 3300044842 | Ga0466957_0019808 | Ga0466957_0019808_3288_3440 | 50 |
| 1106 | 3300045051 | Ga0451576_0352313 | Ga0451576_0352313_1156_1308 | 50 |
| 1107 | 3300045976 | Ga0466967_0002809 | Ga0466967_0002809_3065_3217 | 50 |
| 1108 | 3300045976 | Ga0466967_0444622 | Ga0466967_0444622_442_594 | 50 |
| 1109 | 3300045976 | Ga0466967_0943300 | Ga0466967_0943300_121_273 | 50 |
| 1110 | 3300045976 | Ga0466967_1480479 | Ga0466967_1480479_110_262 | 50 |
| 1111 | 3300045976 | Ga0466967_1543262 | Ga0466967_1543262_165_317 | 50 |
| 1112 | 3300045976 | Ga0466967_2334817 | Ga0466967_2334817_340_492 | 50 |
| 1113 | 3300046455 | Ga0495603_0100902 | Ga0495603_0100902_947_1099 | 50 |
| 1114 | 3300046457 | Ga0495590_0130756 | Ga0495590_0130756_620_772 | 50 |
| 1115 | 3300046459 | Ga0495629_0624215 | Ga0495629_0624215_214_366 | 50 |
| 1116 | 3300046460 | Ga0495638_0312985 | Ga0495638_0312985_593_745 | 50 |
| 1117 | 3300046462 | Ga0495651_0742602 | Ga0495651_0742602_276_428 | 50 |
| 1118 | 3300046463 | Ga0495653_0101144 | Ga0495653_0101144_1337_1489 | 50 |
| 1119 | 3300046463 | Ga0495653_0165483 | Ga0495653_0165483_424_576 | 50 |
| 1120 | 3300046472 | Ga0495580_0013706 | Ga0495580_0013706_5565_5717 | 50 |
| 1121 | 3300046472 | Ga0495580_0329207 | Ga0495580_0329207_660_812 | 50 |
| 1122 | 3300046472 | Ga0495580_1013166 | Ga0495580_1013166_156_308 | 50 |
| 1123 | 3300046473 | Ga0495582_0046171 | Ga0495582_0046171_1164_1316 | 50 |
| 1124 | 3300046475 | Ga0495639_0110802 | Ga0495639_0110802_974_1126 | 50 |
| 1125 | 3300046476 | Ga0495662_0010302 | Ga0495662_0010302_3547_3699 | 50 |
| 1126 | 3300046477 | Ga0495664_0014771 | Ga0495664_0014771_3601_3753 | 50 |
| 1127 | 3300046477 | Ga0495664_0113036 | Ga0495664_0113036_119_271 | 50 |
| 1128 | 3300046477 | Ga0495664_0383713 | Ga0495664_0383713_314_466 | 50 |
| 1129 | 3300046491 | Ga0495584_0381930 | Ga0495584_0381930_499_651 | 50 |
| 1130 | 3300046499 | Ga0495594_0255209 | Ga0495594_0255209_595_747 | 50 |
| 1131 | 3300046507 | Ga0495606_0105987 | Ga0495606_0105987_1175_1327 | 50 |
| 1132 | 3300046514 | Ga0495618_0274332 | Ga0495618_0274332_165_317 | 50 |
| 1133 | 3300046516 | Ga0495628_0509100 | Ga0495628_0509100_587_739 | 50 |
| 1134 | 3300046517 | Ga0495630_0040788 | Ga0495630_0040788_1574_1726 | 50 |
| 1135 | 3300046517 | Ga0495630_0608366 | Ga0495630_0608366_426_578 | 50 |
| 1136 | 3300046517 | Ga0495630_0909152 | Ga0495630_0909152_207_359 | 50 |
| 1137 | 3300046517 | Ga0495630_0987330 | Ga0495630_0987330_23_175 | 50 |
| 1138 | 3300046526 | Ga0495666_0092268 | Ga0495666_0092268_196_348 | 50 |
| 1139 | 3300046529 | Ga0495652_0105267 | Ga0495652_0105267_1237_1389 | 50 |
| 1140 | 3300046531 | Ga0495665_0087128 | Ga0495665_0087128_941_1093 | 50 |
| 1141 | 3300046531 | Ga0495665_0102077 | Ga0495665_0102077_890_1042 | 50 |
| 1142 | 3300046533 | Ga0495640_0041700 | Ga0495640_0041700_2789_2941 | 50 |
| 1143 | 3300046533 | Ga0495640_0334793 | Ga0495640_0334793_221_373 | 50 |
| 1144 | 3300046533 | Ga0495640_0967887 | Ga0495640_0967887_196_348 | 50 |
| 1145 | 3300046535 | Ga0495586_0051611 | Ga0495586_0051611_387_539 | 50 |
| 1146 | 3300046535 | Ga0495586_0479206 | Ga0495586_0479206_425_577 | 50 |
| 1147 | 3300046543 | Ga0495645_0027722 | Ga0495645_0027722_2770_2922 | 50 |
| 1148 | 3300046543 | Ga0495645_0069587 | Ga0495645_0069587_1144_1296 | 50 |
| 1149 | 3300046543 | Ga0495645_0560322 | Ga0495645_0560322_401_553 | 50 |
| 1150 | 3300046557 | Ga0495622_0068342 | Ga0495622_0068342_423_575 | 50 |
| 1151 | 3300046559 | Ga0495667_0040028 | Ga0495667_0040028_356_508 | 50 |
| 1152 | 3300046642 | Ga0495634_0124638 | Ga0495634_0124638_786_938 | 50 |
| 1153 | 3300046642 | Ga0495634_0789494 | Ga0495634_0789494_244_396 | 50 |
| 1154 | 3300046663 | Ga0495635_0000082 | Ga0495635_0000082_4044_4196 | 50 |
| 1155 | 3300046663 | Ga0495635_0007858 | Ga0495635_0007858_3715_3867 | 50 |
| 1156 | 3300046663 | Ga0495635_0418785 | Ga0495635_0418785_295_447 | 50 |
| 1157 | 3300046675 | Ga0495657_0357251 | Ga0495657_0357251_554_706 | 50 |
| 1158 | 3300046678 | Ga0495599_0211052 | Ga0495599_0211052_467_619 | 50 |
| 1159 | 3300046678 | Ga0495599_0771340 | Ga0495599_0771340_222_374 | 50 |
| 1160 | 3300046679 | Ga0495623_0509093 | Ga0495623_0509093_258_410 | 50 |
| 1161 | 3300046680 | Ga0495646_0201999 | Ga0495646_0201999_152_304 | 50 |
| 1162 | 3300046681 | Ga0495647_0126736 | Ga0495647_0126736_450_602 | 50 |
| 1163 | 3300046681 | Ga0495647_0221857 | Ga0495647_0221857_630_782 | 50 |
| 1164 | 3300046683 | Ga0495658_0018744 | Ga0495658_0018744_1476_1628 | 50 |
| 1165 | 3300046689 | Ga0495613_0107356 | Ga0495613_0107356_802_954 | 50 |
| 1166 | 3300046689 | Ga0495613_0167055 | Ga0495613_0167055_1369_1521 | 50 |
| 1167 | 3300046689 | Ga0495613_0248223 | Ga0495613_0248223_991_1143 | 50 |
| 1168 | 3300046690 | Ga0495624_0043952 | Ga0495624_0043952_769_921 | 50 |
| 1169 | 3300046690 | Ga0495624_0519326 | Ga0495624_0519326_139_291 | 50 |
| 1170 | 3300046692 | Ga0495671_0200171 | Ga0495671_0200171_382_534 | 50 |
| 1171 | 3300046809 | Ga0495600_0044373 | Ga0495600_0044373_1409_1561 | 50 |
| 1172 | 3300047315 | Ga0495581_0078431 | Ga0495581_0078431_1040_1192 | 50 |
| 1173 | 3300047315 | Ga0495581_0171710 | Ga0495581_0171710_939_1091 | 50 |
| 1174 | 3300047317 | Ga0495604_0536057 | Ga0495604_0536057_193_345 | 50 |
| 1175 | 3300047317 | Ga0495604_0851316 | Ga0495604_0851316_13_165 | 50 |
| 1176 | 3300047319 | Ga0495674_0004477 | Ga0495674_0004477_2965_3117 | 50 |
| 1177 | 3300047319 | Ga0495674_0400956 | Ga0495674_0400956_866_1018 | 50 |
| 1178 | 3300047319 | Ga0495674_0588326 | Ga0495674_0588326_293_445 | 50 |
| 1179 | 3300047319 | Ga0495674_0627840 | Ga0495674_0627840_645_797 | 50 |
| 1180 | 3300047321 | Ga0495676_0414621 | Ga0495676_0414621_555_707 | 50 |
| 1181 | 3300047321 | Ga0495676_0624935 | Ga0495676_0624935_472_624 | 50 |
| 1182 | 3300047322 | Ga0495680_0000053 | Ga0495680_0000053_46164_46316 | 50 |
| 1183 | 3300047322 | Ga0495680_0176291 | Ga0495680_0176291_483_635 | 50 |
| 1184 | 3300047322 | Ga0495680_0528785 | Ga0495680_0528785_348_500 | 50 |
| 1185 | 3300047444 | Ga0495675_0164407 | Ga0495675_0164407_474_626 | 50 |
| 1186 | 3300047444 | Ga0495675_0762373 | Ga0495675_0762373_149_301 | 50 |
| 1187 | 3300047471 | Ga0495684_0004775 | Ga0495684_0004775_9595_9747 | 50 |
| 1188 | 3300047471 | Ga0495684_0017082 | Ga0495684_0017082_1997_2149 | 50 |
| 1189 | 3300047471 | Ga0495684_0064085 | Ga0495684_0064085_2390_2542 | 50 |
| 1190 | 3300047673 | Ga0495593_0251714 | Ga0495593_0251714_542_694 | 50 |
| 1191 | 3300048089 | Ga0495614_0638168 | Ga0495614_0638168_49_201 | 50 |
| 1192 | 3300048905 | Ga0496102_0789570 | Ga0496102_0789570_319_471 | 50 |
| 1193 | 3300048905 | Ga0496102_0858763 | Ga0496102_0858763_588_740 | 50 |
| 1194 | 3300048905 | Ga0496102_1175772 | Ga0496102_1175772_150_302 | 50 |
| 1195 | 3300048905 | Ga0496102_1778335 | Ga0496102_1778335_282_434 | 50 |
| 1196 | 3300048909 | Ga0496106_0008099 | Ga0496106_0008099_6572_6724 | 50 |
| 1197 | 3300048911 | Ga0496108_0674340 | Ga0496108_0674340_561_713 | 50 |
| 1198 | 3300048912 | Ga0496109_0185900 | Ga0496109_0185900_1774_1926 | 50 |
| 1199 | 3300048912 | Ga0496109_0557691 | Ga0496109_0557691_302_454 | 50 |
| 1200 | 3300048912 | Ga0496109_1539534 | Ga0496109_1539534_332_484 | 50 |
| 1201 | 3300048915 | Ga0496112_0847901 | Ga0496112_0847901_284_436 | 50 |
| 1202 | 3300048916 | Ga0496113_0601457 | Ga0496113_0601457_230_382 | 50 |
| 1203 | 3300048917 | Ga0496114_0313535 | Ga0496114_0313535_619_771 | 50 |
| 1204 | 3300048917 | Ga0496114_1319172 | Ga0496114_1319172_328_480 | 50 |
| 1205 | 3300048918 | Ga0496115_0258938 | Ga0496115_0258938_997_1149 | 50 |
| 1206 | 3300048920 | Ga0496117_0054306 | Ga0496117_0054306_685_837 | 50 |
| 1207 | 3300048921 | Ga0496118_0002057 | Ga0496118_0002057_6506_6658 | 50 |
| 1208 | 3300048924 | Ga0496121_0000077 | Ga0496121_0000077_175453_175605 | 50 |
| 1209 | 3300048924 | Ga0496121_0032758 | Ga0496121_0032758_4075_4227 | 50 |
| 1210 | 3300048924 | Ga0496121_0053767 | Ga0496121_0053767_806_958 | 50 |
| 1211 | 3300048927 | Ga0496124_0006148 | Ga0496124_0006148_12004_12156 | 50 |
| 1212 | 3300048928 | Ga0496125_0044761 | Ga0496125_0044761_691_843 | 50 |
| 1213 | 3300048929 | Ga0496126_0009366 | Ga0496126_0009366_3294_3446 | 50 |
| 1214 | 3300048929 | Ga0496126_0018937 | Ga0496126_0018937_624_776 | 50 |
| 1215 | 3300048929 | Ga0496126_0150968 | Ga0496126_0150968_786_938 | 50 |
| 1216 | 3300048929 | Ga0496126_0318929 | Ga0496126_0318929_586_738 | 50 |
| 1217 | 3300048929 | Ga0496126_0376505 | Ga0496126_0376505_69_221 | 50 |
| 1218 | 3300049129 | Ga0501309_006054 | Ga0501309_006054_1252_1404 | 50 |
| 1219 | 3300049130 | Ga0501310_010792 | Ga0501310_010792_68_220 | 50 |
| 1220 | 3300049162 | Ga0501307_044908 | Ga0501307_044908_234_386 | 50 |
| 1221 | 3300049569 | Ga0501032_0390118 | Ga0501032_0390118_530_682 | 50 |
| 1222 | 3300049570 | Ga0501033_0187960 | Ga0501033_0187960_754_906 | 50 |
| 1223 | 3300049570 | Ga0501033_0775583 | Ga0501033_0775583_218_370 | 50 |
| 1224 | 3300049571 | Ga0501034_0000109 | Ga0501034_0000109_41457_41609 | 50 |
| 1225 | 3300049571 | Ga0501034_0001751 | Ga0501034_0001751_150_302 | 50 |
| 1226 | 3300049571 | Ga0501034_0053875 | Ga0501034_0053875_1883_2035 | 50 |
| 1227 | 3300049571 | Ga0501034_0115699 | Ga0501034_0115699_483_635 | 50 |
| 1228 | 3300049571 | Ga0501034_0574374 | Ga0501034_0574374_721_873 | 50 |
| 1229 | 3300049572 | Ga0501036_0383455 | Ga0501036_0383455_344_496 | 50 |
| 1230 | 3300049573 | Ga0501037_0287677 | Ga0501037_0287677_534_686 | 50 |
| 1231 | 3300049574 | Ga0501038_0719954 | Ga0501038_0719954_106_258 | 50 |
| 1232 | 3300049575 | Ga0501039_0614442 | Ga0501039_0614442_195_347 | 50 |
| 1233 | 3300049577 | Ga0501041_1107385 | Ga0501041_1107385_251_403 | 50 |
| 1234 | 3300049579 | Ga0501043_0125279 | Ga0501043_0125279_1632_1784 | 50 |
| 1235 | 3300049580 | Ga0501046_0116625 | Ga0501046_0116625_908_1060 | 50 |
| 1236 | 3300049582 | Ga0501048_0297614 | Ga0501048_0297614_252_404 | 50 |
| 1237 | 3300049582 | Ga0501048_0543739 | Ga0501048_0543739_532_684 | 50 |
| 1238 | 3300049584 | Ga0501068_0252362 | Ga0501068_0252362_335_487 | 50 |
| 1239 | 3300049586 | Ga0501070_0136672 | Ga0501070_0136672_1165_1317 | 50 |
| 1240 | 3300049586 | Ga0501070_0203456 | Ga0501070_0203456_1415_1567 | 50 |
| 1241 | 3300049586 | Ga0501070_0685443 | Ga0501070_0685443_181_333 | 50 |
| 1242 | 3300049586 | Ga0501070_1237674 | Ga0501070_1237674_79_231 | 50 |
| 1243 | 3300049587 | Ga0501071_0577730 | Ga0501071_0577730_126_278 | 50 |
| 1244 | 3300049588 | Ga0501072_0307215 | Ga0501072_0307215_770_922 | 50 |
| 1245 | 3300049588 | Ga0501072_0601028 | Ga0501072_0601028_424_576 | 50 |
| 1246 | 3300049589 | Ga0501073_0223858 | Ga0501073_0223858_390_542 | 50 |
| 1247 | 3300049592 | Ga0501076_0297973 | Ga0501076_0297973_166_318 | 50 |
| 1248 | 3300049741 | Ga0501079_0865511 | Ga0501079_0865511_237_389 | 50 |
| 1249 | 3300049742 | Ga0501080_0299923 | Ga0501080_0299923_577_729 | 50 |
| 1250 | 3300049742 | Ga0501080_1068868 | Ga0501080_1068868_529_681 | 50 |
| 1251 | 3300049742 | Ga0501080_1204437 | Ga0501080_1204437_299_451 | 50 |
| 1252 | 3300049822 | Ga0501035_0889832 | Ga0501035_0889832_112_264 | 50 |
| 1253 | 3300049823 | Ga0501044_0235998 | Ga0501044_0235998_180_332 | 50 |
| 1254 | 3300049824 | Ga0501045_0359472 | Ga0501045_0359472_898_1050 | 50 |
| 1255 | 3300050489 | nmdc:mga03683_132101_c1 | nmdc:mga03683_132101_c1_822_974 | 50 |
| 1256 | 3300050489 | nmdc:mga03683_148518_c1 | nmdc:mga03683_148518_c1_738_890 | 50 |
| 1257 | 3300050489 | nmdc:mga03683_15481_c1 | nmdc:mga03683_15481_c1_1015_1167 | 50 |
| 1258 | 3300050489 | nmdc:mga03683_169568_c1 | nmdc:mga03683_169568_c1_572_724 | 50 |
| 1259 | 3300050489 | nmdc:mga03683_1825_c1 | nmdc:mga03683_1825_c1_4228_4380 | 50 |
| 1260 | 3300050489 | nmdc:mga03683_22746_c1 | nmdc:mga03683_22746_c1_2092_2244 | 50 |
| 1261 | 3300050489 | nmdc:mga03683_32482_c1 | nmdc:mga03683_32482_c1_1053_1205 | 50 |
| 1262 | 3300050489 | nmdc:mga03683_32979_c1 | nmdc:mga03683_32979_c1_587_739 | 50 |
| 1263 | 3300050489 | nmdc:mga03683_397443_c1 | nmdc:mga03683_397443_c1_34_186 | 50 |
| 1264 | 3300050489 | nmdc:mga03683_461697_c1 | nmdc:mga03683_461697_c1_226_378 | 50 |
| 1265 | 3300050489 | nmdc:mga03683_76855_c1 | nmdc:mga03683_76855_c1_753_905 | 50 |
| 1266 | 3300050490 | nmdc:mga03n38_102713_c1 | nmdc:mga03n38_102713_c1_668_820 | 50 |
| 1267 | 3300050490 | nmdc:mga03n38_951783_c1 | nmdc:mga03n38_951783_c1_164_316 | 50 |
| 1268 | 3300050491 | nmdc:mga00v17_207477_c1 | nmdc:mga00v17_207477_c1_807_959 | 50 |
| 1269 | 3300050491 | nmdc:mga00v17_39264_c1 | nmdc:mga00v17_39264_c1_308_460 | 50 |
| 1270 | 3300050492 | nmdc:mga0yw44_129575_c1 | nmdc:mga0yw44_129575_c1_1175_1327 | 50 |
| 1271 | 3300050492 | nmdc:mga0yw44_22312_c1 | nmdc:mga0yw44_22312_c1_224_376 | 50 |
| 1272 | 3300050492 | nmdc:mga0yw44_38472_c1 | nmdc:mga0yw44_38472_c1_2537_2689 | 50 |
| 1273 | 3300050492 | nmdc:mga0yw44_446005_c1 | nmdc:mga0yw44_446005_c1_588_740 | 50 |
| 1274 | 3300050492 | nmdc:mga0yw44_467214_c1 | nmdc:mga0yw44_467214_c1_178_330 | 50 |
| 1275 | 3300050492 | nmdc:mga0yw44_730278_c1 | nmdc:mga0yw44_730278_c1_34_186 | 50 |
| 1276 | 3300050493 | nmdc:mga0k408_107710_c1 | nmdc:mga0k408_107710_c1_897_1049 | 50 |
| 1277 | 3300050493 | nmdc:mga0k408_162678_c1 | nmdc:mga0k408_162678_c1_848_1000 | 50 |
| 1278 | 3300050493 | nmdc:mga0k408_343354_c1 | nmdc:mga0k408_343354_c1_534_686 | 50 |
| 1279 | 3300050493 | nmdc:mga0k408_5567_c1 | nmdc:mga0k408_5567_c1_5184_5336 | 50 |
| 1280 | 3300050493 | nmdc:mga0k408_609334_c1 | nmdc:mga0k408_609334_c1_224_376 | 50 |
| 1281 | 3300050494 | nmdc:mga06z11_101549_c1 | nmdc:mga06z11_101549_c1_511_663 | 50 |
| 1282 | 3300050494 | nmdc:mga06z11_127247_c1 | nmdc:mga06z11_127247_c1_48_200 | 50 |
| 1283 | 3300050494 | nmdc:mga06z11_174175_c1 | nmdc:mga06z11_174175_c1_31_183 | 50 |
| 1284 | 3300050494 | nmdc:mga06z11_261579_c1 | nmdc:mga06z11_261579_c1_829_981 | 50 |
| 1285 | 3300050494 | nmdc:mga06z11_305409_c1 | nmdc:mga06z11_305409_c1_742_894 | 50 |
| 1286 | 3300050494 | nmdc:mga06z11_358863_c1 | nmdc:mga06z11_358863_c1_244_396 | 50 |
| 1287 | 3300050494 | nmdc:mga06z11_43471_c1 | nmdc:mga06z11_43471_c1_1996_2148 | 50 |
| 1288 | 3300050494 | nmdc:mga06z11_5646_c1 | nmdc:mga06z11_5646_c1_4238_4390 | 50 |
| 1289 | 3300050495 | nmdc:mga04h51_136829_c1 | nmdc:mga04h51_136829_c1_761_913 | 50 |
| 1290 | 3300050496 | nmdc:mga07m45_367567_c1 | nmdc:mga07m45_367567_c1_82_234 | 50 |
| 1291 | 3300050496 | nmdc:mga07m45_402050_c1 | nmdc:mga07m45_402050_c1_573_725 | 50 |
| 1292 | 3300050496 | nmdc:mga07m45_56464_c1 | nmdc:mga07m45_56464_c1_1879_2031 | 50 |
| 1293 | 3300050496 | nmdc:mga07m45_760326_c1 | nmdc:mga07m45_760326_c1_55_207 | 50 |
| 1294 | 3300050496 | nmdc:mga07m45_803591_c1 | nmdc:mga07m45_803591_c1_310_462 | 50 |
| 1295 | 3300050507 | nmdc:mga05p37_733444_c1 | nmdc:mga05p37_733444_c1_440_592 | 50 |
| 1296 | 3300050508 | nmdc:mga09592_1156863_c1 | nmdc:mga09592_1156863_c1_223_375 | 50 |
| 1297 | 3300050509 | nmdc:mga0qj67_606036_c1 | nmdc:mga0qj67_606036_c1_460_612 | 50 |
| 1298 | 3300050511 | nmdc:mga08y16_122656_c1 | nmdc:mga08y16_122656_c1_1700_1852 | 50 |
| 1299 | 3300050511 | nmdc:mga08y16_245174_c1 | nmdc:mga08y16_245174_c1_1563_1715 | 50 |
| 1300 | 3300050511 | nmdc:mga08y16_295626_c1 | nmdc:mga08y16_295626_c1_1508_1660 | 50 |
| 1301 | 3300050511 | nmdc:mga08y16_996516_c1 | nmdc:mga08y16_996516_c1_622_774 | 50 |
| 1302 | 3300050512 | nmdc:mga0n895_17745_c1 | nmdc:mga0n895_17745_c1_2868_3020 | 50 |
| 1303 | 3300050512 | nmdc:mga0n895_329968_c1 | nmdc:mga0n895_329968_c1_1368_1520 | 50 |
| 1304 | 3300050512 | nmdc:mga0n895_64973_c1 | nmdc:mga0n895_64973_c1_750_902 | 50 |
| 1305 | 3300050514 | nmdc:mga08x19_175174_c1 | nmdc:mga08x19_175174_c1_300_452 | 50 |
| 1306 | 3300050514 | nmdc:mga08x19_463128_c1 | nmdc:mga08x19_463128_c1_395_547 | 50 |
| 1307 | 3300050515 | nmdc:mga0a205_678075_c1 | nmdc:mga0a205_678075_c1_370_522 | 50 |
| 1308 | 3300050515 | nmdc:mga0a205_72159_c1 | nmdc:mga0a205_72159_c1_815_967 | 50 |
| 1309 | 3300050515 | nmdc:mga0a205_803235_c1 | nmdc:mga0a205_803235_c1_601_753 | 50 |
| 1310 | 3300050516 | nmdc:mga0sz30_239_c1 | nmdc:mga0sz30_239_c1_9067_9219 | 50 |
| 1311 | 3300050516 | nmdc:mga0sz30_36367_c1 | nmdc:mga0sz30_36367_c1_105_257 | 50 |
| 1312 | 3300050516 | nmdc:mga0sz30_424010_c1 | nmdc:mga0sz30_424010_c1_426_578 | 50 |
| 1313 | 3300050516 | nmdc:mga0sz30_486680_c1 | nmdc:mga0sz30_486680_c1_12_164 | 50 |
| 1314 | 3300050516 | nmdc:mga0sz30_5231_c1 | nmdc:mga0sz30_5231_c1_190_342 | 50 |
| 1315 | 3300053077 | Ga0495601_0084629 | Ga0495601_0084629_1409_1561 | 50 |
| 1316 | 3300053077 | Ga0495601_0236563 | Ga0495601_0236563_620_772 | 50 |
| 1317 | 3300053077 | Ga0495601_0284716 | Ga0495601_0284716_543_695 | 50 |
| 1318 | 3300053077 | Ga0495601_0347852 | Ga0495601_0347852_596_748 | 50 |
| 1319 | 3300053077 | Ga0495601_0470982 | Ga0495601_0470982_479_631 | 50 |
| 1320 | 3300053078 | Ga0495612_0045922 | Ga0495612_0045922_1323_1475 | 50 |
| 1321 | 3300053078 | Ga0495612_0147855 | Ga0495612_0147855_13_165 | 50 |
| 1322 | 3300053079 | Ga0500610_0230325 | Ga0500610_0230325_322_474 | 50 |
| 1323 | 3300053080 | Ga0500635_0003286 | Ga0500635_0003286_2263_2415 | 50 |
| 1324 | 3300053083 | Ga0495655_0066366 | Ga0495655_0066366_241_393 | 50 |
| 1325 | 3300053084 | Ga0495595_0652117 | Ga0495595_0652117_244_396 | 50 |
| 1326 | 3300053085 | Ga0495619_0112948 | Ga0495619_0112948_1256_1408 | 50 |
| 1327 | 3300053085 | Ga0495619_0229266 | Ga0495619_0229266_356_508 | 50 |
| 1328 | 3300053087 | Ga0500643_019179 | Ga0500643_019179_318_470 | 50 |
| 1329 | 3300053087 | Ga0500643_157092 | Ga0500643_157092_203_355 | 50 |
| 1330 | 3300053088 | Ga0500644_0007897 | Ga0500644_0007897_1990_2142 | 50 |
| 1331 | 3300053091 | Ga0500647_0234975 | Ga0500647_0234975_205_357 | 50 |
| 1332 | 3300053092 | Ga0500583_0480932 | Ga0500583_0480932_210_362 | 50 |
| 1333 | 3300053092 | Ga0500583_0508775 | Ga0500583_0508775_385_537 | 50 |
| 1334 | 3300053093 | Ga0500651_0016352 | Ga0500651_0016352_3845_3997 | 50 |
| 1335 | 3300053093 | Ga0500651_0731053 | Ga0500651_0731053_348_500 | 50 |
| 1336 | 3300053094 | Ga0500566_0071146 | Ga0500566_0071146_1192_1344 | 50 |
| 1337 | 3300053094 | Ga0500566_0191433 | Ga0500566_0191433_409_561 | 50 |
| 1338 | 3300053096 | Ga0500641_0000244 | Ga0500641_0000244_10115_10267 | 50 |
| 1339 | 3300053103 | Ga0500555_078586 | Ga0500555_078586_248_400 | 50 |
| 1340 | 3300053105 | Ga0500557_123515 | Ga0500557_123515_224_376 | 50 |
| 1341 | 3300053106 | Ga0500558_162861 | Ga0500558_162861_604_756 | 50 |
| 1342 | 3300053119 | Ga0500595_027620 | Ga0500595_027620_1541_1693 | 50 |
| 1343 | 3300053119 | Ga0500595_071275 | Ga0500595_071275_662_814 | 50 |
| 1344 | 3300053119 | Ga0500595_159895 | Ga0500595_159895_416_568 | 50 |
| 1345 | 3300053120 | Ga0500597_244030 | Ga0500597_244030_315_467 | 50 |
| 1346 | 3300053123 | Ga0500614_066050 | Ga0500614_066050_695_847 | 50 |
| 1347 | 3300053130 | Ga0500642_0126365 | Ga0500642_0126365_305_457 | 50 |
| 1348 | 3300053130 | Ga0500642_0143929 | Ga0500642_0143929_762_914 | 50 |
| 1349 | 3300053131 | Ga0500652_216897 | Ga0500652_216897_178_330 | 50 |
| 1350 | 3300053136 | Ga0500559_0104030 | Ga0500559_0104030_864_1016 | 50 |
| 1351 | 3300053142 | Ga0500577_0218436 | Ga0500577_0218436_463_615 | 50 |
| 1352 | 3300053146 | Ga0500588_0175088 | Ga0500588_0175088_34_186 | 50 |
| 1353 | 3300053148 | Ga0500590_080916 | Ga0500590_080916_151_303 | 50 |
| 1354 | 3300053148 | Ga0500590_179822 | Ga0500590_179822_266_418 | 50 |
| 1355 | 3300053148 | Ga0500590_258878 | Ga0500590_258878_342_494 | 50 |
| 1356 | 3300053150 | Ga0500603_018179 | Ga0500603_018179_1126_1278 | 50 |
| 1357 | 3300053153 | Ga0500616_0000925 | Ga0500616_0000925_7927_8079 | 50 |
| 1358 | 3300053155 | Ga0500620_019185 | Ga0500620_019185_1748_1900 | 50 |
| 1359 | 3300053158 | Ga0500627_0155211 | Ga0500627_0155211_768_920 | 50 |
| 1360 | 3300053162 | Ga0500638_285809 | Ga0500638_285809_453_605 | 50 |
| 1361 | 3300053163 | Ga0500639_253271 | Ga0500639_253271_513_665 | 50 |
| 1362 | 3300053177 | Ga0500636_0086777 | Ga0500636_0086777_1496_1648 | 50 |
| 1363 | 3300053728 | Ga0500657_128973 | Ga0500657_128973_459_611 | 50 |
| 1364 | 3300053731 | Ga0500609_025225 | Ga0500609_025225_416_568 | 50 |
| 1365 | 3300053733 | Ga0500552_007586 | Ga0500552_007586_845_997 | 50 |
| 1366 | 3300053733 | Ga0500552_018616 | Ga0500552_018616_148_300 | 50 |
| 1367 | 3300053735 | Ga0500596_005014 | Ga0500596_005014_322_474 | 50 |
| 1368 | 3300059626 | Ga0587115_033509 | Ga0587115_033509_594_746 | 50 |
| 1369 | 3300059640 | Ga0587067_231921 | Ga0587067_231921_292_444 | 50 |
| 1370 | 3300060353 | Ga0501082_1064267 | Ga0501082_1064267_418_570 | 50 |
| 1371 | 3300061734 | Ga0530510_0221050 | Ga0530510_0221050_710_862 | 50 |
| 1372 | 3300061734 | Ga0530510_0974321 | Ga0530510_0974321_281_433 | 50 |
| 1373 | 3300042876 | Ga0451577_0000001 | Ga0451577_0000001_1072785_1072940 | 51 |
| 1374 | 3300001990 | JGI24737J22298_10019519 | JGI24737J22298_100195193 | 52 |
| 1375 | 3300005327 | Ga0070658_10006980 | Ga0070658_100069808 | 52 |
| 1376 | 3300005329 | Ga0070683_100035249 | Ga0070683_1000352494 | 52 |
| 1377 | 3300005329 | Ga0070683_100066371 | Ga0070683_1000663713 | 52 |
| 1378 | 3300005329 | Ga0070683_100803745 | Ga0070683_1008037452 | 52 |
| 1379 | 3300005331 | Ga0070670_100440685 | Ga0070670_1004406853 | 52 |
| 1380 | 3300005336 | Ga0070680_101713781 | Ga0070680_1017137812 | 52 |
| 1381 | 3300005337 | Ga0070682_100094786 | Ga0070682_1000947862 | 52 |
| 1382 | 3300005338 | Ga0068868_102038785 | Ga0068868_1020387852 | 52 |
| 1383 | 3300005338 | Ga0068868_102378353 | Ga0068868_1023783532 | 52 |
| 1384 | 3300005339 | Ga0070660_100103462 | Ga0070660_1001034623 | 52 |
| 1385 | 3300005344 | Ga0070661_100056480 | Ga0070661_1000564803 | 52 |
| 1386 | 3300005345 | Ga0070692_10100582 | Ga0070692_101005823 | 52 |
| 1387 | 3300005347 | Ga0070668_100120941 | Ga0070668_1001209413 | 52 |
| 1388 | 3300005353 | Ga0070669_101569385 | Ga0070669_1015693852 | 52 |
| 1389 | 3300005355 | Ga0070671_100628595 | Ga0070671_1006285952 | 52 |
| 1390 | 3300005356 | Ga0070674_100290609 | Ga0070674_1002906092 | 52 |
| 1391 | 3300005366 | Ga0070659_100110611 | Ga0070659_1001106113 | 52 |
| 1392 | 3300005367 | Ga0070667_100031455 | Ga0070667_1000314555 | 52 |
| 1393 | 3300005367 | Ga0070667_100263592 | Ga0070667_1002635922 | 52 |
| 1394 | 3300005457 | Ga0070662_100161909 | Ga0070662_1001619093 | 52 |
| 1395 | 3300005459 | Ga0068867_100086826 | Ga0068867_1000868263 | 52 |
| 1396 | 3300005530 | Ga0070679_101304261 | Ga0070679_1013042612 | 52 |
| 1397 | 3300005535 | Ga0070684_100012697 | Ga0070684_1000126976 | 52 |
| 1398 | 3300005535 | Ga0070684_100029010 | Ga0070684_1000290103 | 52 |
| 1399 | 3300005539 | Ga0068853_100301289 | Ga0068853_1003012892 | 52 |
| 1400 | 3300005543 | Ga0070672_100334253 | Ga0070672_1003342532 | 52 |
| 1401 | 3300005543 | Ga0070672_100538371 | Ga0070672_1005383712 | 52 |
| 1402 | 3300005564 | Ga0070664_100064589 | Ga0070664_1000645892 | 52 |
| 1403 | 3300005564 | Ga0070664_100090167 | Ga0070664_1000901673 | 52 |
| 1404 | 3300005564 | Ga0070664_100375151 | Ga0070664_1003751512 | 52 |
| 1405 | 3300005577 | Ga0068857_100041668 | Ga0068857_1000416682 | 52 |
| 1406 | 3300005614 | Ga0068856_102147685 | Ga0068856_1021476852 | 52 |
| 1407 | 3300005615 | Ga0070702_100485335 | Ga0070702_1004853352 | 52 |
| 1408 | 3300005616 | Ga0068852_100032353 | Ga0068852_1000323534 | 52 |
| 1409 | 3300005616 | Ga0068852_100422225 | Ga0068852_1004222253 | 52 |
| 1410 | 3300005618 | Ga0068864_100042879 | Ga0068864_1000428794 | 52 |
| 1411 | 3300005718 | Ga0068866_10295868 | Ga0068866_102958682 | 52 |
| 1412 | 3300005719 | Ga0068861_100749385 | Ga0068861_1007493851 | 52 |
| 1413 | 3300005834 | Ga0068851_10234929 | Ga0068851_102349292 | 52 |
| 1414 | 3300005841 | Ga0068863_100302684 | Ga0068863_1003026842 | 52 |
| 1415 | 3300005842 | Ga0068858_100992624 | Ga0068858_1009926243 | 52 |
| 1416 | 3300005842 | Ga0068858_101085492 | Ga0068858_1010854922 | 52 |
| 1417 | 3300005843 | Ga0068860_101365343 | Ga0068860_1013653432 | 52 |
| 1418 | 3300006871 | Ga0075434_100870128 | Ga0075434_1008701282 | 52 |
| 1419 | 3300009098 | Ga0105245_13258386 | Ga0105245_132583861 | 52 |
| 1420 | 3300009177 | Ga0105248_10049520 | Ga0105248_100495204 | 52 |
| 1421 | 3300025315 | Ga0207697_10113298 | Ga0207697_101132982 | 52 |
| 1422 | 3300025321 | Ga0207656_10080629 | Ga0207656_100806292 | 52 |
| 1423 | 3300025321 | Ga0207656_10269096 | Ga0207656_102690962 | 52 |
| 1424 | 3300025899 | Ga0207642_10030849 | Ga0207642_100308493 | 52 |
| 1425 | 3300025907 | Ga0207645_10074238 | Ga0207645_100742381 | 52 |
| 1426 | 3300025909 | Ga0207705_10087806 | Ga0207705_100878063 | 52 |
| 1427 | 3300025912 | Ga0207707_11525684 | Ga0207707_115256842 | 52 |
| 1428 | 3300025919 | Ga0207657_10381680 | Ga0207657_103816803 | 52 |
| 1429 | 3300025920 | Ga0207649_10143932 | Ga0207649_101439323 | 52 |
| 1430 | 3300025921 | Ga0207652_10223971 | Ga0207652_102239713 | 52 |
| 1431 | 3300025925 | Ga0207650_10160698 | Ga0207650_101606983 | 52 |
| 1432 | 3300025925 | Ga0207650_10382323 | Ga0207650_103823233 | 52 |
| 1433 | 3300025931 | Ga0207644_10881724 | Ga0207644_108817242 | 52 |
| 1434 | 3300025932 | Ga0207690_10019600 | Ga0207690_100196002 | 52 |
| 1435 | 3300025933 | Ga0207706_10047908 | Ga0207706_100479084 | 52 |
| 1436 | 3300025934 | Ga0207686_10230613 | Ga0207686_102306132 | 52 |
| 1437 | 3300025935 | Ga0207709_10506401 | Ga0207709_105064012 | 52 |
| 1438 | 3300025937 | Ga0207669_10253231 | Ga0207669_102532312 | 52 |
| 1439 | 3300025940 | Ga0207691_10022379 | Ga0207691_100223793 | 52 |
| 1440 | 3300025941 | Ga0207711_10243288 | Ga0207711_102432883 | 52 |
| 1441 | 3300025944 | Ga0207661_10012723 | Ga0207661_100127233 | 52 |
| 1442 | 3300025944 | Ga0207661_10164372 | Ga0207661_101643722 | 52 |
| 1443 | 3300025944 | Ga0207661_10490613 | Ga0207661_104906132 | 52 |
| 1444 | 3300025945 | Ga0207679_10034445 | Ga0207679_100344453 | 52 |
| 1445 | 3300025945 | Ga0207679_10244466 | Ga0207679_102444663 | 52 |
| 1446 | 3300025945 | Ga0207679_10695184 | Ga0207679_106951842 | 52 |
| 1447 | 3300025972 | Ga0207668_11229596 | Ga0207668_112295962 | 52 |
| 1448 | 3300025981 | Ga0207640_10404867 | Ga0207640_104048673 | 52 |
| 1449 | 3300026023 | Ga0207677_11645097 | Ga0207677_116450972 | 52 |
| 1450 | 3300026035 | Ga0207703_10495105 | Ga0207703_104951053 | 52 |
| 1451 | 3300026041 | Ga0207639_10156367 | Ga0207639_101563672 | 52 |
| 1452 | 3300026067 | Ga0207678_11015145 | Ga0207678_110151452 | 52 |
| 1453 | 3300026078 | Ga0207702_12170194 | Ga0207702_121701942 | 52 |
| 1454 | 3300026089 | Ga0207648_10384967 | Ga0207648_103849672 | 52 |
| 1455 | 3300026116 | Ga0207674_10003778 | Ga0207674_100037786 | 52 |
| 1456 | 3300026142 | Ga0207698_10018429 | Ga0207698_100184294 | 52 |
| 1457 | 3300046536 | Ga0495587_0454348 | Ga0495587_0454348_510_668 | 52 |
| 1458 | 3300047317 | Ga0495604_0047067 | Ga0495604_0047067_1541_1699 | 52 |
| 1459 | 3300048904 | Ga0496101_0719796 | Ga0496101_0719796_51_209 | 52 |
| 1460 | 3300048912 | Ga0496109_0500653 | Ga0496109_0500653_256_414 | 52 |
| 1461 | 3300048914 | Ga0496111_0876394 | Ga0496111_0876394_123_281 | 52 |
| 1462 | 3300048915 | Ga0496112_0478293 | Ga0496112_0478293_831_989 | 52 |
| 1463 | 3300049741 | Ga0501079_0411430 | Ga0501079_0411430_651_809 | 52 |
| 1464 | 3300049824 | Ga0501045_0419115 | Ga0501045_0419115_122_280 | 52 |
| 1465 | 3300050512 | nmdc:mga0n895_1346942_c1 | nmdc:mga0n895_1346942_c1_190_348 | 52 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar