F494161

General Info

Members Datasets Scaffolds Average Seq Length
1465 514 1458 50

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0055390|Ga0495608_0055390_846_992
Length 48
Sequence MMDFVAELWRFMRARKKFWLLPILVMMVVFIVVLTKGTVFAPFIYTLF

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
3 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
4 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
5 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
6 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
7 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
121 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
160 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
167 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
168 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
169 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
240 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
247 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
248 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
253 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
258 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
259 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
260 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
261 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
262 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
263 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
264 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
265 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
266 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
271 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
274 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
275 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
276 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
277 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
278 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
279 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
280 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
281 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
282 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
283 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
285 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
287 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
288 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
289 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
290 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
291 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
292 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
293 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
294 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
295 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
296 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
297 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
298 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
299 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
300 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
301 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
302 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
303 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
304 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
305 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
306 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
307 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
308 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
313 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
317 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
318 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
319 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
320 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
321 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
322 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
323 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
324 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
325 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
326 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
327 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
328 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
329 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
330 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
331 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
332 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
333 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
334 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
335 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
336 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
337 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
338 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
339 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
340 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
341 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
342 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
343 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
344 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
345 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
346 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
347 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
348 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
349 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
350 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
351 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
352 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
353 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
354 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
355 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
356 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
357 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
358 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
359 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
360 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
361 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
362 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
363 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
364 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
365 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
366 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
367 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
368 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
369 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
370 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
371 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
372 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
373 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
374 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
375 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
376 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
377 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
378 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
379 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
382 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
383 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
384 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
385 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
386 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
387 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
388 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
389 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
390 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
391 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
392 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
393 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
394 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
395 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
396 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
397 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
398 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
399 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
400 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
401 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
402 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
403 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
404 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
405 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
406 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
407 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
408 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
409 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
410 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
422 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
423 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
442 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
443 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
444 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
445 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
446 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
447 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
448 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
456 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
460 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
461 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
462 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
463 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
464 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
465 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
466 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
467 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
468 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
469 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
470 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
471 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
472 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
473 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
474 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
475 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
476 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
477 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
478 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
479 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
480 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
481 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
482 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
483 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
484 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
485 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
486 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
487 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
488 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
489 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
490 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
491 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
492 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
493 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
494 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
495 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
496 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
497 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
498 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
499 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
500 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
501 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
502 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
503 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
504 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
505 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
506 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
507 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
508 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
509 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
510 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
511 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
514 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.23
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.56
Nodule 0.14
Rhizoplane 2.94
Rhizosphere 83.75
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10019519 3300001990 Bacteria 2167
2 JGI25406J46586_10000940 3300003203 Bacteria 13721
3 JGI25406J46586_10021547 3300003203 Bacteria 2584
4 JGI25406J46586_10030719 3300003203 Bacteria 2018
5 JGI25153J46596_10002123 3300003215 Bacteria 11603
6 rootH2_10190176 3300003320 Bacteria 2104
7 JGI25404J52841_10013369 3300003659 Bacteria 1780
8 JGI25405J52794_10090595 3300003911 Bacteria 677
9 Ga0058862_12858404 3300004803 Bacteria 1080
10 Ga0065712_10185320 3300005290 Bacteria 1172
11 Ga0065715_10216814 3300005293 Bacteria 1289
12 Ga0065715_10874724 3300005293 Bacteria 583
13 Ga0070658_10006980 3300005327 Bacteria 9123
14 Ga0070658_10131935 3300005327 Bacteria 2082
15 Ga0070676_10251595 3300005328 Bacteria 1179
16 Ga0070676_11003826 3300005328 Bacteria 627
17 Ga0070683_100004443 3300005329 Bacteria 11562
18 Ga0070683_100033923 3300005329 Bacteria 4658
19 Ga0070683_100035249 3300005329 Bacteria 4573
20 Ga0070683_100066371 3300005329 Bacteria 3361
21 Ga0070683_100803745 3300005329 Bacteria 902
22 Ga0070683_100912673 3300005329 Bacteria 843
23 Ga0070690_100434208 3300005330 Bacteria 971
24 Ga0070690_100482699 3300005330 Bacteria 924
25 Ga0070690_100706536 3300005330 Bacteria 775
26 Ga0070670_100027724 3300005331 Bacteria 4873
27 Ga0070670_100162620 3300005331 Bacteria 1935
28 Ga0070670_100430999 3300005331 Bacteria 1167
29 Ga0070670_100440685 3300005331 Bacteria 1153
30 Ga0070670_100610163 3300005331 Bacteria 977
31 Ga0070677_10871200 3300005333 Bacteria 519
32 Ga0068869_100000708 3300005334 Bacteria 18924
33 Ga0070666_10016127 3300005335 Bacteria 4774
34 Ga0070680_100274888 3300005336 Bacteria 1426
35 Ga0070680_101621571 3300005336 Bacteria 561
36 Ga0070680_101713781 3300005336 Bacteria 545
37 Ga0070682_100039976 3300005337 Bacteria 2884
38 Ga0070682_100094786 3300005337 Bacteria 1959
39 Ga0070682_100162503 3300005337 Bacteria 1544
40 Ga0070682_101020341 3300005337 Bacteria 688
41 Ga0068868_100251129 3300005338 Bacteria 1489
42 Ga0068868_101340941 3300005338 Bacteria 666
43 Ga0068868_102038785 3300005338 Bacteria 545
44 Ga0068868_102378353 3300005338 Bacteria 506
45 Ga0068868_102390218 3300005338 Bacteria 505
46 Ga0070660_100103462 3300005339 Bacteria 2258
47 Ga0070660_100187370 3300005339 Bacteria 1675
48 Ga0070660_101891519 3300005339 Bacteria 509
49 Ga0070689_100147781 3300005340 Bacteria 1894
50 Ga0070689_100242355 3300005340 Bacteria 1485
51 Ga0070689_100293898 3300005340 Bacteria 1351
52 Ga0070691_10124334 3300005341 Bacteria 1301
53 Ga0070691_10365617 3300005341 Bacteria 805
54 Ga0070687_101140673 3300005343 Bacteria 572
55 Ga0070661_100043611 3300005344 Bacteria 3276
56 Ga0070661_100056480 3300005344 Bacteria 2876
57 Ga0070661_100669555 3300005344 Bacteria 844
58 Ga0070661_101067422 3300005344 Bacteria 672
59 Ga0070692_10100582 3300005345 Bacteria 1584
60 Ga0070692_10388411 3300005345 Bacteria 878
61 Ga0070692_11316610 3300005345 Bacteria 519
62 Ga0070668_100009348 3300005347 Bacteria 7272
63 Ga0070668_100120941 3300005347 Bacteria 2093
64 Ga0070668_100429687 3300005347 Bacteria 1132
65 Ga0070668_101055912 3300005347 Bacteria 732
66 Ga0070668_101784614 3300005347 Unclassified 566
67 Ga0070668_101953501 3300005347 Bacteria 541
68 Ga0070669_100021100 3300005353 Bacteria 4655
69 Ga0070669_100034441 3300005353 Bacteria 3666
70 Ga0070669_100050479 3300005353 Bacteria 3039
71 Ga0070669_100426557 3300005353 Bacteria 1089
72 Ga0070669_100778364 3300005353 Bacteria 812
73 Ga0070669_101457439 3300005353 Bacteria 595
74 Ga0070669_101569385 3300005353 Bacteria 573
75 Ga0070675_100066680 3300005354 Bacteria 2978
76 Ga0070675_100306306 3300005354 Bacteria 1401
77 Ga0070671_100628595 3300005355 Bacteria 929
78 Ga0070671_101430619 3300005355 Bacteria 611
79 Ga0070671_101661487 3300005355 Bacteria 567
80 Ga0070674_100290609 3300005356 Bacteria 1299
81 Ga0070674_101038574 3300005356 Bacteria 721
82 Ga0070673_100050408 3300005364 Bacteria 3255
83 Ga0070673_100176614 3300005364 Bacteria 1826
84 Ga0070673_100452159 3300005364 Bacteria 1156
85 Ga0070673_101620520 3300005364 Bacteria 612
86 Ga0070688_100384736 3300005365 Bacteria 1035
87 Ga0070688_100398958 3300005365 Bacteria 1017
88 Ga0070688_100873219 3300005365 Bacteria 708
89 Ga0070659_100110611 3300005366 Bacteria 2217
90 Ga0070659_102041878 3300005366 Bacteria 515
91 Ga0070667_100005347 3300005367 Bacteria 10725
92 Ga0070667_100031455 3300005367 Bacteria 4425
93 Ga0070667_100263592 3300005367 Bacteria 1543
94 Ga0070667_100630757 3300005367 Bacteria 989
95 Ga0070667_100772708 3300005367 Bacteria 891
96 Ga0070667_101973085 3300005367 Bacteria 550
97 Ga0070667_102266512 3300005367 Bacteria 511
98 Ga0070709_10112676 3300005434 Bacteria 1831
99 Ga0070709_10243301 3300005434 Bacteria 1293
100 Ga0070709_10273829 3300005434 Bacteria 1224
101 Ga0070709_10293176 3300005434 Bacteria 1186
102 Ga0070714_100006563 3300005435 Bacteria 8999
103 Ga0070714_100073056 3300005435 Bacteria 2971
104 Ga0070714_100102355 3300005435 Bacteria 2525
105 Ga0070714_100660723 3300005435 Bacteria 1007
106 Ga0070714_100865746 3300005435 Bacteria 877
107 Ga0070713_100027835 3300005436 Bacteria 4457
108 Ga0070713_100031740 3300005436 Bacteria 4210
109 Ga0070713_100047532 3300005436 Bacteria 3528
110 Ga0070713_100060357 3300005436 Bacteria 3170
111 Ga0070713_100216314 3300005436 Bacteria 1737
112 Ga0070713_100227269 3300005436 Bacteria 1695
113 Ga0070710_10077434 3300005437 Bacteria 1933
114 Ga0070710_10196582 3300005437 Bacteria 1271
115 Ga0070710_11222692 3300005437 Bacteria 556
116 Ga0070701_10809268 3300005438 Bacteria 640
117 Ga0070701_11207723 3300005438 Bacteria 537
118 Ga0070711_101028427 3300005439 Bacteria 708
119 Ga0070711_101118662 3300005439 Bacteria 679
120 Ga0070711_101947352 3300005439 Bacteria 517
121 Ga0070705_100672043 3300005440 Bacteria 810
122 Ga0070705_101437375 3300005440 Bacteria 576
123 Ga0070700_100888587 3300005441 Bacteria 725
124 Ga0070700_100958214 3300005441 Bacteria 701
125 Ga0070708_100252458 3300005445 Bacteria 1657
126 Ga0070708_100270417 3300005445 Bacteria 1598
127 Ga0070708_101540875 3300005445 Bacteria 619
128 Ga0070663_101250849 3300005455 Bacteria 653
129 Ga0070678_100038096 3300005456 Bacteria 3382
130 Ga0070678_100343831 3300005456 Bacteria 1281
131 Ga0070678_100496516 3300005456 Bacteria 1076
132 Ga0070678_100566086 3300005456 Bacteria 1010
133 Ga0070678_101876861 3300005456 Bacteria 566
134 Ga0070662_100161909 3300005457 Bacteria 1751
135 Ga0070662_100334207 3300005457 Bacteria 1238
136 Ga0070681_10048012 3300005458 Bacteria 4267
137 Ga0070681_10052271 3300005458 Bacteria 4074
138 Ga0070681_11164486 3300005458 Bacteria 692
139 Ga0070681_11432511 3300005458 Bacteria 615
140 Ga0070681_11505719 3300005458 Bacteria 597
141 Ga0068867_100026445 3300005459 Bacteria 4167
142 Ga0068867_100086826 3300005459 Bacteria 2368
143 Ga0068867_100192548 3300005459 Bacteria 1628
144 Ga0068867_100617106 3300005459 Bacteria 948
145 Ga0068867_101875773 3300005459 Bacteria 565
146 Ga0070685_10342578 3300005466 Bacteria 1020
147 Ga0070685_10413731 3300005466 Bacteria 937
148 Ga0070685_10654335 3300005466 Bacteria 762
149 Ga0070685_11123310 3300005466 Bacteria 595
150 Ga0070706_100065125 3300005467 Bacteria 3370
151 Ga0070707_100065107 3300005468 Unclassified 3501
152 Ga0070707_101370156 3300005468 Bacteria 674
153 Ga0070698_100058117 3300005471 Bacteria 3911
154 Ga0070698_100090301 3300005471 Bacteria 3047
155 Ga0070698_101609126 3300005471 Unclassified 602
156 Ga0070699_100059857 3300005518 Bacteria 3299
157 Ga0070679_100059679 3300005530 Bacteria 3801
158 Ga0070679_100382826 3300005530 Bacteria 1353
159 Ga0070679_100392092 3300005530 Bacteria 1335
160 Ga0070679_100444240 3300005530 Bacteria 1242
161 Ga0070679_101038979 3300005530 Bacteria 764
162 Ga0070679_101304261 3300005530 Bacteria 672
163 Ga0070684_100007463 3300005535 Bacteria 8503
164 Ga0070684_100012697 3300005535 Bacteria 6760
165 Ga0070684_100029010 3300005535 Bacteria 4685
166 Ga0070684_100106264 3300005535 Bacteria 2512
167 Ga0070684_100967433 3300005535 Bacteria 798
168 Ga0070684_101395147 3300005535 Bacteria 660
169 Ga0070697_100020437 3300005536 Bacteria 5237
170 Ga0070697_100508271 3300005536 Bacteria 1054
171 Ga0068853_100174646 3300005539 Bacteria 1945
172 Ga0068853_100239099 3300005539 Bacteria 1664
173 Ga0068853_100301289 3300005539 Bacteria 1482
174 Ga0068853_100478387 3300005539 Bacteria 1174
175 Ga0068853_100533732 3300005539 Bacteria 1110
176 Ga0068853_100637485 3300005539 Bacteria 1014
177 Ga0068853_101071634 3300005539 Bacteria 777
178 Ga0068853_101948537 3300005539 Bacteria 570
179 Ga0068853_101982387 3300005539 Bacteria 564
180 Ga0070672_100010053 3300005543 Bacteria 6550
181 Ga0070672_100334253 3300005543 Bacteria 1289
182 Ga0070672_100538371 3300005543 Bacteria 1013
183 Ga0070672_101073380 3300005543 Bacteria 715
184 Ga0070686_101810100 3300005544 Bacteria 520
185 Ga0070686_101841928 3300005544 Bacteria 516
186 Ga0070695_101293325 3300005545 Bacteria 602
187 Ga0070696_100310212 3300005546 Bacteria 1211
188 Ga0070696_101611494 3300005546 Bacteria 558
189 Ga0070693_100181407 3300005547 Bacteria 1355
190 Ga0070693_100465017 3300005547 Bacteria 891
191 Ga0070693_100969406 3300005547 Unclassified 641
192 Ga0070693_100976858 3300005547 Bacteria 639
193 Ga0070665_100020492 3300005548 Bacteria 6641
194 Ga0070665_100271847 3300005548 Bacteria 1696
195 Ga0070665_100385356 3300005548 Bacteria 1409
196 Ga0070665_100783324 3300005548 Bacteria 967
197 Ga0070665_101504249 3300005548 Bacteria 682
198 Ga0070704_100216017 3300005549 Bacteria 1556
199 Ga0068855_100025340 3300005563 Bacteria 7097
200 Ga0068855_100168944 3300005563 Bacteria 2477
201 Ga0068855_100187077 3300005563 Bacteria 2338
202 Ga0068855_100713535 3300005563 Bacteria 1072
203 Ga0068855_101178465 3300005563 Bacteria 797
204 Ga0068855_101303329 3300005563 Bacteria 752
205 Ga0068855_101603565 3300005563 Bacteria 666
206 Ga0070664_100064589 3300005564 Bacteria 3122
207 Ga0070664_100090167 3300005564 Bacteria 2653
208 Ga0070664_100316783 3300005564 Bacteria 1412
209 Ga0070664_100375151 3300005564 Bacteria 1297
210 Ga0070664_100423770 3300005564 Bacteria 1219
211 Ga0070664_101261183 3300005564 Bacteria 698
212 Ga0068857_100041668 3300005577 Bacteria 4072
213 Ga0068857_100096366 3300005577 Bacteria 2651
214 Ga0068857_100541876 3300005577 Bacteria 1095
215 Ga0068857_101286352 3300005577 Bacteria 709
216 Ga0068854_100219364 3300005578 Bacteria 1504
217 Ga0068854_100740106 3300005578 Bacteria 852
218 Ga0068854_101699283 3300005578 Bacteria 577
219 Ga0068856_100113034 3300005614 Bacteria 2714
220 Ga0068856_100212884 3300005614 Bacteria 1948
221 Ga0068856_100722067 3300005614 Bacteria 1017
222 Ga0068856_101044042 3300005614 Bacteria 835
223 Ga0068856_102147685 3300005614 Bacteria 568
224 Ga0070702_100019857 3300005615 Bacteria 3512
225 Ga0070702_100485335 3300005615 Bacteria 904
226 Ga0070702_101062416 3300005615 Bacteria 645
227 Ga0068852_100032353 3300005616 Bacteria 4330
228 Ga0068852_100422225 3300005616 Bacteria 1315
229 Ga0068852_100814121 3300005616 Bacteria 948
230 Ga0068852_101030749 3300005616 Bacteria 842
231 Ga0068852_101324341 3300005616 Bacteria 742
232 Ga0068859_100001245 3300005617 Bacteria 25989
233 Ga0068859_100184715 3300005617 Bacteria 2168
234 Ga0068859_102411696 3300005617 Bacteria 580
235 Ga0068864_100008273 3300005618 Bacteria 8583
236 Ga0068864_100042879 3300005618 Bacteria 3872
237 Ga0068864_102020404 3300005618 Bacteria 583
238 Ga0068864_102266430 3300005618 Bacteria 549
239 Ga0068866_10059936 3300005718 Bacteria 1971
240 Ga0068866_10295868 3300005718 Bacteria 1009
241 Ga0068866_10833761 3300005718 Bacteria 643
242 Ga0068861_100006169 3300005719 Bacteria 8155
243 Ga0068861_100749385 3300005719 Bacteria 912
244 Ga0068861_100948810 3300005719 Bacteria 818
245 Ga0068861_101210984 3300005719 Bacteria 731
246 Ga0068851_10234929 3300005834 Bacteria 1035
247 Ga0068870_10002331 3300005840 Bacteria 7896
248 Ga0068870_10488874 3300005840 Bacteria 818
249 Ga0068870_10661408 3300005840 Bacteria 717
250 Ga0068870_11124370 3300005840 Bacteria 566
251 Ga0068870_11242674 3300005840 Bacteria 541
252 Ga0068863_100000873 3300005841 Bacteria 30215
253 Ga0068863_100086250 3300005841 Bacteria 2974
254 Ga0068863_100302684 3300005841 Bacteria 1551
255 Ga0068863_101154561 3300005841 Bacteria 780
256 Ga0068863_101478691 3300005841 Bacteria 688
257 Ga0068858_100002812 3300005842 Bacteria 17501
258 Ga0068858_100143105 3300005842 Bacteria 2245
259 Ga0068858_100870038 3300005842 Bacteria 881
260 Ga0068858_100949509 3300005842 Bacteria 842
261 Ga0068858_100992624 3300005842 Bacteria 823
262 Ga0068858_101085492 3300005842 Unclassified 786
263 Ga0068858_101988129 3300005842 Bacteria 575
264 Ga0068860_100000149 3300005843 Bacteria 113068
265 Ga0068860_100012312 3300005843 Bacteria 8428
266 Ga0068860_100521163 3300005843 Bacteria 1189
267 Ga0068860_100792664 3300005843 Bacteria 961
268 Ga0068860_101365343 3300005843 Bacteria 730
269 Ga0068860_101617533 3300005843 Bacteria 670
270 Ga0068860_101762671 3300005843 Bacteria 641
271 Ga0068862_100012163 3300005844 Bacteria 7115
272 Ga0068862_100131633 3300005844 Bacteria 2213
273 Ga0068862_100222846 3300005844 Bacteria 1708
274 Ga0068862_100371395 3300005844 Bacteria 1332
275 Ga0068862_100406614 3300005844 Bacteria 1274
276 Ga0068862_100559699 3300005844 Bacteria 1093
277 Ga0068862_101773246 3300005844 Unclassified 626
278 Ga0068862_102369173 3300005844 Bacteria 542
279 Ga0081455_10001001 3300005937 Bacteria 35840
280 Ga0081455_10007427 3300005937 Bacteria 11546
281 Ga0081455_10090302 3300005937 Bacteria 2484
282 Ga0081455_10091268 3300005937 Bacteria 2467
283 Ga0081455_10128235 3300005937 Bacteria 1988
284 Ga0081455_10910420 3300005937 Bacteria 547
285 Ga0081538_10138715 3300005981 Bacteria 1126
286 Ga0081540_1000003 3300005983 Bacteria 233942
287 Ga0081540_1003189 3300005983 Bacteria 13057
288 Ga0081540_1035955 3300005983 Bacteria 2649
289 Ga0081540_1186596 3300005983 Bacteria 769
290 Ga0081539_10000191 3300005985 Bacteria 142387
291 Ga0081539_10001452 3300005985 Bacteria 40486
292 Ga0081539_10001574 3300005985 Bacteria 37718
293 Ga0081539_10007767 3300005985 Bacteria 9608
294 Ga0070717_10002484 3300006028 Bacteria 13019
295 Ga0070717_10003662 3300006028 Bacteria 11032
296 Ga0070717_10060928 3300006028 Bacteria 3126
297 Ga0070717_11202793 3300006028 Bacteria 690
298 Ga0075365_10005466 3300006038 Bacteria 6856
299 Ga0075365_10169119 3300006038 Bacteria 1525
300 Ga0075365_10207547 3300006038 Bacteria 1373
301 Ga0075365_10558838 3300006038 Bacteria 809
302 Ga0075365_10597471 3300006038 Bacteria 780
303 Ga0075365_10630465 3300006038 Bacteria 758
304 Ga0075365_10675477 3300006038 Bacteria 730
305 Ga0075368_10110543 3300006042 Bacteria 1133
306 Ga0075368_10374334 3300006042 Bacteria 622
307 Ga0075363_100067216 3300006048 Bacteria 1942
308 Ga0075363_100141991 3300006048 Bacteria 1352
309 Ga0075364_10035360 3300006051 Bacteria 3228
310 Ga0075364_10174371 3300006051 Bacteria 1454
311 Ga0075364_10503654 3300006051 Bacteria 828
312 Ga0075432_10085982 3300006058 Bacteria 1146
313 Ga0075432_10383668 3300006058 Bacteria 603
314 Ga0070715_10410531 3300006163 Bacteria 755
315 Ga0070715_10647226 3300006163 Unclassified 625
316 Ga0070715_11047873 3300006163 Bacteria 511
317 Ga0070716_100092196 3300006173 Bacteria 1836
318 Ga0070716_100174999 3300006173 Bacteria 1404
319 Ga0070716_101256805 3300006173 Bacteria 597
320 Ga0070716_101463376 3300006173 Bacteria 557
321 Ga0070712_100051865 3300006175 Bacteria 2859
322 Ga0070712_100729473 3300006175 Bacteria 847
323 Ga0075362_10002622 3300006177 Bacteria 6090
324 Ga0075362_10003948 3300006177 Bacteria 5269
325 Ga0075362_10004980 3300006177 Bacteria 4818
326 Ga0075362_10067150 3300006177 Bacteria 1631
327 Ga0075362_10104884 3300006177 Bacteria 1325
328 Ga0075362_10527718 3300006177 Bacteria 605
329 Ga0075367_10006371 3300006178 Bacteria 5956
330 Ga0075367_10081795 3300006178 Bacteria 1955
331 Ga0075367_10372777 3300006178 Bacteria 902
332 Ga0075367_10484337 3300006178 Bacteria 784
333 Ga0075369_10001306 3300006186 Bacteria 8479
334 Ga0075369_10075756 3300006186 Bacteria 1486
335 Ga0075369_10149250 3300006186 Bacteria 1068
336 Ga0075366_10000880 3300006195 Bacteria 14505
337 Ga0075366_10157169 3300006195 Bacteria 1377
338 Ga0075366_10187591 3300006195 Bacteria 1256
339 Ga0075366_10190723 3300006195 Bacteria 1245
340 Ga0075366_10425519 3300006195 Bacteria 818
341 Ga0097621_100278535 3300006237 Bacteria 1472
342 Ga0097621_100663585 3300006237 Bacteria 958
343 Ga0097621_100862381 3300006237 Bacteria 842
344 Ga0097621_101373661 3300006237 Bacteria 668
345 Ga0075370_10045498 3300006353 Bacteria 2482
346 Ga0075370_10078629 3300006353 Bacteria 1894
347 Ga0075370_10224866 3300006353 Bacteria 1109
348 Ga0075370_10346164 3300006353 Bacteria 887
349 Ga0075370_10435715 3300006353 Bacteria 788
350 Ga0068871_100385436 3300006358 Bacteria 1246
351 Ga0068871_100705272 3300006358 Bacteria 925
352 Ga0075428_100045105 3300006844 Bacteria 4844
353 Ga0075428_100080803 3300006844 Bacteria 3548
354 Ga0075428_100561180 3300006844 Unclassified 1220
355 Ga0075428_101171392 3300006844 Bacteria 811
356 Ga0075428_102272686 3300006844 Unclassified 558
357 Ga0075430_100084875 3300006846 Bacteria 2652
358 Ga0075430_100118025 3300006846 Bacteria 2211
359 Ga0075430_100812322 3300006846 Unclassified 771
360 Ga0075431_100014415 3300006847 Bacteria 7996
361 Ga0075431_100034312 3300006847 Bacteria 5227
362 Ga0075431_102136570 3300006847 Unclassified 514
363 Ga0075433_10003359 3300006852 Bacteria 12372
364 Ga0075433_10018901 3300006852 Bacteria 5736
365 Ga0075434_100017326 3300006871 Bacteria 6936
366 Ga0075434_100020139 3300006871 Bacteria 6465
367 Ga0075434_100067222 3300006871 Bacteria 3571
368 Ga0075434_100193791 3300006871 Bacteria 2052
369 Ga0075434_100522982 3300006871 Bacteria 1207
370 Ga0075434_100525994 3300006871 Bacteria 1203
371 Ga0075434_100866084 3300006871 Bacteria 919
372 Ga0075434_100870128 3300006871 Bacteria 916
373 Ga0075434_101077628 3300006871 Bacteria 817
374 Ga0075429_100047982 3300006880 Bacteria 3714
375 Ga0075429_100222872 3300006880 Bacteria 1652
376 Ga0075429_100437713 3300006880 Unclassified 1146
377 Ga0075429_100609623 3300006880 Bacteria 956
378 Ga0068865_100266213 3300006881 Bacteria 1359
379 Ga0075436_100270712 3300006914 Bacteria 1213
380 Ga0075436_100921172 3300006914 Unclassified 654
381 Ga0097620_100001245 3300006931 Bacteria 25989
382 Ga0097620_100184722 3300006931 Bacteria 2168
383 Ga0097620_102411355 3300006931 Bacteria 580
384 Ga0075435_100235203 3300007076 Bacteria 1557
385 Ga0075435_100531957 3300007076 Bacteria 1017
386 Ga0075435_100619304 3300007076 Bacteria 939
387 Ga0099794_10017466 3300007265 Bacteria 3199
388 Ga0099795_10104454 3300007788 Bacteria 1115
389 Ga0099795_10106440 3300007788 Bacteria 1106
390 Ga0099795_10473198 3300007788 Bacteria 580
391 Ga0105250_10108891 3300009092 Bacteria 1134
392 Ga0105240_10075127 3300009093 Bacteria 4169
393 Ga0105240_10357095 3300009093 Bacteria 1656
394 Ga0105240_10822753 3300009093 Bacteria 1004
395 Ga0105240_11779767 3300009093 Bacteria 642
396 Ga0105240_11879762 3300009093 Bacteria 623
397 Ga0111539_10015625 3300009094 Bacteria 9437
398 Ga0111539_10046064 3300009094 Bacteria 5219
399 Ga0111539_10068483 3300009094 Bacteria 4190
400 Ga0111539_10089231 3300009094 Bacteria 3622
401 Ga0111539_10645809 3300009094 Bacteria 1232
402 Ga0111539_12192369 3300009094 Bacteria 641
403 Ga0105245_10257845 3300009098 Bacteria 1696
404 Ga0105245_10575581 3300009098 Bacteria 1150
405 Ga0105245_10593084 3300009098 Bacteria 1134
406 Ga0105245_11669470 3300009098 Bacteria 689
407 Ga0105245_11764188 3300009098 Bacteria 671
408 Ga0105245_11818477 3300009098 Bacteria 662
409 Ga0105245_12994096 3300009098 Bacteria 524
410 Ga0105245_13258386 3300009098 Unclassified 503
411 Ga0105247_10041211 3300009101 Bacteria 2825
412 Ga0105247_10070694 3300009101 Bacteria 2181
413 Ga0105247_10324994 3300009101 Bacteria 1074
414 Ga0105247_10464790 3300009101 Bacteria 915
415 Ga0105247_10515367 3300009101 Bacteria 874
416 Ga0105247_10562553 3300009101 Bacteria 840
417 Ga0105247_11345847 3300009101 Bacteria 575
418 Ga0105247_11452821 3300009101 Bacteria 557
419 Ga0114129_10761458 3300009147 Bacteria 1239
420 Ga0114129_11558884 3300009147 Bacteria 810
421 Ga0114129_13123651 3300009147 Bacteria 541
422 Ga0105243_10188988 3300009148 Bacteria 1797
423 Ga0105243_11152555 3300009148 Bacteria 786
424 Ga0105243_11241130 3300009148 Bacteria 760
425 Ga0105243_11378026 3300009148 Bacteria 725
426 Ga0105243_12463319 3300009148 Bacteria 559
427 Ga0105241_10128324 3300009174 Bacteria 2050
428 Ga0105241_10304189 3300009174 Bacteria 1369
429 Ga0105241_11754185 3300009174 Bacteria 605
430 Ga0105241_11767469 3300009174 Bacteria 602
431 Ga0105241_11931794 3300009174 Bacteria 579
432 Ga0105241_11989951 3300009174 Bacteria 572
433 Ga0105242_11835702 3300009176 Bacteria 645
434 Ga0105242_12797035 3300009176 Bacteria 538
435 Ga0105248_10002517 3300009177 Bacteria 20397
436 Ga0105248_10049520 3300009177 Bacteria 4712
437 Ga0105248_11398025 3300009177 Bacteria 792
438 Ga0105248_11404553 3300009177 Bacteria 790
439 Ga0105248_12667761 3300009177 Bacteria 570
440 Ga0105248_13334491 3300009177 Bacteria 510
441 Ga0105237_10053338 3300009545 Bacteria 4056
442 Ga0105237_10055453 3300009545 Bacteria 3969
443 Ga0105237_10149240 3300009545 Bacteria 2334
444 Ga0105237_10229785 3300009545 Bacteria 1856
445 Ga0105237_10363524 3300009545 Bacteria 1451
446 Ga0105237_10876228 3300009545 Bacteria 905
447 Ga0105237_11547053 3300009545 Bacteria 670
448 Ga0105237_11926353 3300009545 Bacteria 599
449 Ga0105238_10257663 3300009551 Bacteria 1724
450 Ga0105238_10345144 3300009551 Bacteria 1477
451 Ga0105238_10793711 3300009551 Bacteria 962
452 Ga0105238_11280213 3300009551 Bacteria 759
453 Ga0105249_10117602 3300009553 Bacteria 2521
454 Ga0105249_11197395 3300009553 Bacteria 831
455 Ga0105249_11326698 3300009553 Bacteria 791
456 Ga0105249_11365889 3300009553 Bacteria 780
457 Ga0105249_12128511 3300009553 Bacteria 634
458 Ga0105035_116424 3300009988 Bacteria 684
459 Ga0099796_10095363 3300010159 Bacteria 1112
460 Ga0099796_10119314 3300010159 Bacteria 1012
461 Ga0099796_10533419 3300010159 Bacteria 527
462 Ga0105239_10085772 3300010375 Bacteria 3471
463 Ga0105239_10207156 3300010375 Bacteria 2197
464 Ga0105239_10644134 3300010375 Bacteria 1210
465 Ga0105239_12092602 3300010375 Bacteria 658
466 Ga0105239_12483287 3300010375 Bacteria 604
467 Ga0105239_12680615 3300010375 Bacteria 581
468 Ga0105246_10225045 3300011119 Bacteria 1473
469 Ga0105246_10772466 3300011119 Bacteria 850
470 Ga0105246_10811141 3300011119 Bacteria 831
471 Ga0157321_1017925 3300012487 Bacteria 622
472 Ga0157373_10304337 3300013100 Bacteria 1132
473 Ga0157373_10445422 3300013100 Bacteria 931
474 Ga0157371_10037740 3300013102 Bacteria 3457
475 Ga0157371_10202736 3300013102 Bacteria 1422
476 Ga0157371_10806974 3300013102 Bacteria 707
477 Ga0157370_10240766 3300013104 Bacteria 1674
478 Ga0157370_10598302 3300013104 Bacteria 1010
479 Ga0157370_10676620 3300013104 Bacteria 942
480 Ga0157370_10728503 3300013104 Bacteria 904
481 Ga0157370_10742744 3300013104 Bacteria 894
482 Ga0157370_11861012 3300013104 Bacteria 540
483 Ga0157370_12027016 3300013104 Bacteria 516
484 Ga0157369_10059379 3300013105 Bacteria 4124
485 Ga0157369_10273787 3300013105 Bacteria 1759
486 Ga0157369_10288107 3300013105 Bacteria 1710
487 Ga0157369_10484948 3300013105 Bacteria 1279
488 Ga0157369_10524350 3300013105 Bacteria 1225
489 Ga0157369_11040671 3300013105 Bacteria 838
490 Ga0157374_10194493 3300013296 Bacteria 1985
491 Ga0157374_10202392 3300013296 Bacteria 1944
492 Ga0157374_10782565 3300013296 Bacteria 969
493 Ga0157374_10797268 3300013296 Bacteria 960
494 Ga0157374_11170581 3300013296 Bacteria 790
495 Ga0157374_12908873 3300013296 Unclassified 506
496 Ga0157378_10016126 3300013297 Bacteria 6543
497 Ga0157378_10180605 3300013297 Bacteria 1985
498 Ga0157378_10395136 3300013297 Bacteria 1361
499 Ga0157378_10716397 3300013297 Bacteria 1021
500 Ga0157378_11194236 3300013297 Bacteria 800
501 Ga0157378_12561561 3300013297 Bacteria 562
502 Ga0163162_10082452 3300013306 Bacteria 3288
503 Ga0163162_10096960 3300013306 Bacteria 3037
504 Ga0163162_10354072 3300013306 Bacteria 1601
505 Ga0163162_10395900 3300013306 Bacteria 1514
506 Ga0163162_11056463 3300013306 Bacteria 919
507 Ga0163162_11410211 3300013306 Bacteria 793
508 Ga0163162_12087887 3300013306 Bacteria 650
509 Ga0163162_13246855 3300013306 Bacteria 521
510 Ga0163162_13334989 3300013306 Bacteria 514
511 Ga0157372_10044917 3300013307 Bacteria 4897
512 Ga0157372_10237973 3300013307 Bacteria 2112
513 Ga0157372_10538562 3300013307 Bacteria 1361
514 Ga0157372_11478237 3300013307 Bacteria 783
515 Ga0157372_12429284 3300013307 Bacteria 602
516 Ga0157375_10222455 3300013308 Bacteria 2046
517 Ga0157375_11454833 3300013308 Bacteria 808
518 Ga0163163_10000812 3300014325 Bacteria 26556
519 Ga0163163_10113227 3300014325 Bacteria 2743
520 Ga0163163_10490016 3300014325 Bacteria 1291
521 Ga0163163_11050982 3300014325 Unclassified 877
522 Ga0163163_12660334 3300014325 Bacteria 558
523 Ga0157380_11695684 3300014326 Bacteria 689
524 Ga0157380_11916092 3300014326 Bacteria 653
525 Ga0157380_12261617 3300014326 Bacteria 608
526 Ga0182008_10244091 3300014497 Bacteria 925
527 Ga0182008_10566222 3300014497 Bacteria 633
528 Ga0182008_10846232 3300014497 Bacteria 534
529 Ga0157377_10540151 3300014745 Bacteria 822
530 Ga0157377_10888734 3300014745 Bacteria 665
531 Ga0157377_11295171 3300014745 Bacteria 569
532 Ga0157379_10000401 3300014968 Bacteria 35047
533 Ga0157379_10398503 3300014968 Bacteria 1265
534 Ga0157379_10666434 3300014968 Bacteria 975
535 Ga0157379_10926495 3300014968 Bacteria 828
536 Ga0157379_11014445 3300014968 Bacteria 792
537 Ga0157379_11747140 3300014968 Bacteria 610
538 Ga0157376_10058405 3300014969 Bacteria 3231
539 Ga0157376_10452778 3300014969 Bacteria 1252
540 Ga0157376_10596257 3300014969 Bacteria 1099
541 Ga0157376_11840955 3300014969 Bacteria 642
542 Ga0157376_12196332 3300014969 Bacteria 591
543 Ga0157376_12687351 3300014969 Bacteria 538
544 Ga0157376_13008035 3300014969 Bacteria 510
545 Ga0163161_10229479 3300017792 Bacteria 1440
546 Ga0163161_10572716 3300017792 Bacteria 928
547 Ga0197907_11200871 3300020069 Bacteria 2421
548 Ga0206356_10599982 3300020070 Bacteria 756
549 Ga0206356_11246173 3300020070 Unclassified 544
550 Ga0206349_1682998 3300020075 Bacteria 788
551 Ga0206355_1179373 3300020076 Bacteria 1939
552 Ga0206350_10626026 3300020080 Bacteria 4374
553 Ga0206354_11293970 3300020081 Bacteria 1471
554 Ga0206353_10193602 3300020082 Bacteria 897
555 Ga0154015_1702973 3300020610 Bacteria 1198
556 Ga0213873_10263288 3300021358 Bacteria 549
557 Ga0213872_10400673 3300021361 Bacteria 556
558 Ga0213874_10022748 3300021377 Bacteria 1742
559 Ga0213876_10204990 3300021384 Bacteria 1048
560 Ga0213871_10023878 3300021441 Bacteria 1543
561 Ga0224712_10011865 3300022467 Bacteria 2719
562 Ga0224712_10361874 3300022467 Bacteria 687
563 Ga0209758_1000183 3300025297 Bacteria 140623
564 Ga0209758_1022536 3300025297 Bacteria 2881
565 Ga0209758_1064599 3300025297 Bacteria 1185
566 Ga0207426_1102116 3300025302 Bacteria 738
567 Ga0207697_10113298 3300025315 Bacteria 1162
568 Ga0207697_10136582 3300025315 Bacteria 1061
569 Ga0207656_10080629 3300025321 Bacteria 1462
570 Ga0207656_10269096 3300025321 Bacteria 838
571 Ga0207653_10038324 3300025885 Bacteria 1566
572 Ga0207682_10283279 3300025893 Bacteria 775
573 Ga0207692_10107183 3300025898 Bacteria 1544
574 Ga0207692_10195267 3300025898 Bacteria 1187
575 Ga0207692_10304093 3300025898 Bacteria 971
576 Ga0207692_10457524 3300025898 Bacteria 804
577 Ga0207692_10731483 3300025898 Bacteria 644
578 Ga0207642_10030849 3300025899 Bacteria 2238
579 Ga0207642_10468464 3300025899 Bacteria 766
580 Ga0207710_10059715 3300025900 Bacteria 1727
581 Ga0207710_10152875 3300025900 Bacteria 1120
582 Ga0207710_10241257 3300025900 Bacteria 902
583 Ga0207710_10441552 3300025900 Bacteria 671
584 Ga0207710_10503179 3300025900 Bacteria 629
585 Ga0207688_10264866 3300025901 Bacteria 1044
586 Ga0207688_10465756 3300025901 Bacteria 789
587 Ga0207688_10855520 3300025901 Bacteria 576
588 Ga0207680_11004005 3300025903 Bacteria 598
589 Ga0207685_10191741 3300025905 Bacteria 954
590 Ga0207685_10574958 3300025905 Bacteria 602
591 Ga0207699_10025581 3300025906 Bacteria 3242
592 Ga0207699_10199589 3300025906 Bacteria 1355
593 Ga0207699_10284276 3300025906 Bacteria 1150
594 Ga0207699_10679423 3300025906 Bacteria 753
595 Ga0207699_10870700 3300025906 Bacteria 664
596 Ga0207699_11357232 3300025906 Bacteria 526
597 Ga0207699_11370861 3300025906 Bacteria 523
598 Ga0207699_11423756 3300025906 Bacteria 513
599 Ga0207645_10074238 3300025907 Bacteria 2177
600 Ga0207645_10214199 3300025907 Bacteria 1269
601 Ga0207645_10291619 3300025907 Bacteria 1085
602 Ga0207645_10321812 3300025907 Bacteria 1032
603 Ga0207643_10022986 3300025908 Bacteria 3437
604 Ga0207643_10147552 3300025908 Bacteria 1408
605 Ga0207643_11093598 3300025908 Bacteria 514
606 Ga0207643_11103461 3300025908 Bacteria 512
607 Ga0207705_10087806 3300025909 Bacteria 2274
608 Ga0207684_10057054 3300025910 Bacteria 3313
609 Ga0207654_10276160 3300025911 Bacteria 1135
610 Ga0207654_10284125 3300025911 Bacteria 1120
611 Ga0207707_10019814 3300025912 Bacteria 5873
612 Ga0207707_10027775 3300025912 Bacteria 4947
613 Ga0207707_11157195 3300025912 Bacteria 628
614 Ga0207707_11525684 3300025912 Bacteria 529
615 Ga0207695_10054576 3300025913 Bacteria 4171
616 Ga0207695_10340223 3300025913 Bacteria 1388
617 Ga0207695_11330962 3300025913 Bacteria 599
618 Ga0207671_10099942 3300025914 Bacteria 2196
619 Ga0207671_10099958 3300025914 Bacteria 2196
620 Ga0207671_10103991 3300025914 Bacteria 2154
621 Ga0207671_10174515 3300025914 Bacteria 1670
622 Ga0207671_10292548 3300025914 Bacteria 1286
623 Ga0207671_10397523 3300025914 Bacteria 1096
624 Ga0207693_10008445 3300025915 Bacteria 8428
625 Ga0207693_10223615 3300025915 Bacteria 1479
626 Ga0207663_10337156 3300025916 Bacteria 1138
627 Ga0207663_10385522 3300025916 Bacteria 1068
628 Ga0207663_10554305 3300025916 Bacteria 899
629 Ga0207663_10953971 3300025916 Bacteria 687
630 Ga0207663_10982780 3300025916 Bacteria 677
631 Ga0207660_10017576 3300025917 Bacteria 4754
632 Ga0207660_10263412 3300025917 Bacteria 1364
633 Ga0207660_10742314 3300025917 Bacteria 801
634 Ga0207657_10099624 3300025919 Bacteria 2413
635 Ga0207657_10381680 3300025919 Bacteria 1109
636 Ga0207649_10143932 3300025920 Bacteria 1634
637 Ga0207649_10280444 3300025920 Bacteria 1211
638 Ga0207649_10295375 3300025920 Bacteria 1183
639 Ga0207649_10781425 3300025920 Bacteria 744
640 Ga0207649_10966266 3300025920 Bacteria 669
641 Ga0207652_10223971 3300025921 Bacteria 1695
642 Ga0207652_10407074 3300025921 Bacteria 1227
643 Ga0207652_10654237 3300025921 Bacteria 940
644 Ga0207652_11076474 3300025921 Bacteria 704
645 Ga0207652_11767678 3300025921 Bacteria 523
646 Ga0207646_10020117 3300025922 Bacteria 6190
647 Ga0207646_10223738 3300025922 Bacteria 1700
648 Ga0207646_10624543 3300025922 Bacteria 966
649 Ga0207681_10065491 3300025923 Bacteria 2512
650 Ga0207681_10108734 3300025923 Bacteria 2013
651 Ga0207681_10462411 3300025923 Bacteria 1034
652 Ga0207681_10918781 3300025923 Bacteria 733
653 Ga0207694_10168517 3300025924 Bacteria 1772
654 Ga0207694_10426931 3300025924 Bacteria 1105
655 Ga0207694_10437989 3300025924 Bacteria 1090
656 Ga0207694_10712461 3300025924 Bacteria 846
657 Ga0207650_10019282 3300025925 Bacteria 4790
658 Ga0207650_10160698 3300025925 Bacteria 1780
659 Ga0207650_10374865 3300025925 Bacteria 1174
660 Ga0207650_10382323 3300025925 Bacteria 1163
661 Ga0207650_10500076 3300025925 Bacteria 1016
662 Ga0207650_10670211 3300025925 Bacteria 875
663 Ga0207659_10051717 3300025926 Bacteria 2923
664 Ga0207687_10984439 3300025927 Bacteria 723
665 Ga0207687_11779417 3300025927 Bacteria 528
666 Ga0207700_10011883 3300025928 Bacteria 5581
667 Ga0207700_10050788 3300025928 Bacteria 3092
668 Ga0207700_10099449 3300025928 Bacteria 2316
669 Ga0207700_10117337 3300025928 Bacteria 2152
670 Ga0207700_10233831 3300025928 Bacteria 1564
671 Ga0207700_10249064 3300025928 Bacteria 1517
672 Ga0207664_10018321 3300025929 Bacteria 5152
673 Ga0207664_10104239 3300025929 Bacteria 2348
674 Ga0207664_10145841 3300025929 Bacteria 2007
675 Ga0207664_10231379 3300025929 Bacteria 1607
676 Ga0207664_10725311 3300025929 Bacteria 894
677 Ga0207644_10414810 3300025931 Bacteria 1102
678 Ga0207644_10881724 3300025931 Bacteria 750
679 Ga0207690_10019600 3300025932 Bacteria 4169
680 Ga0207690_10695748 3300025932 Bacteria 835
681 Ga0207706_10047908 3300025933 Bacteria 3780
682 Ga0207706_10358299 3300025933 Bacteria 1267
683 Ga0207706_11574436 3300025933 Bacteria 533
684 Ga0207686_10230613 3300025934 Bacteria 1342
685 Ga0207686_10308337 3300025934 Bacteria 1178
686 Ga0207709_10071831 3300025935 Bacteria 2199
687 Ga0207709_10506401 3300025935 Bacteria 943
688 Ga0207709_11820810 3300025935 Bacteria 506
689 Ga0207670_10058725 3300025936 Bacteria 2614
690 Ga0207670_10115792 3300025936 Bacteria 1940
691 Ga0207670_10173635 3300025936 Bacteria 1618
692 Ga0207670_10223015 3300025936 Bacteria 1444
693 Ga0207670_10393335 3300025936 Bacteria 1107
694 Ga0207670_11664827 3300025936 Bacteria 543
695 Ga0207669_10153160 3300025937 Bacteria 1618
696 Ga0207669_10253231 3300025937 Bacteria 1312
697 Ga0207669_11961854 3300025937 Bacteria 500
698 Ga0207704_10548350 3300025938 Bacteria 939
699 Ga0207704_10963653 3300025938 Unclassified 720
700 Ga0207704_11566462 3300025938 Bacteria 566
701 Ga0207665_10519596 3300025939 Bacteria 922
702 Ga0207665_11231095 3300025939 Bacteria 597
703 Ga0207691_10022379 3300025940 Bacteria 5961
704 Ga0207691_10048272 3300025940 Bacteria 3904
705 Ga0207691_10943404 3300025940 Bacteria 721
706 Ga0207691_10952283 3300025940 Bacteria 717
707 Ga0207711_10012928 3300025941 Bacteria 6934
708 Ga0207711_10243288 3300025941 Bacteria 1650
709 Ga0207711_12015424 3300025941 Bacteria 520
710 Ga0207689_10000171 3300025942 Bacteria 56716
711 Ga0207689_10676285 3300025942 Bacteria 870
712 Ga0207661_10012723 3300025944 Bacteria 6129
713 Ga0207661_10164372 3300025944 Bacteria 1927
714 Ga0207661_10481810 3300025944 Bacteria 1132
715 Ga0207661_10490613 3300025944 Bacteria 1122
716 Ga0207661_10583060 3300025944 Bacteria 1026
717 Ga0207661_10939988 3300025944 Bacteria 796
718 Ga0207661_11011652 3300025944 Bacteria 765
719 Ga0207661_12063635 3300025944 Bacteria 516
720 Ga0207679_10034445 3300025945 Bacteria 3572
721 Ga0207679_10244466 3300025945 Bacteria 1522
722 Ga0207679_10249924 3300025945 Bacteria 1507
723 Ga0207679_10349056 3300025945 Bacteria 1289
724 Ga0207679_10695184 3300025945 Bacteria 922
725 Ga0207667_10109147 3300025949 Bacteria 2854
726 Ga0207667_10119359 3300025949 Bacteria 2718
727 Ga0207667_10242401 3300025949 Bacteria 1844
728 Ga0207667_10351611 3300025949 Bacteria 1503
729 Ga0207667_10697254 3300025949 Bacteria 1018
730 Ga0207651_10230043 3300025960 Bacteria 1504
731 Ga0207651_10323237 3300025960 Bacteria 1290
732 Ga0207651_11298725 3300025960 Bacteria 654
733 Ga0207651_11465163 3300025960 Bacteria 615
734 Ga0207651_11666480 3300025960 Bacteria 574
735 Ga0207712_10238114 3300025961 Bacteria 1465
736 Ga0207712_11345480 3300025961 Bacteria 639
737 Ga0207668_10175746 3300025972 Unclassified 1684
738 Ga0207668_10662468 3300025972 Bacteria 914
739 Ga0207668_11229596 3300025972 Bacteria 673
740 Ga0207668_11542490 3300025972 Bacteria 600
741 Ga0207668_11905472 3300025972 Bacteria 536
742 Ga0207640_10121501 3300025981 Bacteria 1872
743 Ga0207640_10404867 3300025981 Bacteria 1112
744 Ga0207640_11457509 3300025981 Bacteria 614
745 Ga0207658_10036473 3300025986 Bacteria 3525
746 Ga0207658_10461656 3300025986 Unclassified 1126
747 Ga0207658_10569621 3300025986 Bacteria 1015
748 Ga0207677_10165314 3300026023 Bacteria 1724
749 Ga0207677_10977633 3300026023 Bacteria 767
750 Ga0207677_11645097 3300026023 Bacteria 595
751 Ga0207703_10000464 3300026035 Bacteria 42704
752 Ga0207703_10461782 3300026035 Bacteria 1188
753 Ga0207703_10480171 3300026035 Bacteria 1164
754 Ga0207703_10495105 3300026035 Bacteria 1147
755 Ga0207703_10583978 3300026035 Bacteria 1056
756 Ga0207703_11657165 3300026035 Bacteria 615
757 Ga0207703_11948419 3300026035 Unclassified 564
758 Ga0207703_12285119 3300026035 Bacteria 517
759 Ga0207639_10079336 3300026041 Bacteria 2594
760 Ga0207639_10156367 3300026041 Bacteria 1916
761 Ga0207639_10225846 3300026041 Bacteria 1620
762 Ga0207639_10496085 3300026041 Bacteria 1115
763 Ga0207639_10662177 3300026041 Bacteria 966
764 Ga0207639_11338573 3300026041 Bacteria 672
765 Ga0207678_11015145 3300026067 Bacteria 734
766 Ga0207708_10456892 3300026075 Bacteria 1065
767 Ga0207708_11873678 3300026075 Bacteria 526
768 Ga0207702_10086799 3300026078 Bacteria 2729
769 Ga0207702_10248372 3300026078 Bacteria 1670
770 Ga0207702_10510534 3300026078 Bacteria 1172
771 Ga0207702_10933250 3300026078 Bacteria 860
772 Ga0207702_11711522 3300026078 Bacteria 622
773 Ga0207702_12170194 3300026078 Bacteria 544
774 Ga0207641_10032716 3300026088 Bacteria 4319
775 Ga0207641_10033949 3300026088 Bacteria 4241
776 Ga0207641_11589305 3300026088 Bacteria 656
777 Ga0207641_11887704 3300026088 Bacteria 599
778 Ga0207648_10004075 3300026089 Bacteria 15150
779 Ga0207648_10244203 3300026089 Bacteria 1599
780 Ga0207648_10321347 3300026089 Unclassified 1391
781 Ga0207648_10384967 3300026089 Bacteria 1269
782 Ga0207648_10817150 3300026089 Bacteria 868
783 Ga0207676_10016916 3300026095 Bacteria 5280
784 Ga0207676_10785895 3300026095 Bacteria 928
785 Ga0207676_10840074 3300026095 Bacteria 898
786 Ga0207676_11028923 3300026095 Bacteria 812
787 Ga0207676_11782465 3300026095 Bacteria 614
788 Ga0207674_10003778 3300026116 Bacteria 18471
789 Ga0207674_10009315 3300026116 Bacteria 11243
790 Ga0207674_10019754 3300026116 Bacteria 7291
791 Ga0207674_10122256 3300026116 Bacteria 2569
792 Ga0207674_10540826 3300026116 Bacteria 1125
793 Ga0207674_10965182 3300026116 Bacteria 821
794 Ga0207674_12226465 3300026116 Bacteria 511
795 Ga0207675_100013122 3300026118 Bacteria 7732
796 Ga0207675_100640535 3300026118 Bacteria 1068
797 Ga0207675_100661262 3300026118 Bacteria 1051
798 Ga0207675_100745497 3300026118 Bacteria 990
799 Ga0207675_101118784 3300026118 Bacteria 807
800 Ga0207675_102121635 3300026118 Unclassified 578
801 Ga0207675_102568518 3300026118 Bacteria 519
802 Ga0207683_10064958 3300026121 Bacteria 3217
803 Ga0207683_10177746 3300026121 Bacteria 1929
804 Ga0207683_10557105 3300026121 Bacteria 1060
805 Ga0207683_10762643 3300026121 Bacteria 898
806 Ga0207698_10018429 3300026142 Bacteria 4756
807 Ga0207698_10103163 3300026142 Bacteria 2370
808 Ga0207698_11308132 3300026142 Bacteria 740
809 Ga0207698_11684942 3300026142 Bacteria 649
810 Ga0207698_12005545 3300026142 Unclassified 593
811 Ga0207698_12343020 3300026142 Bacteria 545
812 Ga0207698_12527861 3300026142 Bacteria 524
813 Ga0209588_1033693 3300027671 Bacteria 1643
814 Ga0209588_1075701 3300027671 Bacteria 1087
815 Ga0209813_10238556 3300027866 Bacteria 687
816 Ga0207428_10016765 3300027907 Bacteria 6299
817 Ga0207428_10021763 3300027907 Bacteria 5424
818 Ga0207428_10031923 3300027907 Bacteria 4337
819 Ga0207428_10526169 3300027907 Bacteria 857
820 Ga0207428_10851416 3300027907 Bacteria 646
821 Ga0268266_10005904 3300028379 Bacteria 11330
822 Ga0268266_10066473 3300028379 Bacteria 3119
823 Ga0268266_10092860 3300028379 Bacteria 2648
824 Ga0268266_10538458 3300028379 Bacteria 1118
825 Ga0268266_11217490 3300028379 Bacteria 728
826 Ga0268266_11788426 3300028379 Bacteria 589
827 Ga0268266_12350540 3300028379 Bacteria 504
828 Ga0268265_10011945 3300028380 Bacteria 5875
829 Ga0268265_10220537 3300028380 Bacteria 1659
830 Ga0268265_10303297 3300028380 Bacteria 1439
831 Ga0268265_10465074 3300028380 Bacteria 1184
832 Ga0268265_10488372 3300028380 Bacteria 1158
833 Ga0268265_12412420 3300028380 Bacteria 532
834 Ga0268265_12585260 3300028380 Bacteria 513
835 Ga0268264_10000084 3300028381 Bacteria 242128
836 Ga0268264_10001515 3300028381 Bacteria 21648
837 Ga0268264_10642713 3300028381 Bacteria 1049
838 Ga0268264_11413595 3300028381 Bacteria 706
839 Ga0268264_11735814 3300028381 Bacteria 634
840 Ga0268264_11892679 3300028381 Bacteria 606
841 Ga0307517_10578289 3300028786 Bacteria 557
842 Ga0265338_10114917 3300028800 Bacteria 2159
843 Ga0265338_10613556 3300028800 Unclassified 757
844 Ga0265338_10668674 3300028800 Bacteria 719
845 Ga0265324_10006763 3300029957 Bacteria 4732
846 Ga0307511_10052815 3300030521 Bacteria 3232
847 Ga0265328_10003733 3300031239 Bacteria 6711
848 Ga0265328_10098047 3300031239 Bacteria 1085
849 Ga0265325_10024269 3300031241 Bacteria 3301
850 Ga0265325_10095155 3300031241 Bacteria 1464
851 Ga0265325_10111380 3300031241 Bacteria 1330
852 Ga0265340_10303826 3300031247 Bacteria 707
853 Ga0265339_10044955 3300031249 Bacteria 2433
854 Ga0265339_10226916 3300031249 Bacteria 911
855 Ga0265331_10000247 3300031250 Bacteria 64888
856 Ga0265331_10036305 3300031250 Bacteria 2420
857 Ga0265331_10112612 3300031250 Bacteria 1247
858 Ga0265327_10023457 3300031251 Bacteria 3654
859 Ga0265316_10209861 3300031344 Bacteria 1441
860 Ga0265316_10317948 3300031344 Bacteria 1131
861 Ga0307509_10153689 3300031507 Bacteria 2211
862 Ga0307509_10484231 3300031507 Bacteria 924
863 Ga0307509_10693014 3300031507 Bacteria 685
864 Ga0307408_100144864 3300031548 Bacteria 1869
865 Ga0265313_10231007 3300031595 Bacteria 760
866 Ga0307508_10000105 3300031616 Bacteria 99107
867 Ga0307508_10239342 3300031616 Bacteria 1412
868 Ga0307508_10432899 3300031616 Bacteria 907
869 Ga0265314_10130504 3300031711 Bacteria 1568
870 Ga0265314_10193618 3300031711 Bacteria 1208
871 Ga0265342_10140469 3300031712 Bacteria 1347
872 Ga0316578_10334185 3300031728 Bacteria 903
873 Ga0307516_10670925 3300031730 Bacteria 692
874 Ga0307405_10237908 3300031731 Bacteria 1347
875 Ga0307413_11211737 3300031824 Bacteria 657
876 Ga0307406_10579121 3300031901 Bacteria 922
877 Ga0307416_100346498 3300032002 Bacteria 1501
878 Ga0307411_11982867 3300032005 Bacteria 543
879 Ga0307415_102194505 3300032126 Bacteria 540
880 Ga0307510_10303858 3300033180 Bacteria 1057
881 Ga0316215_1016362 3300033544 Bacteria 746
882 Ga0373950_0063721 3300034818 Bacteria 744
883 Ga0373959_0125493 3300034820 Bacteria 631
884 Ga0373938_0002387 3300034957 Bacteria 3024
885 Ga0373938_0115185 3300034957 Bacteria 688
886 Ga0373926_0026586 3300035083 Bacteria 2025
887 Ga0373928_0067222 3300035084 Bacteria 879
888 Ga0373929_0029597 3300035085 Bacteria 1163
889 Ga0373929_0146869 3300035085 Bacteria 630
890 Ga0373929_0188123 3300035085 Bacteria 573
891 Ga0373934_0015167 3300035086 Bacteria 2921
892 Ga0373934_0135409 3300035086 Bacteria 1006
893 Ga0373940_0336563 3300035088 Bacteria 527
894 Ga0373944_0018895 3300035089 Bacteria 1973
895 Ga0373949_0050956 3300035090 Bacteria 1043
896 Ga0373951_0030626 3300035091 Bacteria 1267
897 Ga0373951_0134474 3300035091 Bacteria 682
898 Ga0373952_0215162 3300035092 Bacteria 568
899 Ga0373923_0029232 3300035111 Bacteria 2208
900 Ga0373923_0103330 3300035111 Bacteria 1259
901 Ga0373923_0234032 3300035111 Bacteria 856
902 Ga0373932_0273949 3300035112 Bacteria 622
903 Ga0373936_0076639 3300035113 Bacteria 1386
904 Ga0373936_0087248 3300035113 Bacteria 1305
905 Ga0373936_0127000 3300035113 Bacteria 1093
906 Ga0373936_0160980 3300035113 Bacteria 978
907 Ga0373936_0200801 3300035113 Bacteria 880
908 Ga0373939_0062831 3300035114 Bacteria 1188
909 Ga0373939_0166417 3300035114 Bacteria 813
910 Ga0373939_0185760 3300035114 Bacteria 778
911 Ga0373941_0069709 3300035115 Bacteria 1164
912 Ga0373941_0079932 3300035115 Bacteria 1102
913 Ga0373941_0138650 3300035115 Bacteria 883
914 Ga0373941_0434345 3300035115 Bacteria 548
915 Ga0373945_0135627 3300035116 Bacteria 989
916 Ga0373945_0185044 3300035116 Bacteria 859
917 Ga0373953_0104021 3300035117 Bacteria 1197
918 Ga0373953_0183285 3300035117 Bacteria 903
919 Ga0373954_0034467 3300035118 Bacteria 2345
920 Ga0373954_0053703 3300035118 Bacteria 1894
921 Ga0373954_0676560 3300035118 Bacteria 512
922 Ga0373956_0107278 3300035119 Bacteria 1298
923 Ga0373956_0121293 3300035119 Bacteria 1221
924 Ga0373957_0301896 3300035120 Bacteria 679
925 Ga0373957_0353780 3300035120 Bacteria 628
926 Ga0373960_0052412 3300035121 Bacteria 1214
927 Ga0373960_0351672 3300035121 Bacteria 559
928 Ga0373943_0056320 3300035170 Bacteria 1951
929 Ga0373943_0121832 3300035170 Bacteria 1386
930 Ga0373943_0310015 3300035170 Bacteria 898
931 Ga0373946_0047551 3300035171 Bacteria 1782
932 Ga0373946_0283397 3300035171 Bacteria 816
933 Ga0373955_0059090 3300035172 Bacteria 2111
934 Ga0373942_0386317 3300035207 Bacteria 500
935 Ga0373961_0011686 3300035241 Bacteria 2182
936 Ga0373961_0013644 3300035241 Bacteria 2052
937 Ga0373961_0069950 3300035241 Bacteria 1084
938 Ga0373962_0022174 3300035242 Bacteria 1681
939 Ga0373962_0028668 3300035242 Bacteria 1512
940 Ga0373924_0306384 3300035410 Bacteria 705
941 Ga0373931_0000317 3300035691 Bacteria 20240
942 Ga0373931_0004056 3300035691 Bacteria 6640
943 Ga0373931_0193823 3300035691 Bacteria 1210
944 Ga0373931_0223543 3300035691 Bacteria 1135
945 Ga0373931_0496027 3300035691 Bacteria 787
946 Ga0373931_0517315 3300035691 Bacteria 772
947 Ga0373935_0101455 3300035692 Bacteria 1898
948 Ga0373935_0136231 3300035692 Bacteria 1654
949 Ga0373935_0166266 3300035692 Bacteria 1506
950 Ga0373935_0544927 3300035692 Bacteria 845
951 Ga0373935_0614359 3300035692 Bacteria 796
952 Ga0373935_0948113 3300035692 Bacteria 638
953 Ga0373935_1096472 3300035692 Bacteria 592
954 Ga0373927_0024147 3300035695 Bacteria 3977
955 Ga0373927_0116454 3300035695 Bacteria 1743
956 Ga0373927_0153953 3300035695 Bacteria 1505
957 Ga0373927_0292335 3300035695 Bacteria 1072
958 Ga0373927_0312442 3300035695 Bacteria 1034
959 Ga0373927_0578213 3300035695 Bacteria 742
960 Ga0373927_0858655 3300035695 Bacteria 599
961 Ga0373933_0017280 3300035724 Bacteria 4045
962 Ga0373933_0087473 3300035724 Bacteria 1919
963 Ga0373933_0884186 3300035724 Bacteria 588
964 Ga0373947_0024091 3300035725 Bacteria 3544
965 Ga0373947_0038743 3300035725 Unclassified 2834
966 Ga0373947_0052625 3300035725 Bacteria 2453
967 Ga0373947_0086745 3300035725 Bacteria 1946
968 Ga0373947_0356324 3300035725 Bacteria 982
969 Ga0373947_0664591 3300035725 Bacteria 711
970 Ga0373937_0108821 3300036401 Bacteria 2577
971 Ga0373937_0118391 3300036401 Bacteria 2467
972 Ga0373937_0162129 3300036401 Bacteria 2096
973 Ga0373937_0227375 3300036401 Bacteria 1756
974 Ga0372808_001897 3300036459 Bacteria 2298
975 Ga0373925_0042688 3300037068 Bacteria 3365
976 Ga0373925_0075212 3300037068 Bacteria 2559
977 Ga0373925_0077433 3300037068 Bacteria 2524
978 Ga0373925_0079553 3300037068 Bacteria 2491
979 Ga0373925_0112578 3300037068 Bacteria 2104
980 Ga0373925_0491133 3300037068 Bacteria 1007
981 Ga0373925_0708989 3300037068 Bacteria 829
982 Ga0373925_0845393 3300037068 Bacteria 754
983 Ga0395899_0002162 3300037312 Bacteria 16144
984 Ga0395899_0021402 3300037312 Bacteria 4904
985 Ga0395899_0302544 3300037312 Bacteria 1082
986 Ga0395900_0004853 3300037418 Bacteria 14164
987 Ga0395900_0005904 3300037418 Bacteria 12783
988 Ga0395900_0064978 3300037418 Bacteria 3748
989 Ga0395900_0240772 3300037418 Bacteria 1815
990 Ga0395900_1047689 3300037418 Bacteria 734
991 Ga0395898_0012089 3300037466 Bacteria 8938
992 Ga0395898_0149599 3300037466 Bacteria 2234
993 Ga0395898_0162409 3300037466 Bacteria 2137
994 Ga0395905_0180874 3300037471 Bacteria 1980
995 Ga0436364_0574078 3300037853 Bacteria 808
996 Ga0436364_1015918 3300037853 Bacteria 632
997 Ga0395901_0040678 3300038443 Bacteria 4815
998 Ga0395901_0139607 3300038443 Bacteria 2547
999 Ga0395901_0148919 3300038443 Bacteria 2460
1000 Ga0395901_0195047 3300038443 Bacteria 2123
1001 Ga0395901_0381956 3300038443 Bacteria 1449
1002 Ga0436365_0368730 3300039437 Bacteria 2426
1003 Ga0436365_0622183 3300039437 Bacteria 2404
1004 Ga0436365_0820984 3300039437 Bacteria 1334
1005 Ga0436365_0869883 3300039437 Bacteria 610
1006 Ga0436365_0920296 3300039437 Bacteria 719
1007 Ga0436365_1044564 3300039437 Bacteria 888
1008 Ga0436365_1545720 3300039437 Bacteria 804
1009 Ga0436365_1547297 3300039437 Bacteria 2194
1010 Ga0436365_1649599 3300039437 Bacteria 1272
1011 Ga0436365_1722483 3300039437 Bacteria 826
1012 Ga0436360_0542064 3300039438 Bacteria 900
1013 Ga0436360_0826367 3300039438 Bacteria 502
1014 Ga0436360_1024581 3300039438 Bacteria 573
1015 Ga0436360_1144799 3300039438 Bacteria 2164
1016 Ga0436361_0035526 3300039447 Bacteria 683
1017 Ga0436361_0175551 3300039447 Bacteria 3548
1018 Ga0436361_0683077 3300039447 Bacteria 969
1019 Ga0436361_0984910 3300039447 Unclassified 636
1020 Ga0436361_1160036 3300039447 Bacteria 961
1021 Ga0436363_0402227 3300039450 Bacteria 660
1022 Ga0436363_0461653 3300039450 Bacteria 4929
1023 Ga0436363_1236422 3300039450 Bacteria 1639
1024 Ga0436363_1265235 3300039450 Bacteria 1084
1025 Ga0436362_0026859 3300039453 Bacteria 692
1026 Ga0436362_0272131 3300039453 Bacteria 877
1027 Ga0436362_0339798 3300039453 Bacteria 615
1028 Ga0436362_0965633 3300039453 Bacteria 626
1029 Ga0439447_053466 3300041407 Bacteria 960
1030 Ga0439466_0108367 3300041411 Bacteria 863
1031 Ga0439465_0072857 3300041413 Bacteria 1153
1032 Ga0451789_1040744 3300041443 Bacteria 1076
1033 Ga0451793_1111873 3300041452 Bacteria 766
1034 Ga0451797_1343343 3300041453 Bacteria 597
1035 Ga0451795_1639049 3300041456 Bacteria 737
1036 Ga0451800_0546300 3300041459 Bacteria 591
1037 Ga0451804_0238532 3300041463 Bacteria 605
1038 Ga0451807_1577102 3300041486 Bacteria 511
1039 Ga0451807_1819751 3300041486 Bacteria 603
1040 Ga0451839_0668696 3300041496 Bacteria 550
1041 Ga0451849_0120354 3300041505 Bacteria 597
1042 Ga0451849_0905281 3300041505 Bacteria 961
1043 Ga0451853_1687619 3300041512 Bacteria 504
1044 Ga0451853_2022784 3300041512 Bacteria 653
1045 Ga0439441_078718 3300042001 Bacteria 715
1046 Ga0439442_110396 3300042002 Bacteria 599
1047 Ga0439442_144014 3300042002 Bacteria 528
1048 Ga0439445_0094973 3300042004 Bacteria 842
1049 Ga0439432_209705 3300042006 Bacteria 564
1050 Ga0439434_0269612 3300042435 Bacteria 585
1051 Ga0439435_0075194 3300042436 Bacteria 1006
1052 Ga0439459_0003070 3300042438 Bacteria 2623
1053 Ga0439459_0062672 3300042438 Bacteria 843
1054 Ga0439464_0163929 3300042439 Bacteria 699
1055 Ga0450893_0099443 3300042532 Bacteria 591
1056 Ga0451577_0000001 3300042876 Bacteria 2461803
1057 Ga0451577_0132183 3300042876 Bacteria 2239
1058 Ga0451577_0193602 3300042876 Bacteria 1834
1059 Ga0451577_0209539 3300042876 Bacteria 1760
1060 Ga0451577_0292611 3300042876 Bacteria 1476
1061 Ga0466972_0506264 3300044658 Bacteria 569
1062 Ga0453683_0006182 3300044673 Bacteria 8240
1063 Ga0453683_0015557 3300044673 Bacteria 4924
1064 Ga0466966_0894995 3300044684 Bacteria 535
1065 Ga0466961_0086598 3300044693 Bacteria 1980
1066 Ga0466963_0021148 3300044694 Bacteria 4100
1067 Ga0466963_0080570 3300044694 Bacteria 2204
1068 Ga0466963_0728197 3300044694 Bacteria 700
1069 Ga0466964_0242465 3300044706 Bacteria 885
1070 Ga0453684_0000015 3300044712 Bacteria 969198
1071 Ga0453684_0000020 3300044712 Bacteria 879938
1072 Ga0453684_0020836 3300044712 Bacteria 9849
1073 Ga0453684_0517058 3300044712 Bacteria 1319
1074 Ga0466968_0312566 3300044735 Bacteria 758
1075 Ga0466968_0409195 3300044735 Bacteria 666
1076 Ga0466968_0640833 3300044735 Bacteria 539
1077 Ga0466957_0019808 3300044842 Bacteria 3960
1078 Ga0451576_0000203 3300045051 Bacteria 149655
1079 Ga0451576_0000863 3300045051 Bacteria 58426
1080 Ga0451576_0003091 3300045051 Bacteria 23347
1081 Ga0451576_0352313 3300045051 Bacteria 1541
1082 Ga0451576_0514088 3300045051 Bacteria 1258
1083 Ga0451576_2281211 3300045051 Bacteria 555
1084 Ga0451576_2683832 3300045051 Bacteria 507
1085 Ga0466967_0002809 3300045976 Bacteria 11043
1086 Ga0466967_0444622 3300045976 Bacteria 1266
1087 Ga0466967_0943300 3300045976 Bacteria 859
1088 Ga0466967_1480479 3300045976 Bacteria 676
1089 Ga0466967_1543262 3300045976 Bacteria 661
1090 Ga0466967_2140231 3300045976 Bacteria 556
1091 Ga0466967_2334817 3300045976 Bacteria 530
1092 Ga0495603_0100902 3300046455 Bacteria 1685
1093 Ga0495590_0130756 3300046457 Bacteria 903
1094 Ga0495629_0104690 3300046459 Bacteria 1974
1095 Ga0495629_0624215 3300046459 Bacteria 719
1096 Ga0495638_0177511 3300046460 Bacteria 1218
1097 Ga0495638_0306213 3300046460 Bacteria 854
1098 Ga0495638_0312985 3300046460 Bacteria 842
1099 Ga0495651_0742602 3300046462 Bacteria 609
1100 Ga0495653_0101144 3300046463 Bacteria 2089
1101 Ga0495653_0165483 3300046463 Bacteria 1531
1102 Ga0495580_0013706 3300046472 Bacteria 6175
1103 Ga0495580_0329207 3300046472 Bacteria 1037
1104 Ga0495580_0884977 3300046472 Bacteria 575
1105 Ga0495580_0941935 3300046472 Bacteria 553
1106 Ga0495580_1013166 3300046472 Bacteria 529
1107 Ga0495582_0046171 3300046473 Bacteria 2399
1108 Ga0495582_0310633 3300046473 Bacteria 907
1109 Ga0495605_0392253 3300046474 Bacteria 578
1110 Ga0495639_0110802 3300046475 Bacteria 1302
1111 Ga0495662_0010302 3300046476 Bacteria 4582
1112 Ga0495662_0382379 3300046476 Bacteria 691
1113 Ga0495664_0014771 3300046477 Bacteria 4432
1114 Ga0495664_0113036 3300046477 Bacteria 1640
1115 Ga0495664_0201077 3300046477 Bacteria 1207
1116 Ga0495664_0383713 3300046477 Bacteria 844
1117 Ga0495584_0381930 3300046491 Bacteria 716
1118 Ga0495594_0255209 3300046499 Bacteria 999
1119 Ga0495606_0105987 3300046507 Bacteria 1703
1120 Ga0495608_0055390 3300046511 Bacteria 2621
1121 Ga0495618_0274332 3300046514 Bacteria 1053
1122 Ga0495628_0509100 3300046516 Bacteria 868
1123 Ga0495630_0040788 3300046517 Bacteria 3468
1124 Ga0495630_0608366 3300046517 Bacteria 838
1125 Ga0495630_0711827 3300046517 Bacteria 768
1126 Ga0495630_0909152 3300046517 Bacteria 670
1127 Ga0495630_0987330 3300046517 Bacteria 640
1128 Ga0495643_0140317 3300046522 Bacteria 1206
1129 Ga0495644_0320088 3300046523 Bacteria 608
1130 Ga0495666_0092268 3300046526 Bacteria 1429
1131 Ga0495652_0105267 3300046529 Bacteria 2280
1132 Ga0495665_0087128 3300046531 Bacteria 1641
1133 Ga0495665_0102077 3300046531 Bacteria 1505
1134 Ga0495640_0041700 3300046533 Bacteria 3206
1135 Ga0495640_0334793 3300046533 Bacteria 936
1136 Ga0495640_0967864 3300046533 Bacteria 502
1137 Ga0495640_0967887 3300046533 Bacteria 502
1138 Ga0495586_0051611 3300046535 Bacteria 2226
1139 Ga0495586_0479206 3300046535 Bacteria 718
1140 Ga0495587_0454348 3300046536 Bacteria 710
1141 Ga0495645_0027722 3300046543 Bacteria 4115
1142 Ga0495645_0069587 3300046543 Bacteria 2540
1143 Ga0495645_0560322 3300046543 Bacteria 707
1144 Ga0495622_0068342 3300046557 Bacteria 1641
1145 Ga0495667_0040028 3300046559 Bacteria 3114
1146 Ga0495667_0255806 3300046559 Bacteria 1114
1147 Ga0495668_0055967 3300046616 Bacteria 2178
1148 Ga0495634_0124638 3300046642 Bacteria 1647
1149 Ga0495634_0249724 3300046642 Bacteria 1086
1150 Ga0495634_0371248 3300046642 Bacteria 854
1151 Ga0495634_0644864 3300046642 Unclassified 612
1152 Ga0495634_0789494 3300046642 Bacteria 542
1153 Ga0495611_0302797 3300046648 Bacteria 737
1154 Ga0495635_0000082 3300046663 Bacteria 58319
1155 Ga0495635_0007858 3300046663 Bacteria 7449
1156 Ga0495635_0418785 3300046663 Bacteria 888
1157 Ga0495657_0029197 3300046675 Bacteria 3870
1158 Ga0495657_0357251 3300046675 Bacteria 864
1159 Ga0495599_0211052 3300046678 Bacteria 1190
1160 Ga0495599_0524964 3300046678 Bacteria 695
1161 Ga0495599_0771340 3300046678 Bacteria 551
1162 Ga0495623_0427013 3300046679 Bacteria 709
1163 Ga0495623_0509093 3300046679 Bacteria 634
1164 Ga0495646_0201999 3300046680 Bacteria 1082
1165 Ga0495647_0126736 3300046681 Bacteria 1078
1166 Ga0495647_0221857 3300046681 Bacteria 835
1167 Ga0495647_0533491 3300046681 Bacteria 548
1168 Ga0495658_0018744 3300046683 Bacteria 3603
1169 Ga0495613_0107356 3300046689 Bacteria 2014
1170 Ga0495613_0167055 3300046689 Bacteria 1563
1171 Ga0495613_0248223 3300046689 Bacteria 1243
1172 Ga0495624_0043952 3300046690 Bacteria 2849
1173 Ga0495624_0170757 3300046690 Bacteria 1327
1174 Ga0495624_0457305 3300046690 Bacteria 765
1175 Ga0495624_0519326 3300046690 Bacteria 712
1176 Ga0495624_0762580 3300046690 Bacteria 573
1177 Ga0495671_0200171 3300046692 Bacteria 969
1178 Ga0495671_0558766 3300046692 Bacteria 545
1179 Ga0495600_0044373 3300046809 Bacteria 2900
1180 Ga0495581_0078431 3300047315 Bacteria 1911
1181 Ga0495581_0171710 3300047315 Bacteria 1268
1182 Ga0495604_0047067 3300047317 Bacteria 3361
1183 Ga0495604_0536057 3300047317 Bacteria 756
1184 Ga0495604_0851316 3300047317 Bacteria 572
1185 Ga0495674_0004477 3300047319 Bacteria 13445
1186 Ga0495674_0313533 3300047319 Bacteria 1279
1187 Ga0495674_0400956 3300047319 Bacteria 1107
1188 Ga0495674_0588326 3300047319 Bacteria 883
1189 Ga0495674_0627840 3300047319 Bacteria 849
1190 Ga0495676_0414621 3300047321 Bacteria 892
1191 Ga0495676_0624935 3300047321 Bacteria 700
1192 Ga0495680_0000053 3300047322 Bacteria 94237
1193 Ga0495680_0176291 3300047322 Bacteria 1546
1194 Ga0495680_0528785 3300047322 Bacteria 797
1195 Ga0495675_0039762 3300047444 Bacteria 2996
1196 Ga0495675_0164407 3300047444 Bacteria 1366
1197 Ga0495675_0762373 3300047444 Bacteria 538
1198 Ga0495684_0004775 3300047471 Bacteria 10588
1199 Ga0495684_0017082 3300047471 Bacteria 5589
1200 Ga0495684_0064085 3300047471 Bacteria 2793
1201 Ga0495684_0389357 3300047471 Bacteria 981
1202 Ga0495684_0469339 3300047471 Bacteria 871
1203 Ga0495593_0222643 3300047673 Bacteria 947
1204 Ga0495593_0251714 3300047673 Bacteria 884
1205 Ga0495602_0127031 3300048088 Bacteria 2041
1206 Ga0495614_0638168 3300048089 Bacteria 513
1207 Ga0496101_0719796 3300048904 Bacteria 788
1208 Ga0496102_0125174 3300048905 Bacteria 2402
1209 Ga0496102_0789570 3300048905 Bacteria 872
1210 Ga0496102_0858763 3300048905 Bacteria 830
1211 Ga0496102_1175772 3300048905 Bacteria 687
1212 Ga0496102_1778335 3300048905 Bacteria 534
1213 Ga0496103_0012360 3300048906 Bacteria 5064
1214 Ga0496104_0232656 3300048907 Bacteria 1755
1215 Ga0496104_0407065 3300048907 Bacteria 1273
1216 Ga0496104_0666642 3300048907 Bacteria 949
1217 Ga0496106_0008099 3300048909 Bacteria 7764
1218 Ga0496108_0347601 3300048911 Bacteria 1294
1219 Ga0496108_0608052 3300048911 Bacteria 952
1220 Ga0496108_0674340 3300048911 Bacteria 898
1221 Ga0496109_0185900 3300048912 Bacteria 1952
1222 Ga0496109_0417709 3300048912 Bacteria 1267
1223 Ga0496109_0500653 3300048912 Bacteria 1147
1224 Ga0496109_0557691 3300048912 Bacteria 1081
1225 Ga0496109_1539534 3300048912 Bacteria 600
1226 Ga0496109_1596625 3300048912 Bacteria 587
1227 Ga0496110_0075010 3300048913 Bacteria 3005
1228 Ga0496110_0263698 3300048913 Bacteria 1568
1229 Ga0496111_0876394 3300048914 Bacteria 647
1230 Ga0496111_1327911 3300048914 Bacteria 506
1231 Ga0496112_0024268 3300048915 Bacteria 5804
1232 Ga0496112_0478293 3300048915 Bacteria 1182
1233 Ga0496112_0847901 3300048915 Bacteria 837
1234 Ga0496112_1167960 3300048915 Bacteria 687
1235 Ga0496113_0023534 3300048916 Bacteria 4368
1236 Ga0496113_0601457 3300048916 Bacteria 881
1237 Ga0496114_0313535 3300048917 Bacteria 1386
1238 Ga0496114_1319172 3300048917 Bacteria 609
1239 Ga0496115_0042673 3300048918 Bacteria 3614
1240 Ga0496115_0258938 3300048918 Bacteria 1431
1241 Ga0496115_0994423 3300048918 Bacteria 641
1242 Ga0496117_0054306 3300048920 Bacteria 2807
1243 Ga0496118_0002057 3300048921 Bacteria 28367
1244 Ga0496121_0000077 3300048924 Bacteria 235293
1245 Ga0496121_0032758 3300048924 Bacteria 4717
1246 Ga0496121_0053767 3300048924 Bacteria 3371
1247 Ga0496124_0006148 3300048927 Bacteria 13170
1248 Ga0496125_0044761 3300048928 Bacteria 3736
1249 Ga0496126_0009366 3300048929 Bacteria 10408
1250 Ga0496126_0018937 3300048929 Bacteria 6800
1251 Ga0496126_0150968 3300048929 Bacteria 1991
1252 Ga0496126_0318929 3300048929 Bacteria 1278
1253 Ga0496126_0376505 3300048929 Bacteria 1156
1254 Ga0501309_006054 3300049129 Bacteria 1463
1255 Ga0501310_010792 3300049130 Bacteria 1025
1256 Ga0501307_044908 3300049162 Bacteria 651
1257 Ga0501032_0390118 3300049569 Bacteria 895
1258 Ga0501033_0187960 3300049570 Bacteria 1479
1259 Ga0501033_0775583 3300049570 Bacteria 649
1260 Ga0501034_0000109 3300049571 Bacteria 151550
1261 Ga0501034_0001751 3300049571 Bacteria 27824
1262 Ga0501034_0053875 3300049571 Bacteria 4050
1263 Ga0501034_0115699 3300049571 Bacteria 2670
1264 Ga0501034_0574374 3300049571 Bacteria 1035
1265 Ga0501036_0383455 3300049572 Bacteria 1173
1266 Ga0501037_0287677 3300049573 Bacteria 1144
1267 Ga0501038_0397428 3300049574 Bacteria 1067
1268 Ga0501038_0719954 3300049574 Bacteria 746
1269 Ga0501039_0614442 3300049575 Bacteria 852
1270 Ga0501041_1107385 3300049577 Unclassified 510
1271 Ga0501043_0125279 3300049579 Bacteria 2014
1272 Ga0501046_0116625 3300049580 Bacteria 2035
1273 Ga0501048_0297614 3300049582 Bacteria 1148
1274 Ga0501048_0543739 3300049582 Bacteria 833
1275 Ga0501067_0280248 3300049583 Bacteria 928
1276 Ga0501067_0382168 3300049583 Bacteria 785
1277 Ga0501067_0685041 3300049583 Bacteria 576
1278 Ga0501068_0252362 3300049584 Bacteria 1124
1279 Ga0501069_0923060 3300049585 Bacteria 532
1280 Ga0501070_0136672 3300049586 Bacteria 2024
1281 Ga0501070_0203456 3300049586 Bacteria 1626
1282 Ga0501070_0685443 3300049586 Bacteria 811
1283 Ga0501070_1237674 3300049586 Bacteria 572
1284 Ga0501071_0577730 3300049587 Bacteria 864
1285 Ga0501072_0307215 3300049588 Bacteria 1261
1286 Ga0501072_0601028 3300049588 Bacteria 867
1287 Ga0501073_0223858 3300049589 Bacteria 1300
1288 Ga0501073_0384093 3300049589 Bacteria 970
1289 Ga0501073_0413478 3300049589 Bacteria 932
1290 Ga0501076_0297973 3300049592 Unclassified 1322
1291 Ga0501076_1041855 3300049592 Bacteria 674
1292 Ga0501079_0411430 3300049741 Bacteria 1061
1293 Ga0501079_0865511 3300049741 Bacteria 712
1294 Ga0501080_0299923 3300049742 Bacteria 1458
1295 Ga0501080_0906495 3300049742 Bacteria 768
1296 Ga0501080_1068868 3300049742 Bacteria 698
1297 Ga0501080_1204437 3300049742 Bacteria 651
1298 Ga0501080_1804565 3300049742 Bacteria 514
1299 Ga0501081_0278248 3300049743 Bacteria 1225
1300 Ga0501035_0889832 3300049822 Bacteria 706
1301 Ga0501044_0235998 3300049823 Bacteria 1774
1302 Ga0501045_0359472 3300049824 Bacteria 1083
1303 Ga0501045_0419115 3300049824 Bacteria 996
1304 nmdc:mga03683_132101_c1 3300050489 Bacteria 1117
1305 nmdc:mga03683_148518_c1 3300050489 Bacteria 1057
1306 nmdc:mga03683_15481_c1 3300050489 Bacteria 2847
1307 nmdc:mga03683_169568_c1 3300050489 Bacteria 991
1308 nmdc:mga03683_1825_c1 3300050489 Bacteria 6461
1309 nmdc:mga03683_22746_c1 3300050489 Bacteria 2433
1310 nmdc:mga03683_32482_c1 3300050489 Bacteria 2100
1311 nmdc:mga03683_32979_c1 3300050489 Bacteria 2086
1312 nmdc:mga03683_397443_c1 3300050489 Bacteria 658
1313 nmdc:mga03683_461697_c1 3300050489 Bacteria 612
1314 nmdc:mga03683_76855_c1 3300050489 Bacteria 986
1315 nmdc:mga03n38_102713_c1 3300050490 Bacteria 1381
1316 nmdc:mga03n38_951783_c1 3300050490 Bacteria 507
1317 nmdc:mga00v17_207477_c1 3300050491 Bacteria 1267
1318 nmdc:mga00v17_39264_c1 3300050491 Bacteria 2834
1319 nmdc:mga0yw44_129575_c1 3300050492 Bacteria 1632
1320 nmdc:mga0yw44_22312_c1 3300050492 Bacteria 3549
1321 nmdc:mga0yw44_38472_c1 3300050492 Bacteria 2831
1322 nmdc:mga0yw44_446005_c1 3300050492 Bacteria 877
1323 nmdc:mga0yw44_467214_c1 3300050492 Bacteria 855
1324 nmdc:mga0yw44_730278_c1 3300050492 Bacteria 673
1325 nmdc:mga0k408_107710_c1 3300050493 Bacteria 1646
1326 nmdc:mga0k408_162678_c1 3300050493 Bacteria 1330
1327 nmdc:mga0k408_343354_c1 3300050493 Bacteria 890
1328 nmdc:mga0k408_5567_c1 3300050493 Bacteria 6701
1329 nmdc:mga0k408_609334_c1 3300050493 Bacteria 644
1330 nmdc:mga06z11_101549_c1 3300050494 Bacteria 991
1331 nmdc:mga06z11_127247_c1 3300050494 Bacteria 1427
1332 nmdc:mga06z11_174175_c1 3300050494 Bacteria 1237
1333 nmdc:mga06z11_261579_c1 3300050494 Bacteria 1021
1334 nmdc:mga06z11_305409_c1 3300050494 Bacteria 947
1335 nmdc:mga06z11_358863_c1 3300050494 Bacteria 873
1336 nmdc:mga06z11_43471_c1 3300050494 Bacteria 2260
1337 nmdc:mga06z11_5646_c1 3300050494 Bacteria 5039
1338 nmdc:mga06z11_571794_c1 3300050494 Bacteria 687
1339 nmdc:mga04h51_136829_c1 3300050495 Bacteria 926
1340 nmdc:mga07m45_367567_c1 3300050496 Bacteria 836
1341 nmdc:mga07m45_402050_c1 3300050496 Bacteria 795
1342 nmdc:mga07m45_424909_c1 3300050496 Bacteria 771
1343 nmdc:mga07m45_56464_c1 3300050496 Bacteria 2219
1344 nmdc:mga07m45_760326_c1 3300050496 Bacteria 556
1345 nmdc:mga07m45_803591_c1 3300050496 Bacteria 539
1346 nmdc:mga05p37_733444_c1 3300050507 Bacteria 1092
1347 nmdc:mga05p37_8689_c1 3300050507 Bacteria 12002
1348 nmdc:mga09592_1156863_c1 3300050508 Bacteria 641
1349 nmdc:mga09592_207576_c1 3300050508 Bacteria 1697
1350 nmdc:mga09592_2383_c1 3300050508 Bacteria 15174
1351 nmdc:mga0qj67_32605_c1 3300050509 Bacteria 4064
1352 nmdc:mga0qj67_59574_c1 3300050509 Bacteria 3028
1353 nmdc:mga0qj67_606036_c1 3300050509 Unclassified 876
1354 nmdc:mga06r32_7094_c1 3300050510 Bacteria 10088
1355 nmdc:mga06r32_96109_c1 3300050510 Bacteria 2901
1356 nmdc:mga08y16_122656_c1 3300050511 Bacteria 2704
1357 nmdc:mga08y16_13156_c1 3300050511 Bacteria 8706
1358 nmdc:mga08y16_20207_c1 3300050511 Bacteria 7030
1359 nmdc:mga08y16_245174_c1 3300050511 Bacteria 1851
1360 nmdc:mga08y16_295626_c1 3300050511 Bacteria 1670
1361 nmdc:mga08y16_996516_c1 3300050511 Bacteria 818
1362 nmdc:mga0n895_1248009_c1 3300050512 Bacteria 716
1363 nmdc:mga0n895_1346942_c1 3300050512 Unclassified 683
1364 nmdc:mga0n895_17745_c1 3300050512 Bacteria 6567
1365 nmdc:mga0n895_237294_c1 3300050512 Bacteria 1850
1366 nmdc:mga0n895_293958_c1 3300050512 Bacteria 1647
1367 nmdc:mga0n895_329968_c1 3300050512 Bacteria 1546
1368 nmdc:mga0n895_40414_c1 3300050512 Bacteria 4530
1369 nmdc:mga0n895_413359_c1 3300050512 Bacteria 1364
1370 nmdc:mga0n895_64973_c1 3300050512 Bacteria 3611
1371 nmdc:mga0rr50_549627_c1 3300050513 Bacteria 983
1372 nmdc:mga0rr50_954746_c1 3300050513 Bacteria 731
1373 nmdc:mga08x19_1063571_c1 3300050514 Bacteria 574
1374 nmdc:mga08x19_1158850_c1 3300050514 Bacteria 548
1375 nmdc:mga08x19_175174_c1 3300050514 Bacteria 1462
1376 nmdc:mga08x19_463128_c1 3300050514 Bacteria 893
1377 nmdc:mga08x19_916772_c1 3300050514 Unclassified 622
1378 nmdc:mga0a205_36569_c1 3300050515 Bacteria 4718
1379 nmdc:mga0a205_678075_c1 3300050515 Bacteria 881
1380 nmdc:mga0a205_72159_c1 3300050515 Bacteria 3335
1381 nmdc:mga0a205_803235_c1 3300050515 Bacteria 788
1382 nmdc:mga0sz30_175604_c1 3300050516 Bacteria 950
1383 nmdc:mga0sz30_239_c1 3300050516 Bacteria 21056
1384 nmdc:mga0sz30_36367_c1 3300050516 Bacteria 2058
1385 nmdc:mga0sz30_424010_c1 3300050516 Bacteria 597
1386 nmdc:mga0sz30_486680_c1 3300050516 Bacteria 555
1387 nmdc:mga0sz30_5231_c1 3300050516 Bacteria 577
1388 Ga0495601_0084629 3300053077 Bacteria 2037
1389 Ga0495601_0098753 3300053077 Bacteria 1884
1390 Ga0495601_0236563 3300053077 Bacteria 1193
1391 Ga0495601_0284716 3300053077 Bacteria 1078
1392 Ga0495601_0347852 3300053077 Bacteria 964
1393 Ga0495601_0470982 3300053077 Bacteria 812
1394 Ga0495612_0028179 3300053078 Bacteria 2261
1395 Ga0495612_0045922 3300053078 Bacteria 1788
1396 Ga0495612_0147855 3300053078 Bacteria 1021
1397 Ga0500610_0230325 3300053079 Bacteria 870
1398 Ga0500610_0367761 3300053079 Bacteria 600
1399 Ga0500635_0003286 3300053080 Bacteria 4058
1400 Ga0495655_0066366 3300053083 Bacteria 998
1401 Ga0495595_0233573 3300053084 Bacteria 919
1402 Ga0495595_0283669 3300053084 Bacteria 832
1403 Ga0495595_0652117 3300053084 Bacteria 539
1404 Ga0495595_0711475 3300053084 Bacteria 515
1405 Ga0495619_0020222 3300053085 Bacteria 4238
1406 Ga0495619_0112948 3300053085 Bacteria 1857
1407 Ga0495619_0229266 3300053085 Bacteria 1287
1408 Ga0500643_019179 3300053087 Bacteria 2257
1409 Ga0500643_157092 3300053087 Bacteria 610
1410 Ga0500644_0007897 3300053088 Bacteria 2788
1411 Ga0500644_0363605 3300053088 Bacteria 627
1412 Ga0500647_0234975 3300053091 Bacteria 813
1413 Ga0500583_0480932 3300053092 Bacteria 586
1414 Ga0500583_0508775 3300053092 Bacteria 565
1415 Ga0500651_0016352 3300053093 Bacteria 4563
1416 Ga0500651_0731053 3300053093 Bacteria 527
1417 Ga0500566_0071146 3300053094 Bacteria 1952
1418 Ga0500566_0191433 3300053094 Bacteria 1041
1419 Ga0500641_0000244 3300053096 Bacteria 20427
1420 Ga0500555_078586 3300053103 Bacteria 861
1421 Ga0500557_123515 3300053105 Bacteria 859
1422 Ga0500558_162861 3300053106 Bacteria 816
1423 Ga0500594_0108816 3300053118 Bacteria 860
1424 Ga0500595_027620 3300053119 Bacteria 1942
1425 Ga0500595_071275 3300053119 Bacteria 1031
1426 Ga0500595_159895 3300053119 Bacteria 628
1427 Ga0500597_244030 3300053120 Bacteria 738
1428 Ga0500614_066050 3300053123 Bacteria 983
1429 Ga0500642_0126365 3300053130 Bacteria 1198
1430 Ga0500642_0143929 3300053130 Bacteria 1119
1431 Ga0500642_0515829 3300053130 Bacteria 502
1432 Ga0500652_216897 3300053131 Bacteria 771
1433 Ga0500559_0104030 3300053136 Bacteria 1310
1434 Ga0500577_0069185 3300053142 Bacteria 1380
1435 Ga0500577_0182992 3300053142 Bacteria 900
1436 Ga0500577_0218436 3300053142 Bacteria 825
1437 Ga0500588_0175088 3300053146 Bacteria 787
1438 Ga0500590_080916 3300053148 Bacteria 1595
1439 Ga0500590_179822 3300053148 Bacteria 920
1440 Ga0500590_258878 3300053148 Bacteria 685
1441 Ga0500603_018179 3300053150 Bacteria 1690
1442 Ga0500616_0000925 3300053153 Bacteria 32079
1443 Ga0500616_0149582 3300053153 Bacteria 1082
1444 Ga0500620_019185 3300053155 Bacteria 2005
1445 Ga0500627_0155211 3300053158 Bacteria 1034
1446 Ga0500638_285809 3300053162 Bacteria 644
1447 Ga0500639_253271 3300053163 Bacteria 703
1448 Ga0500636_0086777 3300053177 Bacteria 1796
1449 Ga0500657_128973 3300053728 Bacteria 985
1450 Ga0500609_025225 3300053731 Bacteria 814
1451 Ga0500552_007586 3300053733 Bacteria 1257
1452 Ga0500552_018616 3300053733 Bacteria 964
1453 Ga0500596_005014 3300053735 Bacteria 2370
1454 Ga0587115_033509 3300059626 Bacteria 774
1455 Ga0587067_231921 3300059640 Bacteria 505
1456 Ga0501082_1064267 3300060353 Bacteria 707
1457 Ga0530510_0221050 3300061734 Unclassified 1408
1458 Ga0530510_0974321 3300061734 Bacteria 649

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_1041855 Ga0501076_1041855_473_604 43
2 3300049743 Ga0501081_0278248 Ga0501081_0278248_42_173 43
3 iso_pu_bacteria 2513237144 2513911411 45
4 iso_pu_bacteria 2838074704 2838080529 45
5 3300049742 Ga0501080_1804565 Ga0501080_1804565_21_161 46
6 iso_pu_bacteria 2513237101 2513692969 46
7 iso_pu_bacteria 2824704595 2824707025 46
8 iso_pu_bacteria 2824753945 2824757193 46
9 iso_pu_bacteria 2824763712 2824766791 46
10 iso_pu_bacteria 2904711408 2904720910 46
11 3300013100 Ga0157373_10304337 Ga0157373_103043372 47
12 3300013102 Ga0157371_10202736 Ga0157371_102027362 47
13 3300013104 Ga0157370_12027016 Ga0157370_120270162 47
14 3300013105 Ga0157369_10273787 Ga0157369_102737872 47
15 3300013105 Ga0157369_11040671 Ga0157369_110406712 47
16 3300014325 Ga0163163_10113227 Ga0163163_101132273 47
17 3300014968 Ga0157379_10666434 Ga0157379_106664342 47
18 3300014969 Ga0157376_11840955 Ga0157376_118409551 47
19 3300036401 Ga0373937_0108821 Ga0373937_0108821_1293_1436 47
20 3300046559 Ga0495667_0255806 Ga0495667_0255806_777_920 47
21 3300046675 Ga0495657_0029197 Ga0495657_0029197_1306_1449 47
22 3300047444 Ga0495675_0039762 Ga0495675_0039762_2385_2528 47
23 3300048088 Ga0495602_0127031 Ga0495602_0127031_1104_1247 47
24 3300048907 Ga0496104_0232656 Ga0496104_0232656_1533_1676 47
25 3300048907 Ga0496104_0666642 Ga0496104_0666642_74_217 47
26 3300048911 Ga0496108_0347601 Ga0496108_0347601_671_814 47
27 3300048913 Ga0496110_0075010 Ga0496110_0075010_1989_2132 47
28 3300048915 Ga0496112_0024268 Ga0496112_0024268_4728_4871 47
29 3300048915 Ga0496112_1167960 Ga0496112_1167960_91_234 47
30 3300048916 Ga0496113_0023534 Ga0496113_0023534_1675_1818 47
31 3300053084 Ga0495595_0233573 Ga0495595_0233573_20_163 47
32 3300046511 Ga0495608_0055390 Ga0495608_0055390_846_992 48
33 3300003203 JGI25406J46586_10000940 JGI25406J46586_1000094012 49
34 3300003203 JGI25406J46586_10021547 JGI25406J46586_100215473 49
35 3300003215 JGI25153J46596_10002123 JGI25153J46596_100021236 49
36 3300003320 rootH2_10190176 rootH2_101901764 49
37 3300003659 JGI25404J52841_10013369 JGI25404J52841_100133693 49
38 3300005290 Ga0065712_10185320 Ga0065712_101853202 49
39 3300005293 Ga0065715_10216814 Ga0065715_102168142 49
40 3300005328 Ga0070676_10251595 Ga0070676_102515952 49
41 3300005330 Ga0070690_100482699 Ga0070690_1004826992 49
42 3300005331 Ga0070670_100027724 Ga0070670_1000277242 49
43 3300005334 Ga0068869_100000708 Ga0068869_10000070816 49
44 3300005335 Ga0070666_10016127 Ga0070666_100161272 49
45 3300005338 Ga0068868_102390218 Ga0068868_1023902182 49
46 3300005340 Ga0070689_100147781 Ga0070689_1001477813 49
47 3300005340 Ga0070689_100293898 Ga0070689_1002938982 49
48 3300005343 Ga0070687_101140673 Ga0070687_1011406732 49
49 3300005347 Ga0070668_100009348 Ga0070668_1000093486 49
50 3300005353 Ga0070669_100021100 Ga0070669_1000211002 49
51 3300005353 Ga0070669_100426557 Ga0070669_1004265572 49
52 3300005353 Ga0070669_100778364 Ga0070669_1007783642 49
53 3300005356 Ga0070674_101038574 Ga0070674_1010385742 49
54 3300005364 Ga0070673_100176614 Ga0070673_1001766142 49
55 3300005366 Ga0070659_102041878 Ga0070659_1020418782 49
56 3300005367 Ga0070667_100005347 Ga0070667_1000053474 49
57 3300005367 Ga0070667_101973085 Ga0070667_1019730852 49
58 3300005434 Ga0070709_10273829 Ga0070709_102738292 49
59 3300005435 Ga0070714_100006563 Ga0070714_1000065636 49
60 3300005436 Ga0070713_100031740 Ga0070713_1000317404 49
61 3300005436 Ga0070713_100227269 Ga0070713_1002272692 49
62 3300005438 Ga0070701_10809268 Ga0070701_108092682 49
63 3300005439 Ga0070711_101118662 Ga0070711_1011186622 49
64 3300005440 Ga0070705_100672043 Ga0070705_1006720431 49
65 3300005445 Ga0070708_101540875 Ga0070708_1015408751 49
66 3300005457 Ga0070662_100334207 Ga0070662_1003342072 49
67 3300005459 Ga0068867_100026445 Ga0068867_1000264453 49
68 3300005535 Ga0070684_100967433 Ga0070684_1009674333 49
69 3300005539 Ga0068853_100533732 Ga0068853_1005337321 49
70 3300005539 Ga0068853_100637485 Ga0068853_1006374853 49
71 3300005543 Ga0070672_101073380 Ga0070672_1010733802 49
72 3300005545 Ga0070695_101293325 Ga0070695_1012933252 49
73 3300005546 Ga0070696_100310212 Ga0070696_1003102122 49
74 3300005547 Ga0070693_100976858 Ga0070693_1009768582 49
75 3300005548 Ga0070665_100020492 Ga0070665_1000204925 49
76 3300005549 Ga0070704_100216017 Ga0070704_1002160173 49
77 3300005563 Ga0068855_100713535 Ga0068855_1007135352 49
78 3300005563 Ga0068855_101303329 Ga0068855_1013033291 49
79 3300005564 Ga0070664_100423770 Ga0070664_1004237703 49
80 3300005577 Ga0068857_100096366 Ga0068857_1000963663 49
81 3300005578 Ga0068854_100740106 Ga0068854_1007401062 49
82 3300005578 Ga0068854_101699283 Ga0068854_1016992832 49
83 3300005614 Ga0068856_100722067 Ga0068856_1007220672 49
84 3300005615 Ga0070702_100019857 Ga0070702_1000198572 49
85 3300005616 Ga0068852_101030749 Ga0068852_1010307492 49
86 3300005617 Ga0068859_100001245 Ga0068859_10000124519 49
87 3300005618 Ga0068864_100008273 Ga0068864_1000082737 49
88 3300005718 Ga0068866_10059936 Ga0068866_100599362 49
89 3300005719 Ga0068861_100006169 Ga0068861_1000061694 49
90 3300005719 Ga0068861_100948810 Ga0068861_1009488102 49
91 3300005840 Ga0068870_10002331 Ga0068870_100023317 49
92 3300005840 Ga0068870_10661408 Ga0068870_106614082 49
93 3300005840 Ga0068870_11242674 Ga0068870_112426742 49
94 3300005841 Ga0068863_100000873 Ga0068863_1000008735 49
95 3300005841 Ga0068863_101478691 Ga0068863_1014786912 49
96 3300005842 Ga0068858_100002812 Ga0068858_1000028122 49
97 3300005843 Ga0068860_100012312 Ga0068860_1000123127 49
98 3300005843 Ga0068860_100792664 Ga0068860_1007926642 49
99 3300005843 Ga0068860_101762671 Ga0068860_1017626712 49
100 3300005844 Ga0068862_100012163 Ga0068862_1000121635 49
101 3300005844 Ga0068862_100559699 Ga0068862_1005596992 49
102 3300005937 Ga0081455_10090302 Ga0081455_100903024 49
103 3300005937 Ga0081455_10128235 Ga0081455_101282352 49
104 3300005983 Ga0081540_1000003 Ga0081540_1000003134 49
105 3300005983 Ga0081540_1003189 Ga0081540_10031892 49
106 3300005983 Ga0081540_1035955 Ga0081540_10359554 49
107 3300005985 Ga0081539_10000191 Ga0081539_10000191123 49
108 3300005985 Ga0081539_10001574 Ga0081539_1000157418 49
109 3300006038 Ga0075365_10675477 Ga0075365_106754772 49
110 3300006058 Ga0075432_10383668 Ga0075432_103836682 49
111 3300006173 Ga0070716_101463376 Ga0070716_1014633762 49
112 3300006175 Ga0070712_100051865 Ga0070712_1000518653 49
113 3300006195 Ga0075366_10425519 Ga0075366_104255191 49
114 3300006237 Ga0097621_101373661 Ga0097621_1013736612 49
115 3300006353 Ga0075370_10435715 Ga0075370_104357152 49
116 3300006844 Ga0075428_100045105 Ga0075428_1000451053 49
117 3300006844 Ga0075428_100080803 Ga0075428_1000808032 49
118 3300006846 Ga0075430_100084875 Ga0075430_1000848752 49
119 3300006846 Ga0075430_100118025 Ga0075430_1001180253 49
120 3300006847 Ga0075431_100014415 Ga0075431_1000144156 49
121 3300006847 Ga0075431_100034312 Ga0075431_1000343123 49
122 3300006852 Ga0075433_10018901 Ga0075433_100189012 49
123 3300006871 Ga0075434_100017326 Ga0075434_1000173263 49
124 3300006871 Ga0075434_100522982 Ga0075434_1005229822 49
125 3300006871 Ga0075434_100525994 Ga0075434_1005259942 49
126 3300006871 Ga0075434_101077628 Ga0075434_1010776282 49
127 3300006880 Ga0075429_100047982 Ga0075429_1000479823 49
128 3300006880 Ga0075429_100222872 Ga0075429_1002228722 49
129 3300006914 Ga0075436_100921172 Ga0075436_1009211722 49
130 3300006931 Ga0097620_100001245 Ga0097620_10000124519 49
131 3300007076 Ga0075435_100531957 Ga0075435_1005319572 49
132 3300007076 Ga0075435_100619304 Ga0075435_1006193042 49
133 3300007788 Ga0099795_10104454 Ga0099795_101044542 49
134 3300007788 Ga0099795_10106440 Ga0099795_101064401 49
135 3300007788 Ga0099795_10473198 Ga0099795_104731982 49
136 3300009094 Ga0111539_10015625 Ga0111539_100156256 49
137 3300009094 Ga0111539_10046064 Ga0111539_100460647 49
138 3300009094 Ga0111539_10645809 Ga0111539_106458092 49
139 3300009098 Ga0105245_10257845 Ga0105245_102578452 49
140 3300009101 Ga0105247_10070694 Ga0105247_100706942 49
141 3300009101 Ga0105247_10464790 Ga0105247_104647902 49
142 3300009101 Ga0105247_11452821 Ga0105247_114528212 49
143 3300009147 Ga0114129_10761458 Ga0114129_107614582 49
144 3300009147 Ga0114129_13123651 Ga0114129_131236512 49
145 3300009148 Ga0105243_10188988 Ga0105243_101889882 49
146 3300009148 Ga0105243_11378026 Ga0105243_113780262 49
147 3300009148 Ga0105243_12463319 Ga0105243_124633192 49
148 3300009174 Ga0105241_10304189 Ga0105241_103041893 49
149 3300009176 Ga0105242_11835702 Ga0105242_118357022 49
150 3300009176 Ga0105242_12797035 Ga0105242_127970352 49
151 3300009177 Ga0105248_10002517 Ga0105248_1000251715 49
152 3300009545 Ga0105237_10876228 Ga0105237_108762281 49
153 3300009545 Ga0105237_11547053 Ga0105237_115470532 49
154 3300009553 Ga0105249_10117602 Ga0105249_101176022 49
155 3300009553 Ga0105249_11365889 Ga0105249_113658892 49
156 3300009553 Ga0105249_12128511 Ga0105249_121285112 49
157 3300010159 Ga0099796_10533419 Ga0099796_105334192 49
158 3300010375 Ga0105239_10207156 Ga0105239_102071562 49
159 3300011119 Ga0105246_10811141 Ga0105246_108111412 49
160 3300012487 Ga0157321_1017925 Ga0157321_10179252 49
161 3300013296 Ga0157374_10782565 Ga0157374_107825651 49
162 3300013296 Ga0157374_10797268 Ga0157374_107972682 49
163 3300013296 Ga0157374_12908873 Ga0157374_129088731 49
164 3300013297 Ga0157378_10016126 Ga0157378_100161264 49
165 3300013297 Ga0157378_10180605 Ga0157378_101806053 49
166 3300013306 Ga0163162_10096960 Ga0163162_100969602 49
167 3300013306 Ga0163162_11410211 Ga0163162_114102112 49
168 3300013306 Ga0163162_13246855 Ga0163162_132468552 49
169 3300013306 Ga0163162_13334989 Ga0163162_133349892 49
170 3300013308 Ga0157375_10222455 Ga0157375_102224553 49
171 3300014325 Ga0163163_10000812 Ga0163163_100008122 49
172 3300014325 Ga0163163_10490016 Ga0163163_104900162 49
173 3300014326 Ga0157380_11695684 Ga0157380_116956842 49
174 3300014326 Ga0157380_11916092 Ga0157380_119160922 49
175 3300014745 Ga0157377_10888734 Ga0157377_108887342 49
176 3300014745 Ga0157377_11295171 Ga0157377_112951712 49
177 3300014968 Ga0157379_10000401 Ga0157379_1000040129 49
178 3300014968 Ga0157379_10398503 Ga0157379_103985032 49
179 3300014968 Ga0157379_11747140 Ga0157379_117471402 49
180 3300014969 Ga0157376_12687351 Ga0157376_126873512 49
181 3300014969 Ga0157376_13008035 Ga0157376_130080352 49
182 3300017792 Ga0163161_10572716 Ga0163161_105727162 49
183 3300025297 Ga0209758_1000183 Ga0209758_100018328 49
184 3300025297 Ga0209758_1064599 Ga0209758_10645993 49
185 3300025302 Ga0207426_1102116 Ga0207426_11021162 49
186 3300025898 Ga0207692_10195267 Ga0207692_101952672 49
187 3300025898 Ga0207692_10731483 Ga0207692_107314832 49
188 3300025900 Ga0207710_10241257 Ga0207710_102412572 49
189 3300025900 Ga0207710_10441552 Ga0207710_104415522 49
190 3300025901 Ga0207688_10264866 Ga0207688_102648662 49
191 3300025901 Ga0207688_10855520 Ga0207688_108555201 49
192 3300025905 Ga0207685_10574958 Ga0207685_105749582 49
193 3300025906 Ga0207699_10284276 Ga0207699_102842762 49
194 3300025906 Ga0207699_11423756 Ga0207699_114237562 49
195 3300025907 Ga0207645_10291619 Ga0207645_102916192 49
196 3300025908 Ga0207643_10022986 Ga0207643_100229862 49
197 3300025908 Ga0207643_11103461 Ga0207643_111034612 49
198 3300025915 Ga0207693_10008445 Ga0207693_100084456 49
199 3300025916 Ga0207663_10953971 Ga0207663_109539711 49
200 3300025923 Ga0207681_10065491 Ga0207681_100654912 49
201 3300025925 Ga0207650_10019282 Ga0207650_100192825 49
202 3300025928 Ga0207700_10233831 Ga0207700_102338312 49
203 3300025928 Ga0207700_10249064 Ga0207700_102490642 49
204 3300025929 Ga0207664_10104239 Ga0207664_101042392 49
205 3300025929 Ga0207664_10231379 Ga0207664_102313793 49
206 3300025932 Ga0207690_10695748 Ga0207690_106957482 49
207 3300025933 Ga0207706_10358299 Ga0207706_103582992 49
208 3300025934 Ga0207686_10308337 Ga0207686_103083372 49
209 3300025935 Ga0207709_10071831 Ga0207709_100718313 49
210 3300025936 Ga0207670_10058725 Ga0207670_100587252 49
211 3300025936 Ga0207670_10115792 Ga0207670_101157923 49
212 3300025937 Ga0207669_11961854 Ga0207669_119618542 49
213 3300025938 Ga0207704_11566462 Ga0207704_115664621 49
214 3300025939 Ga0207665_10519596 Ga0207665_105195962 49
215 3300025940 Ga0207691_10943404 Ga0207691_109434042 49
216 3300025941 Ga0207711_10012928 Ga0207711_100129284 49
217 3300025942 Ga0207689_10000171 Ga0207689_1000017149 49
218 3300025945 Ga0207679_10249924 Ga0207679_102499243 49
219 3300025960 Ga0207651_10323237 Ga0207651_103232372 49
220 3300025960 Ga0207651_11298725 Ga0207651_112987252 49
221 3300025961 Ga0207712_10238114 Ga0207712_102381142 49
222 3300025972 Ga0207668_10662468 Ga0207668_106624682 49
223 3300025972 Ga0207668_11905472 Ga0207668_119054722 49
224 3300025981 Ga0207640_11457509 Ga0207640_114575092 49
225 3300025986 Ga0207658_10036473 Ga0207658_100364733 49
226 3300026035 Ga0207703_10000464 Ga0207703_1000046428 49
227 3300026035 Ga0207703_11948419 Ga0207703_119484191 49
228 3300026041 Ga0207639_10496085 Ga0207639_104960853 49
229 3300026088 Ga0207641_10033949 Ga0207641_100339492 49
230 3300026089 Ga0207648_10004075 Ga0207648_1000407512 49
231 3300026089 Ga0207648_10817150 Ga0207648_108171502 49
232 3300026095 Ga0207676_10016916 Ga0207676_100169162 49
233 3300026095 Ga0207676_11028923 Ga0207676_110289232 49
234 3300026116 Ga0207674_10009315 Ga0207674_100093159 49
235 3300026118 Ga0207675_100013122 Ga0207675_1000131224 49
236 3300026118 Ga0207675_100640535 Ga0207675_1006405352 49
237 3300026118 Ga0207675_102568518 Ga0207675_1025685182 49
238 3300026142 Ga0207698_11308132 Ga0207698_113081322 49
239 3300026142 Ga0207698_12343020 Ga0207698_123430202 49
240 3300027907 Ga0207428_10016765 Ga0207428_100167653 49
241 3300027907 Ga0207428_10021763 Ga0207428_100217636 49
242 3300028379 Ga0268266_10092860 Ga0268266_100928603 49
243 3300028379 Ga0268266_10538458 Ga0268266_105384582 49
244 3300028379 Ga0268266_12350540 Ga0268266_123505402 49
245 3300028380 Ga0268265_10011945 Ga0268265_100119453 49
246 3300028380 Ga0268265_10488372 Ga0268265_104883722 49
247 3300028380 Ga0268265_12585260 Ga0268265_125852602 49
248 3300028381 Ga0268264_10001515 Ga0268264_100015154 49
249 3300028381 Ga0268264_10642713 Ga0268264_106427132 49
250 3300028381 Ga0268264_11413595 Ga0268264_114135952 49
251 3300028800 Ga0265338_10114917 Ga0265338_101149172 49
252 3300028800 Ga0265338_10613556 Ga0265338_106135562 49
253 3300028800 Ga0265338_10668674 Ga0265338_106686742 49
254 3300029957 Ga0265324_10006763 Ga0265324_100067633 49
255 3300031239 Ga0265328_10003733 Ga0265328_100037336 49
256 3300031239 Ga0265328_10098047 Ga0265328_100980472 49
257 3300031241 Ga0265325_10024269 Ga0265325_100242693 49
258 3300031241 Ga0265325_10111380 Ga0265325_101113802 49
259 3300031249 Ga0265339_10044955 Ga0265339_100449553 49
260 3300031249 Ga0265339_10226916 Ga0265339_102269162 49
261 3300031250 Ga0265331_10000247 Ga0265331_1000024745 49
262 3300031250 Ga0265331_10036305 Ga0265331_100363051 49
263 3300031250 Ga0265331_10112612 Ga0265331_101126121 49
264 3300031251 Ga0265327_10023457 Ga0265327_100234572 49
265 3300031344 Ga0265316_10209861 Ga0265316_102098612 49
266 3300031595 Ga0265313_10231007 Ga0265313_102310072 49
267 3300031711 Ga0265314_10130504 Ga0265314_101305042 49
268 3300031712 Ga0265342_10140469 Ga0265342_101404692 49
269 3300035113 Ga0373936_0200801 Ga0373936_0200801_332_481 49
270 3300035114 Ga0373939_0185760 Ga0373939_0185760_285_434 49
271 3300035118 Ga0373954_0676560 Ga0373954_0676560_335_484 49
272 3300035170 Ga0373943_0056320 Ga0373943_0056320_1745_1894 49
273 3300035691 Ga0373931_0193823 Ga0373931_0193823_570_719 49
274 3300035691 Ga0373931_0223543 Ga0373931_0223543_83_232 49
275 3300035691 Ga0373931_0517315 Ga0373931_0517315_155_304 49
276 3300035692 Ga0373935_0544927 Ga0373935_0544927_440_589 49
277 3300035695 Ga0373927_0578213 Ga0373927_0578213_54_203 49
278 3300035695 Ga0373927_0858655 Ga0373927_0858655_133_282 49
279 3300035725 Ga0373947_0086745 Ga0373947_0086745_36_185 49
280 3300035725 Ga0373947_0664591 Ga0373947_0664591_397_546 49
281 3300037068 Ga0373925_0042688 Ga0373925_0042688_559_708 49
282 3300037068 Ga0373925_0845393 Ga0373925_0845393_189_338 49
283 3300037853 Ga0436364_0574078 Ga0436364_0574078_95_244 49
284 3300039437 Ga0436365_0820984 Ga0436365_0820984_953_1102 49
285 3300039437 Ga0436365_0869883 Ga0436365_0869883_417_566 49
286 3300039450 Ga0436363_0402227 Ga0436363_0402227_418_567 49
287 3300041452 Ga0451793_1111873 Ga0451793_1111873_441_590 49
288 3300041512 Ga0451853_2022784 Ga0451853_2022784_219_368 49
289 3300042876 Ga0451577_0132183 Ga0451577_0132183_1812_1961 49
290 3300042876 Ga0451577_0193602 Ga0451577_0193602_1628_1777 49
291 3300042876 Ga0451577_0209539 Ga0451577_0209539_442_591 49
292 3300042876 Ga0451577_0292611 Ga0451577_0292611_930_1079 49
293 3300044658 Ga0466972_0506264 Ga0466972_0506264_205_354 49
294 3300044673 Ga0453683_0006182 Ga0453683_0006182_4429_4578 49
295 3300044673 Ga0453683_0015557 Ga0453683_0015557_1130_1279 49
296 3300044684 Ga0466966_0894995 Ga0466966_0894995_350_499 49
297 3300044712 Ga0453684_0000015 Ga0453684_0000015_860097_860246 49
298 3300044712 Ga0453684_0000020 Ga0453684_0000020_839917_840066 49
299 3300044712 Ga0453684_0020836 Ga0453684_0020836_3556_3705 49
300 3300044712 Ga0453684_0517058 Ga0453684_0517058_955_1104 49
301 3300044735 Ga0466968_0312566 Ga0466968_0312566_578_727 49
302 3300044735 Ga0466968_0640833 Ga0466968_0640833_247_396 49
303 3300045051 Ga0451576_0000203 Ga0451576_0000203_84447_84596 49
304 3300045051 Ga0451576_0000863 Ga0451576_0000863_21811_21960 49
305 3300045051 Ga0451576_0003091 Ga0451576_0003091_21574_21723 49
306 3300045051 Ga0451576_0514088 Ga0451576_0514088_409_558 49
307 3300045051 Ga0451576_2281211 Ga0451576_2281211_135_284 49
308 3300045051 Ga0451576_2683832 Ga0451576_2683832_347_496 49
309 3300045976 Ga0466967_2140231 Ga0466967_2140231_83_232 49
310 3300046459 Ga0495629_0104690 Ga0495629_0104690_1760_1909 49
311 3300046460 Ga0495638_0177511 Ga0495638_0177511_153_302 49
312 3300046460 Ga0495638_0306213 Ga0495638_0306213_198_347 49
313 3300046472 Ga0495580_0884977 Ga0495580_0884977_178_327 49
314 3300046472 Ga0495580_0941935 Ga0495580_0941935_226_375 49
315 3300046473 Ga0495582_0310633 Ga0495582_0310633_203_352 49
316 3300046474 Ga0495605_0392253 Ga0495605_0392253_170_319 49
317 3300046476 Ga0495662_0382379 Ga0495662_0382379_16_165 49
318 3300046477 Ga0495664_0201077 Ga0495664_0201077_208_357 49
319 3300046517 Ga0495630_0711827 Ga0495630_0711827_199_348 49
320 3300046522 Ga0495643_0140317 Ga0495643_0140317_475_624 49
321 3300046523 Ga0495644_0320088 Ga0495644_0320088_382_531 49
322 3300046533 Ga0495640_0967864 Ga0495640_0967864_207_356 49
323 3300046616 Ga0495668_0055967 Ga0495668_0055967_829_978 49
324 3300046642 Ga0495634_0249724 Ga0495634_0249724_299_448 49
325 3300046642 Ga0495634_0371248 Ga0495634_0371248_139_288 49
326 3300046642 Ga0495634_0644864 Ga0495634_0644864_446_595 49
327 3300046648 Ga0495611_0302797 Ga0495611_0302797_373_522 49
328 3300046678 Ga0495599_0524964 Ga0495599_0524964_436_585 49
329 3300046679 Ga0495623_0427013 Ga0495623_0427013_374_523 49
330 3300046681 Ga0495647_0533491 Ga0495647_0533491_106_255 49
331 3300046690 Ga0495624_0170757 Ga0495624_0170757_475_624 49
332 3300046690 Ga0495624_0457305 Ga0495624_0457305_170_319 49
333 3300046690 Ga0495624_0762580 Ga0495624_0762580_212_361 49
334 3300046692 Ga0495671_0558766 Ga0495671_0558766_187_336 49
335 3300047319 Ga0495674_0313533 Ga0495674_0313533_56_205 49
336 3300047471 Ga0495684_0389357 Ga0495684_0389357_269_418 49
337 3300047471 Ga0495684_0469339 Ga0495684_0469339_269_418 49
338 3300047673 Ga0495593_0222643 Ga0495593_0222643_639_788 49
339 3300048905 Ga0496102_0125174 Ga0496102_0125174_471_620 49
340 3300048906 Ga0496103_0012360 Ga0496103_0012360_793_942 49
341 3300048907 Ga0496104_0407065 Ga0496104_0407065_780_929 49
342 3300048911 Ga0496108_0608052 Ga0496108_0608052_431_580 49
343 3300048912 Ga0496109_0417709 Ga0496109_0417709_228_377 49
344 3300048912 Ga0496109_1596625 Ga0496109_1596625_403_552 49
345 3300048913 Ga0496110_0263698 Ga0496110_0263698_1224_1373 49
346 3300048914 Ga0496111_1327911 Ga0496111_1327911_85_234 49
347 3300048918 Ga0496115_0042673 Ga0496115_0042673_1997_2146 49
348 3300048918 Ga0496115_0994423 Ga0496115_0994423_426_575 49
349 3300049574 Ga0501038_0397428 Ga0501038_0397428_224_373 49
350 3300049583 Ga0501067_0280248 Ga0501067_0280248_411_560 49
351 3300049583 Ga0501067_0382168 Ga0501067_0382168_111_260 49
352 3300049583 Ga0501067_0685041 Ga0501067_0685041_373_522 49
353 3300049585 Ga0501069_0923060 Ga0501069_0923060_250_399 49
354 3300049589 Ga0501073_0384093 Ga0501073_0384093_68_217 49
355 3300049589 Ga0501073_0413478 Ga0501073_0413478_419_568 49
356 3300049742 Ga0501080_0906495 Ga0501080_0906495_61_210 49
357 3300050494 nmdc:mga06z11_571794_c1 nmdc:mga06z11_571794_c1_101_250 49
358 3300050496 nmdc:mga07m45_424909_c1 nmdc:mga07m45_424909_c1_309_458 49
359 3300050507 nmdc:mga05p37_8689_c1 nmdc:mga05p37_8689_c1_8653_8802 49
360 3300050508 nmdc:mga09592_207576_c1 nmdc:mga09592_207576_c1_524_673 49
361 3300050508 nmdc:mga09592_2383_c1 nmdc:mga09592_2383_c1_6576_6725 49
362 3300050509 nmdc:mga0qj67_32605_c1 nmdc:mga0qj67_32605_c1_2115_2264 49
363 3300050509 nmdc:mga0qj67_59574_c1 nmdc:mga0qj67_59574_c1_1855_2004 49
364 3300050510 nmdc:mga06r32_7094_c1 nmdc:mga06r32_7094_c1_1979_2128 49
365 3300050510 nmdc:mga06r32_96109_c1 nmdc:mga06r32_96109_c1_2148_2297 49
366 3300050511 nmdc:mga08y16_13156_c1 nmdc:mga08y16_13156_c1_2995_3144 49
367 3300050511 nmdc:mga08y16_20207_c1 nmdc:mga08y16_20207_c1_3620_3769 49
368 3300050512 nmdc:mga0n895_1248009_c1 nmdc:mga0n895_1248009_c1_184_333 49
369 3300050512 nmdc:mga0n895_237294_c1 nmdc:mga0n895_237294_c1_1458_1607 49
370 3300050512 nmdc:mga0n895_293958_c1 nmdc:mga0n895_293958_c1_303_452 49
371 3300050512 nmdc:mga0n895_40414_c1 nmdc:mga0n895_40414_c1_2451_2600 49
372 3300050512 nmdc:mga0n895_413359_c1 nmdc:mga0n895_413359_c1_1028_1177 49
373 3300050513 nmdc:mga0rr50_549627_c1 nmdc:mga0rr50_549627_c1_405_554 49
374 3300050513 nmdc:mga0rr50_954746_c1 nmdc:mga0rr50_954746_c1_378_527 49
375 3300050514 nmdc:mga08x19_1063571_c1 nmdc:mga08x19_1063571_c1_55_204 49
376 3300050514 nmdc:mga08x19_1158850_c1 nmdc:mga08x19_1158850_c1_16_165 49
377 3300050514 nmdc:mga08x19_916772_c1 nmdc:mga08x19_916772_c1_444_593 49
378 3300050515 nmdc:mga0a205_36569_c1 nmdc:mga0a205_36569_c1_2587_2736 49
379 3300050516 nmdc:mga0sz30_175604_c1 nmdc:mga0sz30_175604_c1_672_821 49
380 3300053077 Ga0495601_0098753 Ga0495601_0098753_676_825 49
381 3300053078 Ga0495612_0028179 Ga0495612_0028179_16_165 49
382 3300053079 Ga0500610_0367761 Ga0500610_0367761_361_510 49
383 3300053084 Ga0495595_0283669 Ga0495595_0283669_276_425 49
384 3300053084 Ga0495595_0711475 Ga0495595_0711475_314_463 49
385 3300053085 Ga0495619_0020222 Ga0495619_0020222_584_733 49
386 3300053088 Ga0500644_0363605 Ga0500644_0363605_114_263 49
387 3300053118 Ga0500594_0108816 Ga0500594_0108816_695_844 49
388 3300053130 Ga0500642_0515829 Ga0500642_0515829_89_238 49
389 3300053142 Ga0500577_0069185 Ga0500577_0069185_1048_1197 49
390 3300053142 Ga0500577_0182992 Ga0500577_0182992_299_448 49
391 3300053153 Ga0500616_0149582 Ga0500616_0149582_440_589 49
392 3300003203 JGI25406J46586_10030719 JGI25406J46586_100307192 50
393 3300003911 JGI25405J52794_10090595 JGI25405J52794_100905952 50
394 3300004803 Ga0058862_12858404 Ga0058862_128584042 50
395 3300005293 Ga0065715_10874724 Ga0065715_108747242 50
396 3300005327 Ga0070658_10131935 Ga0070658_101319352 50
397 3300005328 Ga0070676_11003826 Ga0070676_110038262 50
398 3300005329 Ga0070683_100004443 Ga0070683_1000044432 50
399 3300005329 Ga0070683_100033923 Ga0070683_1000339234 50
400 3300005329 Ga0070683_100912673 Ga0070683_1009126732 50
401 3300005330 Ga0070690_100434208 Ga0070690_1004342082 50
402 3300005330 Ga0070690_100706536 Ga0070690_1007065362 50
403 3300005331 Ga0070670_100162620 Ga0070670_1001626202 50
404 3300005331 Ga0070670_100430999 Ga0070670_1004309991 50
405 3300005331 Ga0070670_100610163 Ga0070670_1006101632 50
406 3300005333 Ga0070677_10871200 Ga0070677_108712002 50
407 3300005336 Ga0070680_100274888 Ga0070680_1002748883 50
408 3300005336 Ga0070680_101621571 Ga0070680_1016215712 50
409 3300005337 Ga0070682_100039976 Ga0070682_1000399762 50
410 3300005337 Ga0070682_100162503 Ga0070682_1001625032 50
411 3300005337 Ga0070682_101020341 Ga0070682_1010203412 50
412 3300005338 Ga0068868_100251129 Ga0068868_1002511292 50
413 3300005338 Ga0068868_101340941 Ga0068868_1013409412 50
414 3300005339 Ga0070660_100187370 Ga0070660_1001873703 50
415 3300005339 Ga0070660_101891519 Ga0070660_1018915192 50
416 3300005340 Ga0070689_100242355 Ga0070689_1002423552 50
417 3300005341 Ga0070691_10124334 Ga0070691_101243342 50
418 3300005341 Ga0070691_10365617 Ga0070691_103656172 50
419 3300005344 Ga0070661_100043611 Ga0070661_1000436113 50
420 3300005344 Ga0070661_100669555 Ga0070661_1006695551 50
421 3300005344 Ga0070661_101067422 Ga0070661_1010674222 50
422 3300005345 Ga0070692_10388411 Ga0070692_103884112 50
423 3300005345 Ga0070692_11316610 Ga0070692_113166102 50
424 3300005347 Ga0070668_100429687 Ga0070668_1004296872 50
425 3300005347 Ga0070668_101055912 Ga0070668_1010559121 50
426 3300005347 Ga0070668_101784614 Ga0070668_1017846141 50
427 3300005347 Ga0070668_101953501 Ga0070668_1019535011 50
428 3300005353 Ga0070669_100034441 Ga0070669_1000344415 50
429 3300005353 Ga0070669_100050479 Ga0070669_1000504794 50
430 3300005353 Ga0070669_101457439 Ga0070669_1014574392 50
431 3300005354 Ga0070675_100066680 Ga0070675_1000666802 50
432 3300005354 Ga0070675_100306306 Ga0070675_1003063062 50
433 3300005355 Ga0070671_101430619 Ga0070671_1014306192 50
434 3300005355 Ga0070671_101661487 Ga0070671_1016614872 50
435 3300005364 Ga0070673_100050408 Ga0070673_1000504082 50
436 3300005364 Ga0070673_100452159 Ga0070673_1004521593 50
437 3300005364 Ga0070673_101620520 Ga0070673_1016205202 50
438 3300005365 Ga0070688_100384736 Ga0070688_1003847362 50
439 3300005365 Ga0070688_100398958 Ga0070688_1003989583 50
440 3300005365 Ga0070688_100873219 Ga0070688_1008732191 50
441 3300005367 Ga0070667_100630757 Ga0070667_1006307572 50
442 3300005367 Ga0070667_100772708 Ga0070667_1007727082 50
443 3300005367 Ga0070667_102266512 Ga0070667_1022665122 50
444 3300005434 Ga0070709_10112676 Ga0070709_101126762 50
445 3300005434 Ga0070709_10243301 Ga0070709_102433013 50
446 3300005434 Ga0070709_10293176 Ga0070709_102931762 50
447 3300005435 Ga0070714_100073056 Ga0070714_1000730562 50
448 3300005435 Ga0070714_100102355 Ga0070714_1001023553 50
449 3300005435 Ga0070714_100660723 Ga0070714_1006607232 50
450 3300005435 Ga0070714_100865746 Ga0070714_1008657462 50
451 3300005436 Ga0070713_100027835 Ga0070713_1000278355 50
452 3300005436 Ga0070713_100047532 Ga0070713_1000475324 50
453 3300005436 Ga0070713_100060357 Ga0070713_1000603574 50
454 3300005436 Ga0070713_100216314 Ga0070713_1002163142 50
455 3300005437 Ga0070710_10077434 Ga0070710_100774342 50
456 3300005437 Ga0070710_10196582 Ga0070710_101965823 50
457 3300005437 Ga0070710_11222692 Ga0070710_112226922 50
458 3300005438 Ga0070701_11207723 Ga0070701_112077232 50
459 3300005439 Ga0070711_101028427 Ga0070711_1010284271 50
460 3300005439 Ga0070711_101947352 Ga0070711_1019473521 50
461 3300005440 Ga0070705_101437375 Ga0070705_1014373752 50
462 3300005441 Ga0070700_100888587 Ga0070700_1008885872 50
463 3300005441 Ga0070700_100958214 Ga0070700_1009582142 50
464 3300005445 Ga0070708_100252458 Ga0070708_1002524581 50
465 3300005445 Ga0070708_100270417 Ga0070708_1002704172 50
466 3300005455 Ga0070663_101250849 Ga0070663_1012508492 50
467 3300005456 Ga0070678_100038096 Ga0070678_1000380962 50
468 3300005456 Ga0070678_100343831 Ga0070678_1003438313 50
469 3300005456 Ga0070678_100496516 Ga0070678_1004965162 50
470 3300005456 Ga0070678_100566086 Ga0070678_1005660862 50
471 3300005456 Ga0070678_101876861 Ga0070678_1018768611 50
472 3300005458 Ga0070681_10048012 Ga0070681_100480123 50
473 3300005458 Ga0070681_10052271 Ga0070681_100522713 50
474 3300005458 Ga0070681_11164486 Ga0070681_111644862 50
475 3300005458 Ga0070681_11432511 Ga0070681_114325112 50
476 3300005458 Ga0070681_11505719 Ga0070681_115057192 50
477 3300005459 Ga0068867_100192548 Ga0068867_1001925482 50
478 3300005459 Ga0068867_100617106 Ga0068867_1006171062 50
479 3300005459 Ga0068867_101875773 Ga0068867_1018757732 50
480 3300005466 Ga0070685_10342578 Ga0070685_103425782 50
481 3300005466 Ga0070685_10413731 Ga0070685_104137311 50
482 3300005466 Ga0070685_10654335 Ga0070685_106543352 50
483 3300005466 Ga0070685_11123310 Ga0070685_111233102 50
484 3300005467 Ga0070706_100065125 Ga0070706_1000651253 50
485 3300005468 Ga0070707_100065107 Ga0070707_1000651072 50
486 3300005468 Ga0070707_101370156 Ga0070707_1013701561 50
487 3300005471 Ga0070698_100058117 Ga0070698_1000581178 50
488 3300005471 Ga0070698_100090301 Ga0070698_1000903013 50
489 3300005471 Ga0070698_101609126 Ga0070698_1016091261 50
490 3300005518 Ga0070699_100059857 Ga0070699_1000598572 50
491 3300005530 Ga0070679_100059679 Ga0070679_1000596794 50
492 3300005530 Ga0070679_100382826 Ga0070679_1003828262 50
493 3300005530 Ga0070679_100392092 Ga0070679_1003920923 50
494 3300005530 Ga0070679_100444240 Ga0070679_1004442402 50
495 3300005530 Ga0070679_101038979 Ga0070679_1010389791 50
496 3300005535 Ga0070684_100007463 Ga0070684_1000074634 50
497 3300005535 Ga0070684_100106264 Ga0070684_1001062643 50
498 3300005535 Ga0070684_101395147 Ga0070684_1013951472 50
499 3300005536 Ga0070697_100020437 Ga0070697_1000204372 50
500 3300005536 Ga0070697_100508271 Ga0070697_1005082712 50
501 3300005539 Ga0068853_100174646 Ga0068853_1001746463 50
502 3300005539 Ga0068853_100239099 Ga0068853_1002390992 50
503 3300005539 Ga0068853_100478387 Ga0068853_1004783872 50
504 3300005539 Ga0068853_101071634 Ga0068853_1010716342 50
505 3300005539 Ga0068853_101948537 Ga0068853_1019485372 50
506 3300005539 Ga0068853_101982387 Ga0068853_1019823872 50
507 3300005543 Ga0070672_100010053 Ga0070672_1000100536 50
508 3300005544 Ga0070686_101810100 Ga0070686_1018101001 50
509 3300005544 Ga0070686_101841928 Ga0070686_1018419282 50
510 3300005546 Ga0070696_101611494 Ga0070696_1016114942 50
511 3300005547 Ga0070693_100181407 Ga0070693_1001814072 50
512 3300005547 Ga0070693_100465017 Ga0070693_1004650172 50
513 3300005547 Ga0070693_100969406 Ga0070693_1009694062 50
514 3300005548 Ga0070665_100271847 Ga0070665_1002718472 50
515 3300005548 Ga0070665_100385356 Ga0070665_1003853562 50
516 3300005548 Ga0070665_100783324 Ga0070665_1007833242 50
517 3300005548 Ga0070665_101504249 Ga0070665_1015042492 50
518 3300005563 Ga0068855_100025340 Ga0068855_1000253405 50
519 3300005563 Ga0068855_100168944 Ga0068855_1001689443 50
520 3300005563 Ga0068855_100187077 Ga0068855_1001870772 50
521 3300005563 Ga0068855_101178465 Ga0068855_1011784652 50
522 3300005563 Ga0068855_101603565 Ga0068855_1016035652 50
523 3300005564 Ga0070664_100316783 Ga0070664_1003167832 50
524 3300005564 Ga0070664_101261183 Ga0070664_1012611832 50
525 3300005577 Ga0068857_100541876 Ga0068857_1005418762 50
526 3300005577 Ga0068857_101286352 Ga0068857_1012863522 50
527 3300005578 Ga0068854_100219364 Ga0068854_1002193642 50
528 3300005614 Ga0068856_100113034 Ga0068856_1001130342 50
529 3300005614 Ga0068856_100212884 Ga0068856_1002128842 50
530 3300005614 Ga0068856_101044042 Ga0068856_1010440422 50
531 3300005615 Ga0070702_101062416 Ga0070702_1010624162 50
532 3300005616 Ga0068852_100814121 Ga0068852_1008141212 50
533 3300005616 Ga0068852_101324341 Ga0068852_1013243412 50
534 3300005617 Ga0068859_100184715 Ga0068859_1001847152 50
535 3300005617 Ga0068859_102411696 Ga0068859_1024116962 50
536 3300005618 Ga0068864_102020404 Ga0068864_1020204042 50
537 3300005618 Ga0068864_102266430 Ga0068864_1022664301 50
538 3300005718 Ga0068866_10833761 Ga0068866_108337612 50
539 3300005719 Ga0068861_101210984 Ga0068861_1012109842 50
540 3300005840 Ga0068870_10488874 Ga0068870_104888742 50
541 3300005840 Ga0068870_11124370 Ga0068870_111243702 50
542 3300005841 Ga0068863_100086250 Ga0068863_1000862503 50
543 3300005841 Ga0068863_101154561 Ga0068863_1011545612 50
544 3300005842 Ga0068858_100143105 Ga0068858_1001431052 50
545 3300005842 Ga0068858_100870038 Ga0068858_1008700382 50
546 3300005842 Ga0068858_100949509 Ga0068858_1009495092 50
547 3300005842 Ga0068858_101988129 Ga0068858_1019881292 50
548 3300005843 Ga0068860_100000149 Ga0068860_10000014965 50
549 3300005843 Ga0068860_100521163 Ga0068860_1005211632 50
550 3300005843 Ga0068860_101617533 Ga0068860_1016175332 50
551 3300005844 Ga0068862_100131633 Ga0068862_1001316332 50
552 3300005844 Ga0068862_100222846 Ga0068862_1002228463 50
553 3300005844 Ga0068862_100371395 Ga0068862_1003713952 50
554 3300005844 Ga0068862_100406614 Ga0068862_1004066142 50
555 3300005844 Ga0068862_101773246 Ga0068862_1017732462 50
556 3300005844 Ga0068862_102369173 Ga0068862_1023691732 50
557 3300005937 Ga0081455_10001001 Ga0081455_1000100121 50
558 3300005937 Ga0081455_10007427 Ga0081455_100074272 50
559 3300005937 Ga0081455_10091268 Ga0081455_100912684 50
560 3300005937 Ga0081455_10910420 Ga0081455_109104202 50
561 3300005981 Ga0081538_10138715 Ga0081538_101387152 50
562 3300005983 Ga0081540_1186596 Ga0081540_11865962 50
563 3300005985 Ga0081539_10001452 Ga0081539_100014522 50
564 3300005985 Ga0081539_10007767 Ga0081539_1000776710 50
565 3300006028 Ga0070717_10002484 Ga0070717_1000248414 50
566 3300006028 Ga0070717_10003662 Ga0070717_1000366211 50
567 3300006028 Ga0070717_10060928 Ga0070717_100609284 50
568 3300006028 Ga0070717_11202793 Ga0070717_112027932 50
569 3300006038 Ga0075365_10005466 Ga0075365_100054668 50
570 3300006038 Ga0075365_10169119 Ga0075365_101691192 50
571 3300006038 Ga0075365_10207547 Ga0075365_102075472 50
572 3300006038 Ga0075365_10558838 Ga0075365_105588382 50
573 3300006038 Ga0075365_10597471 Ga0075365_105974712 50
574 3300006038 Ga0075365_10630465 Ga0075365_106304652 50
575 3300006042 Ga0075368_10110543 Ga0075368_101105433 50
576 3300006042 Ga0075368_10374334 Ga0075368_103743342 50
577 3300006048 Ga0075363_100067216 Ga0075363_1000672162 50
578 3300006048 Ga0075363_100141991 Ga0075363_1001419913 50
579 3300006051 Ga0075364_10035360 Ga0075364_100353602 50
580 3300006051 Ga0075364_10174371 Ga0075364_101743713 50
581 3300006051 Ga0075364_10503654 Ga0075364_105036542 50
582 3300006058 Ga0075432_10085982 Ga0075432_100859822 50
583 3300006163 Ga0070715_10410531 Ga0070715_104105311 50
584 3300006163 Ga0070715_10647226 Ga0070715_106472261 50
585 3300006163 Ga0070715_11047873 Ga0070715_110478732 50
586 3300006173 Ga0070716_100092196 Ga0070716_1000921963 50
587 3300006173 Ga0070716_100174999 Ga0070716_1001749993 50
588 3300006173 Ga0070716_101256805 Ga0070716_1012568052 50
589 3300006175 Ga0070712_100729473 Ga0070712_1007294732 50
590 3300006177 Ga0075362_10002622 Ga0075362_100026223 50
591 3300006177 Ga0075362_10003948 Ga0075362_100039482 50
592 3300006177 Ga0075362_10004980 Ga0075362_100049807 50
593 3300006177 Ga0075362_10067150 Ga0075362_100671502 50
594 3300006177 Ga0075362_10104884 Ga0075362_101048843 50
595 3300006177 Ga0075362_10527718 Ga0075362_105277182 50
596 3300006178 Ga0075367_10006371 Ga0075367_100063712 50
597 3300006178 Ga0075367_10081795 Ga0075367_100817953 50
598 3300006178 Ga0075367_10372777 Ga0075367_103727772 50
599 3300006178 Ga0075367_10484337 Ga0075367_104843371 50
600 3300006186 Ga0075369_10001306 Ga0075369_100013063 50
601 3300006186 Ga0075369_10075756 Ga0075369_100757564 50
602 3300006186 Ga0075369_10149250 Ga0075369_101492503 50
603 3300006195 Ga0075366_10000880 Ga0075366_1000088011 50
604 3300006195 Ga0075366_10157169 Ga0075366_101571692 50
605 3300006195 Ga0075366_10187591 Ga0075366_101875913 50
606 3300006195 Ga0075366_10190723 Ga0075366_101907233 50
607 3300006237 Ga0097621_100278535 Ga0097621_1002785352 50
608 3300006237 Ga0097621_100663585 Ga0097621_1006635852 50
609 3300006237 Ga0097621_100862381 Ga0097621_1008623812 50
610 3300006353 Ga0075370_10045498 Ga0075370_100454982 50
611 3300006353 Ga0075370_10078629 Ga0075370_100786292 50
612 3300006353 Ga0075370_10224866 Ga0075370_102248662 50
613 3300006353 Ga0075370_10346164 Ga0075370_103461642 50
614 3300006358 Ga0068871_100385436 Ga0068871_1003854362 50
615 3300006358 Ga0068871_100705272 Ga0068871_1007052722 50
616 3300006844 Ga0075428_100561180 Ga0075428_1005611802 50
617 3300006844 Ga0075428_101171392 Ga0075428_1011713922 50
618 3300006844 Ga0075428_102272686 Ga0075428_1022726862 50
619 3300006846 Ga0075430_100812322 Ga0075430_1008123222 50
620 3300006847 Ga0075431_102136570 Ga0075431_1021365702 50
621 3300006852 Ga0075433_10003359 Ga0075433_100033598 50
622 3300006871 Ga0075434_100020139 Ga0075434_1000201392 50
623 3300006871 Ga0075434_100067222 Ga0075434_1000672223 50
624 3300006871 Ga0075434_100193791 Ga0075434_1001937913 50
625 3300006871 Ga0075434_100866084 Ga0075434_1008660842 50
626 3300006880 Ga0075429_100437713 Ga0075429_1004377133 50
627 3300006880 Ga0075429_100609623 Ga0075429_1006096233 50
628 3300006881 Ga0068865_100266213 Ga0068865_1002662132 50
629 3300006914 Ga0075436_100270712 Ga0075436_1002707122 50
630 3300006931 Ga0097620_100184722 Ga0097620_1001847222 50
631 3300006931 Ga0097620_102411355 Ga0097620_1024113552 50
632 3300007076 Ga0075435_100235203 Ga0075435_1002352033 50
633 3300007265 Ga0099794_10017466 Ga0099794_100174662 50
634 3300009092 Ga0105250_10108891 Ga0105250_101088912 50
635 3300009093 Ga0105240_10075127 Ga0105240_100751272 50
636 3300009093 Ga0105240_10357095 Ga0105240_103570953 50
637 3300009093 Ga0105240_10822753 Ga0105240_108227532 50
638 3300009093 Ga0105240_11779767 Ga0105240_117797672 50
639 3300009093 Ga0105240_11879762 Ga0105240_118797622 50
640 3300009094 Ga0111539_10068483 Ga0111539_100684835 50
641 3300009094 Ga0111539_10089231 Ga0111539_100892313 50
642 3300009094 Ga0111539_12192369 Ga0111539_121923692 50
643 3300009098 Ga0105245_10575581 Ga0105245_105755813 50
644 3300009098 Ga0105245_10593084 Ga0105245_105930843 50
645 3300009098 Ga0105245_11669470 Ga0105245_116694702 50
646 3300009098 Ga0105245_11764188 Ga0105245_117641882 50
647 3300009098 Ga0105245_11818477 Ga0105245_118184772 50
648 3300009098 Ga0105245_12994096 Ga0105245_129940961 50
649 3300009101 Ga0105247_10041211 Ga0105247_100412113 50
650 3300009101 Ga0105247_10324994 Ga0105247_103249942 50
651 3300009101 Ga0105247_10515367 Ga0105247_105153672 50
652 3300009101 Ga0105247_10562553 Ga0105247_105625532 50
653 3300009101 Ga0105247_11345847 Ga0105247_113458472 50
654 3300009147 Ga0114129_11558884 Ga0114129_115588842 50
655 3300009148 Ga0105243_11152555 Ga0105243_111525552 50
656 3300009148 Ga0105243_11241130 Ga0105243_112411302 50
657 3300009174 Ga0105241_10128324 Ga0105241_101283242 50
658 3300009174 Ga0105241_11754185 Ga0105241_117541851 50
659 3300009174 Ga0105241_11767469 Ga0105241_117674691 50
660 3300009174 Ga0105241_11931794 Ga0105241_119317942 50
661 3300009174 Ga0105241_11989951 Ga0105241_119899512 50
662 3300009177 Ga0105248_11398025 Ga0105248_113980253 50
663 3300009177 Ga0105248_11404553 Ga0105248_114045532 50
664 3300009177 Ga0105248_12667761 Ga0105248_126677611 50
665 3300009177 Ga0105248_13334491 Ga0105248_133344912 50
666 3300009545 Ga0105237_10053338 Ga0105237_100533382 50
667 3300009545 Ga0105237_10055453 Ga0105237_100554535 50
668 3300009545 Ga0105237_10149240 Ga0105237_101492403 50
669 3300009545 Ga0105237_10229785 Ga0105237_102297852 50
670 3300009545 Ga0105237_10363524 Ga0105237_103635242 50
671 3300009545 Ga0105237_11926353 Ga0105237_119263532 50
672 3300009551 Ga0105238_10257663 Ga0105238_102576632 50
673 3300009551 Ga0105238_10345144 Ga0105238_103451442 50
674 3300009551 Ga0105238_10793711 Ga0105238_107937112 50
675 3300009551 Ga0105238_11280213 Ga0105238_112802131 50
676 3300009553 Ga0105249_11197395 Ga0105249_111973952 50
677 3300009553 Ga0105249_11326698 Ga0105249_113266982 50
678 3300009988 Ga0105035_116424 Ga0105035_1164242 50
679 3300010159 Ga0099796_10095363 Ga0099796_100953632 50
680 3300010159 Ga0099796_10119314 Ga0099796_101193142 50
681 3300010375 Ga0105239_10085772 Ga0105239_100857722 50
682 3300010375 Ga0105239_10644134 Ga0105239_106441343 50
683 3300010375 Ga0105239_12092602 Ga0105239_120926022 50
684 3300010375 Ga0105239_12483287 Ga0105239_124832872 50
685 3300010375 Ga0105239_12680615 Ga0105239_126806151 50
686 3300011119 Ga0105246_10225045 Ga0105246_102250453 50
687 3300011119 Ga0105246_10772466 Ga0105246_107724662 50
688 3300013100 Ga0157373_10445422 Ga0157373_104454222 50
689 3300013102 Ga0157371_10037740 Ga0157371_100377402 50
690 3300013102 Ga0157371_10806974 Ga0157371_108069742 50
691 3300013104 Ga0157370_10240766 Ga0157370_102407662 50
692 3300013104 Ga0157370_10598302 Ga0157370_105983022 50
693 3300013104 Ga0157370_10676620 Ga0157370_106766202 50
694 3300013104 Ga0157370_10728503 Ga0157370_107285032 50
695 3300013104 Ga0157370_10742744 Ga0157370_107427442 50
696 3300013104 Ga0157370_11861012 Ga0157370_118610121 50
697 3300013105 Ga0157369_10059379 Ga0157369_100593792 50
698 3300013105 Ga0157369_10288107 Ga0157369_102881072 50
699 3300013105 Ga0157369_10484948 Ga0157369_104849482 50
700 3300013105 Ga0157369_10524350 Ga0157369_105243501 50
701 3300013296 Ga0157374_10194493 Ga0157374_101944933 50
702 3300013296 Ga0157374_10202392 Ga0157374_102023922 50
703 3300013296 Ga0157374_11170581 Ga0157374_111705812 50
704 3300013297 Ga0157378_10395136 Ga0157378_103951361 50
705 3300013297 Ga0157378_10716397 Ga0157378_107163972 50
706 3300013297 Ga0157378_11194236 Ga0157378_111942362 50
707 3300013297 Ga0157378_12561561 Ga0157378_125615612 50
708 3300013306 Ga0163162_10082452 Ga0163162_100824524 50
709 3300013306 Ga0163162_10354072 Ga0163162_103540723 50
710 3300013306 Ga0163162_10395900 Ga0163162_103959003 50
711 3300013306 Ga0163162_11056463 Ga0163162_110564634 50
712 3300013306 Ga0163162_12087887 Ga0163162_120878872 50
713 3300013307 Ga0157372_10044917 Ga0157372_100449174 50
714 3300013307 Ga0157372_10237973 Ga0157372_102379733 50
715 3300013307 Ga0157372_10538562 Ga0157372_105385621 50
716 3300013307 Ga0157372_11478237 Ga0157372_114782372 50
717 3300013307 Ga0157372_12429284 Ga0157372_124292841 50
718 3300013308 Ga0157375_11454833 Ga0157375_114548331 50
719 3300014325 Ga0163163_11050982 Ga0163163_110509821 50
720 3300014325 Ga0163163_12660334 Ga0163163_126603342 50
721 3300014326 Ga0157380_12261617 Ga0157380_122616171 50
722 3300014497 Ga0182008_10244091 Ga0182008_102440912 50
723 3300014497 Ga0182008_10566222 Ga0182008_105662222 50
724 3300014497 Ga0182008_10846232 Ga0182008_108462322 50
725 3300014745 Ga0157377_10540151 Ga0157377_105401512 50
726 3300014968 Ga0157379_10926495 Ga0157379_109264952 50
727 3300014968 Ga0157379_11014445 Ga0157379_110144451 50
728 3300014969 Ga0157376_10058405 Ga0157376_100584055 50
729 3300014969 Ga0157376_10452778 Ga0157376_104527782 50
730 3300014969 Ga0157376_10596257 Ga0157376_105962573 50
731 3300014969 Ga0157376_12196332 Ga0157376_121963322 50
732 3300017792 Ga0163161_10229479 Ga0163161_102294793 50
733 3300020069 Ga0197907_11200871 Ga0197907_112008712 50
734 3300020070 Ga0206356_10599982 Ga0206356_105999821 50
735 3300020070 Ga0206356_11246173 Ga0206356_112461731 50
736 3300020075 Ga0206349_1682998 Ga0206349_16829981 50
737 3300020076 Ga0206355_1179373 Ga0206355_11793732 50
738 3300020080 Ga0206350_10626026 Ga0206350_106260264 50
739 3300020081 Ga0206354_11293970 Ga0206354_112939702 50
740 3300020082 Ga0206353_10193602 Ga0206353_101936022 50
741 3300020610 Ga0154015_1702973 Ga0154015_17029732 50
742 3300021358 Ga0213873_10263288 Ga0213873_102632882 50
743 3300021361 Ga0213872_10400673 Ga0213872_104006732 50
744 3300021377 Ga0213874_10022748 Ga0213874_100227482 50
745 3300021384 Ga0213876_10204990 Ga0213876_102049902 50
746 3300021441 Ga0213871_10023878 Ga0213871_100238781 50
747 3300022467 Ga0224712_10011865 Ga0224712_100118652 50
748 3300022467 Ga0224712_10361874 Ga0224712_103618741 50
749 3300025297 Ga0209758_1022536 Ga0209758_10225362 50
750 3300025315 Ga0207697_10136582 Ga0207697_101365823 50
751 3300025885 Ga0207653_10038324 Ga0207653_100383242 50
752 3300025893 Ga0207682_10283279 Ga0207682_102832792 50
753 3300025898 Ga0207692_10107183 Ga0207692_101071832 50
754 3300025898 Ga0207692_10304093 Ga0207692_103040932 50
755 3300025898 Ga0207692_10457524 Ga0207692_104575242 50
756 3300025899 Ga0207642_10468464 Ga0207642_104684642 50
757 3300025900 Ga0207710_10059715 Ga0207710_100597152 50
758 3300025900 Ga0207710_10152875 Ga0207710_101528752 50
759 3300025900 Ga0207710_10503179 Ga0207710_105031792 50
760 3300025901 Ga0207688_10465756 Ga0207688_104657562 50
761 3300025903 Ga0207680_11004005 Ga0207680_110040052 50
762 3300025905 Ga0207685_10191741 Ga0207685_101917412 50
763 3300025906 Ga0207699_10025581 Ga0207699_100255812 50
764 3300025906 Ga0207699_10199589 Ga0207699_101995893 50
765 3300025906 Ga0207699_10679423 Ga0207699_106794232 50
766 3300025906 Ga0207699_10870700 Ga0207699_108707002 50
767 3300025906 Ga0207699_11357232 Ga0207699_113572322 50
768 3300025906 Ga0207699_11370861 Ga0207699_113708612 50
769 3300025907 Ga0207645_10214199 Ga0207645_102141992 50
770 3300025907 Ga0207645_10321812 Ga0207645_103218123 50
771 3300025908 Ga0207643_10147552 Ga0207643_101475522 50
772 3300025908 Ga0207643_11093598 Ga0207643_110935981 50
773 3300025910 Ga0207684_10057054 Ga0207684_100570545 50
774 3300025911 Ga0207654_10276160 Ga0207654_102761602 50
775 3300025911 Ga0207654_10284125 Ga0207654_102841252 50
776 3300025912 Ga0207707_10019814 Ga0207707_100198142 50
777 3300025912 Ga0207707_10027775 Ga0207707_100277754 50
778 3300025912 Ga0207707_11157195 Ga0207707_111571951 50
779 3300025913 Ga0207695_10054576 Ga0207695_100545764 50
780 3300025913 Ga0207695_10340223 Ga0207695_103402232 50
781 3300025913 Ga0207695_11330962 Ga0207695_113309622 50
782 3300025914 Ga0207671_10099942 Ga0207671_100999421 50
783 3300025914 Ga0207671_10099958 Ga0207671_100999582 50
784 3300025914 Ga0207671_10103991 Ga0207671_101039912 50
785 3300025914 Ga0207671_10174515 Ga0207671_101745152 50
786 3300025914 Ga0207671_10292548 Ga0207671_102925481 50
787 3300025914 Ga0207671_10397523 Ga0207671_103975232 50
788 3300025915 Ga0207693_10223615 Ga0207693_102236152 50
789 3300025916 Ga0207663_10337156 Ga0207663_103371562 50
790 3300025916 Ga0207663_10385522 Ga0207663_103855222 50
791 3300025916 Ga0207663_10554305 Ga0207663_105543052 50
792 3300025916 Ga0207663_10982780 Ga0207663_109827802 50
793 3300025917 Ga0207660_10017576 Ga0207660_100175762 50
794 3300025917 Ga0207660_10263412 Ga0207660_102634122 50
795 3300025917 Ga0207660_10742314 Ga0207660_107423142 50
796 3300025919 Ga0207657_10099624 Ga0207657_100996243 50
797 3300025920 Ga0207649_10280444 Ga0207649_102804442 50
798 3300025920 Ga0207649_10295375 Ga0207649_102953753 50
799 3300025920 Ga0207649_10781425 Ga0207649_107814252 50
800 3300025920 Ga0207649_10966266 Ga0207649_109662662 50
801 3300025921 Ga0207652_10407074 Ga0207652_104070742 50
802 3300025921 Ga0207652_10654237 Ga0207652_106542372 50
803 3300025921 Ga0207652_11076474 Ga0207652_110764742 50
804 3300025921 Ga0207652_11767678 Ga0207652_117676782 50
805 3300025922 Ga0207646_10020117 Ga0207646_100201172 50
806 3300025922 Ga0207646_10223738 Ga0207646_102237382 50
807 3300025922 Ga0207646_10624543 Ga0207646_106245432 50
808 3300025923 Ga0207681_10108734 Ga0207681_101087343 50
809 3300025923 Ga0207681_10462411 Ga0207681_104624112 50
810 3300025923 Ga0207681_10918781 Ga0207681_109187811 50
811 3300025924 Ga0207694_10168517 Ga0207694_101685172 50
812 3300025924 Ga0207694_10426931 Ga0207694_104269312 50
813 3300025924 Ga0207694_10437989 Ga0207694_104379892 50
814 3300025924 Ga0207694_10712461 Ga0207694_107124612 50
815 3300025925 Ga0207650_10374865 Ga0207650_103748652 50
816 3300025925 Ga0207650_10500076 Ga0207650_105000762 50
817 3300025925 Ga0207650_10670211 Ga0207650_106702112 50
818 3300025926 Ga0207659_10051717 Ga0207659_100517174 50
819 3300025927 Ga0207687_10984439 Ga0207687_109844392 50
820 3300025927 Ga0207687_11779417 Ga0207687_117794172 50
821 3300025928 Ga0207700_10011883 Ga0207700_100118832 50
822 3300025928 Ga0207700_10050788 Ga0207700_100507884 50
823 3300025928 Ga0207700_10099449 Ga0207700_100994492 50
824 3300025928 Ga0207700_10117337 Ga0207700_101173373 50
825 3300025929 Ga0207664_10018321 Ga0207664_100183216 50
826 3300025929 Ga0207664_10145841 Ga0207664_101458412 50
827 3300025929 Ga0207664_10725311 Ga0207664_107253112 50
828 3300025931 Ga0207644_10414810 Ga0207644_104148102 50
829 3300025933 Ga0207706_11574436 Ga0207706_115744362 50
830 3300025935 Ga0207709_11820810 Ga0207709_118208102 50
831 3300025936 Ga0207670_10173635 Ga0207670_101736353 50
832 3300025936 Ga0207670_10223015 Ga0207670_102230153 50
833 3300025936 Ga0207670_10393335 Ga0207670_103933352 50
834 3300025936 Ga0207670_11664827 Ga0207670_116648272 50
835 3300025937 Ga0207669_10153160 Ga0207669_101531602 50
836 3300025938 Ga0207704_10548350 Ga0207704_105483501 50
837 3300025938 Ga0207704_10963653 Ga0207704_109636532 50
838 3300025939 Ga0207665_11231095 Ga0207665_112310952 50
839 3300025940 Ga0207691_10048272 Ga0207691_100482722 50
840 3300025940 Ga0207691_10952283 Ga0207691_109522832 50
841 3300025941 Ga0207711_12015424 Ga0207711_120154241 50
842 3300025942 Ga0207689_10676285 Ga0207689_106762852 50
843 3300025944 Ga0207661_10481810 Ga0207661_104818102 50
844 3300025944 Ga0207661_10583060 Ga0207661_105830602 50
845 3300025944 Ga0207661_10939988 Ga0207661_109399882 50
846 3300025944 Ga0207661_11011652 Ga0207661_110116522 50
847 3300025944 Ga0207661_12063635 Ga0207661_120636352 50
848 3300025945 Ga0207679_10349056 Ga0207679_103490562 50
849 3300025949 Ga0207667_10109147 Ga0207667_101091475 50
850 3300025949 Ga0207667_10119359 Ga0207667_101193592 50
851 3300025949 Ga0207667_10242401 Ga0207667_102424013 50
852 3300025949 Ga0207667_10351611 Ga0207667_103516112 50
853 3300025949 Ga0207667_10697254 Ga0207667_106972542 50
854 3300025960 Ga0207651_10230043 Ga0207651_102300432 50
855 3300025960 Ga0207651_11465163 Ga0207651_114651632 50
856 3300025960 Ga0207651_11666480 Ga0207651_116664802 50
857 3300025961 Ga0207712_11345480 Ga0207712_113454802 50
858 3300025972 Ga0207668_10175746 Ga0207668_101757462 50
859 3300025972 Ga0207668_11542490 Ga0207668_115424902 50
860 3300025981 Ga0207640_10121501 Ga0207640_101215014 50
861 3300025986 Ga0207658_10461656 Ga0207658_104616562 50
862 3300025986 Ga0207658_10569621 Ga0207658_105696212 50
863 3300026023 Ga0207677_10165314 Ga0207677_101653141 50
864 3300026023 Ga0207677_10977633 Ga0207677_109776332 50
865 3300026035 Ga0207703_10461782 Ga0207703_104617822 50
866 3300026035 Ga0207703_10480171 Ga0207703_104801712 50
867 3300026035 Ga0207703_10583978 Ga0207703_105839782 50
868 3300026035 Ga0207703_11657165 Ga0207703_116571652 50
869 3300026035 Ga0207703_12285119 Ga0207703_122851192 50
870 3300026041 Ga0207639_10079336 Ga0207639_100793364 50
871 3300026041 Ga0207639_10225846 Ga0207639_102258462 50
872 3300026041 Ga0207639_10662177 Ga0207639_106621772 50
873 3300026041 Ga0207639_11338573 Ga0207639_113385732 50
874 3300026075 Ga0207708_10456892 Ga0207708_104568922 50
875 3300026075 Ga0207708_11873678 Ga0207708_118736782 50
876 3300026078 Ga0207702_10086799 Ga0207702_100867992 50
877 3300026078 Ga0207702_10248372 Ga0207702_102483722 50
878 3300026078 Ga0207702_10510534 Ga0207702_105105341 50
879 3300026078 Ga0207702_10933250 Ga0207702_109332502 50
880 3300026078 Ga0207702_11711522 Ga0207702_117115222 50
881 3300026088 Ga0207641_10032716 Ga0207641_100327165 50
882 3300026088 Ga0207641_11589305 Ga0207641_115893052 50
883 3300026088 Ga0207641_11887704 Ga0207641_118877041 50
884 3300026089 Ga0207648_10244203 Ga0207648_102442032 50
885 3300026089 Ga0207648_10321347 Ga0207648_103213472 50
886 3300026095 Ga0207676_10785895 Ga0207676_107858951 50
887 3300026095 Ga0207676_10840074 Ga0207676_108400743 50
888 3300026095 Ga0207676_11782465 Ga0207676_117824651 50
889 3300026116 Ga0207674_10019754 Ga0207674_1001975410 50
890 3300026116 Ga0207674_10122256 Ga0207674_101222562 50
891 3300026116 Ga0207674_10540826 Ga0207674_105408263 50
892 3300026116 Ga0207674_10965182 Ga0207674_109651822 50
893 3300026116 Ga0207674_12226465 Ga0207674_122264652 50
894 3300026118 Ga0207675_100661262 Ga0207675_1006612623 50
895 3300026118 Ga0207675_100745497 Ga0207675_1007454972 50
896 3300026118 Ga0207675_101118784 Ga0207675_1011187842 50
897 3300026118 Ga0207675_102121635 Ga0207675_1021216352 50
898 3300026121 Ga0207683_10064958 Ga0207683_100649585 50
899 3300026121 Ga0207683_10177746 Ga0207683_101777462 50
900 3300026121 Ga0207683_10557105 Ga0207683_105571052 50
901 3300026121 Ga0207683_10762643 Ga0207683_107626433 50
902 3300026142 Ga0207698_10103163 Ga0207698_101031633 50
903 3300026142 Ga0207698_11684942 Ga0207698_116849422 50
904 3300026142 Ga0207698_12005545 Ga0207698_120055452 50
905 3300026142 Ga0207698_12527861 Ga0207698_125278611 50
906 3300027671 Ga0209588_1033693 Ga0209588_10336933 50
907 3300027671 Ga0209588_1075701 Ga0209588_10757012 50
908 3300027866 Ga0209813_10238556 Ga0209813_102385561 50
909 3300027907 Ga0207428_10031923 Ga0207428_100319232 50
910 3300027907 Ga0207428_10526169 Ga0207428_105261692 50
911 3300027907 Ga0207428_10851416 Ga0207428_108514162 50
912 3300028379 Ga0268266_10005904 Ga0268266_1000590411 50
913 3300028379 Ga0268266_10066473 Ga0268266_100664732 50
914 3300028379 Ga0268266_11217490 Ga0268266_112174902 50
915 3300028379 Ga0268266_11788426 Ga0268266_117884262 50
916 3300028380 Ga0268265_10220537 Ga0268265_102205371 50
917 3300028380 Ga0268265_10303297 Ga0268265_103032972 50
918 3300028380 Ga0268265_10465074 Ga0268265_104650742 50
919 3300028380 Ga0268265_12412420 Ga0268265_124124202 50
920 3300028381 Ga0268264_10000084 Ga0268264_10000084102 50
921 3300028381 Ga0268264_11735814 Ga0268264_117358142 50
922 3300028381 Ga0268264_11892679 Ga0268264_118926792 50
923 3300028786 Ga0307517_10578289 Ga0307517_105782892 50
924 3300030521 Ga0307511_10052815 Ga0307511_100528153 50
925 3300031241 Ga0265325_10095155 Ga0265325_100951552 50
926 3300031247 Ga0265340_10303826 Ga0265340_103038261 50
927 3300031344 Ga0265316_10317948 Ga0265316_103179481 50
928 3300031507 Ga0307509_10153689 Ga0307509_101536892 50
929 3300031507 Ga0307509_10484231 Ga0307509_104842311 50
930 3300031507 Ga0307509_10693014 Ga0307509_106930141 50
931 3300031548 Ga0307408_100144864 Ga0307408_1001448642 50
932 3300031616 Ga0307508_10000105 Ga0307508_1000010552 50
933 3300031616 Ga0307508_10239342 Ga0307508_102393422 50
934 3300031616 Ga0307508_10432899 Ga0307508_104328992 50
935 3300031711 Ga0265314_10193618 Ga0265314_101936182 50
936 3300031728 Ga0316578_10334185 Ga0316578_103341852 50
937 3300031730 Ga0307516_10670925 Ga0307516_106709252 50
938 3300031731 Ga0307405_10237908 Ga0307405_102379082 50
939 3300031824 Ga0307413_11211737 Ga0307413_112117372 50
940 3300031901 Ga0307406_10579121 Ga0307406_105791213 50
941 3300032002 Ga0307416_100346498 Ga0307416_1003464982 50
942 3300032005 Ga0307411_11982867 Ga0307411_119828672 50
943 3300032126 Ga0307415_102194505 Ga0307415_1021945052 50
944 3300033180 Ga0307510_10303858 Ga0307510_103038582 50
945 3300033544 Ga0316215_1016362 Ga0316215_10163622 50
946 3300034818 Ga0373950_0063721 Ga0373950_0063721_112_264 50
947 3300034820 Ga0373959_0125493 Ga0373959_0125493_135_287 50
948 3300034957 Ga0373938_0002387 Ga0373938_0002387_1064_1216 50
949 3300034957 Ga0373938_0115185 Ga0373938_0115185_106_258 50
950 3300035083 Ga0373926_0026586 Ga0373926_0026586_1463_1615 50
951 3300035084 Ga0373928_0067222 Ga0373928_0067222_363_515 50
952 3300035085 Ga0373929_0029597 Ga0373929_0029597_97_249 50
953 3300035085 Ga0373929_0146869 Ga0373929_0146869_11_163 50
954 3300035085 Ga0373929_0188123 Ga0373929_0188123_192_344 50
955 3300035086 Ga0373934_0015167 Ga0373934_0015167_1407_1559 50
956 3300035086 Ga0373934_0135409 Ga0373934_0135409_504_656 50
957 3300035088 Ga0373940_0336563 Ga0373940_0336563_192_344 50
958 3300035089 Ga0373944_0018895 Ga0373944_0018895_392_544 50
959 3300035090 Ga0373949_0050956 Ga0373949_0050956_75_227 50
960 3300035091 Ga0373951_0030626 Ga0373951_0030626_1078_1230 50
961 3300035091 Ga0373951_0134474 Ga0373951_0134474_394_546 50
962 3300035092 Ga0373952_0215162 Ga0373952_0215162_265_417 50
963 3300035111 Ga0373923_0029232 Ga0373923_0029232_276_428 50
964 3300035111 Ga0373923_0103330 Ga0373923_0103330_588_740 50
965 3300035111 Ga0373923_0234032 Ga0373923_0234032_679_831 50
966 3300035112 Ga0373932_0273949 Ga0373932_0273949_297_449 50
967 3300035113 Ga0373936_0076639 Ga0373936_0076639_288_440 50
968 3300035113 Ga0373936_0087248 Ga0373936_0087248_348_500 50
969 3300035113 Ga0373936_0127000 Ga0373936_0127000_572_724 50
970 3300035113 Ga0373936_0160980 Ga0373936_0160980_208_360 50
971 3300035114 Ga0373939_0062831 Ga0373939_0062831_487_639 50
972 3300035114 Ga0373939_0166417 Ga0373939_0166417_635_787 50
973 3300035115 Ga0373941_0069709 Ga0373941_0069709_71_223 50
974 3300035115 Ga0373941_0079932 Ga0373941_0079932_740_892 50
975 3300035115 Ga0373941_0138650 Ga0373941_0138650_463_615 50
976 3300035115 Ga0373941_0434345 Ga0373941_0434345_257_409 50
977 3300035116 Ga0373945_0135627 Ga0373945_0135627_634_786 50
978 3300035116 Ga0373945_0185044 Ga0373945_0185044_541_693 50
979 3300035117 Ga0373953_0104021 Ga0373953_0104021_539_691 50
980 3300035117 Ga0373953_0183285 Ga0373953_0183285_674_826 50
981 3300035118 Ga0373954_0034467 Ga0373954_0034467_1653_1805 50
982 3300035118 Ga0373954_0053703 Ga0373954_0053703_1210_1362 50
983 3300035119 Ga0373956_0107278 Ga0373956_0107278_790_942 50
984 3300035119 Ga0373956_0121293 Ga0373956_0121293_518_670 50
985 3300035120 Ga0373957_0301896 Ga0373957_0301896_464_616 50
986 3300035120 Ga0373957_0353780 Ga0373957_0353780_307_459 50
987 3300035121 Ga0373960_0052412 Ga0373960_0052412_546_698 50
988 3300035121 Ga0373960_0351672 Ga0373960_0351672_11_163 50
989 3300035170 Ga0373943_0121832 Ga0373943_0121832_1044_1196 50
990 3300035170 Ga0373943_0310015 Ga0373943_0310015_311_463 50
991 3300035171 Ga0373946_0047551 Ga0373946_0047551_557_709 50
992 3300035171 Ga0373946_0283397 Ga0373946_0283397_311_463 50
993 3300035172 Ga0373955_0059090 Ga0373955_0059090_1094_1246 50
994 3300035207 Ga0373942_0386317 Ga0373942_0386317_226_378 50
995 3300035241 Ga0373961_0011686 Ga0373961_0011686_1646_1798 50
996 3300035241 Ga0373961_0013644 Ga0373961_0013644_1812_1964 50
997 3300035241 Ga0373961_0069950 Ga0373961_0069950_476_628 50
998 3300035242 Ga0373962_0022174 Ga0373962_0022174_330_482 50
999 3300035242 Ga0373962_0028668 Ga0373962_0028668_616_768 50
1000 3300035410 Ga0373924_0306384 Ga0373924_0306384_252_404 50
1001 3300035691 Ga0373931_0000317 Ga0373931_0000317_273_425 50
1002 3300035691 Ga0373931_0004056 Ga0373931_0004056_2834_2986 50
1003 3300035691 Ga0373931_0496027 Ga0373931_0496027_139_291 50
1004 3300035692 Ga0373935_0101455 Ga0373935_0101455_767_919 50
1005 3300035692 Ga0373935_0136231 Ga0373935_0136231_553_705 50
1006 3300035692 Ga0373935_0166266 Ga0373935_0166266_20_172 50
1007 3300035692 Ga0373935_0614359 Ga0373935_0614359_240_392 50
1008 3300035692 Ga0373935_0948113 Ga0373935_0948113_366_518 50
1009 3300035692 Ga0373935_1096472 Ga0373935_1096472_332_484 50
1010 3300035695 Ga0373927_0024147 Ga0373927_0024147_2293_2445 50
1011 3300035695 Ga0373927_0116454 Ga0373927_0116454_276_428 50
1012 3300035695 Ga0373927_0153953 Ga0373927_0153953_19_171 50
1013 3300035695 Ga0373927_0292335 Ga0373927_0292335_865_1017 50
1014 3300035695 Ga0373927_0312442 Ga0373927_0312442_551_703 50
1015 3300035724 Ga0373933_0017280 Ga0373933_0017280_3629_3781 50
1016 3300035724 Ga0373933_0087473 Ga0373933_0087473_517_669 50
1017 3300035724 Ga0373933_0884186 Ga0373933_0884186_243_395 50
1018 3300035725 Ga0373947_0024091 Ga0373947_0024091_1312_1464 50
1019 3300035725 Ga0373947_0038743 Ga0373947_0038743_51_203 50
1020 3300035725 Ga0373947_0052625 Ga0373947_0052625_511_663 50
1021 3300035725 Ga0373947_0356324 Ga0373947_0356324_362_514 50
1022 3300036401 Ga0373937_0118391 Ga0373937_0118391_61_213 50
1023 3300036401 Ga0373937_0162129 Ga0373937_0162129_1154_1306 50
1024 3300036401 Ga0373937_0227375 Ga0373937_0227375_188_340 50
1025 3300036459 Ga0372808_001897 Ga0372808_001897_1695_1847 50
1026 3300037068 Ga0373925_0075212 Ga0373925_0075212_952_1104 50
1027 3300037068 Ga0373925_0077433 Ga0373925_0077433_288_440 50
1028 3300037068 Ga0373925_0079553 Ga0373925_0079553_2318_2470 50
1029 3300037068 Ga0373925_0112578 Ga0373925_0112578_466_618 50
1030 3300037068 Ga0373925_0491133 Ga0373925_0491133_16_168 50
1031 3300037068 Ga0373925_0708989 Ga0373925_0708989_401_553 50
1032 3300037312 Ga0395899_0002162 Ga0395899_0002162_428_580 50
1033 3300037312 Ga0395899_0021402 Ga0395899_0021402_1123_1275 50
1034 3300037312 Ga0395899_0302544 Ga0395899_0302544_140_292 50
1035 3300037418 Ga0395900_0004853 Ga0395900_0004853_1003_1155 50
1036 3300037418 Ga0395900_0005904 Ga0395900_0005904_12113_12265 50
1037 3300037418 Ga0395900_0064978 Ga0395900_0064978_1795_1947 50
1038 3300037418 Ga0395900_0240772 Ga0395900_0240772_631_783 50
1039 3300037418 Ga0395900_1047689 Ga0395900_1047689_415_567 50
1040 3300037466 Ga0395898_0012089 Ga0395898_0012089_1944_2096 50
1041 3300037466 Ga0395898_0149599 Ga0395898_0149599_1171_1323 50
1042 3300037466 Ga0395898_0162409 Ga0395898_0162409_929_1081 50
1043 3300037471 Ga0395905_0180874 Ga0395905_0180874_1413_1565 50
1044 3300037853 Ga0436364_1015918 Ga0436364_1015918_415_567 50
1045 3300038443 Ga0395901_0040678 Ga0395901_0040678_3795_3947 50
1046 3300038443 Ga0395901_0139607 Ga0395901_0139607_1855_2007 50
1047 3300038443 Ga0395901_0148919 Ga0395901_0148919_1274_1426 50
1048 3300038443 Ga0395901_0195047 Ga0395901_0195047_1354_1506 50
1049 3300038443 Ga0395901_0381956 Ga0395901_0381956_431_583 50
1050 3300039437 Ga0436365_0368730 Ga0436365_0368730_2152_2304 50
1051 3300039437 Ga0436365_0622183 Ga0436365_0622183_851_1003 50
1052 3300039437 Ga0436365_0920296 Ga0436365_0920296_489_641 50
1053 3300039437 Ga0436365_1044564 Ga0436365_1044564_579_731 50
1054 3300039437 Ga0436365_1545720 Ga0436365_1545720_458_610 50
1055 3300039437 Ga0436365_1547297 Ga0436365_1547297_710_862 50
1056 3300039437 Ga0436365_1649599 Ga0436365_1649599_102_254 50
1057 3300039437 Ga0436365_1722483 Ga0436365_1722483_172_324 50
1058 3300039438 Ga0436360_0542064 Ga0436360_0542064_383_535 50
1059 3300039438 Ga0436360_0826367 Ga0436360_0826367_286_438 50
1060 3300039438 Ga0436360_1024581 Ga0436360_1024581_85_237 50
1061 3300039438 Ga0436360_1144799 Ga0436360_1144799_1818_1970 50
1062 3300039447 Ga0436361_0035526 Ga0436361_0035526_336_488 50
1063 3300039447 Ga0436361_0175551 Ga0436361_0175551_1900_2052 50
1064 3300039447 Ga0436361_0683077 Ga0436361_0683077_124_276 50
1065 3300039447 Ga0436361_0984910 Ga0436361_0984910_91_243 50
1066 3300039447 Ga0436361_1160036 Ga0436361_1160036_454_606 50
1067 3300039450 Ga0436363_0461653 Ga0436363_0461653_2147_2299 50
1068 3300039450 Ga0436363_1236422 Ga0436363_1236422_193_345 50
1069 3300039450 Ga0436363_1265235 Ga0436363_1265235_782_934 50
1070 3300039453 Ga0436362_0026859 Ga0436362_0026859_170_322 50
1071 3300039453 Ga0436362_0272131 Ga0436362_0272131_691_843 50
1072 3300039453 Ga0436362_0339798 Ga0436362_0339798_282_434 50
1073 3300039453 Ga0436362_0965633 Ga0436362_0965633_431_583 50
1074 3300041407 Ga0439447_053466 Ga0439447_053466_678_830 50
1075 3300041411 Ga0439466_0108367 Ga0439466_0108367_265_417 50
1076 3300041413 Ga0439465_0072857 Ga0439465_0072857_139_291 50
1077 3300041443 Ga0451789_1040744 Ga0451789_1040744_515_667 50
1078 3300041453 Ga0451797_1343343 Ga0451797_1343343_217_369 50
1079 3300041456 Ga0451795_1639049 Ga0451795_1639049_262_414 50
1080 3300041459 Ga0451800_0546300 Ga0451800_0546300_194_346 50
1081 3300041463 Ga0451804_0238532 Ga0451804_0238532_379_531 50
1082 3300041486 Ga0451807_1577102 Ga0451807_1577102_345_497 50
1083 3300041486 Ga0451807_1819751 Ga0451807_1819751_203_355 50
1084 3300041496 Ga0451839_0668696 Ga0451839_0668696_316_468 50
1085 3300041505 Ga0451849_0120354 Ga0451849_0120354_229_381 50
1086 3300041505 Ga0451849_0905281 Ga0451849_0905281_106_258 50
1087 3300041512 Ga0451853_1687619 Ga0451853_1687619_13_165 50
1088 3300042001 Ga0439441_078718 Ga0439441_078718_293_445 50
1089 3300042002 Ga0439442_110396 Ga0439442_110396_401_553 50
1090 3300042002 Ga0439442_144014 Ga0439442_144014_190_342 50
1091 3300042004 Ga0439445_0094973 Ga0439445_0094973_108_260 50
1092 3300042006 Ga0439432_209705 Ga0439432_209705_41_193 50
1093 3300042435 Ga0439434_0269612 Ga0439434_0269612_22_174 50
1094 3300042436 Ga0439435_0075194 Ga0439435_0075194_546_698 50
1095 3300042438 Ga0439459_0003070 Ga0439459_0003070_975_1127 50
1096 3300042438 Ga0439459_0062672 Ga0439459_0062672_360_512 50
1097 3300042439 Ga0439464_0163929 Ga0439464_0163929_415_567 50
1098 3300042532 Ga0450893_0099443 Ga0450893_0099443_161_313 50
1099 3300044693 Ga0466961_0086598 Ga0466961_0086598_1671_1823 50
1100 3300044694 Ga0466963_0021148 Ga0466963_0021148_1787_1939 50
1101 3300044694 Ga0466963_0080570 Ga0466963_0080570_1046_1198 50
1102 3300044694 Ga0466963_0728197 Ga0466963_0728197_134_286 50
1103 3300044706 Ga0466964_0242465 Ga0466964_0242465_302_454 50
1104 3300044735 Ga0466968_0409195 Ga0466968_0409195_267_419 50
1105 3300044842 Ga0466957_0019808 Ga0466957_0019808_3288_3440 50
1106 3300045051 Ga0451576_0352313 Ga0451576_0352313_1156_1308 50
1107 3300045976 Ga0466967_0002809 Ga0466967_0002809_3065_3217 50
1108 3300045976 Ga0466967_0444622 Ga0466967_0444622_442_594 50
1109 3300045976 Ga0466967_0943300 Ga0466967_0943300_121_273 50
1110 3300045976 Ga0466967_1480479 Ga0466967_1480479_110_262 50
1111 3300045976 Ga0466967_1543262 Ga0466967_1543262_165_317 50
1112 3300045976 Ga0466967_2334817 Ga0466967_2334817_340_492 50
1113 3300046455 Ga0495603_0100902 Ga0495603_0100902_947_1099 50
1114 3300046457 Ga0495590_0130756 Ga0495590_0130756_620_772 50
1115 3300046459 Ga0495629_0624215 Ga0495629_0624215_214_366 50
1116 3300046460 Ga0495638_0312985 Ga0495638_0312985_593_745 50
1117 3300046462 Ga0495651_0742602 Ga0495651_0742602_276_428 50
1118 3300046463 Ga0495653_0101144 Ga0495653_0101144_1337_1489 50
1119 3300046463 Ga0495653_0165483 Ga0495653_0165483_424_576 50
1120 3300046472 Ga0495580_0013706 Ga0495580_0013706_5565_5717 50
1121 3300046472 Ga0495580_0329207 Ga0495580_0329207_660_812 50
1122 3300046472 Ga0495580_1013166 Ga0495580_1013166_156_308 50
1123 3300046473 Ga0495582_0046171 Ga0495582_0046171_1164_1316 50
1124 3300046475 Ga0495639_0110802 Ga0495639_0110802_974_1126 50
1125 3300046476 Ga0495662_0010302 Ga0495662_0010302_3547_3699 50
1126 3300046477 Ga0495664_0014771 Ga0495664_0014771_3601_3753 50
1127 3300046477 Ga0495664_0113036 Ga0495664_0113036_119_271 50
1128 3300046477 Ga0495664_0383713 Ga0495664_0383713_314_466 50
1129 3300046491 Ga0495584_0381930 Ga0495584_0381930_499_651 50
1130 3300046499 Ga0495594_0255209 Ga0495594_0255209_595_747 50
1131 3300046507 Ga0495606_0105987 Ga0495606_0105987_1175_1327 50
1132 3300046514 Ga0495618_0274332 Ga0495618_0274332_165_317 50
1133 3300046516 Ga0495628_0509100 Ga0495628_0509100_587_739 50
1134 3300046517 Ga0495630_0040788 Ga0495630_0040788_1574_1726 50
1135 3300046517 Ga0495630_0608366 Ga0495630_0608366_426_578 50
1136 3300046517 Ga0495630_0909152 Ga0495630_0909152_207_359 50
1137 3300046517 Ga0495630_0987330 Ga0495630_0987330_23_175 50
1138 3300046526 Ga0495666_0092268 Ga0495666_0092268_196_348 50
1139 3300046529 Ga0495652_0105267 Ga0495652_0105267_1237_1389 50
1140 3300046531 Ga0495665_0087128 Ga0495665_0087128_941_1093 50
1141 3300046531 Ga0495665_0102077 Ga0495665_0102077_890_1042 50
1142 3300046533 Ga0495640_0041700 Ga0495640_0041700_2789_2941 50
1143 3300046533 Ga0495640_0334793 Ga0495640_0334793_221_373 50
1144 3300046533 Ga0495640_0967887 Ga0495640_0967887_196_348 50
1145 3300046535 Ga0495586_0051611 Ga0495586_0051611_387_539 50
1146 3300046535 Ga0495586_0479206 Ga0495586_0479206_425_577 50
1147 3300046543 Ga0495645_0027722 Ga0495645_0027722_2770_2922 50
1148 3300046543 Ga0495645_0069587 Ga0495645_0069587_1144_1296 50
1149 3300046543 Ga0495645_0560322 Ga0495645_0560322_401_553 50
1150 3300046557 Ga0495622_0068342 Ga0495622_0068342_423_575 50
1151 3300046559 Ga0495667_0040028 Ga0495667_0040028_356_508 50
1152 3300046642 Ga0495634_0124638 Ga0495634_0124638_786_938 50
1153 3300046642 Ga0495634_0789494 Ga0495634_0789494_244_396 50
1154 3300046663 Ga0495635_0000082 Ga0495635_0000082_4044_4196 50
1155 3300046663 Ga0495635_0007858 Ga0495635_0007858_3715_3867 50
1156 3300046663 Ga0495635_0418785 Ga0495635_0418785_295_447 50
1157 3300046675 Ga0495657_0357251 Ga0495657_0357251_554_706 50
1158 3300046678 Ga0495599_0211052 Ga0495599_0211052_467_619 50
1159 3300046678 Ga0495599_0771340 Ga0495599_0771340_222_374 50
1160 3300046679 Ga0495623_0509093 Ga0495623_0509093_258_410 50
1161 3300046680 Ga0495646_0201999 Ga0495646_0201999_152_304 50
1162 3300046681 Ga0495647_0126736 Ga0495647_0126736_450_602 50
1163 3300046681 Ga0495647_0221857 Ga0495647_0221857_630_782 50
1164 3300046683 Ga0495658_0018744 Ga0495658_0018744_1476_1628 50
1165 3300046689 Ga0495613_0107356 Ga0495613_0107356_802_954 50
1166 3300046689 Ga0495613_0167055 Ga0495613_0167055_1369_1521 50
1167 3300046689 Ga0495613_0248223 Ga0495613_0248223_991_1143 50
1168 3300046690 Ga0495624_0043952 Ga0495624_0043952_769_921 50
1169 3300046690 Ga0495624_0519326 Ga0495624_0519326_139_291 50
1170 3300046692 Ga0495671_0200171 Ga0495671_0200171_382_534 50
1171 3300046809 Ga0495600_0044373 Ga0495600_0044373_1409_1561 50
1172 3300047315 Ga0495581_0078431 Ga0495581_0078431_1040_1192 50
1173 3300047315 Ga0495581_0171710 Ga0495581_0171710_939_1091 50
1174 3300047317 Ga0495604_0536057 Ga0495604_0536057_193_345 50
1175 3300047317 Ga0495604_0851316 Ga0495604_0851316_13_165 50
1176 3300047319 Ga0495674_0004477 Ga0495674_0004477_2965_3117 50
1177 3300047319 Ga0495674_0400956 Ga0495674_0400956_866_1018 50
1178 3300047319 Ga0495674_0588326 Ga0495674_0588326_293_445 50
1179 3300047319 Ga0495674_0627840 Ga0495674_0627840_645_797 50
1180 3300047321 Ga0495676_0414621 Ga0495676_0414621_555_707 50
1181 3300047321 Ga0495676_0624935 Ga0495676_0624935_472_624 50
1182 3300047322 Ga0495680_0000053 Ga0495680_0000053_46164_46316 50
1183 3300047322 Ga0495680_0176291 Ga0495680_0176291_483_635 50
1184 3300047322 Ga0495680_0528785 Ga0495680_0528785_348_500 50
1185 3300047444 Ga0495675_0164407 Ga0495675_0164407_474_626 50
1186 3300047444 Ga0495675_0762373 Ga0495675_0762373_149_301 50
1187 3300047471 Ga0495684_0004775 Ga0495684_0004775_9595_9747 50
1188 3300047471 Ga0495684_0017082 Ga0495684_0017082_1997_2149 50
1189 3300047471 Ga0495684_0064085 Ga0495684_0064085_2390_2542 50
1190 3300047673 Ga0495593_0251714 Ga0495593_0251714_542_694 50
1191 3300048089 Ga0495614_0638168 Ga0495614_0638168_49_201 50
1192 3300048905 Ga0496102_0789570 Ga0496102_0789570_319_471 50
1193 3300048905 Ga0496102_0858763 Ga0496102_0858763_588_740 50
1194 3300048905 Ga0496102_1175772 Ga0496102_1175772_150_302 50
1195 3300048905 Ga0496102_1778335 Ga0496102_1778335_282_434 50
1196 3300048909 Ga0496106_0008099 Ga0496106_0008099_6572_6724 50
1197 3300048911 Ga0496108_0674340 Ga0496108_0674340_561_713 50
1198 3300048912 Ga0496109_0185900 Ga0496109_0185900_1774_1926 50
1199 3300048912 Ga0496109_0557691 Ga0496109_0557691_302_454 50
1200 3300048912 Ga0496109_1539534 Ga0496109_1539534_332_484 50
1201 3300048915 Ga0496112_0847901 Ga0496112_0847901_284_436 50
1202 3300048916 Ga0496113_0601457 Ga0496113_0601457_230_382 50
1203 3300048917 Ga0496114_0313535 Ga0496114_0313535_619_771 50
1204 3300048917 Ga0496114_1319172 Ga0496114_1319172_328_480 50
1205 3300048918 Ga0496115_0258938 Ga0496115_0258938_997_1149 50
1206 3300048920 Ga0496117_0054306 Ga0496117_0054306_685_837 50
1207 3300048921 Ga0496118_0002057 Ga0496118_0002057_6506_6658 50
1208 3300048924 Ga0496121_0000077 Ga0496121_0000077_175453_175605 50
1209 3300048924 Ga0496121_0032758 Ga0496121_0032758_4075_4227 50
1210 3300048924 Ga0496121_0053767 Ga0496121_0053767_806_958 50
1211 3300048927 Ga0496124_0006148 Ga0496124_0006148_12004_12156 50
1212 3300048928 Ga0496125_0044761 Ga0496125_0044761_691_843 50
1213 3300048929 Ga0496126_0009366 Ga0496126_0009366_3294_3446 50
1214 3300048929 Ga0496126_0018937 Ga0496126_0018937_624_776 50
1215 3300048929 Ga0496126_0150968 Ga0496126_0150968_786_938 50
1216 3300048929 Ga0496126_0318929 Ga0496126_0318929_586_738 50
1217 3300048929 Ga0496126_0376505 Ga0496126_0376505_69_221 50
1218 3300049129 Ga0501309_006054 Ga0501309_006054_1252_1404 50
1219 3300049130 Ga0501310_010792 Ga0501310_010792_68_220 50
1220 3300049162 Ga0501307_044908 Ga0501307_044908_234_386 50
1221 3300049569 Ga0501032_0390118 Ga0501032_0390118_530_682 50
1222 3300049570 Ga0501033_0187960 Ga0501033_0187960_754_906 50
1223 3300049570 Ga0501033_0775583 Ga0501033_0775583_218_370 50
1224 3300049571 Ga0501034_0000109 Ga0501034_0000109_41457_41609 50
1225 3300049571 Ga0501034_0001751 Ga0501034_0001751_150_302 50
1226 3300049571 Ga0501034_0053875 Ga0501034_0053875_1883_2035 50
1227 3300049571 Ga0501034_0115699 Ga0501034_0115699_483_635 50
1228 3300049571 Ga0501034_0574374 Ga0501034_0574374_721_873 50
1229 3300049572 Ga0501036_0383455 Ga0501036_0383455_344_496 50
1230 3300049573 Ga0501037_0287677 Ga0501037_0287677_534_686 50
1231 3300049574 Ga0501038_0719954 Ga0501038_0719954_106_258 50
1232 3300049575 Ga0501039_0614442 Ga0501039_0614442_195_347 50
1233 3300049577 Ga0501041_1107385 Ga0501041_1107385_251_403 50
1234 3300049579 Ga0501043_0125279 Ga0501043_0125279_1632_1784 50
1235 3300049580 Ga0501046_0116625 Ga0501046_0116625_908_1060 50
1236 3300049582 Ga0501048_0297614 Ga0501048_0297614_252_404 50
1237 3300049582 Ga0501048_0543739 Ga0501048_0543739_532_684 50
1238 3300049584 Ga0501068_0252362 Ga0501068_0252362_335_487 50
1239 3300049586 Ga0501070_0136672 Ga0501070_0136672_1165_1317 50
1240 3300049586 Ga0501070_0203456 Ga0501070_0203456_1415_1567 50
1241 3300049586 Ga0501070_0685443 Ga0501070_0685443_181_333 50
1242 3300049586 Ga0501070_1237674 Ga0501070_1237674_79_231 50
1243 3300049587 Ga0501071_0577730 Ga0501071_0577730_126_278 50
1244 3300049588 Ga0501072_0307215 Ga0501072_0307215_770_922 50
1245 3300049588 Ga0501072_0601028 Ga0501072_0601028_424_576 50
1246 3300049589 Ga0501073_0223858 Ga0501073_0223858_390_542 50
1247 3300049592 Ga0501076_0297973 Ga0501076_0297973_166_318 50
1248 3300049741 Ga0501079_0865511 Ga0501079_0865511_237_389 50
1249 3300049742 Ga0501080_0299923 Ga0501080_0299923_577_729 50
1250 3300049742 Ga0501080_1068868 Ga0501080_1068868_529_681 50
1251 3300049742 Ga0501080_1204437 Ga0501080_1204437_299_451 50
1252 3300049822 Ga0501035_0889832 Ga0501035_0889832_112_264 50
1253 3300049823 Ga0501044_0235998 Ga0501044_0235998_180_332 50
1254 3300049824 Ga0501045_0359472 Ga0501045_0359472_898_1050 50
1255 3300050489 nmdc:mga03683_132101_c1 nmdc:mga03683_132101_c1_822_974 50
1256 3300050489 nmdc:mga03683_148518_c1 nmdc:mga03683_148518_c1_738_890 50
1257 3300050489 nmdc:mga03683_15481_c1 nmdc:mga03683_15481_c1_1015_1167 50
1258 3300050489 nmdc:mga03683_169568_c1 nmdc:mga03683_169568_c1_572_724 50
1259 3300050489 nmdc:mga03683_1825_c1 nmdc:mga03683_1825_c1_4228_4380 50
1260 3300050489 nmdc:mga03683_22746_c1 nmdc:mga03683_22746_c1_2092_2244 50
1261 3300050489 nmdc:mga03683_32482_c1 nmdc:mga03683_32482_c1_1053_1205 50
1262 3300050489 nmdc:mga03683_32979_c1 nmdc:mga03683_32979_c1_587_739 50
1263 3300050489 nmdc:mga03683_397443_c1 nmdc:mga03683_397443_c1_34_186 50
1264 3300050489 nmdc:mga03683_461697_c1 nmdc:mga03683_461697_c1_226_378 50
1265 3300050489 nmdc:mga03683_76855_c1 nmdc:mga03683_76855_c1_753_905 50
1266 3300050490 nmdc:mga03n38_102713_c1 nmdc:mga03n38_102713_c1_668_820 50
1267 3300050490 nmdc:mga03n38_951783_c1 nmdc:mga03n38_951783_c1_164_316 50
1268 3300050491 nmdc:mga00v17_207477_c1 nmdc:mga00v17_207477_c1_807_959 50
1269 3300050491 nmdc:mga00v17_39264_c1 nmdc:mga00v17_39264_c1_308_460 50
1270 3300050492 nmdc:mga0yw44_129575_c1 nmdc:mga0yw44_129575_c1_1175_1327 50
1271 3300050492 nmdc:mga0yw44_22312_c1 nmdc:mga0yw44_22312_c1_224_376 50
1272 3300050492 nmdc:mga0yw44_38472_c1 nmdc:mga0yw44_38472_c1_2537_2689 50
1273 3300050492 nmdc:mga0yw44_446005_c1 nmdc:mga0yw44_446005_c1_588_740 50
1274 3300050492 nmdc:mga0yw44_467214_c1 nmdc:mga0yw44_467214_c1_178_330 50
1275 3300050492 nmdc:mga0yw44_730278_c1 nmdc:mga0yw44_730278_c1_34_186 50
1276 3300050493 nmdc:mga0k408_107710_c1 nmdc:mga0k408_107710_c1_897_1049 50
1277 3300050493 nmdc:mga0k408_162678_c1 nmdc:mga0k408_162678_c1_848_1000 50
1278 3300050493 nmdc:mga0k408_343354_c1 nmdc:mga0k408_343354_c1_534_686 50
1279 3300050493 nmdc:mga0k408_5567_c1 nmdc:mga0k408_5567_c1_5184_5336 50
1280 3300050493 nmdc:mga0k408_609334_c1 nmdc:mga0k408_609334_c1_224_376 50
1281 3300050494 nmdc:mga06z11_101549_c1 nmdc:mga06z11_101549_c1_511_663 50
1282 3300050494 nmdc:mga06z11_127247_c1 nmdc:mga06z11_127247_c1_48_200 50
1283 3300050494 nmdc:mga06z11_174175_c1 nmdc:mga06z11_174175_c1_31_183 50
1284 3300050494 nmdc:mga06z11_261579_c1 nmdc:mga06z11_261579_c1_829_981 50
1285 3300050494 nmdc:mga06z11_305409_c1 nmdc:mga06z11_305409_c1_742_894 50
1286 3300050494 nmdc:mga06z11_358863_c1 nmdc:mga06z11_358863_c1_244_396 50
1287 3300050494 nmdc:mga06z11_43471_c1 nmdc:mga06z11_43471_c1_1996_2148 50
1288 3300050494 nmdc:mga06z11_5646_c1 nmdc:mga06z11_5646_c1_4238_4390 50
1289 3300050495 nmdc:mga04h51_136829_c1 nmdc:mga04h51_136829_c1_761_913 50
1290 3300050496 nmdc:mga07m45_367567_c1 nmdc:mga07m45_367567_c1_82_234 50
1291 3300050496 nmdc:mga07m45_402050_c1 nmdc:mga07m45_402050_c1_573_725 50
1292 3300050496 nmdc:mga07m45_56464_c1 nmdc:mga07m45_56464_c1_1879_2031 50
1293 3300050496 nmdc:mga07m45_760326_c1 nmdc:mga07m45_760326_c1_55_207 50
1294 3300050496 nmdc:mga07m45_803591_c1 nmdc:mga07m45_803591_c1_310_462 50
1295 3300050507 nmdc:mga05p37_733444_c1 nmdc:mga05p37_733444_c1_440_592 50
1296 3300050508 nmdc:mga09592_1156863_c1 nmdc:mga09592_1156863_c1_223_375 50
1297 3300050509 nmdc:mga0qj67_606036_c1 nmdc:mga0qj67_606036_c1_460_612 50
1298 3300050511 nmdc:mga08y16_122656_c1 nmdc:mga08y16_122656_c1_1700_1852 50
1299 3300050511 nmdc:mga08y16_245174_c1 nmdc:mga08y16_245174_c1_1563_1715 50
1300 3300050511 nmdc:mga08y16_295626_c1 nmdc:mga08y16_295626_c1_1508_1660 50
1301 3300050511 nmdc:mga08y16_996516_c1 nmdc:mga08y16_996516_c1_622_774 50
1302 3300050512 nmdc:mga0n895_17745_c1 nmdc:mga0n895_17745_c1_2868_3020 50
1303 3300050512 nmdc:mga0n895_329968_c1 nmdc:mga0n895_329968_c1_1368_1520 50
1304 3300050512 nmdc:mga0n895_64973_c1 nmdc:mga0n895_64973_c1_750_902 50
1305 3300050514 nmdc:mga08x19_175174_c1 nmdc:mga08x19_175174_c1_300_452 50
1306 3300050514 nmdc:mga08x19_463128_c1 nmdc:mga08x19_463128_c1_395_547 50
1307 3300050515 nmdc:mga0a205_678075_c1 nmdc:mga0a205_678075_c1_370_522 50
1308 3300050515 nmdc:mga0a205_72159_c1 nmdc:mga0a205_72159_c1_815_967 50
1309 3300050515 nmdc:mga0a205_803235_c1 nmdc:mga0a205_803235_c1_601_753 50
1310 3300050516 nmdc:mga0sz30_239_c1 nmdc:mga0sz30_239_c1_9067_9219 50
1311 3300050516 nmdc:mga0sz30_36367_c1 nmdc:mga0sz30_36367_c1_105_257 50
1312 3300050516 nmdc:mga0sz30_424010_c1 nmdc:mga0sz30_424010_c1_426_578 50
1313 3300050516 nmdc:mga0sz30_486680_c1 nmdc:mga0sz30_486680_c1_12_164 50
1314 3300050516 nmdc:mga0sz30_5231_c1 nmdc:mga0sz30_5231_c1_190_342 50
1315 3300053077 Ga0495601_0084629 Ga0495601_0084629_1409_1561 50
1316 3300053077 Ga0495601_0236563 Ga0495601_0236563_620_772 50
1317 3300053077 Ga0495601_0284716 Ga0495601_0284716_543_695 50
1318 3300053077 Ga0495601_0347852 Ga0495601_0347852_596_748 50
1319 3300053077 Ga0495601_0470982 Ga0495601_0470982_479_631 50
1320 3300053078 Ga0495612_0045922 Ga0495612_0045922_1323_1475 50
1321 3300053078 Ga0495612_0147855 Ga0495612_0147855_13_165 50
1322 3300053079 Ga0500610_0230325 Ga0500610_0230325_322_474 50
1323 3300053080 Ga0500635_0003286 Ga0500635_0003286_2263_2415 50
1324 3300053083 Ga0495655_0066366 Ga0495655_0066366_241_393 50
1325 3300053084 Ga0495595_0652117 Ga0495595_0652117_244_396 50
1326 3300053085 Ga0495619_0112948 Ga0495619_0112948_1256_1408 50
1327 3300053085 Ga0495619_0229266 Ga0495619_0229266_356_508 50
1328 3300053087 Ga0500643_019179 Ga0500643_019179_318_470 50
1329 3300053087 Ga0500643_157092 Ga0500643_157092_203_355 50
1330 3300053088 Ga0500644_0007897 Ga0500644_0007897_1990_2142 50
1331 3300053091 Ga0500647_0234975 Ga0500647_0234975_205_357 50
1332 3300053092 Ga0500583_0480932 Ga0500583_0480932_210_362 50
1333 3300053092 Ga0500583_0508775 Ga0500583_0508775_385_537 50
1334 3300053093 Ga0500651_0016352 Ga0500651_0016352_3845_3997 50
1335 3300053093 Ga0500651_0731053 Ga0500651_0731053_348_500 50
1336 3300053094 Ga0500566_0071146 Ga0500566_0071146_1192_1344 50
1337 3300053094 Ga0500566_0191433 Ga0500566_0191433_409_561 50
1338 3300053096 Ga0500641_0000244 Ga0500641_0000244_10115_10267 50
1339 3300053103 Ga0500555_078586 Ga0500555_078586_248_400 50
1340 3300053105 Ga0500557_123515 Ga0500557_123515_224_376 50
1341 3300053106 Ga0500558_162861 Ga0500558_162861_604_756 50
1342 3300053119 Ga0500595_027620 Ga0500595_027620_1541_1693 50
1343 3300053119 Ga0500595_071275 Ga0500595_071275_662_814 50
1344 3300053119 Ga0500595_159895 Ga0500595_159895_416_568 50
1345 3300053120 Ga0500597_244030 Ga0500597_244030_315_467 50
1346 3300053123 Ga0500614_066050 Ga0500614_066050_695_847 50
1347 3300053130 Ga0500642_0126365 Ga0500642_0126365_305_457 50
1348 3300053130 Ga0500642_0143929 Ga0500642_0143929_762_914 50
1349 3300053131 Ga0500652_216897 Ga0500652_216897_178_330 50
1350 3300053136 Ga0500559_0104030 Ga0500559_0104030_864_1016 50
1351 3300053142 Ga0500577_0218436 Ga0500577_0218436_463_615 50
1352 3300053146 Ga0500588_0175088 Ga0500588_0175088_34_186 50
1353 3300053148 Ga0500590_080916 Ga0500590_080916_151_303 50
1354 3300053148 Ga0500590_179822 Ga0500590_179822_266_418 50
1355 3300053148 Ga0500590_258878 Ga0500590_258878_342_494 50
1356 3300053150 Ga0500603_018179 Ga0500603_018179_1126_1278 50
1357 3300053153 Ga0500616_0000925 Ga0500616_0000925_7927_8079 50
1358 3300053155 Ga0500620_019185 Ga0500620_019185_1748_1900 50
1359 3300053158 Ga0500627_0155211 Ga0500627_0155211_768_920 50
1360 3300053162 Ga0500638_285809 Ga0500638_285809_453_605 50
1361 3300053163 Ga0500639_253271 Ga0500639_253271_513_665 50
1362 3300053177 Ga0500636_0086777 Ga0500636_0086777_1496_1648 50
1363 3300053728 Ga0500657_128973 Ga0500657_128973_459_611 50
1364 3300053731 Ga0500609_025225 Ga0500609_025225_416_568 50
1365 3300053733 Ga0500552_007586 Ga0500552_007586_845_997 50
1366 3300053733 Ga0500552_018616 Ga0500552_018616_148_300 50
1367 3300053735 Ga0500596_005014 Ga0500596_005014_322_474 50
1368 3300059626 Ga0587115_033509 Ga0587115_033509_594_746 50
1369 3300059640 Ga0587067_231921 Ga0587067_231921_292_444 50
1370 3300060353 Ga0501082_1064267 Ga0501082_1064267_418_570 50
1371 3300061734 Ga0530510_0221050 Ga0530510_0221050_710_862 50
1372 3300061734 Ga0530510_0974321 Ga0530510_0974321_281_433 50
1373 3300042876 Ga0451577_0000001 Ga0451577_0000001_1072785_1072940 51
1374 3300001990 JGI24737J22298_10019519 JGI24737J22298_100195193 52
1375 3300005327 Ga0070658_10006980 Ga0070658_100069808 52
1376 3300005329 Ga0070683_100035249 Ga0070683_1000352494 52
1377 3300005329 Ga0070683_100066371 Ga0070683_1000663713 52
1378 3300005329 Ga0070683_100803745 Ga0070683_1008037452 52
1379 3300005331 Ga0070670_100440685 Ga0070670_1004406853 52
1380 3300005336 Ga0070680_101713781 Ga0070680_1017137812 52
1381 3300005337 Ga0070682_100094786 Ga0070682_1000947862 52
1382 3300005338 Ga0068868_102038785 Ga0068868_1020387852 52
1383 3300005338 Ga0068868_102378353 Ga0068868_1023783532 52
1384 3300005339 Ga0070660_100103462 Ga0070660_1001034623 52
1385 3300005344 Ga0070661_100056480 Ga0070661_1000564803 52
1386 3300005345 Ga0070692_10100582 Ga0070692_101005823 52
1387 3300005347 Ga0070668_100120941 Ga0070668_1001209413 52
1388 3300005353 Ga0070669_101569385 Ga0070669_1015693852 52
1389 3300005355 Ga0070671_100628595 Ga0070671_1006285952 52
1390 3300005356 Ga0070674_100290609 Ga0070674_1002906092 52
1391 3300005366 Ga0070659_100110611 Ga0070659_1001106113 52
1392 3300005367 Ga0070667_100031455 Ga0070667_1000314555 52
1393 3300005367 Ga0070667_100263592 Ga0070667_1002635922 52
1394 3300005457 Ga0070662_100161909 Ga0070662_1001619093 52
1395 3300005459 Ga0068867_100086826 Ga0068867_1000868263 52
1396 3300005530 Ga0070679_101304261 Ga0070679_1013042612 52
1397 3300005535 Ga0070684_100012697 Ga0070684_1000126976 52
1398 3300005535 Ga0070684_100029010 Ga0070684_1000290103 52
1399 3300005539 Ga0068853_100301289 Ga0068853_1003012892 52
1400 3300005543 Ga0070672_100334253 Ga0070672_1003342532 52
1401 3300005543 Ga0070672_100538371 Ga0070672_1005383712 52
1402 3300005564 Ga0070664_100064589 Ga0070664_1000645892 52
1403 3300005564 Ga0070664_100090167 Ga0070664_1000901673 52
1404 3300005564 Ga0070664_100375151 Ga0070664_1003751512 52
1405 3300005577 Ga0068857_100041668 Ga0068857_1000416682 52
1406 3300005614 Ga0068856_102147685 Ga0068856_1021476852 52
1407 3300005615 Ga0070702_100485335 Ga0070702_1004853352 52
1408 3300005616 Ga0068852_100032353 Ga0068852_1000323534 52
1409 3300005616 Ga0068852_100422225 Ga0068852_1004222253 52
1410 3300005618 Ga0068864_100042879 Ga0068864_1000428794 52
1411 3300005718 Ga0068866_10295868 Ga0068866_102958682 52
1412 3300005719 Ga0068861_100749385 Ga0068861_1007493851 52
1413 3300005834 Ga0068851_10234929 Ga0068851_102349292 52
1414 3300005841 Ga0068863_100302684 Ga0068863_1003026842 52
1415 3300005842 Ga0068858_100992624 Ga0068858_1009926243 52
1416 3300005842 Ga0068858_101085492 Ga0068858_1010854922 52
1417 3300005843 Ga0068860_101365343 Ga0068860_1013653432 52
1418 3300006871 Ga0075434_100870128 Ga0075434_1008701282 52
1419 3300009098 Ga0105245_13258386 Ga0105245_132583861 52
1420 3300009177 Ga0105248_10049520 Ga0105248_100495204 52
1421 3300025315 Ga0207697_10113298 Ga0207697_101132982 52
1422 3300025321 Ga0207656_10080629 Ga0207656_100806292 52
1423 3300025321 Ga0207656_10269096 Ga0207656_102690962 52
1424 3300025899 Ga0207642_10030849 Ga0207642_100308493 52
1425 3300025907 Ga0207645_10074238 Ga0207645_100742381 52
1426 3300025909 Ga0207705_10087806 Ga0207705_100878063 52
1427 3300025912 Ga0207707_11525684 Ga0207707_115256842 52
1428 3300025919 Ga0207657_10381680 Ga0207657_103816803 52
1429 3300025920 Ga0207649_10143932 Ga0207649_101439323 52
1430 3300025921 Ga0207652_10223971 Ga0207652_102239713 52
1431 3300025925 Ga0207650_10160698 Ga0207650_101606983 52
1432 3300025925 Ga0207650_10382323 Ga0207650_103823233 52
1433 3300025931 Ga0207644_10881724 Ga0207644_108817242 52
1434 3300025932 Ga0207690_10019600 Ga0207690_100196002 52
1435 3300025933 Ga0207706_10047908 Ga0207706_100479084 52
1436 3300025934 Ga0207686_10230613 Ga0207686_102306132 52
1437 3300025935 Ga0207709_10506401 Ga0207709_105064012 52
1438 3300025937 Ga0207669_10253231 Ga0207669_102532312 52
1439 3300025940 Ga0207691_10022379 Ga0207691_100223793 52
1440 3300025941 Ga0207711_10243288 Ga0207711_102432883 52
1441 3300025944 Ga0207661_10012723 Ga0207661_100127233 52
1442 3300025944 Ga0207661_10164372 Ga0207661_101643722 52
1443 3300025944 Ga0207661_10490613 Ga0207661_104906132 52
1444 3300025945 Ga0207679_10034445 Ga0207679_100344453 52
1445 3300025945 Ga0207679_10244466 Ga0207679_102444663 52
1446 3300025945 Ga0207679_10695184 Ga0207679_106951842 52
1447 3300025972 Ga0207668_11229596 Ga0207668_112295962 52
1448 3300025981 Ga0207640_10404867 Ga0207640_104048673 52
1449 3300026023 Ga0207677_11645097 Ga0207677_116450972 52
1450 3300026035 Ga0207703_10495105 Ga0207703_104951053 52
1451 3300026041 Ga0207639_10156367 Ga0207639_101563672 52
1452 3300026067 Ga0207678_11015145 Ga0207678_110151452 52
1453 3300026078 Ga0207702_12170194 Ga0207702_121701942 52
1454 3300026089 Ga0207648_10384967 Ga0207648_103849672 52
1455 3300026116 Ga0207674_10003778 Ga0207674_100037786 52
1456 3300026142 Ga0207698_10018429 Ga0207698_100184294 52
1457 3300046536 Ga0495587_0454348 Ga0495587_0454348_510_668 52
1458 3300047317 Ga0495604_0047067 Ga0495604_0047067_1541_1699 52
1459 3300048904 Ga0496101_0719796 Ga0496101_0719796_51_209 52
1460 3300048912 Ga0496109_0500653 Ga0496109_0500653_256_414 52
1461 3300048914 Ga0496111_0876394 Ga0496111_0876394_123_281 52
1462 3300048915 Ga0496112_0478293 Ga0496112_0478293_831_989 52
1463 3300049741 Ga0501079_0411430 Ga0501079_0411430_651_809 52
1464 3300049824 Ga0501045_0419115 Ga0501045_0419115_122_280 52
1465 3300050512 nmdc:mga0n895_1346942_c1 nmdc:mga0n895_1346942_c1_190_348 52

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19451

DUF5989

Family of unknown function (DUF5989)

2

48

0.98

Feature Viewer

pLDDT pTM Quality
78.47 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map