F494136

General Info

Members Datasets Scaffolds Average Seq Length
1462 669 1333 206

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0039383|Ga0373925_0039383_2444_3118
Length 224
Sequence MRPGRTFGTSTKTVNTENDNVTKRAESKYKIDRRLQVNLWGRPKSPYNDREYGPGQHGQRRRKPTEYGTQLMAKQRLKGYYGNIGERQFRKIYEEAARRRGDTGENLVGLLERRLDTVVYRAKFVSTVFAARQFVNHGHIRVNGKRVNVSSYQLKDNDVVELREKSRELAVVLEAVGSGERDVPGYIDADHKKMRAVFLRAPALSDVPYPVQMNPSMVVEFYSR

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2534681786 Brucella suis 92/29 Isolate Unclassified
11 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
12 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
13 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
14 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
15 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
16 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
17 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
18 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
19 2643221584 Caulobacter sp. Root656 Isolate Unclassified
20 2643221640 Caulobacter sp. Root342 Isolate Unclassified
21 2643221642 Caulobacter sp. Root343 Isolate Unclassified
22 2643221651 Afipia sp. Root123D2 Isolate Unclassified
23 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
26 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
27 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
28 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
29 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
30 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
31 2751185800 Brucella pituitosa AA2 Isolate Unclassified
32 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
33 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
34 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355199
37 2818991435 Caulobacter henricii 536 Isolate Unclassified
38 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
39 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
40 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
41 2849560528 Caulobacter zeae 410 Isolate Unclassified
42 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
43 2851153111 Caulobacter radicis 736 Isolate Unclassified
44 2854911287 Brucella lupini LUP21 Isolate Unclassified
45 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
46 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
47 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
48 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
49 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
50 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
51 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
52 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
53 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
54 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
55 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
56 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
57 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
58 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
59 2902330777 Methylobacterium sp. 2A Isolate Unclassified
60 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
61 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
62 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
63 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
64 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
65 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
66 2904699407
67 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
68 2906610324
69 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
70 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
71 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
72 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
73 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
74 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
75 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
76 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
77 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
78 2922425934
79 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
80 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
81 2932401849 Devosia sp. 2618 Isolate Rhizosphere
82 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
83 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
84 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
85 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
86 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
87 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
88 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
89 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
90 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
91 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
92 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
93 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
94 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
95 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
96 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
97 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
98 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
99 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
100 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
101 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
102 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
103 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
104 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
105 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
107 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
108 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
109 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
110 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
111 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
112 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
113 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
114 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
116 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
117 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
118 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
119 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
120 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
121 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
122 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
123 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
124 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
125 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
126 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
127 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
128 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
129 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
130 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
131 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
132 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
133 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
134 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
135 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
136 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
137 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
138 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
139 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
140 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
141 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
142 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
143 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
144 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
145 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
146 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
147 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
148 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
149 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
150 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
151 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
152 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
153 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
154 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
157 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
158 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
159 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
160 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
161 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
162 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
163 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
164 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
165 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
166 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
167 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
168 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
169 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
170 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
171 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
172 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
173 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
174 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
175 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
176 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
177 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
178 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
179 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
180 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
181 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
182 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
183 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
184 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
185 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
186 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
187 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
188 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
189 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
190 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
191 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
192 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
193 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
194 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
195 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
196 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
197 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
198 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
199 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
200 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
201 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
202 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
204 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
205 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
206 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
207 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
208 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
209 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
210 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
211 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
212 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
213 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
214 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
215 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
216 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
217 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
218 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
219 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
220 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
221 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
222 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
223 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
225 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
226 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
227 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
228 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
229 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
231 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
235 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
236 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
239 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
303 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
305 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
306 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
310 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
311 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
312 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
313 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
314 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
315 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
316 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
317 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
319 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
320 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
321 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
322 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
323 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
324 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
325 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
326 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
327 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
328 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
329 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
330 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
331 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
332 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
333 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
334 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
335 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
336 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
337 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
338 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
339 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
340 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
341 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
342 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
343 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
344 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
345 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
346 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
347 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
348 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
349 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
350 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
351 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
352 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
353 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
354 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
355 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
356 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
357 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
358 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
359 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
360 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
361 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
362 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
363 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
364 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
365 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
366 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
367 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
368 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
369 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
370 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
371 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
372 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
373 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
374 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
375 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
376 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
377 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
378 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
379 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
380 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
381 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
382 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
383 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
384 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
385 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
386 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
387 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
388 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
389 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
390 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
391 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
392 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
393 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
394 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
395 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
396 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
397 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
398 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
399 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
400 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
401 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
402 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
403 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
404 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
405 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
406 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
407 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
408 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
409 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
410 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
411 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
412 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
413 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
414 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
415 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
416 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
417 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
418 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
419 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
420 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
421 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
422 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
423 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
424 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
425 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
426 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
427 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
428 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
429 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
430 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
431 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
432 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
433 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
434 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
435 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
436 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
437 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
438 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
439 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
440 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
441 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
442 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
443 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
444 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
445 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
446 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
447 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
448 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
449 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
450 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
451 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
452 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
453 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
454 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
455 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
458 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
459 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
460 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
461 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
462 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
463 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
464 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
465 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
466 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
467 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
468 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
469 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
470 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
471 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
472 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
473 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
474 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
475 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
476 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
477 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
478 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
479 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
480 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
481 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
482 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
483 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
484 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
485 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
486 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
487 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
488 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
489 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
490 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
491 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
492 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
493 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
494 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
495 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
496 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
497 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
498 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
499 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
500 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
501 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
502 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
503 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
504 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
505 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
506 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
507 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
508 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
509 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
510 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
511 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
512 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
513 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
514 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
515 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
516 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
517 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
518 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
519 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
527 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
531 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
532 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
533 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
534 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
536 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
537 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
540 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
541 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
542 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
543 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
544 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
545 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
546 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
547 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
548 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
549 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
550 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
551 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
552 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
553 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
554 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
555 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
556 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
558 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
559 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
560 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
561 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
562 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
563 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
564 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
565 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
566 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
567 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
568 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
569 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
570 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
571 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
572 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
573 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
574 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
575 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
576 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
577 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
578 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
579 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
580 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
581 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
582 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
583 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
584 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
585 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
586 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
587 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
588 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
589 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
590 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
591 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
592 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
593 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
594 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
595 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
596 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
597 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
598 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
599 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
600 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
601 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
602 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
603 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
604 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
605 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
606 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
607 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
608 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
609 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
610 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
611 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
612 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
613 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
614 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
615 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
616 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
617 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
618 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
619 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
620 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
621 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
622 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
623 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
624 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
625 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
626 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
627 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
628 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
629 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
630 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
631 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
632 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
633 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
634 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
640 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
641 641522639 Methylobacterium sp. 4-46 Isolate Nodule
642 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
643 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
644 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
645 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
646 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
647 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
648 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
649 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
650 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
651 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
652 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
653 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
654 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
655 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
656 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
657 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
658 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
659 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
660 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
661 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
662 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
663 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
664 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
665 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
666 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
667 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
668 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
669 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.57
Metatranscriptomes 1.85
Isolates 8.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 4.65
Rhizoplane 4.04
Rhizosphere 69.97
Stem 0
Stem Tuber 0
Unclassified 10.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1004380 3300000531 Bacteria 798
2 JGI24739J22299_10120830 3300001989 Bacteria 782
3 JGI24735J21928_10014695 3300002067 Bacteria 2451
4 JGI24738J21930_10071137 3300002075 Bacteria 721
5 JGI25406J46586_10000101 3300003203 Bacteria 38086
6 Ga0055526_1028152 3300003771 Bacteria 1709
7 Ga0055537_1001423 3300003773 Bacteria 9378
8 Ga0055524_1005289 3300003775 Bacteria 5795
9 Ga0055524_1033973 3300003775 Bacteria 1418
10 Ga0055536_1011111 3300003781 Bacteria 3496
11 Ga0055528_1004840 3300003790 Bacteria 6399
12 Ga0055530_10002837 3300003791 Bacteria 10598
13 Ga0055530_10023172 3300003791 Bacteria 1790
14 Ga0055531_10001240 3300003794 Bacteria 19383
15 Ga0055531_10002429 3300003794 Bacteria 12473
16 Ga0055531_10004719 3300003794 Bacteria 8152
17 Ga0055531_10024439 3300003794 Bacteria 2229
18 Ga0055543_1018162 3300004625 Bacteria 1315
19 Ga0058862_12854699 3300004803 Bacteria 748
20 Ga0065165_1000041 3300005262 Bacteria 203876
21 Ga0065165_1000633 3300005262 Bacteria 50986
22 Ga0065712_10253498 3300005290 Bacteria 938
23 Ga0070658_10106345 3300005327 Bacteria 2321
24 Ga0070658_10144361 3300005327 Bacteria 1989
25 Ga0070658_10561700 3300005327 Bacteria 988
26 Ga0070683_100072208 3300005329 Bacteria 3221
27 Ga0070683_100499675 3300005329 Bacteria 1162
28 Ga0070670_100000101 3300005331 Bacteria 79628
29 Ga0070670_100587604 3300005331 Bacteria 996
30 Ga0070666_10067482 3300005335 Bacteria 2429
31 Ga0070666_10091155 3300005335 Bacteria 2094
32 Ga0070680_100009670 3300005336 Bacteria 7417
33 Ga0070680_100010206 3300005336 Bacteria 7240
34 Ga0070680_100116799 3300005336 Bacteria 2224
35 Ga0068868_100069182 3300005338 Bacteria 2813
36 Ga0070660_100010739 3300005339 Bacteria 6482
37 Ga0070660_100015321 3300005339 Bacteria 5533
38 Ga0070660_100069935 3300005339 Bacteria 2738
39 Ga0070660_100088007 3300005339 Bacteria 2445
40 Ga0070689_100370609 3300005340 Bacteria 1205
41 Ga0070691_10010631 3300005341 Bacteria 4202
42 Ga0070691_10044810 3300005341 Bacteria 2098
43 Ga0070661_100205100 3300005344 Bacteria 1508
44 Ga0070668_100002639 3300005347 Bacteria 13171
45 Ga0070668_100002804 3300005347 Bacteria 12824
46 Ga0070668_100006876 3300005347 Bacteria 8431
47 Ga0070668_100010442 3300005347 Bacteria 6900
48 Ga0070668_100024530 3300005347 Bacteria 4570
49 Ga0070668_100031453 3300005347 Bacteria 4038
50 Ga0070669_100299233 3300005353 Bacteria 1293
51 Ga0070669_100945213 3300005353 Bacteria 738
52 Ga0070671_100010347 3300005355 Bacteria 7483
53 Ga0070674_100082069 3300005356 Bacteria 2305
54 Ga0070673_100294288 3300005364 Bacteria 1427
55 Ga0070659_100007601 3300005366 Bacteria 7878
56 Ga0070659_100105258 3300005366 Bacteria 2273
57 Ga0070659_100118253 3300005366 Bacteria 2144
58 Ga0070667_100000260 3300005367 Bacteria 60154
59 Ga0070667_100061934 3300005367 Bacteria 3169
60 Ga0070667_100415627 3300005367 Bacteria 1226
61 Ga0070714_100010680 3300005435 Bacteria 7266
62 Ga0070714_100027346 3300005435 Bacteria 4722
63 Ga0070713_100014590 3300005436 Bacteria 5843
64 Ga0070713_100183121 3300005436 Bacteria 1883
65 Ga0070710_10008646 3300005437 Bacteria 4960
66 Ga0070711_100022451 3300005439 Bacteria 4091
67 Ga0070711_100072618 3300005439 Bacteria 2428
68 Ga0070711_100342020 3300005439 Bacteria 1201
69 Ga0070663_100033825 3300005455 Bacteria 3534
70 Ga0070663_100702779 3300005455 Bacteria 859
71 Ga0070678_100218620 3300005456 Bacteria 1583
72 Ga0070662_100343500 3300005457 Bacteria 1222
73 Ga0070681_10009749 3300005458 Bacteria 9452
74 Ga0070681_10020222 3300005458 Bacteria 6673
75 Ga0070681_10041919 3300005458 Bacteria 4588
76 Ga0070681_10089343 3300005458 Bacteria 3032
77 Ga0070681_10099566 3300005458 Bacteria 2852
78 Ga0070681_10441312 3300005458 Bacteria 1214
79 Ga0070681_11059156 3300005458 Bacteria 731
80 Ga0070685_10313071 3300005466 Bacteria 1061
81 Ga0070706_100282188 3300005467 Bacteria 1550
82 Ga0070706_100320492 3300005467 Bacteria 1445
83 Ga0070706_100557247 3300005467 Bacteria 1066
84 Ga0070707_100926281 3300005468 Bacteria 836
85 Ga0070698_100117512 3300005471 Bacteria 2621
86 Ga0070699_100130782 3300005518 Bacteria 2212
87 Ga0070679_100042441 3300005530 Bacteria 4529
88 Ga0070679_100046034 3300005530 Bacteria 4347
89 Ga0070679_100215694 3300005530 Bacteria 1881
90 Ga0070679_100267662 3300005530 Bacteria 1664
91 Ga0070684_100067429 3300005535 Bacteria 3143
92 Ga0070684_100806656 3300005535 Bacteria 878
93 Ga0070697_100013902 3300005536 Bacteria 6318
94 Ga0070697_100231132 3300005536 Bacteria 1578
95 Ga0068853_100057282 3300005539 Bacteria 3363
96 Ga0068853_100310092 3300005539 Bacteria 1460
97 Ga0068853_100481855 3300005539 Bacteria 1169
98 Ga0068853_101570104 3300005539 Bacteria 637
99 Ga0070672_100205918 3300005543 Bacteria 1646
100 Ga0070686_100245897 3300005544 Bacteria 1304
101 Ga0070695_100364240 3300005545 Bacteria 1086
102 Ga0070696_100169497 3300005546 Bacteria 1613
103 Ga0070696_100171209 3300005546 Bacteria 1605
104 Ga0070696_100490905 3300005546 Bacteria 975
105 Ga0070696_100499431 3300005546 Bacteria 967
106 Ga0070665_100000397 3300005548 Bacteria 64128
107 Ga0070665_100000880 3300005548 Bacteria 38536
108 Ga0070665_100002230 3300005548 Bacteria 21591
109 Ga0070665_100069160 3300005548 Bacteria 3539
110 Ga0070665_100502518 3300005548 Bacteria 1224
111 Ga0068855_100015616 3300005563 Bacteria 9137
112 Ga0068855_100018740 3300005563 Bacteria 8322
113 Ga0068855_100039947 3300005563 Bacteria 5569
114 Ga0068855_100123883 3300005563 Bacteria 2956
115 Ga0068855_100167450 3300005563 Bacteria 2490
116 Ga0068855_100271020 3300005563 Bacteria 1887
117 Ga0068855_100442475 3300005563 Bacteria 1419
118 Ga0070664_100033202 3300005564 Bacteria 4320
119 Ga0070664_100084582 3300005564 Bacteria 2739
120 Ga0068857_100026104 3300005577 Bacteria 5146
121 Ga0068857_100116325 3300005577 Bacteria 2405
122 Ga0068856_100134140 3300005614 Bacteria 2481
123 Ga0068856_100372226 3300005614 Bacteria 1447
124 Ga0070702_100267382 3300005615 Bacteria 1167
125 Ga0068852_100130708 3300005616 Bacteria 2312
126 Ga0068852_100135812 3300005616 Bacteria 2271
127 Ga0068852_100215372 3300005616 Bacteria 1824
128 Ga0068852_100559513 3300005616 Bacteria 1145
129 Ga0068852_100682386 3300005616 Bacteria 1036
130 Ga0068859_100000437 3300005617 Bacteria 41851
131 Ga0068859_100016312 3300005617 Bacteria 7462
132 Ga0068859_100304730 3300005617 Bacteria 1686
133 Ga0068864_100000496 3300005618 Bacteria 33880
134 Ga0068864_100000701 3300005618 Bacteria 28115
135 Ga0068864_100098794 3300005618 Bacteria 2586
136 Ga0068864_100107862 3300005618 Bacteria 2477
137 Ga0068861_100124429 3300005719 Bacteria 2084
138 Ga0068851_10207230 3300005834 Bacteria 1097
139 Ga0068863_100000864 3300005841 Bacteria 30310
140 Ga0068863_100001649 3300005841 Bacteria 22078
141 Ga0068863_100006085 3300005841 Bacteria 11837
142 Ga0068863_100009904 3300005841 Bacteria 9281
143 Ga0068863_100060517 3300005841 Bacteria 3581
144 Ga0068863_100113685 3300005841 Bacteria 2579
145 Ga0068863_100465067 3300005841 Bacteria 1242
146 Ga0068863_100482290 3300005841 Bacteria 1219
147 Ga0068863_100935709 3300005841 Bacteria 868
148 Ga0068858_100000557 3300005842 Bacteria 38867
149 Ga0068860_100000070 3300005843 Bacteria 178676
150 Ga0068860_100000309 3300005843 Bacteria 67252
151 Ga0068862_100001520 3300005844 Bacteria 21267
152 Ga0068862_100056514 3300005844 Bacteria 3362
153 Ga0068862_100205590 3300005844 Bacteria 1777
154 Ga0068862_100345741 3300005844 Bacteria 1379
155 Ga0081455_10002423 3300005937 Bacteria 22248
156 Ga0081455_10010819 3300005937 Bacteria 9218
157 Ga0081538_10003068 3300005981 Bacteria 15895
158 Ga0081538_10022376 3300005981 Bacteria 4580
159 Ga0081538_10043188 3300005981 Bacteria 2834
160 Ga0081540_1019810 3300005983 Bacteria 4072
161 Ga0081540_1035967 3300005983 Bacteria 2648
162 Ga0081539_10000008 3300005985 Bacteria 525071
163 Ga0081539_10014085 3300005985 Bacteria 5950
164 Ga0070717_10016637 3300006028 Bacteria 5707
165 Ga0070717_10070743 3300006028 Bacteria 2908
166 Ga0075365_10093296 3300006038 Bacteria 2053
167 Ga0075368_10176869 3300006042 Bacteria 898
168 Ga0075363_100124774 3300006048 Bacteria 1440
169 Ga0075364_10046198 3300006051 Bacteria 2835
170 Ga0075364_10370723 3300006051 Bacteria 976
171 Ga0070715_10000358 3300006163 Bacteria 11380
172 Ga0070715_10210497 3300006163 Bacteria 993
173 Ga0070716_100006533 3300006173 Bacteria 5699
174 Ga0070716_100242252 3300006173 Bacteria 1223
175 Ga0070712_100208013 3300006175 Bacteria 1541
176 Ga0075362_10037486 3300006177 Bacteria 2125
177 Ga0075367_10057233 3300006178 Bacteria 2318
178 Ga0075369_10076845 3300006186 Bacteria 1476
179 Ga0075369_10081048 3300006186 Bacteria 1439
180 Ga0075369_10163808 3300006186 Bacteria 1019
181 Ga0075366_10013172 3300006195 Bacteria 4702
182 Ga0075370_10069769 3300006353 Bacteria 2009
183 Ga0068871_100358309 3300006358 Bacteria 1291
184 Ga0068871_100804409 3300006358 Bacteria 867
185 Ga0075428_100000612 3300006844 Bacteria 36453
186 Ga0075428_100006199 3300006844 Bacteria 13302
187 Ga0075428_100074390 3300006844 Bacteria 3711
188 Ga0075428_100217357 3300006844 Bacteria 2064
189 Ga0075430_100000371 3300006846 Bacteria 32893
190 Ga0075430_100007366 3300006846 Bacteria 9295
191 Ga0075430_100636539 3300006846 Bacteria 880
192 Ga0075431_100000784 3300006847 Bacteria 27686
193 Ga0075431_100044588 3300006847 Bacteria 4574
194 Ga0075431_100120241 3300006847 Bacteria 2710
195 Ga0075431_100456694 3300006847 Bacteria 1272
196 Ga0075429_100001166 3300006880 Bacteria 21212
197 Ga0075429_100003441 3300006880 Bacteria 13509
198 Ga0075429_100115656 3300006880 Bacteria 2345
199 Ga0075429_100675920 3300006880 Bacteria 905
200 Ga0068865_100004894 3300006881 Bacteria 8094
201 Ga0097620_100000437 3300006931 Bacteria 41851
202 Ga0097620_100016312 3300006931 Bacteria 7462
203 Ga0097620_100304730 3300006931 Bacteria 1686
204 Ga0075435_100248266 3300007076 Bacteria 1515
205 Ga0099794_10226604 3300007265 Bacteria 961
206 Ga0099795_10014016 3300007788 Bacteria 2475
207 Ga0105244_10097418 3300009036 Bacteria 1441
208 Ga0105250_10057097 3300009092 Bacteria 1566
209 Ga0105240_10000870 3300009093 Bacteria 54448
210 Ga0105240_10027333 3300009093 Bacteria 7470
211 Ga0105240_10040364 3300009093 Bacteria 5970
212 Ga0105240_10041156 3300009093 Bacteria 5901
213 Ga0105240_10049045 3300009093 Bacteria 5333
214 Ga0105240_10123179 3300009093 Bacteria 3120
215 Ga0105240_10150129 3300009093 Bacteria 2776
216 Ga0111539_10354154 3300009094 Bacteria 1708
217 Ga0105247_10185132 3300009101 Bacteria 1392
218 Ga0114129_10033846 3300009147 Bacteria 7218
219 Ga0114129_10281198 3300009147 Bacteria 2223
220 Ga0114129_10285719 3300009147 Bacteria 2203
221 Ga0105243_10187333 3300009148 Bacteria 1804
222 Ga0105241_10473774 3300009174 Bacteria 1112
223 Ga0105242_10036107 3300009176 Bacteria 3964
224 Ga0105242_10831876 3300009176 Bacteria 917
225 Ga0105242_10967200 3300009176 Bacteria 857
226 Ga0105248_10002557 3300009177 Bacteria 20245
227 Ga0105248_10007729 3300009177 Bacteria 11806
228 Ga0105248_10008553 3300009177 Bacteria 11237
229 Ga0105248_10791780 3300009177 Bacteria 1070
230 Ga0105248_11792607 3300009177 Bacteria 696
231 Ga0105237_10033614 3300009545 Bacteria 5196
232 Ga0105237_10059315 3300009545 Bacteria 3829
233 Ga0105238_10003129 3300009551 Bacteria 16514
234 Ga0105238_10006387 3300009551 Bacteria 11728
235 Ga0105238_10050733 3300009551 Bacteria 4176
236 Ga0105238_10168139 3300009551 Bacteria 2169
237 Ga0105249_10005538 3300009553 Bacteria 10915
238 Ga0105249_10423524 3300009553 Bacteria 1365
239 Ga0105249_10486055 3300009553 Bacteria 1278
240 Ga0105249_10512142 3300009553 Bacteria 1246
241 Ga0105249_10538176 3300009553 Bacteria 1217
242 Ga0099796_10005800 3300010159 Bacteria 3110
243 Ga0105239_10032269 3300010375 Bacteria 5756
244 Ga0105239_10270021 3300010375 Bacteria 1913
245 Ga0105239_10417378 3300010375 Bacteria 1520
246 Ga0157370_10050985 3300013104 Bacteria 3954
247 Ga0157370_10193638 3300013104 Bacteria 1887
248 Ga0157370_10515923 3300013104 Bacteria 1097
249 Ga0157369_10011431 3300013105 Bacteria 10082
250 Ga0157369_10020578 3300013105 Bacteria 7376
251 Ga0157369_10817895 3300013105 Bacteria 957
252 Ga0157378_10720057 3300013297 Bacteria 1019
253 Ga0163162_11116593 3300013306 Bacteria 893
254 Ga0157372_11417165 3300013307 Bacteria 801
255 Ga0157375_10084432 3300013308 Bacteria 3224
256 Ga0163163_10045294 3300014325 Bacteria 4317
257 Ga0163163_10108001 3300014325 Bacteria 2809
258 Ga0163163_10180728 3300014325 Bacteria 2157
259 Ga0163163_10242858 3300014325 Bacteria 1851
260 Ga0163163_10275653 3300014325 Bacteria 1733
261 Ga0182008_10290951 3300014497 Bacteria 852
262 Ga0157379_10000373 3300014968 Bacteria 36116
263 Ga0157379_10030580 3300014968 Bacteria 4794
264 Ga0157379_10216894 3300014968 Bacteria 1733
265 Ga0163161_10071187 3300017792 Bacteria 2544
266 Ga0163161_10401502 3300017792 Bacteria 1099
267 Ga0206356_11457785 3300020070 Bacteria 1176
268 Ga0206353_10655117 3300020082 Bacteria 1136
269 Ga0213874_10046890 3300021377 Bacteria 1313
270 Ga0213876_10000218 3300021384 Bacteria 57753
271 Ga0213875_10080495 3300021388 Bacteria 1520
272 Ga0224712_10185394 3300022467 Bacteria 940
273 Ga0209026_1001465 3300025250 Bacteria 10416
274 Ga0209026_1012573 3300025250 Bacteria 1469
275 Ga0209148_1000344 3300025254 Bacteria 61011
276 Ga0209148_1005887 3300025254 Bacteria 2731
277 Ga0209233_1021012 3300025261 Bacteria 1700
278 Ga0209565_1000661 3300025263 Bacteria 22013
279 Ga0209455_1001281 3300025272 Bacteria 11747
280 Ga0209455_1009146 3300025272 Bacteria 2625
281 Ga0209673_1001807 3300025273 Bacteria 17607
282 Ga0209130_1042331 3300025284 Bacteria 872
283 Ga0209675_1051408 3300025291 Bacteria 849
284 Ga0209676_1000026 3300025292 Bacteria 574599
285 Ga0209676_1000067 3300025292 Bacteria 315576
286 Ga0209676_1000134 3300025292 Bacteria 183222
287 Ga0209564_1000164 3300025295 Bacteria 160675
288 Ga0209564_1010778 3300025295 Bacteria 4168
289 Ga0209758_1000555 3300025297 Bacteria 59166
290 Ga0209758_1000649 3300025297 Bacteria 52785
291 Ga0209758_1001988 3300025297 Bacteria 22050
292 Ga0209758_1002062 3300025297 Bacteria 21474
293 Ga0209758_1011655 3300025297 Bacteria 5055
294 Ga0209050_1000034 3300025298 Bacteria 433906
295 Ga0209050_1000348 3300025298 Bacteria 90399
296 Ga0209050_1001208 3300025298 Bacteria 30295
297 Ga0209050_1004246 3300025298 Bacteria 9845
298 Ga0209050_1035716 3300025298 Bacteria 1465
299 Ga0209050_1046109 3300025298 Bacteria 1148
300 Ga0209256_1010886 3300025299 Bacteria 3733
301 Ga0209256_1084284 3300025299 Bacteria 688
302 Ga0209257_1000052 3300025304 Bacteria 430947
303 Ga0209257_1000066 3300025304 Bacteria 344166
304 Ga0209257_1000100 3300025304 Bacteria 253399
305 Ga0209257_1000424 3300025304 Bacteria 81333
306 Ga0209257_1000618 3300025304 Bacteria 57657
307 Ga0207697_10053351 3300025315 Bacteria 1674
308 Ga0207696_1078880 3300025711 Bacteria 910
309 Ga0207682_10050958 3300025893 Bacteria 1713
310 Ga0207692_10147659 3300025898 Bacteria 1343
311 Ga0207710_10037028 3300025900 Bacteria 2153
312 Ga0207710_10038762 3300025900 Bacteria 2108
313 Ga0207710_10275677 3300025900 Bacteria 845
314 Ga0207688_10041574 3300025901 Bacteria 2558
315 Ga0207688_10047746 3300025901 Bacteria 2391
316 Ga0207680_10029163 3300025903 Bacteria 3097
317 Ga0207680_10050436 3300025903 Bacteria 2483
318 Ga0207647_10003636 3300025904 Bacteria 11537
319 Ga0207685_10022739 3300025905 Bacteria 2124
320 Ga0207699_10002386 3300025906 Bacteria 8866
321 Ga0207699_10125930 3300025906 Bacteria 1663
322 Ga0207645_10181878 3300025907 Bacteria 1379
323 Ga0207643_10138117 3300025908 Bacteria 1454
324 Ga0207643_10285400 3300025908 Bacteria 1024
325 Ga0207705_10002082 3300025909 Bacteria 15557
326 Ga0207705_10088789 3300025909 Bacteria 2261
327 Ga0207705_10174852 3300025909 Bacteria 1618
328 Ga0207705_10319137 3300025909 Bacteria 1194
329 Ga0207684_10284644 3300025910 Bacteria 1425
330 Ga0207654_10027785 3300025911 Bacteria 3079
331 Ga0207654_10247229 3300025911 Bacteria 1194
332 Ga0207707_10000466 3300025912 Bacteria 41992
333 Ga0207707_10008012 3300025912 Bacteria 9177
334 Ga0207707_10035840 3300025912 Bacteria 4338
335 Ga0207707_10037513 3300025912 Bacteria 4235
336 Ga0207707_10230934 3300025912 Bacteria 1610
337 Ga0207707_10235479 3300025912 Bacteria 1593
338 Ga0207707_10293286 3300025912 Bacteria 1407
339 Ga0207707_10442252 3300025912 Bacteria 1113
340 Ga0207707_10506403 3300025912 Bacteria 1029
341 Ga0207695_10000029 3300025913 Bacteria 548364
342 Ga0207695_10001430 3300025913 Bacteria 40141
343 Ga0207695_10001687 3300025913 Bacteria 35481
344 Ga0207695_10006230 3300025913 Bacteria 15536
345 Ga0207695_10043806 3300025913 Bacteria 4764
346 Ga0207695_10057285 3300025913 Bacteria 4049
347 Ga0207695_10063634 3300025913 Bacteria 3802
348 Ga0207695_10134339 3300025913 Bacteria 2429
349 Ga0207695_10183143 3300025913 Bacteria 2015
350 Ga0207695_10446384 3300025913 Bacteria 1177
351 Ga0207671_10013462 3300025914 Bacteria 6512
352 Ga0207671_10057564 3300025914 Bacteria 2881
353 Ga0207671_10121542 3300025914 Bacteria 1996
354 Ga0207671_10175859 3300025914 Bacteria 1664
355 Ga0207671_10256670 3300025914 Bacteria 1375
356 Ga0207671_10770548 3300025914 Bacteria 764
357 Ga0207693_10018646 3300025915 Bacteria 5524
358 Ga0207693_10215389 3300025915 Bacteria 1509
359 Ga0207663_10028365 3300025916 Bacteria 3276
360 Ga0207663_10028656 3300025916 Bacteria 3262
361 Ga0207663_10460513 3300025916 Bacteria 982
362 Ga0207663_10815521 3300025916 Bacteria 744
363 Ga0207660_10002013 3300025917 Bacteria 13517
364 Ga0207660_10004908 3300025917 Bacteria 8710
365 Ga0207660_10048121 3300025917 Bacteria 3017
366 Ga0207660_10049198 3300025917 Bacteria 2986
367 Ga0207660_10448611 3300025917 Bacteria 1043
368 Ga0207660_10476264 3300025917 Bacteria 1011
369 Ga0207662_10135662 3300025918 Bacteria 1555
370 Ga0207662_10403451 3300025918 Bacteria 927
371 Ga0207657_10004634 3300025919 Bacteria 14526
372 Ga0207649_10103135 3300025920 Bacteria 1892
373 Ga0207649_10523330 3300025920 Bacteria 904
374 Ga0207652_10002138 3300025921 Bacteria 16939
375 Ga0207652_10011255 3300025921 Bacteria 7208
376 Ga0207652_10015469 3300025921 Bacteria 6202
377 Ga0207652_10024322 3300025921 Bacteria 5024
378 Ga0207652_10150415 3300025921 Bacteria 2084
379 Ga0207652_10537001 3300025921 Bacteria 1052
380 Ga0207652_10889039 3300025921 Bacteria 787
381 Ga0207646_10121935 3300025922 Bacteria 2342
382 Ga0207646_10765904 3300025922 Bacteria 861
383 Ga0207681_10002433 3300025923 Bacteria 11804
384 Ga0207681_10415939 3300025923 Bacteria 1088
385 Ga0207694_10000131 3300025924 Bacteria 76343
386 Ga0207694_10014107 3300025924 Bacteria 6024
387 Ga0207694_10025852 3300025924 Bacteria 4464
388 Ga0207694_10105194 3300025924 Bacteria 2240
389 Ga0207694_10125480 3300025924 Bacteria 2053
390 Ga0207694_10160307 3300025924 Bacteria 1817
391 Ga0207694_10245872 3300025924 Bacteria 1463
392 Ga0207650_10000064 3300025925 Bacteria 142969
393 Ga0207650_10025375 3300025925 Bacteria 4222
394 Ga0207650_10098260 3300025925 Bacteria 2249
395 Ga0207650_10693003 3300025925 Bacteria 860
396 Ga0207687_10017929 3300025927 Bacteria 4671
397 Ga0207687_10387715 3300025927 Bacteria 1146
398 Ga0207687_10964580 3300025927 Bacteria 731
399 Ga0207700_10013938 3300025928 Bacteria 5252
400 Ga0207700_10056499 3300025928 Bacteria 2955
401 Ga0207664_10249595 3300025929 Bacteria 1548
402 Ga0207664_10524963 3300025929 Bacteria 1061
403 Ga0207690_10000170 3300025932 Bacteria 50577
404 Ga0207690_10006537 3300025932 Bacteria 6913
405 Ga0207690_10079124 3300025932 Bacteria 2290
406 Ga0207690_10359302 3300025932 Bacteria 1153
407 Ga0207706_10279629 3300025933 Bacteria 1456
408 Ga0207686_10017727 3300025934 Bacteria 4017
409 Ga0207670_10671700 3300025936 Bacteria 856
410 Ga0207669_10325250 3300025937 Bacteria 1178
411 Ga0207704_10012197 3300025938 Bacteria 4259
412 Ga0207665_10000064 3300025939 Bacteria 68931
413 Ga0207665_10399042 3300025939 Bacteria 1047
414 Ga0207711_10001318 3300025941 Bacteria 23485
415 Ga0207711_10002832 3300025941 Bacteria 15237
416 Ga0207711_10009573 3300025941 Bacteria 8076
417 Ga0207711_10021129 3300025941 Bacteria 5437
418 Ga0207711_10995048 3300025941 Bacteria 778
419 Ga0207689_10128904 3300025942 Bacteria 2081
420 Ga0207689_10643491 3300025942 Bacteria 893
421 Ga0207689_10753412 3300025942 Bacteria 822
422 Ga0207661_10043844 3300025944 Bacteria 3531
423 Ga0207661_10283335 3300025944 Bacteria 1482
424 Ga0207679_10067373 3300025945 Bacteria 2686
425 Ga0207679_10454341 3300025945 Bacteria 1137
426 Ga0207679_10566261 3300025945 Bacteria 1021
427 Ga0207667_10012774 3300025949 Bacteria 9646
428 Ga0207667_10042898 3300025949 Bacteria 4804
429 Ga0207667_10180188 3300025949 Bacteria 2170
430 Ga0207667_10200996 3300025949 Bacteria 2044
431 Ga0207667_10217326 3300025949 Bacteria 1958
432 Ga0207651_10160210 3300025960 Bacteria 1763
433 Ga0207651_10310825 3300025960 Bacteria 1314
434 Ga0207712_10000569 3300025961 Bacteria 29784
435 Ga0207712_10168262 3300025961 Bacteria 1711
436 Ga0207712_10311459 3300025961 Bacteria 1295
437 Ga0207712_10567989 3300025961 Bacteria 977
438 Ga0207668_10000003 3300025972 Bacteria 206959
439 Ga0207668_10000678 3300025972 Bacteria 20916
440 Ga0207668_10016025 3300025972 Bacteria 4669
441 Ga0207668_10068169 3300025972 Bacteria 2528
442 Ga0207668_10092129 3300025972 Bacteria 2229
443 Ga0207658_10000470 3300025986 Bacteria 37577
444 Ga0207658_10075281 3300025986 Bacteria 2568
445 Ga0207658_10148121 3300025986 Bacteria 1909
446 Ga0207677_10061549 3300026023 Bacteria 2600
447 Ga0207703_10001508 3300026035 Bacteria 21233
448 Ga0207703_10009963 3300026035 Bacteria 7455
449 Ga0207703_10452893 3300026035 Bacteria 1199
450 Ga0207639_10005534 3300026041 Bacteria 8539
451 Ga0207639_10010391 3300026041 Bacteria 6446
452 Ga0207639_10056544 3300026041 Bacteria 3008
453 Ga0207639_10488418 3300026041 Bacteria 1123
454 Ga0207678_10637942 3300026067 Bacteria 935
455 Ga0207702_10065320 3300026078 Bacteria 3116
456 Ga0207641_10000067 3300026088 Bacteria 155379
457 Ga0207641_10002338 3300026088 Bacteria 17553
458 Ga0207641_10002399 3300026088 Bacteria 17295
459 Ga0207641_10627466 3300026088 Bacteria 1054
460 Ga0207641_10885041 3300026088 Bacteria 886
461 Ga0207676_10000285 3300026095 Bacteria 43703
462 Ga0207676_10001669 3300026095 Bacteria 16357
463 Ga0207676_10017334 3300026095 Bacteria 5220
464 Ga0207674_10003851 3300026116 Bacteria 18291
465 Ga0207674_10023460 3300026116 Bacteria 6608
466 Ga0207674_10064139 3300026116 Bacteria 3706
467 Ga0207674_11325862 3300026116 Bacteria 689
468 Ga0207675_100031120 3300026118 Bacteria 4969
469 Ga0207675_100058131 3300026118 Bacteria 3609
470 Ga0207683_10091755 3300026121 Bacteria 2706
471 Ga0207683_10560164 3300026121 Bacteria 1057
472 Ga0207698_10033186 3300026142 Bacteria 3748
473 Ga0207698_10042590 3300026142 Bacteria 3394
474 Ga0207698_10139974 3300026142 Bacteria 2083
475 Ga0207698_10475900 3300026142 Bacteria 1211
476 Ga0209969_1024606 3300027360 Bacteria 905
477 Ga0209981_1000340 3300027378 Bacteria 6003
478 Ga0209179_1031830 3300027512 Bacteria 1084
479 Ga0209999_1001296 3300027543 Bacteria 4289
480 Ga0209813_10002235 3300027866 Bacteria 4418
481 Ga0209813_10125183 3300027866 Bacteria 898
482 Ga0268266_10000062 3300028379 Bacteria 253490
483 Ga0268266_10001802 3300028379 Bacteria 24277
484 Ga0268266_10003531 3300028379 Bacteria 15523
485 Ga0268266_10016020 3300028379 Bacteria 6410
486 Ga0268266_10016270 3300028379 Bacteria 6357
487 Ga0268266_10556631 3300028379 Bacteria 1099
488 Ga0268265_10001343 3300028380 Bacteria 20961
489 Ga0268265_10002488 3300028380 Bacteria 13836
490 Ga0268265_10016485 3300028380 Bacteria 5077
491 Ga0268265_10069519 3300028380 Bacteria 2734
492 Ga0268265_10081510 3300028380 Bacteria 2555
493 Ga0268265_10120918 3300028380 Bacteria 2157
494 Ga0268264_10000029 3300028381 Bacteria 419246
495 Ga0268264_10000035 3300028381 Bacteria 398196
496 Ga0268264_10000118 3300028381 Bacteria 193487
497 Ga0268264_10024356 3300028381 Bacteria 4942
498 Ga0268264_10053855 3300028381 Bacteria 3358
499 Ga0265326_10093849 3300028558 Bacteria 850
500 Ga0265334_10002345 3300028573 Bacteria 8909
501 Ga0265334_10006982 3300028573 Bacteria 4848
502 Ga0265334_10134070 3300028573 Bacteria 880
503 Ga0265323_10084554 3300028653 Bacteria 1068
504 Ga0265336_10002849 3300028666 Bacteria 6968
505 Ga0307517_10000049 3300028786 Bacteria 160368
506 Ga0307517_10004318 3300028786 Bacteria 21895
507 Ga0307517_10126022 3300028786 Bacteria 1868
508 Ga0307517_10290175 3300028786 Bacteria 925
509 Ga0265338_10000065 3300028800 Bacteria 188966
510 Ga0265338_10011636 3300028800 Bacteria 10140
511 Ga0265338_10023104 3300028800 Bacteria 6404
512 Ga0265338_10023917 3300028800 Bacteria 6261
513 Ga0265338_10220362 3300028800 Bacteria 1418
514 Ga0265338_10396690 3300028800 Bacteria 984
515 Ga0265324_10014325 3300029957 Bacteria 2937
516 Ga0307511_10002913 3300030521 Bacteria 17719
517 Ga0307511_10065390 3300030521 Bacteria 2722
518 Ga0265760_10018921 3300031090 Bacteria 1984
519 Ga0265330_10120172 3300031235 Bacteria 1120
520 Ga0265320_10120452 3300031240 Bacteria 1197
521 Ga0265325_10005453 3300031241 Bacteria 7850
522 Ga0265339_10001461 3300031249 Bacteria 17491
523 Ga0265339_10005966 3300031249 Bacteria 8054
524 Ga0265331_10001629 3300031250 Bacteria 16372
525 Ga0265331_10039828 3300031250 Bacteria 2289
526 Ga0265331_10112694 3300031250 Bacteria 1247
527 Ga0265327_10000334 3300031251 Bacteria 89444
528 Ga0265327_10002518 3300031251 Bacteria 19130
529 Ga0265327_10005115 3300031251 Bacteria 11138
530 Ga0265316_10090273 3300031344 Bacteria 2338
531 Ga0265316_10091351 3300031344 Bacteria 2322
532 Ga0307513_10000414 3300031456 Bacteria 61908
533 Ga0307513_10000431 3300031456 Bacteria 60478
534 Ga0307513_10019412 3300031456 Bacteria 8093
535 Ga0307513_10106608 3300031456 Bacteria 2808
536 Ga0307509_10176861 3300031507 Bacteria 2005
537 Ga0265313_10000270 3300031595 Bacteria 56761
538 Ga0265313_10000290 3300031595 Bacteria 54838
539 Ga0307508_10000090 3300031616 Bacteria 106893
540 Ga0307508_10448280 3300031616 Bacteria 883
541 Ga0307514_10319746 3300031649 Bacteria 853
542 Ga0265314_10035278 3300031711 Bacteria 3647
543 Ga0265314_10054614 3300031711 Bacteria 2764
544 Ga0265314_10057598 3300031711 Bacteria 2667
545 Ga0265314_10151527 3300031711 Bacteria 1421
546 Ga0265314_10245940 3300031711 Bacteria 1029
547 Ga0265342_10005498 3300031712 Bacteria 9637
548 Ga0265342_10015375 3300031712 Bacteria 5036
549 Ga0265342_10028716 3300031712 Bacteria 3461
550 Ga0307516_10000084 3300031730 Bacteria 104156
551 Ga0307405_10843136 3300031731 Bacteria 771
552 Ga0307518_10350958 3300031838 Bacteria 859
553 Ga0307407_10073331 3300031903 Bacteria 2045
554 Ga0307407_10074665 3300031903 Bacteria 2030
555 Ga0307412_10240913 3300031911 Bacteria 1399
556 Ga0307412_10440069 3300031911 Bacteria 1071
557 Ga0307409_100100735 3300031995 Bacteria 2395
558 Ga0307409_100318933 3300031995 Bacteria 1453
559 Ga0307409_100401457 3300031995 Bacteria 1309
560 Ga0307416_101189046 3300032002 Bacteria 868
561 Ga0307414_10861920 3300032004 Bacteria 829
562 Ga0307507_10167482 3300033179 Bacteria 1606
563 Ga0307510_10004617 3300033180 Bacteria 16241
564 Ga0307510_10005455 3300033180 Bacteria 15151
565 Ga0307510_10049660 3300033180 Bacteria 4459
566 Ga0307510_10180789 3300033180 Bacteria 1672
567 Ga0315911_1000011 3300033442 Bacteria 264678
568 Ga0316212_1030239 3300033547 Bacteria 761
569 Ga0373948_0047216 3300034817 Bacteria 917
570 Ga0373926_0078469 3300035083 Bacteria 1218
571 Ga0373926_0107294 3300035083 Bacteria 1047
572 Ga0373934_0015323 3300035086 Bacteria 2908
573 Ga0373934_0166516 3300035086 Bacteria 904
574 Ga0373944_0002107 3300035089 Bacteria 5055
575 Ga0373952_0051144 3300035092 Bacteria 986
576 Ga0373923_0008238 3300035111 Bacteria 3707
577 Ga0373923_0044399 3300035111 Bacteria 1842
578 Ga0373923_0346578 3300035111 Bacteria 709
579 Ga0373932_0027180 3300035112 Bacteria 1563
580 Ga0373936_0006507 3300035113 Bacteria 4403
581 Ga0373936_0016751 3300035113 Bacteria 2820
582 Ga0373936_0034573 3300035113 Bacteria 2009
583 Ga0373945_0014375 3300035116 Bacteria 2651
584 Ga0373945_0325100 3300035116 Bacteria 663
585 Ga0373953_0044097 3300035117 Bacteria 1782
586 Ga0373953_0058182 3300035117 Bacteria 1575
587 Ga0373954_0001303 3300035118 Bacteria 10039
588 Ga0373954_0113370 3300035118 Bacteria 1312
589 Ga0373956_0000726 3300035119 Bacteria 13568
590 Ga0373956_0044953 3300035119 Bacteria 1969
591 Ga0373960_0102667 3300035121 Bacteria 929
592 Ga0373943_0004812 3300035170 Bacteria 6099
593 Ga0373943_0168271 3300035170 Bacteria 1198
594 Ga0373946_0008147 3300035171 Bacteria 3846
595 Ga0373946_0330958 3300035171 Bacteria 758
596 Ga0373955_0003241 3300035172 Bacteria 7127
597 Ga0373955_0337575 3300035172 Bacteria 911
598 Ga0373924_0069637 3300035410 Bacteria 1482
599 Ga0373931_0001506 3300035691 Bacteria 10029
600 Ga0373931_0192097 3300035691 Bacteria 1215
601 Ga0373935_0000746 3300035692 Bacteria 17275
602 Ga0373935_0142286 3300035692 Bacteria 1621
603 Ga0373935_0148398 3300035692 Bacteria 1589
604 Ga0373935_0267523 3300035692 Bacteria 1200
605 Ga0373927_0001005 3300035695 Bacteria 21497
606 Ga0373927_0005832 3300035695 Bacteria 8449
607 Ga0373927_0007328 3300035695 Bacteria 7471
608 Ga0373927_0046813 3300035695 Bacteria 2797
609 Ga0373927_0072459 3300035695 Bacteria 2229
610 Ga0373927_0140972 3300035695 Bacteria 1577
611 Ga0373933_0002183 3300035724 Bacteria 11198
612 Ga0373933_0017857 3300035724 Bacteria 3984
613 Ga0373933_0033690 3300035724 Bacteria 2981
614 Ga0373947_0005667 3300035725 Bacteria 7285
615 Ga0373947_0087448 3300035725 Bacteria 1938
616 Ga0373947_0225329 3300035725 Bacteria 1233
617 Ga0373947_0256246 3300035725 Bacteria 1158
618 Ga0373947_0297724 3300035725 Bacteria 1075
619 Ga0373947_0313140 3300035725 Bacteria 1048
620 Ga0373937_0002920 3300036401 Bacteria 14286
621 Ga0373937_0061629 3300036401 Bacteria 3448
622 Ga0373937_0101399 3300036401 Bacteria 2671
623 Ga0373937_0144521 3300036401 Bacteria 2226
624 Ga0373937_0189840 3300036401 Bacteria 1930
625 Ga0373937_0583978 3300036401 Bacteria 1061
626 Ga0310109_024461 3300036534 Bacteria 811
627 Ga0373925_0000335 3300037068 Bacteria 48779
628 Ga0373925_0006131 3300037068 Bacteria 8880
629 Ga0373925_0024191 3300037068 Bacteria 4433
630 Ga0373925_0039383 3300037068 Bacteria 3497
631 Ga0373925_0051552 3300037068 Bacteria 3072
632 Ga0373925_0058505 3300037068 Bacteria 2890
633 Ga0395899_0000004 3300037312 Bacteria 874267
634 Ga0395899_0000392 3300037312 Bacteria 52225
635 Ga0395899_0037553 3300037312 Bacteria 3631
636 Ga0395899_0149214 3300037312 Bacteria 1658
637 Ga0395900_0000004 3300037418 Bacteria 564908
638 Ga0395900_0039173 3300037418 Bacteria 4884
639 Ga0395900_0046235 3300037418 Bacteria 4482
640 Ga0395900_0063108 3300037418 Bacteria 3809
641 Ga0395900_0081560 3300037418 Bacteria 3323
642 Ga0395900_0139812 3300037418 Bacteria 2480
643 Ga0395900_0319424 3300037418 Bacteria 1533
644 Ga0395900_0511166 3300037418 Bacteria 1150
645 Ga0395898_0015313 3300037466 Bacteria 7867
646 Ga0395898_0133953 3300037466 Bacteria 2372
647 Ga0395898_0264804 3300037466 Bacteria 1639
648 Ga0395898_0273995 3300037466 Bacteria 1609
649 Ga0395898_0409631 3300037466 Bacteria 1292
650 Ga0395905_0012043 3300037471 Bacteria 8337
651 Ga0395905_0014075 3300037471 Bacteria 7647
652 Ga0395905_0329054 3300037471 Bacteria 1418
653 Ga0395905_0419442 3300037471 Bacteria 1234
654 Ga0395905_0782467 3300037471 Bacteria 857
655 Ga0436364_0294495 3300037853 Bacteria 996
656 Ga0436364_0765763 3300037853 Bacteria 2884
657 Ga0436364_0967922 3300037853 Bacteria 1775
658 Ga0436364_1145508 3300037853 Bacteria 5108
659 Ga0436364_1328893 3300037853 Bacteria 936
660 Ga0436364_1523679 3300037853 Bacteria 845
661 Ga0436364_1525373 3300037853 Bacteria 968
662 Ga0395901_0000005 3300038443 Bacteria 544998
663 Ga0395901_0002466 3300038443 Bacteria 18767
664 Ga0395901_0039843 3300038443 Bacteria 4863
665 Ga0395901_0306632 3300038443 Bacteria 1645
666 Ga0395901_0371755 3300038443 Bacteria 1472
667 Ga0395901_0834628 3300038443 Bacteria 908
668 Ga0400485_03320 3300038735 Bacteria 10604
669 Ga0400483_023760 3300039062 Bacteria 7131
670 Ga0400483_040634 3300039062 Bacteria 6524
671 Ga0400483_052412 3300039062 Bacteria 5315
672 Ga0400483_092856 3300039062 Bacteria 1926
673 Ga0400483_183320 3300039062 Bacteria 6606
674 Ga0400483_193625 3300039062 Bacteria 8230
675 Ga0400483_217638 3300039062 Bacteria 24445
676 Ga0400483_218418 3300039062 Bacteria 42144
677 Ga0400483_257882 3300039062 Bacteria 2972
678 Ga0400483_272292 3300039062 Bacteria 4518
679 Ga0400483_275881 3300039062 Bacteria 1023
680 Ga0436365_0442593 3300039437 Bacteria 1541
681 Ga0436365_0577642 3300039437 Bacteria 77516
682 Ga0436365_0603212 3300039437 Bacteria 6165
683 Ga0436365_0649797 3300039437 Bacteria 875
684 Ga0436365_0751394 3300039437 Bacteria 2322
685 Ga0436365_0891213 3300039437 Bacteria 807
686 Ga0436365_1118553 3300039437 Bacteria 2521
687 Ga0436365_1300363 3300039437 Bacteria 1869
688 Ga0436360_0164010 3300039438 Bacteria 1373
689 Ga0436360_0272555 3300039438 Bacteria 749
690 Ga0436360_0339257 3300039438 Bacteria 3187
691 Ga0436360_0355615 3300039438 Bacteria 634
692 Ga0436360_0412786 3300039438 Bacteria 1453
693 Ga0436360_0640524 3300039438 Bacteria 739
694 Ga0436360_1305805 3300039438 Bacteria 1129
695 Ga0436360_1306958 3300039438 Bacteria 1836
696 Ga0436361_0223293 3300039447 Bacteria 1684
697 Ga0436361_0569699 3300039447 Bacteria 18031
698 Ga0436361_0783402 3300039447 Bacteria 2796
699 Ga0436361_1136221 3300039447 Bacteria 1043
700 Ga0436363_0225819 3300039450 Bacteria 706
701 Ga0436363_0740142 3300039450 Bacteria 901
702 Ga0436363_1100534 3300039450 Bacteria 696
703 Ga0436363_1533112 3300039450 Bacteria 879
704 Ga0436362_1014140 3300039453 Bacteria 797
705 Ga0439465_0034528 3300041413 Bacteria 1619
706 Ga0451790_33576 3300041444 Bacteria 777
707 Ga0451793_1221768 3300041452 Bacteria 615
708 Ga0451793_1584844 3300041452 Bacteria 926
709 Ga0451800_0349978 3300041459 Bacteria 758
710 Ga0451807_1028089 3300041486 Bacteria 705
711 Ga0451839_0013675 3300041496 Bacteria 781
712 Ga0451851_0179760 3300041507 Bacteria 859
713 Ga0439431_0053914 3300041997 Bacteria 1048
714 Ga0439431_0122671 3300041997 Bacteria 725
715 Ga0439448_0020795 3300042005 Bacteria 2034
716 Ga0439448_0112534 3300042005 Bacteria 931
717 Ga0439432_034533 3300042006 Bacteria 1623
718 Ga0439432_077648 3300042006 Bacteria 1008
719 Ga0439450_015569 3300042008 Bacteria 1559
720 Ga0439454_000646 3300042011 Bacteria 2921
721 Ga0439455_0004924 3300042012 Bacteria 2680
722 Ga0439456_083156 3300042013 Bacteria 716
723 Ga0439463_001082 3300042016 Bacteria 7352
724 Ga0439446_0012923 3300042156 Bacteria 2285
725 Ga0439434_0102851 3300042435 Bacteria 921
726 Ga0439434_0160628 3300042435 Bacteria 746
727 Ga0439459_0009822 3300042438 Bacteria 1658
728 Ga0439464_0007526 3300042439 Bacteria 2848
729 Ga0439460_0007151 3300042461 Bacteria 2785
730 Ga0439440_0012915 3300042993 Bacteria 1783
731 Ga0466966_0001611 3300044684 Bacteria 14530
732 Ga0466966_0211388 3300044684 Bacteria 1172
733 Ga0466966_0290872 3300044684 Bacteria 982
734 Ga0466961_0000729 3300044693 Bacteria 20668
735 Ga0466961_0176993 3300044693 Bacteria 1325
736 Ga0466963_0092275 3300044694 Bacteria 2063
737 Ga0466963_0381938 3300044694 Bacteria 993
738 Ga0466968_0036681 3300044735 Bacteria 2055
739 Ga0466957_0288464 3300044842 Bacteria 1100
740 Ga0466959_0016762 3300045049 Bacteria 5361
741 Ga0466959_0284459 3300045049 Bacteria 1134
742 Ga0466967_0064758 3300045976 Bacteria 3251
743 Ga0466967_0140691 3300045976 Bacteria 2248
744 Ga0466967_0356150 3300045976 Bacteria 1417
745 Ga0466967_0508770 3300045976 Bacteria 1182
746 Ga0495617_082408 3300046452 Bacteria 1053
747 Ga0495592_0001015 3300046454 Bacteria 19460
748 Ga0495592_0160953 3300046454 Bacteria 1544
749 Ga0495592_0292078 3300046454 Bacteria 1062
750 Ga0495592_0386922 3300046454 Bacteria 889
751 Ga0495603_0014076 3300046455 Bacteria 4838
752 Ga0495603_0096327 3300046455 Bacteria 1729
753 Ga0495603_0286794 3300046455 Bacteria 946
754 Ga0495590_0001375 3300046457 Bacteria 10563
755 Ga0495629_0011592 3300046459 Bacteria 6400
756 Ga0495629_0054448 3300046459 Bacteria 2798
757 Ga0495629_0224185 3300046459 Bacteria 1296
758 Ga0495629_0307888 3300046459 Bacteria 1084
759 Ga0495638_0006134 3300046460 Bacteria 8794
760 Ga0495638_0054700 3300046460 Bacteria 2480
761 Ga0495638_0061356 3300046460 Bacteria 2323
762 Ga0495641_0009631 3300046461 Bacteria 5717
763 Ga0495651_0363585 3300046462 Bacteria 953
764 Ga0495651_0526357 3300046462 Bacteria 754
765 Ga0495653_0000934 3300046463 Bacteria 22498
766 Ga0495653_0079298 3300046463 Bacteria 2432
767 Ga0495653_0142684 3300046463 Bacteria 1682
768 Ga0495653_0335730 3300046463 Bacteria 976
769 Ga0495650_0000244 3300046471 Bacteria 107511
770 Ga0495580_0000612 3300046472 Bacteria 30191
771 Ga0495580_0010282 3300046472 Bacteria 7298
772 Ga0495582_0019067 3300046473 Bacteria 3754
773 Ga0495582_0068295 3300046473 Bacteria 1964
774 Ga0495582_0089154 3300046473 Bacteria 1719
775 Ga0495639_0001536 3300046475 Bacteria 10297
776 Ga0495639_0038030 3300046475 Bacteria 2160
777 Ga0495639_0238859 3300046475 Bacteria 896
778 Ga0495664_0013114 3300046477 Bacteria 4701
779 Ga0495664_0322198 3300046477 Bacteria 932
780 Ga0495664_0330181 3300046477 Bacteria 919
781 Ga0495585_0039584 3300046492 Bacteria 2649
782 Ga0495585_0226696 3300046492 Bacteria 941
783 Ga0495594_0098647 3300046499 Bacteria 1642
784 Ga0495594_0209109 3300046499 Bacteria 1112
785 Ga0495596_0167271 3300046500 Bacteria 855
786 Ga0495607_0307923 3300046501 Bacteria 743
787 Ga0495583_0097502 3300046506 Bacteria 1258
788 Ga0495606_0005813 3300046507 Bacteria 11637
789 Ga0495606_0059666 3300046507 Bacteria 2446
790 Ga0495608_0002093 3300046511 Bacteria 14381
791 Ga0495608_0013352 3300046511 Bacteria 5698
792 Ga0495608_0393237 3300046511 Bacteria 849
793 Ga0495610_0002447 3300046512 Bacteria 15615
794 Ga0495616_0000561 3300046513 Bacteria 28171
795 Ga0495618_0317127 3300046514 Bacteria 966
796 Ga0495628_0020462 3300046516 Bacteria 5456
797 Ga0495628_0091030 3300046516 Bacteria 2361
798 Ga0495628_0123443 3300046516 Bacteria 1985
799 Ga0495628_0203866 3300046516 Bacteria 1489
800 Ga0495630_0035589 3300046517 Bacteria 3720
801 Ga0495630_0050507 3300046517 Bacteria 3113
802 Ga0495630_0127018 3300046517 Bacteria 1936
803 Ga0495631_0118568 3300046518 Bacteria 1138
804 Ga0495637_0023333 3300046520 Bacteria 2814
805 Ga0495643_0041517 3300046522 Bacteria 2507
806 Ga0495643_0134258 3300046522 Bacteria 1240
807 Ga0495644_0215384 3300046523 Bacteria 742
808 Ga0495648_0000165 3300046524 Bacteria 78462
809 Ga0495648_0030929 3300046524 Bacteria 3533
810 Ga0495666_0026921 3300046526 Bacteria 2831
811 Ga0495642_0018614 3300046528 Bacteria 2719
812 Ga0495642_0036369 3300046528 Bacteria 1990
813 Ga0495642_0181321 3300046528 Bacteria 916
814 Ga0495652_0002209 3300046529 Bacteria 20424
815 Ga0495652_0036404 3300046529 Bacteria 4280
816 Ga0495652_0049140 3300046529 Bacteria 3612
817 Ga0495652_0112630 3300046529 Bacteria 2185
818 Ga0495652_0160604 3300046529 Bacteria 1745
819 Ga0495652_0230424 3300046529 Bacteria 1386
820 Ga0495652_0401043 3300046529 Bacteria 971
821 Ga0495654_0000024 3300046530 Bacteria 238195
822 Ga0495654_0041892 3300046530 Bacteria 2276
823 Ga0495665_0000866 3300046531 Bacteria 15828
824 Ga0495665_0243738 3300046531 Bacteria 926
825 Ga0495640_0003099 3300046533 Bacteria 13412
826 Ga0495640_0060112 3300046533 Bacteria 2585
827 Ga0495640_0247644 3300046533 Bacteria 1117
828 Ga0495640_0353867 3300046533 Bacteria 906
829 Ga0495587_0015200 3300046536 Bacteria 4810
830 Ga0495587_0029924 3300046536 Bacteria 3304
831 Ga0495587_0133003 3300046536 Bacteria 1421
832 Ga0495609_0023541 3300046538 Bacteria 2830
833 Ga0495621_0076579 3300046539 Bacteria 1241
834 Ga0495597_0003599 3300046542 Bacteria 8921
835 Ga0495597_0043380 3300046542 Bacteria 2003
836 Ga0495645_0012499 3300046543 Bacteria 5983
837 Ga0495645_0013311 3300046543 Bacteria 5815
838 Ga0495645_0040862 3300046543 Bacteria 3382
839 Ga0495645_0338967 3300046543 Bacteria 971
840 Ga0495645_0358784 3300046543 Bacteria 937
841 Ga0495645_0425059 3300046543 Bacteria 842
842 Ga0495622_0010588 3300046557 Bacteria 4255
843 Ga0495622_0033434 3300046557 Bacteria 2400
844 Ga0495622_0054153 3300046557 Bacteria 1861
845 Ga0495633_0024018 3300046558 Bacteria 3016
846 Ga0495633_0139294 3300046558 Bacteria 1122
847 Ga0495667_0009515 3300046559 Bacteria 6585
848 Ga0495667_0023947 3300046559 Bacteria 4112
849 Ga0495667_0156529 3300046559 Bacteria 1466
850 Ga0495656_0015319 3300046615 Bacteria 2892
851 Ga0495656_0445946 3300046615 Bacteria 681
852 Ga0495668_0000042 3300046616 Bacteria 229361
853 Ga0495668_0006417 3300046616 Bacteria 7704
854 Ga0495668_0006930 3300046616 Bacteria 7335
855 Ga0495668_0070100 3300046616 Bacteria 1927
856 Ga0495668_0135365 3300046616 Bacteria 1348
857 Ga0495668_0165455 3300046616 Bacteria 1211
858 Ga0495668_0173531 3300046616 Bacteria 1181
859 Ga0495634_0003047 3300046642 Bacteria 13635
860 Ga0495634_0045191 3300046642 Bacteria 2978
861 Ga0495634_0068412 3300046642 Bacteria 2346
862 Ga0495634_0078105 3300046642 Bacteria 2169
863 Ga0495611_0316360 3300046648 Bacteria 718
864 Ga0495625_0029821 3300046660 Bacteria 4075
865 Ga0495625_0065494 3300046660 Bacteria 2561
866 Ga0495625_0121557 3300046660 Bacteria 1776
867 Ga0495625_0203516 3300046660 Bacteria 1305
868 Ga0495625_0289169 3300046660 Bacteria 1052
869 Ga0495635_0000540 3300046663 Bacteria 24055
870 Ga0495635_0007303 3300046663 Bacteria 7716
871 Ga0495635_0062629 3300046663 Bacteria 2554
872 Ga0495635_0065285 3300046663 Bacteria 2497
873 Ga0495659_0080223 3300046664 Bacteria 1237
874 Ga0495588_0026578 3300046674 Bacteria 2891
875 Ga0495588_0057027 3300046674 Bacteria 2017
876 Ga0495657_0001615 3300046675 Bacteria 19351
877 Ga0495657_0003319 3300046675 Bacteria 13189
878 Ga0495657_0023689 3300046675 Bacteria 4384
879 Ga0495599_0007666 3300046678 Bacteria 6555
880 Ga0495599_0071308 3300046678 Bacteria 2169
881 Ga0495599_0169737 3300046678 Bacteria 1346
882 Ga0495623_0051844 3300046679 Bacteria 2594
883 Ga0495623_0168305 3300046679 Bacteria 1282
884 Ga0495646_0010030 3300046680 Bacteria 6021
885 Ga0495646_0096661 3300046680 Bacteria 1698
886 Ga0495647_0021408 3300046681 Bacteria 2328
887 Ga0495658_0005259 3300046683 Bacteria 6372
888 Ga0495658_0215711 3300046683 Bacteria 1200
889 Ga0495658_0257007 3300046683 Bacteria 1099
890 Ga0495669_0000078 3300046684 Bacteria 64436
891 Ga0495669_0009879 3300046684 Bacteria 4032
892 Ga0495669_0045945 3300046684 Bacteria 1948
893 Ga0495613_0004342 3300046689 Bacteria 10610
894 Ga0495613_0148598 3300046689 Bacteria 1672
895 Ga0495613_0584005 3300046689 Bacteria 745
896 Ga0495624_0000079 3300046690 Bacteria 63196
897 Ga0495670_0106363 3300046691 Bacteria 1449
898 Ga0495600_0007254 3300046809 Bacteria 6770
899 Ga0495600_0065595 3300046809 Bacteria 2374
900 Ga0495600_0085449 3300046809 Bacteria 2058
901 Ga0495660_0029161 3300046810 Bacteria 3115
902 Ga0495660_0065495 3300046810 Bacteria 1939
903 Ga0495581_0000260 3300047315 Bacteria 25339
904 Ga0495581_0108817 3300047315 Bacteria 1611
905 Ga0495581_0244006 3300047315 Bacteria 1050
906 Ga0495581_0361447 3300047315 Bacteria 847
907 Ga0495604_0006608 3300047317 Bacteria 9190
908 Ga0495604_0021019 3300047317 Bacteria 5207
909 Ga0495604_0093261 3300047317 Bacteria 2228
910 Ga0495604_0124469 3300047317 Bacteria 1861
911 Ga0495636_0082612 3300047318 Bacteria 1385
912 Ga0495674_0039127 3300047319 Bacteria 4252
913 Ga0495674_0060084 3300047319 Bacteria 3317
914 Ga0495674_0062608 3300047319 Bacteria 3238
915 Ga0495672_0065581 3300047320 Bacteria 2075
916 Ga0495672_0103686 3300047320 Bacteria 1538
917 Ga0495672_0229000 3300047320 Bacteria 913
918 Ga0495676_0070484 3300047321 Bacteria 2692
919 Ga0495680_0012504 3300047322 Bacteria 7465
920 Ga0495680_0032774 3300047322 Bacteria 4213
921 Ga0495680_0118005 3300047322 Bacteria 1961
922 Ga0495687_080764 3300047443 Bacteria 1274
923 Ga0495675_0001958 3300047444 Bacteria 12284
924 Ga0495675_0048595 3300047444 Bacteria 2698
925 Ga0495675_0086146 3300047444 Bacteria 1975
926 Ga0495677_0046949 3300047445 Bacteria 1585
927 Ga0495677_0152752 3300047445 Bacteria 889
928 Ga0495673_0015936 3300047469 Bacteria 3857
929 Ga0495673_0028515 3300047469 Bacteria 2643
930 Ga0495681_0124308 3300047470 Bacteria 1104
931 Ga0495681_0185514 3300047470 Bacteria 852
932 Ga0495684_0001865 3300047471 Bacteria 16864
933 Ga0495684_0007297 3300047471 Bacteria 8566
934 Ga0495684_0010601 3300047471 Bacteria 7124
935 Ga0495684_0048320 3300047471 Bacteria 3254
936 Ga0495686_0001646 3300047472 Bacteria 23306
937 Ga0495686_0003347 3300047472 Bacteria 13988
938 Ga0495686_0027519 3300047472 Bacteria 3710
939 Ga0495686_0193227 3300047472 Bacteria 1172
940 Ga0495686_0249230 3300047472 Bacteria 998
941 Ga0495593_0002394 3300047673 Bacteria 11278
942 Ga0495593_0027612 3300047673 Bacteria 3123
943 Ga0495593_0040729 3300047673 Bacteria 2500
944 Ga0495602_0009374 3300048088 Bacteria 10184
945 Ga0495602_0040611 3300048088 Bacteria 4262
946 Ga0495602_0142472 3300048088 Bacteria 1896
947 Ga0495626_0059314 3300048091 Bacteria 1746
948 Ga0496100_0059701 3300048903 Bacteria 2507
949 Ga0496100_0232261 3300048903 Bacteria 1358
950 Ga0496100_0367005 3300048903 Bacteria 1091
951 Ga0496100_0848994 3300048903 Bacteria 716
952 Ga0496101_0015844 3300048904 Bacteria 5088
953 Ga0496102_0000518 3300048905 Bacteria 42014
954 Ga0496102_0018170 3300048905 Bacteria 6171
955 Ga0496102_0018766 3300048905 Bacteria 6083
956 Ga0496102_0052840 3300048905 Bacteria 3703
957 Ga0496102_0739641 3300048905 Bacteria 906
958 Ga0496103_0077711 3300048906 Bacteria 2084
959 Ga0496104_0137241 3300048907 Bacteria 2349
960 Ga0496105_0004162 3300048908 Bacteria 10857
961 Ga0496105_0004256 3300048908 Bacteria 10766
962 Ga0496105_0112402 3300048908 Bacteria 2248
963 Ga0496105_0679311 3300048908 Bacteria 792
964 Ga0496106_0000116 3300048909 Bacteria 61237
965 Ga0496106_0013096 3300048909 Bacteria 6120
966 Ga0496106_0078196 3300048909 Bacteria 2538
967 Ga0496106_0094820 3300048909 Bacteria 2308
968 Ga0496106_0363639 3300048909 Bacteria 1162
969 Ga0496107_0001003 3300048910 Bacteria 16852
970 Ga0496107_0554203 3300048910 Bacteria 851
971 Ga0496108_0000523 3300048911 Bacteria 30064
972 Ga0496108_0005230 3300048911 Bacteria 10477
973 Ga0496108_0034870 3300048911 Bacteria 4181
974 Ga0496109_0001407 3300048912 Bacteria 19953
975 Ga0496109_0005646 3300048912 Bacteria 10464
976 Ga0496109_0285204 3300048912 Bacteria 1556
977 Ga0496110_0018684 3300048913 Bacteria 5815
978 Ga0496110_0065369 3300048913 Bacteria 3215
979 Ga0496110_0444838 3300048913 Bacteria 1181
980 Ga0496110_1073373 3300048913 Bacteria 713
981 Ga0496111_0078263 3300048914 Bacteria 2411
982 Ga0496111_0333052 3300048914 Bacteria 1124
983 Ga0496112_0005822 3300048915 Bacteria 10731
984 Ga0496112_0030428 3300048915 Bacteria 5224
985 Ga0496112_0069799 3300048915 Bacteria 3470
986 Ga0496112_0089521 3300048915 Bacteria 3046
987 Ga0496112_0097854 3300048915 Bacteria 2904
988 Ga0496112_0164043 3300048915 Bacteria 2188
989 Ga0496112_0220787 3300048915 Bacteria 1851
990 Ga0496112_0358193 3300048915 Bacteria 1401
991 Ga0496113_0073598 3300048916 Bacteria 2603
992 Ga0496113_0468122 3300048916 Bacteria 1013
993 Ga0496114_0023481 3300048917 Bacteria 5033
994 Ga0496114_0166178 3300048917 Bacteria 1921
995 Ga0496115_0001962 3300048918 Bacteria 14682
996 Ga0496115_0002796 3300048918 Bacteria 12540
997 Ga0496115_0010930 3300048918 Bacteria 6796
998 Ga0496115_0012733 3300048918 Bacteria 6339
999 Ga0496115_0279760 3300048918 Bacteria 1370
1000 Ga0496115_0652816 3300048918 Bacteria 831
1001 Ga0496117_0039261 3300048920 Bacteria 3496
1002 Ga0496117_0056067 3300048920 Bacteria 2748
1003 Ga0496117_0090740 3300048920 Bacteria 1968
1004 Ga0496118_0006091 3300048921 Bacteria 13407
1005 Ga0496118_0010206 3300048921 Bacteria 9325
1006 Ga0496118_0057706 3300048921 Bacteria 2907
1007 Ga0496118_0183459 3300048921 Bacteria 1261
1008 Ga0496119_0023537 3300048922 Bacteria 4363
1009 Ga0496120_0291662 3300048923 Bacteria 750
1010 Ga0496121_0000053 3300048924 Bacteria 312611
1011 Ga0496121_0001006 3300048924 Bacteria 50348
1012 Ga0496121_0007140 3300048924 Bacteria 13552
1013 Ga0496121_0012978 3300048924 Bacteria 9004
1014 Ga0496121_0036555 3300048924 Bacteria 4375
1015 Ga0496121_0037388 3300048924 Bacteria 4312
1016 Ga0496121_0095890 3300048924 Bacteria 2304
1017 Ga0496122_0028275 3300048925 Bacteria 4764
1018 Ga0496122_0175784 3300048925 Bacteria 1283
1019 Ga0496123_0034089 3300048926 Bacteria 3652
1020 Ga0496123_0181302 3300048926 Bacteria 1099
1021 Ga0496124_0027923 3300048927 Bacteria 5054
1022 Ga0496124_0134902 3300048927 Bacteria 1955
1023 Ga0496124_0163386 3300048927 Bacteria 1733
1024 Ga0496124_0273170 3300048927 Bacteria 1236
1025 Ga0496124_0490044 3300048927 Bacteria 827
1026 Ga0496125_0000063 3300048928 Bacteria 250260
1027 Ga0496125_0000692 3300048928 Bacteria 55634
1028 Ga0496125_0004834 3300048928 Bacteria 15300
1029 Ga0496125_0206556 3300048928 Bacteria 1280
1030 Ga0496125_0207858 3300048928 Bacteria 1274
1031 Ga0496125_0308976 3300048928 Bacteria 964
1032 Ga0496126_0005437 3300048929 Bacteria 14524
1033 Ga0496126_0005856 3300048929 Bacteria 13876
1034 Ga0496126_0010695 3300048929 Bacteria 9587
1035 Ga0496126_0024996 3300048929 Bacteria 5757
1036 Ga0496126_0061522 3300048929 Bacteria 3372
1037 Ga0496126_0084558 3300048929 Bacteria 2798
1038 Ga0496126_0088140 3300048929 Bacteria 2734
1039 Ga0496126_0105848 3300048929 Bacteria 2455
1040 Ga0496126_0194926 3300048929 Bacteria 1714
1041 Ga0496126_0221731 3300048929 Bacteria 1588
1042 Ga0496126_0776235 3300048929 Bacteria 737
1043 Ga0495682_0062222 3300049460 Bacteria 1347
1044 Ga0501314_019671 3300049530 Bacteria 694
1045 Ga0501317_046203 3300049533 Bacteria 679
1046 Ga0501323_035212 3300049539 Bacteria 717
1047 Ga0501329_02705 3300049545 Bacteria 865
1048 Ga0501335_017530 3300049551 Bacteria 744
1049 Ga0501336_018612 3300049552 Bacteria 617
1050 Ga0501031_0018753 3300049568 Bacteria 4504
1051 Ga0501031_0040667 3300049568 Bacteria 3036
1052 Ga0501031_0131864 3300049568 Bacteria 1632
1053 Ga0501032_0036721 3300049569 Bacteria 3344
1054 Ga0501032_0408136 3300049569 Bacteria 872
1055 Ga0501033_0010145 3300049570 Bacteria 7230
1056 Ga0501033_0039811 3300049570 Bacteria 3510
1057 Ga0501033_0057649 3300049570 Bacteria 2870
1058 Ga0501033_0061003 3300049570 Bacteria 2780
1059 Ga0501033_0062673 3300049570 Bacteria 2738
1060 Ga0501033_0666746 3300049570 Bacteria 710
1061 Ga0501034_0002925 3300049571 Bacteria 19803
1062 Ga0501034_0052520 3300049571 Bacteria 4105
1063 Ga0501034_0891302 3300049571 Bacteria 778
1064 Ga0501036_0017092 3300049572 Bacteria 6064
1065 Ga0501036_0019870 3300049572 Bacteria 5640
1066 Ga0501036_0045518 3300049572 Bacteria 3717
1067 Ga0501037_0018936 3300049573 Bacteria 5075
1068 Ga0501037_0132577 3300049573 Bacteria 1786
1069 Ga0501037_0140022 3300049573 Bacteria 1732
1070 Ga0501037_0143231 3300049573 Bacteria 1710
1071 Ga0501037_0194571 3300049573 Bacteria 1435
1072 Ga0501038_0061441 3300049574 Bacteria 3213
1073 Ga0501038_0140642 3300049574 Bacteria 1975
1074 Ga0501038_0203618 3300049574 Bacteria 1587
1075 Ga0501038_0210776 3300049574 Bacteria 1554
1076 Ga0501038_0741293 3300049574 Bacteria 733
1077 Ga0501039_0001765 3300049575 Bacteria 15962
1078 Ga0501039_0082192 3300049575 Bacteria 2508
1079 Ga0501039_0099838 3300049575 Bacteria 2265
1080 Ga0501040_0002053 3300049576 Bacteria 12978
1081 Ga0501040_0006026 3300049576 Bacteria 7847
1082 Ga0501040_0041569 3300049576 Bacteria 3131
1083 Ga0501041_0031708 3300049577 Bacteria 3194
1084 Ga0501041_0032148 3300049577 Bacteria 3171
1085 Ga0501041_0107255 3300049577 Bacteria 1731
1086 Ga0501041_0222424 3300049577 Bacteria 1185
1087 Ga0501042_0006496 3300049578 Bacteria 7592
1088 Ga0501042_0007090 3300049578 Bacteria 7324
1089 Ga0501042_0101129 3300049578 Bacteria 2073
1090 Ga0501042_0210836 3300049578 Bacteria 1401
1091 Ga0501042_0856644 3300049578 Bacteria 662
1092 Ga0501043_0020010 3300049579 Bacteria 5253
1093 Ga0501043_0083945 3300049579 Bacteria 2504
1094 Ga0501043_0382572 3300049579 Bacteria 1065
1095 Ga0501043_0462899 3300049579 Bacteria 951
1096 Ga0501046_0013607 3300049580 Bacteria 6882
1097 Ga0501046_0033739 3300049580 Bacteria 4133
1098 Ga0501046_0052251 3300049580 Bacteria 3221
1099 Ga0501046_0104794 3300049580 Bacteria 2167
1100 Ga0501047_0024481 3300049581 Bacteria 5793
1101 Ga0501047_0035413 3300049581 Bacteria 4823
1102 Ga0501047_0060948 3300049581 Bacteria 3640
1103 Ga0501047_0394826 3300049581 Bacteria 1217
1104 Ga0501047_0704524 3300049581 Bacteria 827
1105 Ga0501048_0050138 3300049582 Bacteria 2973
1106 Ga0501048_0063127 3300049582 Bacteria 2621
1107 Ga0501048_0071077 3300049582 Bacteria 2457
1108 Ga0501048_0547898 3300049582 Bacteria 830
1109 Ga0501067_0083497 3300049583 Bacteria 1772
1110 Ga0501068_0046288 3300049584 Bacteria 2623
1111 Ga0501068_0166528 3300049584 Bacteria 1390
1112 Ga0501068_0205588 3300049584 Bacteria 1249
1113 Ga0501070_0000329 3300049586 Bacteria 43062
1114 Ga0501071_0002499 3300049587 Bacteria 11181
1115 Ga0501071_0043672 3300049587 Bacteria 3215
1116 Ga0501071_0083826 3300049587 Bacteria 2335
1117 Ga0501071_0205774 3300049587 Bacteria 1479
1118 Ga0501072_0000404 3300049588 Bacteria 30870
1119 Ga0501072_0005957 3300049588 Bacteria 9289
1120 Ga0501072_0284636 3300049588 Bacteria 1315
1121 Ga0501073_0094101 3300049589 Bacteria 2081
1122 Ga0501073_0341263 3300049589 Bacteria 1034
1123 Ga0501074_0020761 3300049590 Bacteria 4772
1124 Ga0501074_0068008 3300049590 Bacteria 2561
1125 Ga0501074_0174655 3300049590 Bacteria 1533
1126 Ga0501074_0514973 3300049590 Bacteria 848
1127 Ga0501075_0003123 3300049591 Bacteria 11073
1128 Ga0501075_0056549 3300049591 Bacteria 2953
1129 Ga0501075_0081749 3300049591 Bacteria 2446
1130 Ga0501075_0134392 3300049591 Bacteria 1884
1131 Ga0501075_0143716 3300049591 Bacteria 1818
1132 Ga0501075_0278874 3300049591 Bacteria 1274
1133 Ga0501076_0008200 3300049592 Bacteria 7652
1134 Ga0501076_0014532 3300049592 Bacteria 5932
1135 Ga0501076_0051590 3300049592 Bacteria 3256
1136 Ga0501076_0273486 3300049592 Bacteria 1383
1137 Ga0501077_0002661 3300049593 Bacteria 10707
1138 Ga0501077_0007349 3300049593 Bacteria 6792
1139 Ga0501077_0014674 3300049593 Bacteria 4924
1140 Ga0501077_0066656 3300049593 Bacteria 2284
1141 Ga0501077_0189801 3300049593 Bacteria 1305
1142 Ga0501077_0543500 3300049593 Bacteria 745
1143 Ga0501238_002774 3300049671 Bacteria 2119
1144 Ga0501257_003510 3300049686 Bacteria 3369
1145 Ga0501079_0017122 3300049741 Bacteria 5534
1146 Ga0501079_0028862 3300049741 Bacteria 4258
1147 Ga0501079_0078560 3300049741 Bacteria 2552
1148 Ga0501080_0160907 3300049742 Bacteria 2073
1149 Ga0501080_0230862 3300049742 Bacteria 1691
1150 Ga0501081_0005768 3300049743 Bacteria 8018
1151 Ga0501081_0048682 3300049743 Bacteria 2917
1152 Ga0501081_0090285 3300049743 Bacteria 2153
1153 Ga0501273_027996 3300049770 Bacteria 792
1154 Ga0501035_0001146 3300049822 Bacteria 27712
1155 Ga0501035_0057192 3300049822 Bacteria 3478
1156 Ga0501035_0216337 3300049822 Bacteria 1638
1157 Ga0501035_0317235 3300049822 Bacteria 1310
1158 Ga0501044_0014747 3300049823 Bacteria 8425
1159 Ga0501044_0018956 3300049823 Bacteria 7368
1160 Ga0501044_0110240 3300049823 Bacteria 2761
1161 Ga0501044_0138142 3300049823 Bacteria 2427
1162 Ga0501044_1029363 3300049823 Bacteria 694
1163 Ga0501045_0000769 3300049824 Bacteria 20594
1164 Ga0501045_0012830 3300049824 Bacteria 5906
1165 Ga0501045_0033121 3300049824 Bacteria 3747
1166 Ga0501045_0064576 3300049824 Bacteria 2687
1167 nmdc:mga03683_102815_c1 3300050489 Bacteria 1257
1168 nmdc:mga00v17_76660_c1 3300050491 Bacteria 2080
1169 nmdc:mga0yw44_283950_c1 3300050492 Bacteria 1107
1170 nmdc:mga0yw44_40419_c1 3300050492 Bacteria 2771
1171 nmdc:mga0yw44_578169_c1 3300050492 Bacteria 763
1172 nmdc:mga0k408_99988_c1 3300050493 Bacteria 1710
1173 nmdc:mga06z11_2536_c1 3300050494 Bacteria 6982
1174 nmdc:mga06z11_398842_c1 3300050494 Bacteria 828
1175 nmdc:mga04h51_3728_c1 3300050495 Bacteria 3731
1176 nmdc:mga07m45_132961_c1 3300050496 Bacteria 1440
1177 nmdc:mga07m45_154896_c1 3300050496 Bacteria 1329
1178 nmdc:mga05p37_112203_c1 3300050507 Bacteria 3353
1179 nmdc:mga05p37_154934_c1 3300050507 Bacteria 2801
1180 nmdc:mga05p37_171_c1 3300050507 Bacteria 63303
1181 nmdc:mga05p37_185239_c1 3300050507 Bacteria 2531
1182 nmdc:mga05p37_478512_c1 3300050507 Bacteria 1435
1183 nmdc:mga05p37_634367_c1 3300050507 Bacteria 1200
1184 nmdc:mga05p37_94514_c1 3300050507 Bacteria 3683
1185 nmdc:mga09592_183_c1 3300050508 Bacteria 44709
1186 nmdc:mga09592_192657_c1 3300050508 Bacteria 1765
1187 nmdc:mga09592_565_c1 3300050508 Bacteria 28059
1188 nmdc:mga09592_617536_c1 3300050508 Bacteria 928
1189 nmdc:mga0qj67_14906_c1 3300050509 Bacteria 5879
1190 nmdc:mga0qj67_300347_c1 3300050509 Bacteria 1301
1191 nmdc:mga0qj67_306246_c1 3300050509 Bacteria 1287
1192 nmdc:mga0qj67_337702_c1 3300050509 Bacteria 1219
1193 nmdc:mga0qj67_538_c1 3300050509 Bacteria 25772
1194 nmdc:mga06r32_102130_c1 3300050510 Bacteria 2815
1195 nmdc:mga06r32_10511_c1 3300050510 Bacteria 8348
1196 nmdc:mga06r32_156443_c1 3300050510 Bacteria 2261
1197 nmdc:mga06r32_342_c1 3300050510 Bacteria 38838
1198 nmdc:mga06r32_54803_c1 3300050510 Bacteria 3824
1199 nmdc:mga0n895_150649_c1 3300050512 Bacteria 2356
1200 nmdc:mga0n895_68361_c1 3300050512 Bacteria 3519
1201 nmdc:mga0rr50_351456_c1 3300050513 Bacteria 1240
1202 nmdc:mga0sz30_190741_c1 3300050516 Bacteria 910
1203 nmdc:mga0sz30_94027_c2 3300050516 Bacteria 881
1204 Ga0495601_0102887 3300053077 Bacteria 1846
1205 Ga0495601_0112525 3300053077 Bacteria 1763
1206 Ga0495601_0215294 3300053077 Bacteria 1255
1207 Ga0495612_0007827 3300053078 Bacteria 4359
1208 Ga0495612_0027321 3300053078 Bacteria 2294
1209 Ga0495612_0087489 3300053078 Bacteria 1315
1210 Ga0495612_0143475 3300053078 Bacteria 1037
1211 Ga0500635_0000253 3300053080 Bacteria 22197
1212 Ga0500635_0021631 3300053080 Bacteria 1984
1213 Ga0500635_0059095 3300053080 Bacteria 1333
1214 Ga0495595_0120370 3300053084 Bacteria 1278
1215 Ga0495595_0231231 3300053084 Bacteria 924
1216 Ga0495619_0030125 3300053085 Bacteria 3511
1217 Ga0495619_0034980 3300053085 Bacteria 3267
1218 Ga0495619_0223782 3300053085 Bacteria 1303
1219 Ga0495619_0232128 3300053085 Bacteria 1278
1220 Ga0500578_0000004 3300053086 Bacteria 260037
1221 Ga0500578_0143138 3300053086 Bacteria 1494
1222 Ga0500643_010462 3300053087 Bacteria 3450
1223 Ga0500643_051721 3300053087 Bacteria 1172
1224 Ga0500644_0015838 3300053088 Bacteria 2159
1225 Ga0500651_0290965 3300053093 Bacteria 939
1226 Ga0500566_0000064 3300053094 Bacteria 50908
1227 Ga0500641_0000579 3300053096 Bacteria 13194
1228 Ga0500641_0005464 3300053096 Bacteria 4503
1229 Ga0500654_097567 3300053099 Bacteria 1272
1230 Ga0500555_001693 3300053103 Bacteria 6635
1231 Ga0500555_031479 3300053103 Bacteria 1503
1232 Ga0500556_0032494 3300053104 Bacteria 1783
1233 Ga0500556_0106605 3300053104 Bacteria 1084
1234 Ga0500557_000039 3300053105 Bacteria 66862
1235 Ga0500562_000608 3300053108 Bacteria 8644
1236 Ga0500562_001033 3300053108 Bacteria 6815
1237 Ga0500572_000026 3300053111 Bacteria 45518
1238 Ga0500572_000344 3300053111 Bacteria 16637
1239 Ga0500572_001098 3300053111 Bacteria 7936
1240 Ga0500591_132517 3300053115 Bacteria 1002
1241 Ga0500592_037410 3300053116 Bacteria 784
1242 Ga0500592_043485 3300053116 Bacteria 728
1243 Ga0500594_0000138 3300053118 Bacteria 20114
1244 Ga0500595_001915 3300053119 Bacteria 10728
1245 Ga0500595_002372 3300053119 Bacteria 9413
1246 Ga0500595_003808 3300053119 Bacteria 6935
1247 Ga0500595_004822 3300053119 Bacteria 5969
1248 Ga0500595_005581 3300053119 Bacteria 5476
1249 Ga0500595_009864 3300053119 Bacteria 3831
1250 Ga0500595_016291 3300053119 Bacteria 2772
1251 Ga0500597_129962 3300053120 Bacteria 1089
1252 Ga0500607_025494 3300053121 Bacteria 3290
1253 Ga0500608_000023 3300053122 Bacteria 72341
1254 Ga0500608_019488 3300053122 Bacteria 3112
1255 Ga0500608_141741 3300053122 Bacteria 1064
1256 Ga0500614_008827 3300053123 Bacteria 2142
1257 Ga0500614_010766 3300053123 Bacteria 1968
1258 Ga0500621_016170 3300053126 Bacteria 2759
1259 Ga0500642_0000063 3300053130 Bacteria 58680
1260 Ga0500642_0019596 3300053130 Bacteria 2642
1261 Ga0500652_079500 3300053131 Bacteria 1365
1262 Ga0500655_034645 3300053133 Bacteria 980
1263 Ga0500658_0049187 3300053134 Bacteria 1717
1264 Ga0500658_0146711 3300053134 Bacteria 1061
1265 Ga0500559_0000002 3300053136 Bacteria 262002
1266 Ga0500559_0001395 3300053136 Bacteria 13743
1267 Ga0500559_0003076 3300053136 Bacteria 8326
1268 Ga0500559_0007457 3300053136 Bacteria 4847
1269 Ga0500559_0146195 3300053136 Bacteria 1108
1270 Ga0500559_0180086 3300053136 Bacteria 995
1271 Ga0500561_0046394 3300053137 Bacteria 1169
1272 Ga0500564_000305 3300053138 Bacteria 13757
1273 Ga0500568_0141317 3300053139 Bacteria 892
1274 Ga0500577_0000092 3300053142 Bacteria 21385
1275 Ga0500577_0223170 3300053142 Bacteria 816
1276 Ga0500585_141361 3300053144 Bacteria 847
1277 Ga0500603_025338 3300053150 Bacteria 1491
1278 Ga0500616_0023510 3300053153 Bacteria 3432
1279 Ga0500619_003604 3300053154 Bacteria 3200
1280 Ga0500622_0000284 3300053156 Bacteria 51631
1281 Ga0500622_0003739 3300053156 Bacteria 9948
1282 Ga0500622_0017705 3300053156 Bacteria 3791
1283 Ga0500622_0038142 3300053156 Bacteria 2507
1284 Ga0500627_0003805 3300053158 Bacteria 4740
1285 Ga0500627_0055665 3300053158 Bacteria 1732
1286 Ga0500630_000572 3300053159 Bacteria 16714
1287 Ga0500633_0120469 3300053160 Bacteria 976
1288 Ga0500634_0041129 3300053161 Bacteria 2510
1289 Ga0500638_000124 3300053162 Bacteria 14946
1290 Ga0500638_073702 3300053162 Bacteria 1629
1291 Ga0500638_192661 3300053162 Bacteria 869
1292 Ga0500639_000353 3300053163 Bacteria 22721
1293 Ga0500639_104745 3300053163 Bacteria 1386
1294 Ga0500639_158560 3300053163 Bacteria 1033
1295 Ga0500636_0027446 3300053177 Bacteria 3364
1296 Ga0500636_0207102 3300053177 Bacteria 1032
1297 Ga0500637_0000356 3300053178 Bacteria 17344
1298 Ga0500637_0053738 3300053178 Bacteria 2299
1299 Ga0500576_040143 3300053725 Bacteria 2109
1300 Ga0500625_080811 3300053729 Bacteria 1419
1301 Ga0500645_014088 3300053730 Bacteria 2554
1302 Ga0500596_004103 3300053735 Bacteria 2699
1303 Ga0500596_006575 3300053735 Bacteria 1956
1304 Ga0500599_001756 3300053736 Bacteria 2537
1305 Ga0501084_0001541 3300054114 Bacteria 18335
1306 Ga0501084_0007455 3300054114 Bacteria 9018
1307 Ga0501084_0045054 3300054114 Bacteria 3694
1308 Ga0500661_000328 3300055283 Bacteria 8643
1309 Ga0590074_010167 3300059423 Bacteria 1573
1310 Ga0587084_036967 3300059477 Bacteria 813
1311 Ga0587084_048941 3300059477 Bacteria 743
1312 Ga0587084_051779 3300059477 Bacteria 729
1313 Ga0587084_072327 3300059477 Bacteria 653
1314 Ga0587077_083954 3300059493 Bacteria 736
1315 Ga0587085_051521 3300059506 Bacteria 751
1316 Ga0587086_030546 3300059507 Bacteria 790
1317 Ga0587101_051517 3300059623 Bacteria 710
1318 Ga0587115_040151 3300059626 Bacteria 728
1319 Ga0587062_041186 3300059639 Bacteria 750
1320 Ga0587068_031220 3300059641 Bacteria 925
1321 Ga0587068_054066 3300059641 Bacteria 758
1322 Ga0587072_070570 3300059643 Bacteria 737
1323 Ga0587079_080167 3300059647 Bacteria 745
1324 Ga0501082_0003607 3300060353 Bacteria 13517
1325 Ga0501082_0005568 3300060353 Bacteria 10936
1326 Ga0501082_0117648 3300060353 Bacteria 2302
1327 Ga0501082_0273588 3300060353 Bacteria 1470
1328 Ga0501082_0643757 3300060353 Bacteria 928
1329 Ga0501082_0746699 3300060353 Bacteria 856
1330 Ga0530510_0000429 3300061734 Bacteria 27096
1331 Ga0530510_0005706 3300061734 Bacteria 8623
1332 Ga0530510_0007861 3300061734 Bacteria 7438
1333 Ga0530510_0033114 3300061734 Bacteria 3720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042005 Ga0439448_0020795 Ga0439448_0020795_18_548 175
2 3300049578 Ga0501042_0101129 Ga0501042_0101129_80_610 175
3 3300049589 Ga0501073_0341263 Ga0501073_0341263_478_1008 175
4 3300049592 Ga0501076_0273486 Ga0501076_0273486_780_1310 175
5 3300049570 Ga0501033_0666746 Ga0501033_0666746_14_631 186
6 3300049583 Ga0501067_0083497 Ga0501067_0083497_12_575 187
7 3300005329 Ga0070683_100499675 Ga0070683_1004996752 191
8 3300009177 Ga0105248_11792607 Ga0105248_117926071 191
9 3300039437 Ga0436365_1118553 Ga0436365_1118553_1295_1870 191
10 3300039438 Ga0436360_0355615 Ga0436360_0355615_15_590 191
11 3300041452 Ga0451793_1221768 Ga0451793_1221768_28_603 191
12 3300042435 Ga0439434_0160628 Ga0439434_0160628_148_723 191
13 3300046522 Ga0495643_0134258 Ga0495643_0134258_30_605 191
14 3300046539 Ga0495621_0076579 Ga0495621_0076579_222_797 191
15 3300046660 Ga0495625_0203516 Ga0495625_0203516_33_608 191
16 3300049533 Ga0501317_046203 Ga0501317_046203_14_589 191
17 3300049552 Ga0501336_018612 Ga0501336_018612_25_600 191
18 3300049571 Ga0501034_0891302 Ga0501034_0891302_190_765 191
19 3300053087 Ga0500643_010462 Ga0500643_010462_2321_2896 191
20 3300039062 Ga0400483_218418 Ga0400483_218418_16830_17447 192
21 3300039062 Ga0400483_275881 Ga0400483_275881_264_884 193
22 3300039062 Ga0400483_052412 Ga0400483_052412_3815_4435 194
23 3300039062 Ga0400483_217638 Ga0400483_217638_23807_24427 194
24 iso_pu_bacteria 8016566248 8016574777 194
25 3300038735 Ga0400485_03320 Ga0400485_03320_3049_3669 196
26 iso_pu_bacteria 8019547302 8019555521 197
27 3300049571 Ga0501034_0052520 Ga0501034_0052520_640_1257 198
28 3300049582 Ga0501048_0547898 Ga0501048_0547898_175_792 198
29 3300049584 Ga0501068_0205588 Ga0501068_0205588_226_843 198
30 3300049589 Ga0501073_0094101 Ga0501073_0094101_1447_2064 198
31 3300049823 Ga0501044_0110240 Ga0501044_0110240_2106_2723 198
32 iso_pu_bacteria 2883291878 2883295631 200
33 3300005937 Ga0081455_10010819 Ga0081455_1001081911 201
34 3300005981 Ga0081538_10003068 Ga0081538_100030683 201
35 3300005981 Ga0081538_10022376 Ga0081538_100223763 201
36 3300006844 Ga0075428_100000612 Ga0075428_10000061235 201
37 3300006844 Ga0075428_100006199 Ga0075428_10000619920 201
38 3300006844 Ga0075428_100074390 Ga0075428_1000743905 201
39 3300006844 Ga0075428_100217357 Ga0075428_1002173573 201
40 3300006846 Ga0075430_100000371 Ga0075430_10000037130 201
41 3300006846 Ga0075430_100007366 Ga0075430_10000736610 201
42 3300006847 Ga0075431_100000784 Ga0075431_10000078429 201
43 3300006847 Ga0075431_100044588 Ga0075431_1000445887 201
44 3300006847 Ga0075431_100120241 Ga0075431_1001202415 201
45 3300006880 Ga0075429_100001166 Ga0075429_10000116632 201
46 3300006880 Ga0075429_100003441 Ga0075429_1000034413 201
47 3300006880 Ga0075429_100115656 Ga0075429_1001156563 201
48 3300006880 Ga0075429_100675920 Ga0075429_1006759202 201
49 3300009094 Ga0111539_10354154 Ga0111539_103541542 201
50 3300009147 Ga0114129_10033846 Ga0114129_100338462 201
51 3300009147 Ga0114129_10281198 Ga0114129_102811982 201
52 3300009147 Ga0114129_10285719 Ga0114129_102857193 201
53 3300031903 Ga0307407_10073331 Ga0307407_100733313 201
54 3300042008 Ga0439450_015569 Ga0439450_015569_299_913 201
55 3300042011 Ga0439454_000646 Ga0439454_000646_759_1373 201
56 3300042012 Ga0439455_0004924 Ga0439455_0004924_2037_2651 201
57 3300042016 Ga0439463_001082 Ga0439463_001082_6006_6620 201
58 3300042439 Ga0439464_0007526 Ga0439464_0007526_1616_2230 201
59 3300042461 Ga0439460_0007151 Ga0439460_0007151_1693_2307 201
60 3300042993 Ga0439440_0012915 Ga0439440_0012915_115_729 201
61 3300049568 Ga0501031_0018753 Ga0501031_0018753_3761_4375 201
62 3300049568 Ga0501031_0131864 Ga0501031_0131864_738_1352 201
63 3300049569 Ga0501032_0036721 Ga0501032_0036721_2075_2689 201
64 3300049569 Ga0501032_0408136 Ga0501032_0408136_190_804 201
65 3300049570 Ga0501033_0010145 Ga0501033_0010145_5258_5872 201
66 3300049570 Ga0501033_0062673 Ga0501033_0062673_50_664 201
67 3300049572 Ga0501036_0019870 Ga0501036_0019870_3539_4153 201
68 3300049572 Ga0501036_0045518 Ga0501036_0045518_1377_1991 201
69 3300049573 Ga0501037_0132577 Ga0501037_0132577_793_1407 201
70 3300049573 Ga0501037_0143231 Ga0501037_0143231_782_1396 201
71 3300049574 Ga0501038_0061441 Ga0501038_0061441_1186_1800 201
72 3300049574 Ga0501038_0210776 Ga0501038_0210776_853_1467 201
73 3300049575 Ga0501039_0001765 Ga0501039_0001765_13644_14258 201
74 3300049575 Ga0501039_0082192 Ga0501039_0082192_1317_1931 201
75 3300049576 Ga0501040_0002053 Ga0501040_0002053_2098_2712 201
76 3300049576 Ga0501040_0041569 Ga0501040_0041569_1342_1956 201
77 3300049577 Ga0501041_0032148 Ga0501041_0032148_1059_1673 201
78 3300049577 Ga0501041_0107255 Ga0501041_0107255_1103_1717 201
79 3300049578 Ga0501042_0006496 Ga0501042_0006496_5962_6576 201
80 3300049579 Ga0501043_0083945 Ga0501043_0083945_718_1332 201
81 3300049579 Ga0501043_0382572 Ga0501043_0382572_156_770 201
82 3300049580 Ga0501046_0013607 Ga0501046_0013607_4701_5315 201
83 3300049580 Ga0501046_0033739 Ga0501046_0033739_1402_2016 201
84 3300049584 Ga0501068_0046288 Ga0501068_0046288_1747_2361 201
85 3300049584 Ga0501068_0166528 Ga0501068_0166528_146_760 201
86 3300049587 Ga0501071_0002499 Ga0501071_0002499_8916_9530 201
87 3300049587 Ga0501071_0083826 Ga0501071_0083826_169_783 201
88 3300049588 Ga0501072_0000404 Ga0501072_0000404_13639_14253 201
89 3300049588 Ga0501072_0005957 Ga0501072_0005957_7292_7906 201
90 3300049590 Ga0501074_0020761 Ga0501074_0020761_1524_2138 201
91 3300049590 Ga0501074_0068008 Ga0501074_0068008_1839_2453 201
92 3300049591 Ga0501075_0003123 Ga0501075_0003123_1403_2017 201
93 3300049591 Ga0501075_0056549 Ga0501075_0056549_1543_2157 201
94 3300049591 Ga0501075_0081749 Ga0501075_0081749_1578_2192 201
95 3300049592 Ga0501076_0014532 Ga0501076_0014532_3815_4429 201
96 3300049592 Ga0501076_0051590 Ga0501076_0051590_1406_2020 201
97 3300049593 Ga0501077_0002661 Ga0501077_0002661_3211_3825 201
98 3300049593 Ga0501077_0007349 Ga0501077_0007349_1362_1976 201
99 3300049593 Ga0501077_0014674 Ga0501077_0014674_3448_4062 201
100 3300049741 Ga0501079_0017122 Ga0501079_0017122_1441_2055 201
101 3300049741 Ga0501079_0078560 Ga0501079_0078560_1075_1689 201
102 3300049743 Ga0501081_0005768 Ga0501081_0005768_6031_6645 201
103 3300049743 Ga0501081_0090285 Ga0501081_0090285_161_775 201
104 3300049822 Ga0501035_0317235 Ga0501035_0317235_162_776 201
105 3300049824 Ga0501045_0000769 Ga0501045_0000769_5992_6606 201
106 3300049824 Ga0501045_0033121 Ga0501045_0033121_1371_1985 201
107 3300050507 nmdc:mga05p37_112203_c1 nmdc:mga05p37_112203_c1_1110_1724 201
108 3300050507 nmdc:mga05p37_154934_c1 nmdc:mga05p37_154934_c1_1635_2249 201
109 3300050507 nmdc:mga05p37_171_c1 nmdc:mga05p37_171_c1_37021_37635 201
110 3300050507 nmdc:mga05p37_478512_c1 nmdc:mga05p37_478512_c1_274_888 201
111 3300050507 nmdc:mga05p37_634367_c1 nmdc:mga05p37_634367_c1_560_1174 201
112 3300050507 nmdc:mga05p37_94514_c1 nmdc:mga05p37_94514_c1_2263_2877 201
113 3300050508 nmdc:mga09592_183_c1 nmdc:mga09592_183_c1_15055_15669 201
114 3300050508 nmdc:mga09592_192657_c1 nmdc:mga09592_192657_c1_42_656 201
115 3300050508 nmdc:mga09592_565_c1 nmdc:mga09592_565_c1_24169_24783 201
116 3300050508 nmdc:mga09592_617536_c1 nmdc:mga09592_617536_c1_192_806 201
117 3300050509 nmdc:mga0qj67_14906_c1 nmdc:mga0qj67_14906_c1_4458_5072 201
118 3300050509 nmdc:mga0qj67_300347_c1 nmdc:mga0qj67_300347_c1_275_889 201
119 3300050509 nmdc:mga0qj67_306246_c1 nmdc:mga0qj67_306246_c1_331_945 201
120 3300050509 nmdc:mga0qj67_337702_c1 nmdc:mga0qj67_337702_c1_257_871 201
121 3300050509 nmdc:mga0qj67_538_c1 nmdc:mga0qj67_538_c1_4346_4960 201
122 3300050510 nmdc:mga06r32_102130_c1 nmdc:mga06r32_102130_c1_1700_2314 201
123 3300050510 nmdc:mga06r32_10511_c1 nmdc:mga06r32_10511_c1_4458_5072 201
124 3300050510 nmdc:mga06r32_156443_c1 nmdc:mga06r32_156443_c1_276_890 201
125 3300050510 nmdc:mga06r32_342_c1 nmdc:mga06r32_342_c1_26778_27392 201
126 3300050510 nmdc:mga06r32_54803_c1 nmdc:mga06r32_54803_c1_1483_2097 201
127 3300054114 Ga0501084_0007455 Ga0501084_0007455_3301_3915 201
128 3300054114 Ga0501084_0045054 Ga0501084_0045054_1688_2302 201
129 3300059423 Ga0590074_010167 Ga0590074_010167_654_1268 201
130 3300060353 Ga0501082_0005568 Ga0501082_0005568_5368_5982 201
131 3300060353 Ga0501082_0117648 Ga0501082_0117648_541_1155 201
132 3300061734 Ga0530510_0000429 Ga0530510_0000429_12506_13120 201
133 3300061734 Ga0530510_0007861 Ga0530510_0007861_1701_2315 201
134 3300061734 Ga0530510_0033114 Ga0530510_0033114_1727_2341 201
135 iso_pu_bacteria 2508501009 2508544080 201
136 iso_pu_bacteria 2508501128 2509153763 201
137 iso_pu_bacteria 2513237096 2513660051 201
138 iso_pu_bacteria 2513237098 2513676488 201
139 iso_pu_bacteria 2513237101 2513696983 201
140 iso_pu_bacteria 2513237137 2513858229 201
141 iso_pu_bacteria 2513237145 2513922139 201
142 iso_pu_bacteria 2517572143 2517893882 201
143 iso_pu_bacteria 2524023228 2524537849 201
144 iso_pu_bacteria 2534681786 2535484567 201
145 iso_pu_bacteria 2545555834 2545678007 201
146 iso_pu_bacteria 2582581279 2585147323 201
147 iso_pu_bacteria 2582581280 2585150763 201
148 iso_pu_bacteria 2582581293 2585195735 201
149 iso_pu_bacteria 2585428106 2587916167 201
150 iso_pu_bacteria 2595698237 2596371274 201
151 iso_pu_bacteria 2643221545 2643751184 201
152 iso_pu_bacteria 2643221552 2643780554 201
153 iso_pu_bacteria 2643221584 2643929197 201
154 iso_pu_bacteria 2643221640 2644227337 201
155 iso_pu_bacteria 2643221642 2644233195 201
156 iso_pu_bacteria 2643221651 2644287793 201
157 iso_pu_bacteria 2643221691 2644511150 201
158 iso_pu_bacteria 2667528175 2671122875 201
159 iso_pu_bacteria 2671180139 2671692796 201
160 iso_pu_bacteria 2721755755 2723846426 201
161 iso_pu_bacteria 2728368998 2728748009 201
162 iso_pu_bacteria 2738541281 2738743370 201
163 iso_pu_bacteria 2738543032 2739352987 201
164 iso_pu_bacteria 2739367756 2739793299 201
165 iso_pu_bacteria 2751185800 2753359147 201
166 iso_pu_bacteria 2757320392 2757570020 201
167 iso_pu_bacteria 2758568016 2758641391 201
168 iso_pu_bacteria 2791355048 2792460098 201
169 iso_pu_bacteria 2791355197 2793072479 201
170 iso_pu_bacteria 2791355199 2793076915 201
171 iso_pu_bacteria 2818991435 2819538689 201
172 iso_pu_bacteria 2818991454 2819646777 201
173 iso_pu_bacteria 2843744320 2843746665 201
174 iso_pu_bacteria 2844315083 2844317684 201
175 iso_pu_bacteria 2849560528 2849563781 201
176 iso_pu_bacteria 2849573788 2849576102 201
177 iso_pu_bacteria 2851153111 2851154917 201
178 iso_pu_bacteria 2854911287 2854915170 201
179 iso_pu_bacteria 2857504554 2857507458 201
180 iso_pu_bacteria 2874604998 2874610606 201
181 iso_pu_bacteria 2874620515 2874623165 201
182 iso_pu_bacteria 2876808645 2876816247 201
183 iso_pu_bacteria 2879110137 2879118668 201
184 iso_pu_bacteria 2884960567 2884962731 201
185 iso_pu_bacteria 2885366525 2885368887 201
186 iso_pu_bacteria 2885374607 2885382470 201
187 iso_pu_bacteria 2885383462 2885387390 201
188 iso_pu_bacteria 2889033259 2889039060 201
189 iso_pu_bacteria 2889306138 2889306345 201
190 iso_pu_bacteria 2894817345 2894818995 201
191 iso_pu_bacteria 2898329390 2898331456 201
192 iso_pu_bacteria 2902330777 2902334960 201
193 iso_pu_bacteria 2902405164 2902408077 201
194 iso_pu_bacteria 2903727486 2903735364 201
195 iso_pu_bacteria 2903748898 2903750453 201
196 iso_pu_bacteria 2903768456 2903771736 201
197 iso_pu_bacteria 2904666416 2904669985 201
198 iso_pu_bacteria 2904690495 2904693470 201
199 iso_pu_bacteria 2904699407 2904700698 201
200 iso_pu_bacteria 2906602504 2906608717 201
201 iso_pu_bacteria 2906610324 2906610772 201
202 iso_pu_bacteria 2906626472 2906630150 201
203 iso_pu_bacteria 2906635258 2906635928 201
204 iso_pu_bacteria 2906660503 2906663975 201
205 iso_pu_bacteria 2908739725 2908744282 201
206 iso_pu_bacteria 2908756301 2908761795 201
207 iso_pu_bacteria 2915650412 2915651658 201
208 iso_pu_bacteria 2917554339 2917557478 201
209 iso_pu_bacteria 2922361189 2922362237 201
210 iso_pu_bacteria 2922386360 2922388008 201
211 iso_pu_bacteria 2922425934 2922428553 201
212 iso_pu_bacteria 2928125067 2928126203 201
213 iso_pu_bacteria 2928531327 2928534269 201
214 iso_pu_bacteria 2932401849 2932402893 201
215 iso_pu_bacteria 2935630451 2935634533 201
216 iso_pu_bacteria 2935769743 2935771432 201
217 iso_pu_bacteria 2935777560 2935779121 201
218 iso_pu_bacteria 2935785616 2935788325 201
219 iso_pu_bacteria 2935793552 2935800862 201
220 iso_pu_bacteria 2935908558 2935911737 201
221 iso_pu_bacteria 2935916978 2935919392 201
222 iso_pu_bacteria 2935926038 2935928766 201
223 iso_pu_bacteria 2935934488 2935938411 201
224 iso_pu_bacteria 2935942939 2935945697 201
225 iso_pu_bacteria 2935951376 2935954696 201
226 iso_pu_bacteria 2935967501 2935970583 201
227 iso_pu_bacteria 2941507105 2941509019 201
228 iso_pu_bacteria 2941515067 2941516848 201
229 iso_pu_bacteria 2941523033 2941525057 201
230 iso_pu_bacteria 2941531003 2941536324 201
231 iso_pu_bacteria 3005474847 3005478684 201
232 iso_pu_bacteria 3005594810 3005597420 201
233 iso_pu_bacteria 3005718088 3005720862 201
234 iso_pu_bacteria 641522639 641642475 201
235 iso_pu_bacteria 643348564 643598139 201
236 iso_pu_bacteria 8006933436 8006942675 201
237 iso_pu_bacteria 8006964411 8006964812 201
238 iso_pu_bacteria 8006973647 8006982402 201
239 iso_pu_bacteria 8006984368 8006991791 201
240 iso_pu_bacteria 8006994254 8006995548 201
241 iso_pu_bacteria 8016522445 8016522953 201
242 iso_pu_bacteria 8016530956 8016536414 201
243 iso_pu_bacteria 8016539877 8016540695 201
244 iso_pu_bacteria 8016557553 8016560929 201
245 iso_pu_bacteria 8016575299 8016578852 201
246 iso_pu_bacteria 8016583857 8016590787 201
247 iso_pu_bacteria 8016595262 8016598797 201
248 iso_pu_bacteria 8016603502 8016612284 201
249 iso_pu_bacteria 8016622563 8016628437 201
250 iso_pu_bacteria 8019530166 8019536135 201
251 iso_pu_bacteria 8019538911 8019543336 201
252 iso_pu_bacteria 8019555841 8019558442 201
253 iso_pu_bacteria 8019565922 8019566856 201
254 iso_pu_bacteria 8019648815 8019656421 201
255 iso_pu_bacteria 8019687851 8019688383 201
256 iso_pu_bacteria 8045864390 8045865095 201
257 iso_pu_bacteria 8056673599 8056676406 201
258 iso_pu_bacteria 8056689827 8056691867 201
259 iso_pu_bacteria 8056967851 8056969488 201
260 iso_pu_bacteria 8057529695 8057530600 201
261 3300039062 Ga0400483_023760 Ga0400483_023760_5668_6288 202
262 3300039062 Ga0400483_257882 Ga0400483_257882_664_1284 202
263 3300039062 Ga0400483_272292 Ga0400483_272292_1242_1862 202
264 3300003771 Ga0055526_1028152 Ga0055526_10281522 204
265 3300003781 Ga0055536_1011111 Ga0055536_10111112 204
266 3300005458 Ga0070681_10041919 Ga0070681_100419192 204
267 3300005458 Ga0070681_10099566 Ga0070681_100995661 204
268 3300005467 Ga0070706_100282188 Ga0070706_1002821881 204
269 3300005467 Ga0070706_100557247 Ga0070706_1005572471 204
270 3300005468 Ga0070707_100926281 Ga0070707_1009262811 204
271 3300005518 Ga0070699_100130782 Ga0070699_1001307822 204
272 3300005539 Ga0068853_100057282 Ga0068853_1000572823 204
273 3300005546 Ga0070696_100171209 Ga0070696_1001712091 204
274 3300005841 Ga0068863_100935709 Ga0068863_1009357091 204
275 3300006163 Ga0070715_10210497 Ga0070715_102104971 204
276 3300006173 Ga0070716_100242252 Ga0070716_1002422522 204
277 3300007265 Ga0099794_10226604 Ga0099794_102266042 204
278 3300009551 Ga0105238_10006387 Ga0105238_100063874 204
279 3300013105 Ga0157369_10817895 Ga0157369_108178951 204
280 3300013297 Ga0157378_10720057 Ga0157378_107200572 204
281 3300013306 Ga0163162_11116593 Ga0163162_111165932 204
282 3300014325 Ga0163163_10180728 Ga0163163_101807283 204
283 3300014325 Ga0163163_10242858 Ga0163163_102428581 204
284 3300025292 Ga0209676_1000026 Ga0209676_1000026203 204
285 3300025298 Ga0209050_1004246 Ga0209050_100424610 204
286 3300025910 Ga0207684_10284644 Ga0207684_102846441 204
287 3300025912 Ga0207707_10235479 Ga0207707_102354792 204
288 3300025912 Ga0207707_10442252 Ga0207707_104422521 204
289 3300025915 Ga0207693_10215389 Ga0207693_102153891 204
290 3300025922 Ga0207646_10765904 Ga0207646_107659041 204
291 3300025924 Ga0207694_10025852 Ga0207694_100258524 204
292 3300025939 Ga0207665_10399042 Ga0207665_103990421 204
293 3300025945 Ga0207679_10566261 Ga0207679_105662611 204
294 3300026041 Ga0207639_10056544 Ga0207639_100565443 204
295 3300026088 Ga0207641_10885041 Ga0207641_108850411 204
296 3300031235 Ga0265330_10120172 Ga0265330_101201721 204
297 3300031250 Ga0265331_10001629 Ga0265331_100016296 204
298 3300031595 Ga0265313_10000290 Ga0265313_1000029031 204
299 3300031711 Ga0265314_10054614 Ga0265314_100546141 204
300 3300031712 Ga0265342_10015375 Ga0265342_100153754 204
301 3300035111 Ga0373923_0346578 Ga0373923_0346578_28_642 204
302 3300035113 Ga0373936_0034573 Ga0373936_0034573_1084_1698 204
303 3300036401 Ga0373937_0144521 Ga0373937_0144521_1307_1921 204
304 3300037068 Ga0373925_0039383 Ga0373925_0039383_2444_3118 204
305 3300039062 Ga0400483_040634 Ga0400483_040634_2014_2628 204
306 3300039062 Ga0400483_183320 Ga0400483_183320_2145_2759 204
307 3300039062 Ga0400483_193625 Ga0400483_193625_4495_5160 204
308 3300039438 Ga0436360_0412786 Ga0436360_0412786_357_971 204
309 3300046683 Ga0495658_0215711 Ga0495658_0215711_65_679 204
310 3300046689 Ga0495613_0584005 Ga0495613_0584005_26_640 204
311 3300049593 Ga0501077_0066656 Ga0501077_0066656_1434_2048 204
312 3300053078 Ga0495612_0143475 Ga0495612_0143475_201_815 204
313 3300060353 Ga0501082_0643757 Ga0501082_0643757_287_910 204
314 3300000531 CNBas_1004380 CNBas_10043801 205
315 3300001989 JGI24739J22299_10120830 JGI24739J22299_101208301 205
316 3300002067 JGI24735J21928_10014695 JGI24735J21928_100146951 205
317 3300002075 JGI24738J21930_10071137 JGI24738J21930_100711371 205
318 3300003203 JGI25406J46586_10000101 JGI25406J46586_100001011 205
319 3300003773 Ga0055537_1001423 Ga0055537_10014236 205
320 3300003775 Ga0055524_1005289 Ga0055524_100528910 205
321 3300003775 Ga0055524_1033973 Ga0055524_10339731 205
322 3300003790 Ga0055528_1004840 Ga0055528_10048409 205
323 3300003791 Ga0055530_10002837 Ga0055530_100028379 205
324 3300003791 Ga0055530_10023172 Ga0055530_100231721 205
325 3300003794 Ga0055531_10001240 Ga0055531_1000124011 205
326 3300003794 Ga0055531_10002429 Ga0055531_100024299 205
327 3300003794 Ga0055531_10004719 Ga0055531_100047191 205
328 3300003794 Ga0055531_10024439 Ga0055531_100244391 205
329 3300004625 Ga0055543_1018162 Ga0055543_10181622 205
330 3300004803 Ga0058862_12854699 Ga0058862_128546991 205
331 3300005262 Ga0065165_1000041 Ga0065165_100004129 205
332 3300005262 Ga0065165_1000633 Ga0065165_100063337 205
333 3300005290 Ga0065712_10253498 Ga0065712_102534981 205
334 3300005327 Ga0070658_10106345 Ga0070658_101063451 205
335 3300005327 Ga0070658_10144361 Ga0070658_101443612 205
336 3300005327 Ga0070658_10561700 Ga0070658_105617001 205
337 3300005329 Ga0070683_100072208 Ga0070683_1000722083 205
338 3300005331 Ga0070670_100000101 Ga0070670_1000001016 205
339 3300005331 Ga0070670_100587604 Ga0070670_1005876041 205
340 3300005335 Ga0070666_10067482 Ga0070666_100674821 205
341 3300005335 Ga0070666_10091155 Ga0070666_100911552 205
342 3300005336 Ga0070680_100009670 Ga0070680_1000096704 205
343 3300005336 Ga0070680_100010206 Ga0070680_1000102062 205
344 3300005336 Ga0070680_100116799 Ga0070680_1001167992 205
345 3300005338 Ga0068868_100069182 Ga0068868_1000691822 205
346 3300005339 Ga0070660_100010739 Ga0070660_1000107393 205
347 3300005339 Ga0070660_100015321 Ga0070660_1000153211 205
348 3300005339 Ga0070660_100069935 Ga0070660_1000699354 205
349 3300005339 Ga0070660_100088007 Ga0070660_1000880074 205
350 3300005340 Ga0070689_100370609 Ga0070689_1003706092 205
351 3300005341 Ga0070691_10010631 Ga0070691_100106311 205
352 3300005341 Ga0070691_10044810 Ga0070691_100448102 205
353 3300005344 Ga0070661_100205100 Ga0070661_1002051001 205
354 3300005347 Ga0070668_100002639 Ga0070668_10000263910 205
355 3300005347 Ga0070668_100002804 Ga0070668_10000280412 205
356 3300005347 Ga0070668_100006876 Ga0070668_1000068767 205
357 3300005347 Ga0070668_100010442 Ga0070668_1000104425 205
358 3300005347 Ga0070668_100024530 Ga0070668_1000245304 205
359 3300005347 Ga0070668_100031453 Ga0070668_1000314531 205
360 3300005353 Ga0070669_100299233 Ga0070669_1002992332 205
361 3300005353 Ga0070669_100945213 Ga0070669_1009452131 205
362 3300005355 Ga0070671_100010347 Ga0070671_1000103472 205
363 3300005356 Ga0070674_100082069 Ga0070674_1000820692 205
364 3300005364 Ga0070673_100294288 Ga0070673_1002942882 205
365 3300005366 Ga0070659_100007601 Ga0070659_1000076015 205
366 3300005366 Ga0070659_100105258 Ga0070659_1001052583 205
367 3300005366 Ga0070659_100118253 Ga0070659_1001182532 205
368 3300005367 Ga0070667_100000260 Ga0070667_10000026014 205
369 3300005367 Ga0070667_100061934 Ga0070667_1000619343 205
370 3300005367 Ga0070667_100415627 Ga0070667_1004156271 205
371 3300005435 Ga0070714_100010680 Ga0070714_1000106805 205
372 3300005435 Ga0070714_100027346 Ga0070714_1000273463 205
373 3300005436 Ga0070713_100014590 Ga0070713_1000145903 205
374 3300005436 Ga0070713_100183121 Ga0070713_1001831211 205
375 3300005437 Ga0070710_10008646 Ga0070710_100086462 205
376 3300005439 Ga0070711_100022451 Ga0070711_1000224511 205
377 3300005439 Ga0070711_100072618 Ga0070711_1000726183 205
378 3300005439 Ga0070711_100342020 Ga0070711_1003420201 205
379 3300005455 Ga0070663_100033825 Ga0070663_1000338255 205
380 3300005455 Ga0070663_100702779 Ga0070663_1007027791 205
381 3300005456 Ga0070678_100218620 Ga0070678_1002186201 205
382 3300005457 Ga0070662_100343500 Ga0070662_1003435002 205
383 3300005458 Ga0070681_10009749 Ga0070681_100097495 205
384 3300005458 Ga0070681_10020222 Ga0070681_100202224 205
385 3300005458 Ga0070681_10089343 Ga0070681_100893432 205
386 3300005458 Ga0070681_10441312 Ga0070681_104413121 205
387 3300005458 Ga0070681_11059156 Ga0070681_110591561 205
388 3300005466 Ga0070685_10313071 Ga0070685_103130711 205
389 3300005467 Ga0070706_100320492 Ga0070706_1003204922 205
390 3300005471 Ga0070698_100117512 Ga0070698_1001175123 205
391 3300005530 Ga0070679_100042441 Ga0070679_1000424414 205
392 3300005530 Ga0070679_100046034 Ga0070679_1000460344 205
393 3300005530 Ga0070679_100215694 Ga0070679_1002156942 205
394 3300005530 Ga0070679_100267662 Ga0070679_1002676622 205
395 3300005535 Ga0070684_100067429 Ga0070684_1000674293 205
396 3300005535 Ga0070684_100806656 Ga0070684_1008066561 205
397 3300005536 Ga0070697_100013902 Ga0070697_1000139022 205
398 3300005536 Ga0070697_100231132 Ga0070697_1002311322 205
399 3300005539 Ga0068853_100310092 Ga0068853_1003100921 205
400 3300005539 Ga0068853_100481855 Ga0068853_1004818551 205
401 3300005539 Ga0068853_101570104 Ga0068853_1015701041 205
402 3300005543 Ga0070672_100205918 Ga0070672_1002059182 205
403 3300005544 Ga0070686_100245897 Ga0070686_1002458972 205
404 3300005545 Ga0070695_100364240 Ga0070695_1003642401 205
405 3300005546 Ga0070696_100169497 Ga0070696_1001694972 205
406 3300005546 Ga0070696_100490905 Ga0070696_1004909052 205
407 3300005546 Ga0070696_100499431 Ga0070696_1004994311 205
408 3300005548 Ga0070665_100000397 Ga0070665_10000039710 205
409 3300005548 Ga0070665_100000880 Ga0070665_1000008802 205
410 3300005548 Ga0070665_100002230 Ga0070665_10000223011 205
411 3300005548 Ga0070665_100069160 Ga0070665_1000691602 205
412 3300005548 Ga0070665_100502518 Ga0070665_1005025182 205
413 3300005563 Ga0068855_100015616 Ga0068855_1000156166 205
414 3300005563 Ga0068855_100018740 Ga0068855_1000187404 205
415 3300005563 Ga0068855_100039947 Ga0068855_1000399471 205
416 3300005563 Ga0068855_100123883 Ga0068855_1001238834 205
417 3300005563 Ga0068855_100167450 Ga0068855_1001674502 205
418 3300005563 Ga0068855_100271020 Ga0068855_1002710203 205
419 3300005563 Ga0068855_100442475 Ga0068855_1004424752 205
420 3300005564 Ga0070664_100033202 Ga0070664_1000332025 205
421 3300005564 Ga0070664_100084582 Ga0070664_1000845824 205
422 3300005577 Ga0068857_100026104 Ga0068857_1000261045 205
423 3300005577 Ga0068857_100116325 Ga0068857_1001163252 205
424 3300005614 Ga0068856_100134140 Ga0068856_1001341402 205
425 3300005614 Ga0068856_100372226 Ga0068856_1003722262 205
426 3300005615 Ga0070702_100267382 Ga0070702_1002673821 205
427 3300005616 Ga0068852_100130708 Ga0068852_1001307082 205
428 3300005616 Ga0068852_100135812 Ga0068852_1001358122 205
429 3300005616 Ga0068852_100215372 Ga0068852_1002153724 205
430 3300005616 Ga0068852_100559513 Ga0068852_1005595131 205
431 3300005616 Ga0068852_100682386 Ga0068852_1006823862 205
432 3300005617 Ga0068859_100000437 Ga0068859_10000043728 205
433 3300005617 Ga0068859_100016312 Ga0068859_1000163127 205
434 3300005617 Ga0068859_100304730 Ga0068859_1003047302 205
435 3300005618 Ga0068864_100000496 Ga0068864_10000049610 205
436 3300005618 Ga0068864_100000701 Ga0068864_10000070115 205
437 3300005618 Ga0068864_100098794 Ga0068864_1000987942 205
438 3300005618 Ga0068864_100107862 Ga0068864_1001078624 205
439 3300005719 Ga0068861_100124429 Ga0068861_1001244292 205
440 3300005834 Ga0068851_10207230 Ga0068851_102072302 205
441 3300005841 Ga0068863_100000864 Ga0068863_10000086420 205
442 3300005841 Ga0068863_100001649 Ga0068863_10000164912 205
443 3300005841 Ga0068863_100006085 Ga0068863_1000060859 205
444 3300005841 Ga0068863_100009904 Ga0068863_1000099046 205
445 3300005841 Ga0068863_100060517 Ga0068863_1000605173 205
446 3300005841 Ga0068863_100113685 Ga0068863_1001136854 205
447 3300005841 Ga0068863_100465067 Ga0068863_1004650672 205
448 3300005841 Ga0068863_100482290 Ga0068863_1004822902 205
449 3300005842 Ga0068858_100000557 Ga0068858_10000055720 205
450 3300005843 Ga0068860_100000070 Ga0068860_10000007026 205
451 3300005843 Ga0068860_100000309 Ga0068860_10000030950 205
452 3300005844 Ga0068862_100001520 Ga0068862_10000152013 205
453 3300005844 Ga0068862_100056514 Ga0068862_1000565142 205
454 3300005844 Ga0068862_100205590 Ga0068862_1002055902 205
455 3300005844 Ga0068862_100345741 Ga0068862_1003457411 205
456 3300005937 Ga0081455_10002423 Ga0081455_1000242317 205
457 3300005981 Ga0081538_10043188 Ga0081538_100431883 205
458 3300005983 Ga0081540_1019810 Ga0081540_10198103 205
459 3300005983 Ga0081540_1035967 Ga0081540_10359672 205
460 3300005985 Ga0081539_10000008 Ga0081539_10000008490 205
461 3300005985 Ga0081539_10014085 Ga0081539_100140857 205
462 3300006028 Ga0070717_10016637 Ga0070717_100166373 205
463 3300006028 Ga0070717_10070743 Ga0070717_100707433 205
464 3300006038 Ga0075365_10093296 Ga0075365_100932961 205
465 3300006042 Ga0075368_10176869 Ga0075368_101768691 205
466 3300006048 Ga0075363_100124774 Ga0075363_1001247742 205
467 3300006051 Ga0075364_10046198 Ga0075364_100461982 205
468 3300006051 Ga0075364_10370723 Ga0075364_103707231 205
469 3300006163 Ga0070715_10000358 Ga0070715_100003587 205
470 3300006173 Ga0070716_100006533 Ga0070716_1000065333 205
471 3300006175 Ga0070712_100208013 Ga0070712_1002080132 205
472 3300006177 Ga0075362_10037486 Ga0075362_100374862 205
473 3300006178 Ga0075367_10057233 Ga0075367_100572331 205
474 3300006186 Ga0075369_10076845 Ga0075369_100768453 205
475 3300006186 Ga0075369_10081048 Ga0075369_100810481 205
476 3300006186 Ga0075369_10163808 Ga0075369_101638081 205
477 3300006195 Ga0075366_10013172 Ga0075366_100131724 205
478 3300006353 Ga0075370_10069769 Ga0075370_100697693 205
479 3300006358 Ga0068871_100358309 Ga0068871_1003583092 205
480 3300006358 Ga0068871_100804409 Ga0068871_1008044092 205
481 3300006846 Ga0075430_100636539 Ga0075430_1006365391 205
482 3300006847 Ga0075431_100456694 Ga0075431_1004566943 205
483 3300006881 Ga0068865_100004894 Ga0068865_10000489410 205
484 3300006931 Ga0097620_100000437 Ga0097620_10000043728 205
485 3300006931 Ga0097620_100016312 Ga0097620_1000163127 205
486 3300006931 Ga0097620_100304730 Ga0097620_1003047302 205
487 3300007076 Ga0075435_100248266 Ga0075435_1002482662 205
488 3300007788 Ga0099795_10014016 Ga0099795_100140161 205
489 3300009036 Ga0105244_10097418 Ga0105244_100974182 205
490 3300009092 Ga0105250_10057097 Ga0105250_100570973 205
491 3300009093 Ga0105240_10000870 Ga0105240_100008704 205
492 3300009093 Ga0105240_10027333 Ga0105240_100273338 205
493 3300009093 Ga0105240_10040364 Ga0105240_100403645 205
494 3300009093 Ga0105240_10041156 Ga0105240_100411566 205
495 3300009093 Ga0105240_10049045 Ga0105240_100490455 205
496 3300009093 Ga0105240_10123179 Ga0105240_101231792 205
497 3300009093 Ga0105240_10150129 Ga0105240_101501293 205
498 3300009101 Ga0105247_10185132 Ga0105247_101851322 205
499 3300009148 Ga0105243_10187333 Ga0105243_101873333 205
500 3300009174 Ga0105241_10473774 Ga0105241_104737742 205
501 3300009176 Ga0105242_10036107 Ga0105242_100361073 205
502 3300009176 Ga0105242_10831876 Ga0105242_108318761 205
503 3300009176 Ga0105242_10967200 Ga0105242_109672001 205
504 3300009177 Ga0105248_10002557 Ga0105248_100025577 205
505 3300009177 Ga0105248_10007729 Ga0105248_100077293 205
506 3300009177 Ga0105248_10008553 Ga0105248_1000855312 205
507 3300009177 Ga0105248_10791780 Ga0105248_107917801 205
508 3300009545 Ga0105237_10033614 Ga0105237_100336144 205
509 3300009545 Ga0105237_10059315 Ga0105237_100593154 205
510 3300009551 Ga0105238_10003129 Ga0105238_100031292 205
511 3300009551 Ga0105238_10050733 Ga0105238_100507332 205
512 3300009551 Ga0105238_10168139 Ga0105238_101681393 205
513 3300009553 Ga0105249_10005538 Ga0105249_100055389 205
514 3300009553 Ga0105249_10423524 Ga0105249_104235242 205
515 3300009553 Ga0105249_10486055 Ga0105249_104860552 205
516 3300009553 Ga0105249_10512142 Ga0105249_105121422 205
517 3300009553 Ga0105249_10538176 Ga0105249_105381761 205
518 3300010159 Ga0099796_10005800 Ga0099796_100058004 205
519 3300010375 Ga0105239_10032269 Ga0105239_100322692 205
520 3300010375 Ga0105239_10270021 Ga0105239_102700212 205
521 3300010375 Ga0105239_10417378 Ga0105239_104173781 205
522 3300013104 Ga0157370_10050985 Ga0157370_100509855 205
523 3300013104 Ga0157370_10193638 Ga0157370_101936382 205
524 3300013104 Ga0157370_10515923 Ga0157370_105159232 205
525 3300013105 Ga0157369_10011431 Ga0157369_100114314 205
526 3300013105 Ga0157369_10020578 Ga0157369_100205788 205
527 3300013307 Ga0157372_11417165 Ga0157372_114171651 205
528 3300013308 Ga0157375_10084432 Ga0157375_100844325 205
529 3300014325 Ga0163163_10045294 Ga0163163_100452943 205
530 3300014325 Ga0163163_10108001 Ga0163163_101080013 205
531 3300014325 Ga0163163_10275653 Ga0163163_102756532 205
532 3300014497 Ga0182008_10290951 Ga0182008_102909511 205
533 3300014968 Ga0157379_10000373 Ga0157379_100003739 205
534 3300014968 Ga0157379_10030580 Ga0157379_100305804 205
535 3300014968 Ga0157379_10216894 Ga0157379_102168942 205
536 3300017792 Ga0163161_10071187 Ga0163161_100711873 205
537 3300017792 Ga0163161_10401502 Ga0163161_104015022 205
538 3300020070 Ga0206356_11457785 Ga0206356_114577852 205
539 3300020082 Ga0206353_10655117 Ga0206353_106551172 205
540 3300021377 Ga0213874_10046890 Ga0213874_100468902 205
541 3300021384 Ga0213876_10000218 Ga0213876_1000021845 205
542 3300021388 Ga0213875_10080495 Ga0213875_100804952 205
543 3300022467 Ga0224712_10185394 Ga0224712_101853942 205
544 3300025250 Ga0209026_1001465 Ga0209026_10014653 205
545 3300025250 Ga0209026_1012573 Ga0209026_10125731 205
546 3300025254 Ga0209148_1000344 Ga0209148_100034437 205
547 3300025254 Ga0209148_1005887 Ga0209148_10058872 205
548 3300025261 Ga0209233_1021012 Ga0209233_10210122 205
549 3300025263 Ga0209565_1000661 Ga0209565_100066116 205
550 3300025272 Ga0209455_1001281 Ga0209455_10012817 205
551 3300025272 Ga0209455_1009146 Ga0209455_10091462 205
552 3300025273 Ga0209673_1001807 Ga0209673_10018073 205
553 3300025284 Ga0209130_1042331 Ga0209130_10423311 205
554 3300025291 Ga0209675_1051408 Ga0209675_10514082 205
555 3300025292 Ga0209676_1000067 Ga0209676_1000067141 205
556 3300025292 Ga0209676_1000134 Ga0209676_1000134155 205
557 3300025295 Ga0209564_1000164 Ga0209564_1000164100 205
558 3300025295 Ga0209564_1010778 Ga0209564_10107786 205
559 3300025297 Ga0209758_1000555 Ga0209758_100055543 205
560 3300025297 Ga0209758_1000649 Ga0209758_100064920 205
561 3300025297 Ga0209758_1001988 Ga0209758_100198820 205
562 3300025297 Ga0209758_1002062 Ga0209758_100206219 205
563 3300025297 Ga0209758_1011655 Ga0209758_10116553 205
564 3300025298 Ga0209050_1000034 Ga0209050_1000034233 205
565 3300025298 Ga0209050_1000348 Ga0209050_100034815 205
566 3300025298 Ga0209050_1001208 Ga0209050_100120819 205
567 3300025298 Ga0209050_1035716 Ga0209050_10357162 205
568 3300025298 Ga0209050_1046109 Ga0209050_10461091 205
569 3300025299 Ga0209256_1010886 Ga0209256_10108861 205
570 3300025299 Ga0209256_1084284 Ga0209256_10842841 205
571 3300025304 Ga0209257_1000052 Ga0209257_1000052177 205
572 3300025304 Ga0209257_1000066 Ga0209257_1000066144 205
573 3300025304 Ga0209257_1000100 Ga0209257_100010042 205
574 3300025304 Ga0209257_1000424 Ga0209257_100042413 205
575 3300025304 Ga0209257_1000618 Ga0209257_100061824 205
576 3300025315 Ga0207697_10053351 Ga0207697_100533513 205
577 3300025711 Ga0207696_1078880 Ga0207696_10788802 205
578 3300025893 Ga0207682_10050958 Ga0207682_100509581 205
579 3300025898 Ga0207692_10147659 Ga0207692_101476591 205
580 3300025900 Ga0207710_10037028 Ga0207710_100370283 205
581 3300025900 Ga0207710_10038762 Ga0207710_100387621 205
582 3300025900 Ga0207710_10275677 Ga0207710_102756772 205
583 3300025901 Ga0207688_10041574 Ga0207688_100415742 205
584 3300025901 Ga0207688_10047746 Ga0207688_100477462 205
585 3300025903 Ga0207680_10029163 Ga0207680_100291632 205
586 3300025903 Ga0207680_10050436 Ga0207680_100504362 205
587 3300025904 Ga0207647_10003636 Ga0207647_1000363612 205
588 3300025905 Ga0207685_10022739 Ga0207685_100227391 205
589 3300025906 Ga0207699_10002386 Ga0207699_100023863 205
590 3300025906 Ga0207699_10125930 Ga0207699_101259302 205
591 3300025907 Ga0207645_10181878 Ga0207645_101818782 205
592 3300025908 Ga0207643_10138117 Ga0207643_101381171 205
593 3300025908 Ga0207643_10285400 Ga0207643_102854002 205
594 3300025909 Ga0207705_10002082 Ga0207705_100020823 205
595 3300025909 Ga0207705_10088789 Ga0207705_100887893 205
596 3300025909 Ga0207705_10174852 Ga0207705_101748522 205
597 3300025909 Ga0207705_10319137 Ga0207705_103191372 205
598 3300025911 Ga0207654_10027785 Ga0207654_100277852 205
599 3300025911 Ga0207654_10247229 Ga0207654_102472291 205
600 3300025912 Ga0207707_10000466 Ga0207707_1000046637 205
601 3300025912 Ga0207707_10008012 Ga0207707_100080128 205
602 3300025912 Ga0207707_10035840 Ga0207707_100358402 205
603 3300025912 Ga0207707_10037513 Ga0207707_100375133 205
604 3300025912 Ga0207707_10230934 Ga0207707_102309341 205
605 3300025912 Ga0207707_10293286 Ga0207707_102932862 205
606 3300025912 Ga0207707_10506403 Ga0207707_105064032 205
607 3300025913 Ga0207695_10000029 Ga0207695_10000029146 205
608 3300025913 Ga0207695_10001430 Ga0207695_100014308 205
609 3300025913 Ga0207695_10001687 Ga0207695_1000168724 205
610 3300025913 Ga0207695_10006230 Ga0207695_1000623010 205
611 3300025913 Ga0207695_10043806 Ga0207695_100438064 205
612 3300025913 Ga0207695_10057285 Ga0207695_100572855 205
613 3300025913 Ga0207695_10063634 Ga0207695_100636344 205
614 3300025913 Ga0207695_10134339 Ga0207695_101343392 205
615 3300025913 Ga0207695_10183143 Ga0207695_101831432 205
616 3300025913 Ga0207695_10446384 Ga0207695_104463841 205
617 3300025914 Ga0207671_10013462 Ga0207671_100134621 205
618 3300025914 Ga0207671_10057564 Ga0207671_100575642 205
619 3300025914 Ga0207671_10121542 Ga0207671_101215422 205
620 3300025914 Ga0207671_10175859 Ga0207671_101758592 205
621 3300025914 Ga0207671_10256670 Ga0207671_102566702 205
622 3300025914 Ga0207671_10770548 Ga0207671_107705481 205
623 3300025915 Ga0207693_10018646 Ga0207693_100186463 205
624 3300025916 Ga0207663_10028365 Ga0207663_100283652 205
625 3300025916 Ga0207663_10028656 Ga0207663_100286561 205
626 3300025916 Ga0207663_10460513 Ga0207663_104605131 205
627 3300025916 Ga0207663_10815521 Ga0207663_108155211 205
628 3300025917 Ga0207660_10002013 Ga0207660_100020135 205
629 3300025917 Ga0207660_10004908 Ga0207660_100049085 205
630 3300025917 Ga0207660_10048121 Ga0207660_100481212 205
631 3300025917 Ga0207660_10049198 Ga0207660_100491984 205
632 3300025917 Ga0207660_10448611 Ga0207660_104486111 205
633 3300025917 Ga0207660_10476264 Ga0207660_104762641 205
634 3300025918 Ga0207662_10135662 Ga0207662_101356622 205
635 3300025918 Ga0207662_10403451 Ga0207662_104034511 205
636 3300025919 Ga0207657_10004634 Ga0207657_100046347 205
637 3300025920 Ga0207649_10103135 Ga0207649_101031354 205
638 3300025920 Ga0207649_10523330 Ga0207649_105233301 205
639 3300025921 Ga0207652_10002138 Ga0207652_100021385 205
640 3300025921 Ga0207652_10011255 Ga0207652_100112554 205
641 3300025921 Ga0207652_10015469 Ga0207652_100154698 205
642 3300025921 Ga0207652_10024322 Ga0207652_100243225 205
643 3300025921 Ga0207652_10150415 Ga0207652_101504151 205
644 3300025921 Ga0207652_10537001 Ga0207652_105370012 205
645 3300025921 Ga0207652_10889039 Ga0207652_108890391 205
646 3300025922 Ga0207646_10121935 Ga0207646_101219352 205
647 3300025923 Ga0207681_10002433 Ga0207681_1000243313 205
648 3300025923 Ga0207681_10415939 Ga0207681_104159391 205
649 3300025924 Ga0207694_10000131 Ga0207694_1000013143 205
650 3300025924 Ga0207694_10014107 Ga0207694_100141075 205
651 3300025924 Ga0207694_10105194 Ga0207694_101051944 205
652 3300025924 Ga0207694_10125480 Ga0207694_101254801 205
653 3300025924 Ga0207694_10160307 Ga0207694_101603071 205
654 3300025924 Ga0207694_10245872 Ga0207694_102458722 205
655 3300025925 Ga0207650_10000064 Ga0207650_100000646 205
656 3300025925 Ga0207650_10025375 Ga0207650_100253754 205
657 3300025925 Ga0207650_10098260 Ga0207650_100982602 205
658 3300025925 Ga0207650_10693003 Ga0207650_106930031 205
659 3300025927 Ga0207687_10017929 Ga0207687_100179294 205
660 3300025927 Ga0207687_10387715 Ga0207687_103877152 205
661 3300025927 Ga0207687_10964580 Ga0207687_109645801 205
662 3300025928 Ga0207700_10013938 Ga0207700_100139386 205
663 3300025928 Ga0207700_10056499 Ga0207700_100564993 205
664 3300025929 Ga0207664_10249595 Ga0207664_102495951 205
665 3300025929 Ga0207664_10524963 Ga0207664_105249631 205
666 3300025932 Ga0207690_10000170 Ga0207690_1000017047 205
667 3300025932 Ga0207690_10006537 Ga0207690_100065373 205
668 3300025932 Ga0207690_10079124 Ga0207690_100791243 205
669 3300025932 Ga0207690_10359302 Ga0207690_103593021 205
670 3300025933 Ga0207706_10279629 Ga0207706_102796291 205
671 3300025934 Ga0207686_10017727 Ga0207686_100177272 205
672 3300025936 Ga0207670_10671700 Ga0207670_106717001 205
673 3300025937 Ga0207669_10325250 Ga0207669_103252501 205
674 3300025938 Ga0207704_10012197 Ga0207704_100121974 205
675 3300025939 Ga0207665_10000064 Ga0207665_1000006449 205
676 3300025941 Ga0207711_10001318 Ga0207711_1000131816 205
677 3300025941 Ga0207711_10002832 Ga0207711_100028322 205
678 3300025941 Ga0207711_10009573 Ga0207711_100095733 205
679 3300025941 Ga0207711_10021129 Ga0207711_100211293 205
680 3300025941 Ga0207711_10995048 Ga0207711_109950481 205
681 3300025942 Ga0207689_10128904 Ga0207689_101289043 205
682 3300025942 Ga0207689_10643491 Ga0207689_106434912 205
683 3300025942 Ga0207689_10753412 Ga0207689_107534121 205
684 3300025944 Ga0207661_10043844 Ga0207661_100438443 205
685 3300025944 Ga0207661_10283335 Ga0207661_102833352 205
686 3300025945 Ga0207679_10067373 Ga0207679_100673733 205
687 3300025945 Ga0207679_10454341 Ga0207679_104543411 205
688 3300025949 Ga0207667_10012774 Ga0207667_100127744 205
689 3300025949 Ga0207667_10042898 Ga0207667_100428982 205
690 3300025949 Ga0207667_10180188 Ga0207667_101801882 205
691 3300025949 Ga0207667_10200996 Ga0207667_102009962 205
692 3300025949 Ga0207667_10217326 Ga0207667_102173262 205
693 3300025960 Ga0207651_10160210 Ga0207651_101602103 205
694 3300025960 Ga0207651_10310825 Ga0207651_103108252 205
695 3300025961 Ga0207712_10000569 Ga0207712_100005695 205
696 3300025961 Ga0207712_10168262 Ga0207712_101682622 205
697 3300025961 Ga0207712_10311459 Ga0207712_103114592 205
698 3300025961 Ga0207712_10567989 Ga0207712_105679891 205
699 3300025972 Ga0207668_10000003 Ga0207668_1000000360 205
700 3300025972 Ga0207668_10000678 Ga0207668_1000067811 205
701 3300025972 Ga0207668_10016025 Ga0207668_100160254 205
702 3300025972 Ga0207668_10068169 Ga0207668_100681694 205
703 3300025972 Ga0207668_10092129 Ga0207668_100921292 205
704 3300025986 Ga0207658_10000470 Ga0207658_1000047028 205
705 3300025986 Ga0207658_10075281 Ga0207658_100752812 205
706 3300025986 Ga0207658_10148121 Ga0207658_101481212 205
707 3300026023 Ga0207677_10061549 Ga0207677_100615492 205
708 3300026035 Ga0207703_10001508 Ga0207703_1000150821 205
709 3300026035 Ga0207703_10009963 Ga0207703_100099637 205
710 3300026035 Ga0207703_10452893 Ga0207703_104528931 205
711 3300026041 Ga0207639_10005534 Ga0207639_100055347 205
712 3300026041 Ga0207639_10010391 Ga0207639_100103915 205
713 3300026041 Ga0207639_10488418 Ga0207639_104884182 205
714 3300026067 Ga0207678_10637942 Ga0207678_106379421 205
715 3300026078 Ga0207702_10065320 Ga0207702_100653204 205
716 3300026088 Ga0207641_10000067 Ga0207641_1000006714 205
717 3300026088 Ga0207641_10002338 Ga0207641_100023389 205
718 3300026088 Ga0207641_10002399 Ga0207641_1000239916 205
719 3300026088 Ga0207641_10627466 Ga0207641_106274662 205
720 3300026095 Ga0207676_10000285 Ga0207676_1000028527 205
721 3300026095 Ga0207676_10001669 Ga0207676_100016693 205
722 3300026095 Ga0207676_10017334 Ga0207676_100173345 205
723 3300026116 Ga0207674_10003851 Ga0207674_1000385117 205
724 3300026116 Ga0207674_10023460 Ga0207674_100234603 205
725 3300026116 Ga0207674_10064139 Ga0207674_100641394 205
726 3300026116 Ga0207674_11325862 Ga0207674_113258621 205
727 3300026118 Ga0207675_100031120 Ga0207675_1000311202 205
728 3300026118 Ga0207675_100058131 Ga0207675_1000581314 205
729 3300026121 Ga0207683_10091755 Ga0207683_100917552 205
730 3300026121 Ga0207683_10560164 Ga0207683_105601642 205
731 3300026142 Ga0207698_10033186 Ga0207698_100331863 205
732 3300026142 Ga0207698_10042590 Ga0207698_100425903 205
733 3300026142 Ga0207698_10139974 Ga0207698_101399742 205
734 3300026142 Ga0207698_10475900 Ga0207698_104759001 205
735 3300027360 Ga0209969_1024606 Ga0209969_10246062 205
736 3300027378 Ga0209981_1000340 Ga0209981_10003407 205
737 3300027512 Ga0209179_1031830 Ga0209179_10318302 205
738 3300027543 Ga0209999_1001296 Ga0209999_10012965 205
739 3300027866 Ga0209813_10002235 Ga0209813_100022354 205
740 3300027866 Ga0209813_10125183 Ga0209813_101251831 205
741 3300028379 Ga0268266_10000062 Ga0268266_1000006283 205
742 3300028379 Ga0268266_10001802 Ga0268266_1000180214 205
743 3300028379 Ga0268266_10003531 Ga0268266_1000353112 205
744 3300028379 Ga0268266_10016020 Ga0268266_100160204 205
745 3300028379 Ga0268266_10016270 Ga0268266_100162707 205
746 3300028379 Ga0268266_10556631 Ga0268266_105566311 205
747 3300028380 Ga0268265_10001343 Ga0268265_1000134315 205
748 3300028380 Ga0268265_10002488 Ga0268265_1000248812 205
749 3300028380 Ga0268265_10016485 Ga0268265_100164854 205
750 3300028380 Ga0268265_10069519 Ga0268265_100695193 205
751 3300028380 Ga0268265_10081510 Ga0268265_100815102 205
752 3300028380 Ga0268265_10120918 Ga0268265_101209182 205
753 3300028381 Ga0268264_10000029 Ga0268264_1000002953 205
754 3300028381 Ga0268264_10000035 Ga0268264_1000003552 205
755 3300028381 Ga0268264_10000118 Ga0268264_1000011865 205
756 3300028381 Ga0268264_10024356 Ga0268264_100243565 205
757 3300028381 Ga0268264_10053855 Ga0268264_100538552 205
758 3300028558 Ga0265326_10093849 Ga0265326_100938491 205
759 3300028573 Ga0265334_10002345 Ga0265334_100023458 205
760 3300028573 Ga0265334_10006982 Ga0265334_100069822 205
761 3300028573 Ga0265334_10134070 Ga0265334_101340701 205
762 3300028653 Ga0265323_10084554 Ga0265323_100845542 205
763 3300028666 Ga0265336_10002849 Ga0265336_100028498 205
764 3300028786 Ga0307517_10000049 Ga0307517_100000496 205
765 3300028786 Ga0307517_10004318 Ga0307517_1000431814 205
766 3300028786 Ga0307517_10126022 Ga0307517_101260224 205
767 3300028786 Ga0307517_10290175 Ga0307517_102901751 205
768 3300028800 Ga0265338_10000065 Ga0265338_1000006585 205
769 3300028800 Ga0265338_10011636 Ga0265338_1001163610 205
770 3300028800 Ga0265338_10023104 Ga0265338_100231046 205
771 3300028800 Ga0265338_10023917 Ga0265338_100239174 205
772 3300028800 Ga0265338_10220362 Ga0265338_102203622 205
773 3300028800 Ga0265338_10396690 Ga0265338_103966901 205
774 3300029957 Ga0265324_10014325 Ga0265324_100143253 205
775 3300030521 Ga0307511_10002913 Ga0307511_1000291317 205
776 3300030521 Ga0307511_10065390 Ga0307511_100653901 205
777 3300031090 Ga0265760_10018921 Ga0265760_100189213 205
778 3300031240 Ga0265320_10120452 Ga0265320_101204522 205
779 3300031241 Ga0265325_10005453 Ga0265325_100054533 205
780 3300031249 Ga0265339_10001461 Ga0265339_1000146114 205
781 3300031249 Ga0265339_10005966 Ga0265339_100059664 205
782 3300031250 Ga0265331_10039828 Ga0265331_100398281 205
783 3300031250 Ga0265331_10112694 Ga0265331_101126942 205
784 3300031251 Ga0265327_10000334 Ga0265327_1000033425 205
785 3300031251 Ga0265327_10002518 Ga0265327_1000251814 205
786 3300031251 Ga0265327_10005115 Ga0265327_100051158 205
787 3300031344 Ga0265316_10090273 Ga0265316_100902733 205
788 3300031344 Ga0265316_10091351 Ga0265316_100913513 205
789 3300031456 Ga0307513_10000414 Ga0307513_1000041448 205
790 3300031456 Ga0307513_10000431 Ga0307513_1000043115 205
791 3300031456 Ga0307513_10019412 Ga0307513_100194124 205
792 3300031456 Ga0307513_10106608 Ga0307513_101066083 205
793 3300031507 Ga0307509_10176861 Ga0307509_101768611 205
794 3300031595 Ga0265313_10000270 Ga0265313_100002703 205
795 3300031616 Ga0307508_10000090 Ga0307508_1000009055 205
796 3300031616 Ga0307508_10448280 Ga0307508_104482801 205
797 3300031649 Ga0307514_10319746 Ga0307514_103197461 205
798 3300031711 Ga0265314_10035278 Ga0265314_100352782 205
799 3300031711 Ga0265314_10057598 Ga0265314_100575982 205
800 3300031711 Ga0265314_10151527 Ga0265314_101515272 205
801 3300031711 Ga0265314_10245940 Ga0265314_102459402 205
802 3300031712 Ga0265342_10005498 Ga0265342_100054988 205
803 3300031712 Ga0265342_10028716 Ga0265342_100287162 205
804 3300031730 Ga0307516_10000084 Ga0307516_1000008480 205
805 3300031731 Ga0307405_10843136 Ga0307405_108431361 205
806 3300031838 Ga0307518_10350958 Ga0307518_103509581 205
807 3300031903 Ga0307407_10074665 Ga0307407_100746653 205
808 3300031911 Ga0307412_10240913 Ga0307412_102409132 205
809 3300031911 Ga0307412_10440069 Ga0307412_104400692 205
810 3300031995 Ga0307409_100100735 Ga0307409_1001007352 205
811 3300031995 Ga0307409_100318933 Ga0307409_1003189333 205
812 3300031995 Ga0307409_100401457 Ga0307409_1004014571 205
813 3300032002 Ga0307416_101189046 Ga0307416_1011890461 205
814 3300032004 Ga0307414_10861920 Ga0307414_108619201 205
815 3300033179 Ga0307507_10167482 Ga0307507_101674822 205
816 3300033180 Ga0307510_10004617 Ga0307510_100046179 205
817 3300033180 Ga0307510_10005455 Ga0307510_1000545518 205
818 3300033180 Ga0307510_10049660 Ga0307510_100496604 205
819 3300033180 Ga0307510_10180789 Ga0307510_101807892 205
820 3300033442 Ga0315911_1000011 Ga0315911_100001169 205
821 3300033547 Ga0316212_1030239 Ga0316212_10302391 205
822 3300034817 Ga0373948_0047216 Ga0373948_0047216_253_870 205
823 3300035083 Ga0373926_0078469 Ga0373926_0078469_185_907 205
824 3300035083 Ga0373926_0107294 Ga0373926_0107294_73_690 205
825 3300035086 Ga0373934_0015323 Ga0373934_0015323_1647_2264 205
826 3300035086 Ga0373934_0166516 Ga0373934_0166516_23_745 205
827 3300035089 Ga0373944_0002107 Ga0373944_0002107_1003_1620 205
828 3300035092 Ga0373952_0051144 Ga0373952_0051144_217_834 205
829 3300035111 Ga0373923_0008238 Ga0373923_0008238_3078_3695 205
830 3300035111 Ga0373923_0044399 Ga0373923_0044399_793_1515 205
831 3300035112 Ga0373932_0027180 Ga0373932_0027180_816_1433 205
832 3300035113 Ga0373936_0006507 Ga0373936_0006507_2667_3389 205
833 3300035113 Ga0373936_0016751 Ga0373936_0016751_2023_2721 205
834 3300035116 Ga0373945_0014375 Ga0373945_0014375_1890_2507 205
835 3300035116 Ga0373945_0325100 Ga0373945_0325100_24_641 205
836 3300035117 Ga0373953_0044097 Ga0373953_0044097_199_921 205
837 3300035117 Ga0373953_0058182 Ga0373953_0058182_739_1356 205
838 3300035118 Ga0373954_0001303 Ga0373954_0001303_8996_9613 205
839 3300035118 Ga0373954_0113370 Ga0373954_0113370_68_790 205
840 3300035119 Ga0373956_0000726 Ga0373956_0000726_2814_3431 205
841 3300035119 Ga0373956_0044953 Ga0373956_0044953_415_1032 205
842 3300035121 Ga0373960_0102667 Ga0373960_0102667_223_840 205
843 3300035170 Ga0373943_0004812 Ga0373943_0004812_893_1510 205
844 3300035170 Ga0373943_0168271 Ga0373943_0168271_159_776 205
845 3300035171 Ga0373946_0008147 Ga0373946_0008147_2140_2862 205
846 3300035171 Ga0373946_0330958 Ga0373946_0330958_14_631 205
847 3300035172 Ga0373955_0003241 Ga0373955_0003241_3324_3941 205
848 3300035172 Ga0373955_0337575 Ga0373955_0337575_280_897 205
849 3300035410 Ga0373924_0069637 Ga0373924_0069637_676_1293 205
850 3300035691 Ga0373931_0001506 Ga0373931_0001506_9349_9966 205
851 3300035691 Ga0373931_0192097 Ga0373931_0192097_230_847 205
852 3300035692 Ga0373935_0000746 Ga0373935_0000746_157_774 205
853 3300035692 Ga0373935_0142286 Ga0373935_0142286_719_1441 205
854 3300035692 Ga0373935_0148398 Ga0373935_0148398_876_1493 205
855 3300035692 Ga0373935_0267523 Ga0373935_0267523_466_1083 205
856 3300035695 Ga0373927_0001005 Ga0373927_0001005_4279_4896 205
857 3300035695 Ga0373927_0005832 Ga0373927_0005832_314_931 205
858 3300035695 Ga0373927_0007328 Ga0373927_0007328_1575_2192 205
859 3300035695 Ga0373927_0046813 Ga0373927_0046813_173_790 205
860 3300035695 Ga0373927_0072459 Ga0373927_0072459_569_1291 205
861 3300035695 Ga0373927_0140972 Ga0373927_0140972_479_1096 205
862 3300035724 Ga0373933_0002183 Ga0373933_0002183_3680_4351 205
863 3300035724 Ga0373933_0017857 Ga0373933_0017857_2654_3376 205
864 3300035724 Ga0373933_0033690 Ga0373933_0033690_1320_1937 205
865 3300035725 Ga0373947_0005667 Ga0373947_0005667_4808_5530 205
866 3300035725 Ga0373947_0087448 Ga0373947_0087448_867_1484 205
867 3300035725 Ga0373947_0225329 Ga0373947_0225329_397_1014 205
868 3300035725 Ga0373947_0256246 Ga0373947_0256246_469_1086 205
869 3300035725 Ga0373947_0297724 Ga0373947_0297724_155_772 205
870 3300035725 Ga0373947_0313140 Ga0373947_0313140_234_851 205
871 3300036401 Ga0373937_0002920 Ga0373937_0002920_10909_11526 205
872 3300036401 Ga0373937_0061629 Ga0373937_0061629_1603_2220 205
873 3300036401 Ga0373937_0101399 Ga0373937_0101399_1296_1913 205
874 3300036401 Ga0373937_0189840 Ga0373937_0189840_407_1129 205
875 3300036401 Ga0373937_0583978 Ga0373937_0583978_272_889 205
876 3300036534 Ga0310109_024461 Ga0310109_024461_31_648 205
877 3300037068 Ga0373925_0000335 Ga0373925_0000335_39890_40507 205
878 3300037068 Ga0373925_0006131 Ga0373925_0006131_1613_2230 205
879 3300037068 Ga0373925_0024191 Ga0373925_0024191_668_1390 205
880 3300037068 Ga0373925_0051552 Ga0373925_0051552_1394_2011 205
881 3300037068 Ga0373925_0058505 Ga0373925_0058505_1081_1698 205
882 3300037312 Ga0395899_0000004 Ga0395899_0000004_527912_528529 205
883 3300037312 Ga0395899_0000392 Ga0395899_0000392_8926_9543 205
884 3300037312 Ga0395899_0037553 Ga0395899_0037553_1640_2257 205
885 3300037312 Ga0395899_0149214 Ga0395899_0149214_818_1435 205
886 3300037418 Ga0395900_0000004 Ga0395900_0000004_401824_402441 205
887 3300037418 Ga0395900_0039173 Ga0395900_0039173_3015_3632 205
888 3300037418 Ga0395900_0046235 Ga0395900_0046235_117_734 205
889 3300037418 Ga0395900_0063108 Ga0395900_0063108_946_1563 205
890 3300037418 Ga0395900_0081560 Ga0395900_0081560_1387_2004 205
891 3300037418 Ga0395900_0139812 Ga0395900_0139812_1246_1863 205
892 3300037418 Ga0395900_0319424 Ga0395900_0319424_518_1135 205
893 3300037418 Ga0395900_0511166 Ga0395900_0511166_109_726 205
894 3300037466 Ga0395898_0015313 Ga0395898_0015313_6768_7385 205
895 3300037466 Ga0395898_0133953 Ga0395898_0133953_1589_2206 205
896 3300037466 Ga0395898_0264804 Ga0395898_0264804_527_1144 205
897 3300037466 Ga0395898_0273995 Ga0395898_0273995_32_649 205
898 3300037466 Ga0395898_0409631 Ga0395898_0409631_220_837 205
899 3300037471 Ga0395905_0012043 Ga0395905_0012043_3613_4230 205
900 3300037471 Ga0395905_0014075 Ga0395905_0014075_1396_2013 205
901 3300037471 Ga0395905_0329054 Ga0395905_0329054_345_962 205
902 3300037471 Ga0395905_0419442 Ga0395905_0419442_603_1220 205
903 3300037471 Ga0395905_0782467 Ga0395905_0782467_53_670 205
904 3300037853 Ga0436364_0294495 Ga0436364_0294495_112_729 205
905 3300037853 Ga0436364_0765763 Ga0436364_0765763_659_1276 205
906 3300037853 Ga0436364_0967922 Ga0436364_0967922_887_1504 205
907 3300037853 Ga0436364_1145508 Ga0436364_1145508_520_1137 205
908 3300037853 Ga0436364_1328893 Ga0436364_1328893_32_649 205
909 3300037853 Ga0436364_1523679 Ga0436364_1523679_85_702 205
910 3300037853 Ga0436364_1525373 Ga0436364_1525373_166_852 205
911 3300038443 Ga0395901_0000005 Ga0395901_0000005_163124_163741 205
912 3300038443 Ga0395901_0002466 Ga0395901_0002466_17085_17702 205
913 3300038443 Ga0395901_0039843 Ga0395901_0039843_1508_2125 205
914 3300038443 Ga0395901_0306632 Ga0395901_0306632_319_936 205
915 3300038443 Ga0395901_0371755 Ga0395901_0371755_786_1403 205
916 3300038443 Ga0395901_0834628 Ga0395901_0834628_10_627 205
917 3300039062 Ga0400483_092856 Ga0400483_092856_372_992 205
918 3300039437 Ga0436365_0442593 Ga0436365_0442593_147_764 205
919 3300039437 Ga0436365_0577642 Ga0436365_0577642_56796_57413 205
920 3300039437 Ga0436365_0603212 Ga0436365_0603212_1711_2328 205
921 3300039437 Ga0436365_0649797 Ga0436365_0649797_96_713 205
922 3300039437 Ga0436365_0751394 Ga0436365_0751394_260_877 205
923 3300039437 Ga0436365_0891213 Ga0436365_0891213_115_732 205
924 3300039437 Ga0436365_1300363 Ga0436365_1300363_402_1019 205
925 3300039438 Ga0436360_0164010 Ga0436360_0164010_493_1110 205
926 3300039438 Ga0436360_0272555 Ga0436360_0272555_13_630 205
927 3300039438 Ga0436360_0339257 Ga0436360_0339257_350_967 205
928 3300039438 Ga0436360_0640524 Ga0436360_0640524_66_683 205
929 3300039438 Ga0436360_1305805 Ga0436360_1305805_83_700 205
930 3300039438 Ga0436360_1306958 Ga0436360_1306958_1055_1672 205
931 3300039447 Ga0436361_0223293 Ga0436361_0223293_111_728 205
932 3300039447 Ga0436361_0569699 Ga0436361_0569699_8617_9234 205
933 3300039447 Ga0436361_0783402 Ga0436361_0783402_2130_2747 205
934 3300039447 Ga0436361_1136221 Ga0436361_1136221_230_847 205
935 3300039450 Ga0436363_0225819 Ga0436363_0225819_39_656 205
936 3300039450 Ga0436363_0740142 Ga0436363_0740142_252_869 205
937 3300039450 Ga0436363_1100534 Ga0436363_1100534_53_670 205
938 3300039450 Ga0436363_1533112 Ga0436363_1533112_86_703 205
939 3300039453 Ga0436362_1014140 Ga0436362_1014140_129_746 205
940 3300041413 Ga0439465_0034528 Ga0439465_0034528_12_629 205
941 3300041444 Ga0451790_33576 Ga0451790_33576_29_646 205
942 3300041452 Ga0451793_1584844 Ga0451793_1584844_139_756 205
943 3300041459 Ga0451800_0349978 Ga0451800_0349978_37_654 205
944 3300041486 Ga0451807_1028089 Ga0451807_1028089_78_695 205
945 3300041496 Ga0451839_0013675 Ga0451839_0013675_10_627 205
946 3300041507 Ga0451851_0179760 Ga0451851_0179760_103_720 205
947 3300041997 Ga0439431_0053914 Ga0439431_0053914_186_803 205
948 3300041997 Ga0439431_0122671 Ga0439431_0122671_19_636 205
949 3300042005 Ga0439448_0112534 Ga0439448_0112534_84_701 205
950 3300042006 Ga0439432_034533 Ga0439432_034533_351_968 205
951 3300042006 Ga0439432_077648 Ga0439432_077648_331_948 205
952 3300042013 Ga0439456_083156 Ga0439456_083156_66_683 205
953 3300042156 Ga0439446_0012923 Ga0439446_0012923_1556_2173 205
954 3300042435 Ga0439434_0102851 Ga0439434_0102851_45_662 205
955 3300042438 Ga0439459_0009822 Ga0439459_0009822_604_1221 205
956 3300044684 Ga0466966_0001611 Ga0466966_0001611_12978_13595 205
957 3300044684 Ga0466966_0211388 Ga0466966_0211388_443_1060 205
958 3300044684 Ga0466966_0290872 Ga0466966_0290872_55_672 205
959 3300044693 Ga0466961_0000729 Ga0466961_0000729_2738_3355 205
960 3300044693 Ga0466961_0176993 Ga0466961_0176993_120_737 205
961 3300044694 Ga0466963_0092275 Ga0466963_0092275_717_1334 205
962 3300044694 Ga0466963_0381938 Ga0466963_0381938_68_685 205
963 3300044735 Ga0466968_0036681 Ga0466968_0036681_628_1245 205
964 3300044842 Ga0466957_0288464 Ga0466957_0288464_218_835 205
965 3300045049 Ga0466959_0016762 Ga0466959_0016762_4705_5322 205
966 3300045049 Ga0466959_0284459 Ga0466959_0284459_177_794 205
967 3300045976 Ga0466967_0064758 Ga0466967_0064758_1827_2444 205
968 3300045976 Ga0466967_0140691 Ga0466967_0140691_1266_1883 205
969 3300045976 Ga0466967_0356150 Ga0466967_0356150_782_1399 205
970 3300045976 Ga0466967_0508770 Ga0466967_0508770_366_983 205
971 3300046452 Ga0495617_082408 Ga0495617_082408_55_672 205
972 3300046454 Ga0495592_0001015 Ga0495592_0001015_13243_13860 205
973 3300046454 Ga0495592_0160953 Ga0495592_0160953_285_902 205
974 3300046454 Ga0495592_0292078 Ga0495592_0292078_32_754 205
975 3300046454 Ga0495592_0386922 Ga0495592_0386922_78_695 205
976 3300046455 Ga0495603_0014076 Ga0495603_0014076_98_715 205
977 3300046455 Ga0495603_0096327 Ga0495603_0096327_182_904 205
978 3300046455 Ga0495603_0286794 Ga0495603_0286794_194_811 205
979 3300046457 Ga0495590_0001375 Ga0495590_0001375_3899_4516 205
980 3300046459 Ga0495629_0011592 Ga0495629_0011592_490_1107 205
981 3300046459 Ga0495629_0054448 Ga0495629_0054448_638_1255 205
982 3300046459 Ga0495629_0224185 Ga0495629_0224185_54_671 205
983 3300046459 Ga0495629_0307888 Ga0495629_0307888_85_720 205
984 3300046460 Ga0495638_0006134 Ga0495638_0006134_3485_4102 205
985 3300046460 Ga0495638_0054700 Ga0495638_0054700_872_1489 205
986 3300046460 Ga0495638_0061356 Ga0495638_0061356_718_1335 205
987 3300046461 Ga0495641_0009631 Ga0495641_0009631_388_1005 205
988 3300046462 Ga0495651_0363585 Ga0495651_0363585_311_928 205
989 3300046462 Ga0495651_0526357 Ga0495651_0526357_20_637 205
990 3300046463 Ga0495653_0000934 Ga0495653_0000934_1723_2340 205
991 3300046463 Ga0495653_0079298 Ga0495653_0079298_209_826 205
992 3300046463 Ga0495653_0142684 Ga0495653_0142684_45_662 205
993 3300046463 Ga0495653_0335730 Ga0495653_0335730_50_667 205
994 3300046471 Ga0495650_0000244 Ga0495650_0000244_76717_77334 205
995 3300046472 Ga0495580_0000612 Ga0495580_0000612_6448_7065 205
996 3300046472 Ga0495580_0010282 Ga0495580_0010282_383_1105 205
997 3300046473 Ga0495582_0019067 Ga0495582_0019067_99_821 205
998 3300046473 Ga0495582_0068295 Ga0495582_0068295_179_796 205
999 3300046473 Ga0495582_0089154 Ga0495582_0089154_610_1227 205
1000 3300046475 Ga0495639_0001536 Ga0495639_0001536_8133_8750 205
1001 3300046475 Ga0495639_0038030 Ga0495639_0038030_990_1712 205
1002 3300046475 Ga0495639_0238859 Ga0495639_0238859_206_823 205
1003 3300046477 Ga0495664_0013114 Ga0495664_0013114_3186_3803 205
1004 3300046477 Ga0495664_0322198 Ga0495664_0322198_248_865 205
1005 3300046477 Ga0495664_0330181 Ga0495664_0330181_102_719 205
1006 3300046492 Ga0495585_0039584 Ga0495585_0039584_153_770 205
1007 3300046492 Ga0495585_0226696 Ga0495585_0226696_145_762 205
1008 3300046499 Ga0495594_0098647 Ga0495594_0098647_605_1222 205
1009 3300046499 Ga0495594_0209109 Ga0495594_0209109_456_1073 205
1010 3300046500 Ga0495596_0167271 Ga0495596_0167271_142_759 205
1011 3300046501 Ga0495607_0307923 Ga0495607_0307923_83_700 205
1012 3300046506 Ga0495583_0097502 Ga0495583_0097502_229_846 205
1013 3300046507 Ga0495606_0005813 Ga0495606_0005813_2153_2770 205
1014 3300046507 Ga0495606_0059666 Ga0495606_0059666_1143_1760 205
1015 3300046511 Ga0495608_0002093 Ga0495608_0002093_9496_10113 205
1016 3300046511 Ga0495608_0013352 Ga0495608_0013352_696_1313 205
1017 3300046511 Ga0495608_0393237 Ga0495608_0393237_155_772 205
1018 3300046512 Ga0495610_0002447 Ga0495610_0002447_4329_4946 205
1019 3300046513 Ga0495616_0000561 Ga0495616_0000561_19099_19716 205
1020 3300046514 Ga0495618_0317127 Ga0495618_0317127_219_836 205
1021 3300046516 Ga0495628_0020462 Ga0495628_0020462_405_1022 205
1022 3300046516 Ga0495628_0091030 Ga0495628_0091030_719_1336 205
1023 3300046516 Ga0495628_0123443 Ga0495628_0123443_113_730 205
1024 3300046516 Ga0495628_0203866 Ga0495628_0203866_551_1168 205
1025 3300046517 Ga0495630_0035589 Ga0495630_0035589_449_1171 205
1026 3300046517 Ga0495630_0050507 Ga0495630_0050507_2484_3101 205
1027 3300046517 Ga0495630_0127018 Ga0495630_0127018_66_683 205
1028 3300046518 Ga0495631_0118568 Ga0495631_0118568_256_891 205
1029 3300046520 Ga0495637_0023333 Ga0495637_0023333_2015_2632 205
1030 3300046522 Ga0495643_0041517 Ga0495643_0041517_1653_2270 205
1031 3300046523 Ga0495644_0215384 Ga0495644_0215384_63_680 205
1032 3300046524 Ga0495648_0000165 Ga0495648_0000165_71315_71932 205
1033 3300046524 Ga0495648_0030929 Ga0495648_0030929_2532_3149 205
1034 3300046526 Ga0495666_0026921 Ga0495666_0026921_1925_2542 205
1035 3300046528 Ga0495642_0018614 Ga0495642_0018614_1007_1624 205
1036 3300046528 Ga0495642_0036369 Ga0495642_0036369_1205_1822 205
1037 3300046528 Ga0495642_0181321 Ga0495642_0181321_139_756 205
1038 3300046529 Ga0495652_0002209 Ga0495652_0002209_878_1495 205
1039 3300046529 Ga0495652_0036404 Ga0495652_0036404_3471_4088 205
1040 3300046529 Ga0495652_0049140 Ga0495652_0049140_2748_3470 205
1041 3300046529 Ga0495652_0112630 Ga0495652_0112630_154_771 205
1042 3300046529 Ga0495652_0160604 Ga0495652_0160604_774_1391 205
1043 3300046529 Ga0495652_0230424 Ga0495652_0230424_190_807 205
1044 3300046529 Ga0495652_0401043 Ga0495652_0401043_164_781 205
1045 3300046530 Ga0495654_0000024 Ga0495654_0000024_201443_202060 205
1046 3300046530 Ga0495654_0041892 Ga0495654_0041892_797_1414 205
1047 3300046531 Ga0495665_0000866 Ga0495665_0000866_5950_6567 205
1048 3300046531 Ga0495665_0243738 Ga0495665_0243738_13_648 205
1049 3300046533 Ga0495640_0003099 Ga0495640_0003099_6631_7248 205
1050 3300046533 Ga0495640_0060112 Ga0495640_0060112_1232_1849 205
1051 3300046533 Ga0495640_0247644 Ga0495640_0247644_345_962 205
1052 3300046533 Ga0495640_0353867 Ga0495640_0353867_86_808 205
1053 3300046536 Ga0495587_0015200 Ga0495587_0015200_3250_3867 205
1054 3300046536 Ga0495587_0029924 Ga0495587_0029924_2304_2921 205
1055 3300046536 Ga0495587_0133003 Ga0495587_0133003_587_1204 205
1056 3300046538 Ga0495609_0023541 Ga0495609_0023541_2171_2788 205
1057 3300046542 Ga0495597_0003599 Ga0495597_0003599_8274_8891 205
1058 3300046542 Ga0495597_0043380 Ga0495597_0043380_412_1029 205
1059 3300046543 Ga0495645_0012499 Ga0495645_0012499_1287_1904 205
1060 3300046543 Ga0495645_0013311 Ga0495645_0013311_2572_3189 205
1061 3300046543 Ga0495645_0040862 Ga0495645_0040862_2004_2621 205
1062 3300046543 Ga0495645_0338967 Ga0495645_0338967_66_683 205
1063 3300046543 Ga0495645_0358784 Ga0495645_0358784_160_777 205
1064 3300046543 Ga0495645_0425059 Ga0495645_0425059_185_802 205
1065 3300046557 Ga0495622_0010588 Ga0495622_0010588_1769_2386 205
1066 3300046557 Ga0495622_0033434 Ga0495622_0033434_715_1332 205
1067 3300046557 Ga0495622_0054153 Ga0495622_0054153_982_1599 205
1068 3300046558 Ga0495633_0024018 Ga0495633_0024018_164_781 205
1069 3300046558 Ga0495633_0139294 Ga0495633_0139294_474_1091 205
1070 3300046559 Ga0495667_0009515 Ga0495667_0009515_3487_4104 205
1071 3300046559 Ga0495667_0023947 Ga0495667_0023947_3320_3937 205
1072 3300046559 Ga0495667_0156529 Ga0495667_0156529_198_815 205
1073 3300046615 Ga0495656_0015319 Ga0495656_0015319_2239_2856 205
1074 3300046615 Ga0495656_0445946 Ga0495656_0445946_14_631 205
1075 3300046616 Ga0495668_0000042 Ga0495668_0000042_183716_184333 205
1076 3300046616 Ga0495668_0006417 Ga0495668_0006417_6859_7476 205
1077 3300046616 Ga0495668_0006930 Ga0495668_0006930_4762_5379 205
1078 3300046616 Ga0495668_0070100 Ga0495668_0070100_1231_1848 205
1079 3300046616 Ga0495668_0135365 Ga0495668_0135365_15_632 205
1080 3300046616 Ga0495668_0165455 Ga0495668_0165455_549_1166 205
1081 3300046616 Ga0495668_0173531 Ga0495668_0173531_166_783 205
1082 3300046642 Ga0495634_0003047 Ga0495634_0003047_12482_13099 205
1083 3300046642 Ga0495634_0045191 Ga0495634_0045191_1299_1916 205
1084 3300046642 Ga0495634_0068412 Ga0495634_0068412_383_1105 205
1085 3300046642 Ga0495634_0078105 Ga0495634_0078105_1432_2049 205
1086 3300046648 Ga0495611_0316360 Ga0495611_0316360_60_677 205
1087 3300046660 Ga0495625_0029821 Ga0495625_0029821_300_917 205
1088 3300046660 Ga0495625_0065494 Ga0495625_0065494_1893_2510 205
1089 3300046660 Ga0495625_0121557 Ga0495625_0121557_404_1021 205
1090 3300046660 Ga0495625_0289169 Ga0495625_0289169_147_764 205
1091 3300046663 Ga0495635_0000540 Ga0495635_0000540_19170_19787 205
1092 3300046663 Ga0495635_0007303 Ga0495635_0007303_5364_6086 205
1093 3300046663 Ga0495635_0062629 Ga0495635_0062629_1643_2260 205
1094 3300046663 Ga0495635_0065285 Ga0495635_0065285_1133_1750 205
1095 3300046664 Ga0495659_0080223 Ga0495659_0080223_501_1118 205
1096 3300046674 Ga0495588_0026578 Ga0495588_0026578_645_1262 205
1097 3300046674 Ga0495588_0057027 Ga0495588_0057027_667_1284 205
1098 3300046675 Ga0495657_0001615 Ga0495657_0001615_16909_17526 205
1099 3300046675 Ga0495657_0003319 Ga0495657_0003319_6587_7204 205
1100 3300046675 Ga0495657_0023689 Ga0495657_0023689_376_993 205
1101 3300046678 Ga0495599_0007666 Ga0495599_0007666_2679_3296 205
1102 3300046678 Ga0495599_0071308 Ga0495599_0071308_1493_2110 205
1103 3300046678 Ga0495599_0169737 Ga0495599_0169737_113_730 205
1104 3300046679 Ga0495623_0051844 Ga0495623_0051844_1131_1748 205
1105 3300046679 Ga0495623_0168305 Ga0495623_0168305_204_821 205
1106 3300046680 Ga0495646_0010030 Ga0495646_0010030_2584_3201 205
1107 3300046680 Ga0495646_0096661 Ga0495646_0096661_435_1052 205
1108 3300046681 Ga0495647_0021408 Ga0495647_0021408_1029_1646 205
1109 3300046683 Ga0495658_0005259 Ga0495658_0005259_440_1057 205
1110 3300046683 Ga0495658_0257007 Ga0495658_0257007_359_1081 205
1111 3300046684 Ga0495669_0000078 Ga0495669_0000078_51779_52396 205
1112 3300046684 Ga0495669_0009879 Ga0495669_0009879_1885_2502 205
1113 3300046684 Ga0495669_0045945 Ga0495669_0045945_1200_1817 205
1114 3300046689 Ga0495613_0004342 Ga0495613_0004342_9364_9981 205
1115 3300046689 Ga0495613_0148598 Ga0495613_0148598_79_696 205
1116 3300046690 Ga0495624_0000079 Ga0495624_0000079_42577_43194 205
1117 3300046691 Ga0495670_0106363 Ga0495670_0106363_459_1076 205
1118 3300046809 Ga0495600_0007254 Ga0495600_0007254_5867_6484 205
1119 3300046809 Ga0495600_0065595 Ga0495600_0065595_570_1187 205
1120 3300046809 Ga0495600_0085449 Ga0495600_0085449_1153_1770 205
1121 3300046810 Ga0495660_0029161 Ga0495660_0029161_312_929 205
1122 3300046810 Ga0495660_0065495 Ga0495660_0065495_470_1087 205
1123 3300047315 Ga0495581_0000260 Ga0495581_0000260_10729_11346 205
1124 3300047315 Ga0495581_0108817 Ga0495581_0108817_358_975 205
1125 3300047315 Ga0495581_0244006 Ga0495581_0244006_93_815 205
1126 3300047315 Ga0495581_0361447 Ga0495581_0361447_40_657 205
1127 3300047317 Ga0495604_0006608 Ga0495604_0006608_1013_1630 205
1128 3300047317 Ga0495604_0021019 Ga0495604_0021019_1153_1770 205
1129 3300047317 Ga0495604_0093261 Ga0495604_0093261_559_1281 205
1130 3300047317 Ga0495604_0124469 Ga0495604_0124469_670_1287 205
1131 3300047318 Ga0495636_0082612 Ga0495636_0082612_407_1024 205
1132 3300047319 Ga0495674_0039127 Ga0495674_0039127_44_661 205
1133 3300047319 Ga0495674_0060084 Ga0495674_0060084_2010_2627 205
1134 3300047319 Ga0495674_0062608 Ga0495674_0062608_1128_1745 205
1135 3300047320 Ga0495672_0065581 Ga0495672_0065581_278_895 205
1136 3300047320 Ga0495672_0103686 Ga0495672_0103686_389_1006 205
1137 3300047320 Ga0495672_0229000 Ga0495672_0229000_57_674 205
1138 3300047321 Ga0495676_0070484 Ga0495676_0070484_1195_1812 205
1139 3300047322 Ga0495680_0012504 Ga0495680_0012504_5393_6010 205
1140 3300047322 Ga0495680_0032774 Ga0495680_0032774_2696_3313 205
1141 3300047322 Ga0495680_0118005 Ga0495680_0118005_73_690 205
1142 3300047443 Ga0495687_080764 Ga0495687_080764_267_884 205
1143 3300047444 Ga0495675_0001958 Ga0495675_0001958_2535_3152 205
1144 3300047444 Ga0495675_0048595 Ga0495675_0048595_1928_2545 205
1145 3300047444 Ga0495675_0086146 Ga0495675_0086146_88_810 205
1146 3300047445 Ga0495677_0046949 Ga0495677_0046949_369_986 205
1147 3300047445 Ga0495677_0152752 Ga0495677_0152752_41_658 205
1148 3300047469 Ga0495673_0015936 Ga0495673_0015936_1816_2433 205
1149 3300047469 Ga0495673_0028515 Ga0495673_0028515_46_663 205
1150 3300047470 Ga0495681_0124308 Ga0495681_0124308_465_1082 205
1151 3300047470 Ga0495681_0185514 Ga0495681_0185514_49_666 205
1152 3300047471 Ga0495684_0001865 Ga0495684_0001865_1318_1935 205
1153 3300047471 Ga0495684_0007297 Ga0495684_0007297_5677_6294 205
1154 3300047471 Ga0495684_0010601 Ga0495684_0010601_314_931 205
1155 3300047471 Ga0495684_0048320 Ga0495684_0048320_2071_2793 205
1156 3300047472 Ga0495686_0001646 Ga0495686_0001646_12626_13243 205
1157 3300047472 Ga0495686_0003347 Ga0495686_0003347_8399_9016 205
1158 3300047472 Ga0495686_0027519 Ga0495686_0027519_13_630 205
1159 3300047472 Ga0495686_0193227 Ga0495686_0193227_11_628 205
1160 3300047472 Ga0495686_0249230 Ga0495686_0249230_342_959 205
1161 3300047673 Ga0495593_0002394 Ga0495593_0002394_692_1309 205
1162 3300047673 Ga0495593_0027612 Ga0495593_0027612_1012_1629 205
1163 3300047673 Ga0495593_0040729 Ga0495593_0040729_195_917 205
1164 3300048088 Ga0495602_0009374 Ga0495602_0009374_5867_6484 205
1165 3300048088 Ga0495602_0040611 Ga0495602_0040611_1487_2104 205
1166 3300048088 Ga0495602_0142472 Ga0495602_0142472_435_1052 205
1167 3300048091 Ga0495626_0059314 Ga0495626_0059314_541_1158 205
1168 3300048903 Ga0496100_0059701 Ga0496100_0059701_771_1388 205
1169 3300048903 Ga0496100_0232261 Ga0496100_0232261_55_672 205
1170 3300048903 Ga0496100_0367005 Ga0496100_0367005_336_953 205
1171 3300048903 Ga0496100_0848994 Ga0496100_0848994_56_673 205
1172 3300048904 Ga0496101_0015844 Ga0496101_0015844_1637_2254 205
1173 3300048905 Ga0496102_0000518 Ga0496102_0000518_38901_39518 205
1174 3300048905 Ga0496102_0018170 Ga0496102_0018170_397_1014 205
1175 3300048905 Ga0496102_0018766 Ga0496102_0018766_5008_5625 205
1176 3300048905 Ga0496102_0052840 Ga0496102_0052840_1474_2091 205
1177 3300048905 Ga0496102_0739641 Ga0496102_0739641_259_876 205
1178 3300048906 Ga0496103_0077711 Ga0496103_0077711_531_1148 205
1179 3300048907 Ga0496104_0137241 Ga0496104_0137241_466_1083 205
1180 3300048908 Ga0496105_0004162 Ga0496105_0004162_1031_1648 205
1181 3300048908 Ga0496105_0004256 Ga0496105_0004256_6299_6916 205
1182 3300048908 Ga0496105_0112402 Ga0496105_0112402_427_1044 205
1183 3300048908 Ga0496105_0679311 Ga0496105_0679311_117_734 205
1184 3300048909 Ga0496106_0000116 Ga0496106_0000116_12336_12953 205
1185 3300048909 Ga0496106_0013096 Ga0496106_0013096_461_1078 205
1186 3300048909 Ga0496106_0078196 Ga0496106_0078196_719_1336 205
1187 3300048909 Ga0496106_0094820 Ga0496106_0094820_979_1596 205
1188 3300048909 Ga0496106_0363639 Ga0496106_0363639_426_1043 205
1189 3300048910 Ga0496107_0001003 Ga0496107_0001003_12180_12797 205
1190 3300048910 Ga0496107_0554203 Ga0496107_0554203_146_763 205
1191 3300048911 Ga0496108_0000523 Ga0496108_0000523_15732_16349 205
1192 3300048911 Ga0496108_0005230 Ga0496108_0005230_6134_6751 205
1193 3300048911 Ga0496108_0034870 Ga0496108_0034870_315_932 205
1194 3300048912 Ga0496109_0001407 Ga0496109_0001407_3532_4149 205
1195 3300048912 Ga0496109_0005646 Ga0496109_0005646_5494_6111 205
1196 3300048912 Ga0496109_0285204 Ga0496109_0285204_319_936 205
1197 3300048913 Ga0496110_0018684 Ga0496110_0018684_4487_5104 205
1198 3300048913 Ga0496110_0065369 Ga0496110_0065369_1819_2436 205
1199 3300048913 Ga0496110_0444838 Ga0496110_0444838_346_963 205
1200 3300048913 Ga0496110_1073373 Ga0496110_1073373_45_662 205
1201 3300048914 Ga0496111_0078263 Ga0496111_0078263_1713_2330 205
1202 3300048914 Ga0496111_0333052 Ga0496111_0333052_394_1011 205
1203 3300048915 Ga0496112_0005822 Ga0496112_0005822_6185_6802 205
1204 3300048915 Ga0496112_0030428 Ga0496112_0030428_2151_2768 205
1205 3300048915 Ga0496112_0069799 Ga0496112_0069799_1488_2105 205
1206 3300048915 Ga0496112_0089521 Ga0496112_0089521_1636_2253 205
1207 3300048915 Ga0496112_0097854 Ga0496112_0097854_270_887 205
1208 3300048915 Ga0496112_0164043 Ga0496112_0164043_1204_1821 205
1209 3300048915 Ga0496112_0220787 Ga0496112_0220787_315_932 205
1210 3300048915 Ga0496112_0358193 Ga0496112_0358193_709_1326 205
1211 3300048916 Ga0496113_0073598 Ga0496113_0073598_380_997 205
1212 3300048916 Ga0496113_0468122 Ga0496113_0468122_382_999 205
1213 3300048917 Ga0496114_0023481 Ga0496114_0023481_3813_4430 205
1214 3300048917 Ga0496114_0166178 Ga0496114_0166178_1143_1760 205
1215 3300048918 Ga0496115_0001962 Ga0496115_0001962_1539_2156 205
1216 3300048918 Ga0496115_0002796 Ga0496115_0002796_4103_4720 205
1217 3300048918 Ga0496115_0010930 Ga0496115_0010930_2182_2799 205
1218 3300048918 Ga0496115_0012733 Ga0496115_0012733_5438_6055 205
1219 3300048918 Ga0496115_0279760 Ga0496115_0279760_710_1327 205
1220 3300048918 Ga0496115_0652816 Ga0496115_0652816_136_753 205
1221 3300048920 Ga0496117_0039261 Ga0496117_0039261_2484_3101 205
1222 3300048920 Ga0496117_0056067 Ga0496117_0056067_401_1018 205
1223 3300048920 Ga0496117_0090740 Ga0496117_0090740_864_1481 205
1224 3300048921 Ga0496118_0006091 Ga0496118_0006091_531_1148 205
1225 3300048921 Ga0496118_0010206 Ga0496118_0010206_1320_1937 205
1226 3300048921 Ga0496118_0057706 Ga0496118_0057706_2155_2772 205
1227 3300048921 Ga0496118_0183459 Ga0496118_0183459_109_726 205
1228 3300048922 Ga0496119_0023537 Ga0496119_0023537_1170_1787 205
1229 3300048923 Ga0496120_0291662 Ga0496120_0291662_47_664 205
1230 3300048924 Ga0496121_0000053 Ga0496121_0000053_73888_74505 205
1231 3300048924 Ga0496121_0001006 Ga0496121_0001006_16866_17483 205
1232 3300048924 Ga0496121_0007140 Ga0496121_0007140_6583_7200 205
1233 3300048924 Ga0496121_0012978 Ga0496121_0012978_2478_3095 205
1234 3300048924 Ga0496121_0036555 Ga0496121_0036555_3302_3919 205
1235 3300048924 Ga0496121_0037388 Ga0496121_0037388_1402_2019 205
1236 3300048924 Ga0496121_0095890 Ga0496121_0095890_22_639 205
1237 3300048925 Ga0496122_0028275 Ga0496122_0028275_56_673 205
1238 3300048925 Ga0496122_0175784 Ga0496122_0175784_243_860 205
1239 3300048926 Ga0496123_0034089 Ga0496123_0034089_2810_3427 205
1240 3300048926 Ga0496123_0181302 Ga0496123_0181302_220_837 205
1241 3300048927 Ga0496124_0027923 Ga0496124_0027923_1727_2344 205
1242 3300048927 Ga0496124_0134902 Ga0496124_0134902_28_645 205
1243 3300048927 Ga0496124_0163386 Ga0496124_0163386_27_644 205
1244 3300048927 Ga0496124_0273170 Ga0496124_0273170_277_894 205
1245 3300048927 Ga0496124_0490044 Ga0496124_0490044_164_781 205
1246 3300048928 Ga0496125_0000063 Ga0496125_0000063_4131_4748 205
1247 3300048928 Ga0496125_0000692 Ga0496125_0000692_43860_44477 205
1248 3300048928 Ga0496125_0004834 Ga0496125_0004834_1645_2262 205
1249 3300048928 Ga0496125_0206556 Ga0496125_0206556_424_1041 205
1250 3300048928 Ga0496125_0207858 Ga0496125_0207858_410_1027 205
1251 3300048928 Ga0496125_0308976 Ga0496125_0308976_240_857 205
1252 3300048929 Ga0496126_0005437 Ga0496126_0005437_10300_10917 205
1253 3300048929 Ga0496126_0005856 Ga0496126_0005856_10964_11581 205
1254 3300048929 Ga0496126_0010695 Ga0496126_0010695_4722_5339 205
1255 3300048929 Ga0496126_0024996 Ga0496126_0024996_839_1456 205
1256 3300048929 Ga0496126_0061522 Ga0496126_0061522_1904_2521 205
1257 3300048929 Ga0496126_0084558 Ga0496126_0084558_1691_2308 205
1258 3300048929 Ga0496126_0088140 Ga0496126_0088140_678_1295 205
1259 3300048929 Ga0496126_0105848 Ga0496126_0105848_1165_1782 205
1260 3300048929 Ga0496126_0194926 Ga0496126_0194926_102_719 205
1261 3300048929 Ga0496126_0221731 Ga0496126_0221731_890_1507 205
1262 3300048929 Ga0496126_0776235 Ga0496126_0776235_73_690 205
1263 3300049460 Ga0495682_0062222 Ga0495682_0062222_651_1268 205
1264 3300049530 Ga0501314_019671 Ga0501314_019671_56_673 205
1265 3300049539 Ga0501323_035212 Ga0501323_035212_13_630 205
1266 3300049545 Ga0501329_02705 Ga0501329_02705_224_841 205
1267 3300049551 Ga0501335_017530 Ga0501335_017530_44_661 205
1268 3300049568 Ga0501031_0040667 Ga0501031_0040667_1805_2422 205
1269 3300049570 Ga0501033_0039811 Ga0501033_0039811_2099_2716 205
1270 3300049570 Ga0501033_0057649 Ga0501033_0057649_1608_2225 205
1271 3300049570 Ga0501033_0061003 Ga0501033_0061003_2135_2752 205
1272 3300049571 Ga0501034_0002925 Ga0501034_0002925_16683_17300 205
1273 3300049572 Ga0501036_0017092 Ga0501036_0017092_2886_3503 205
1274 3300049573 Ga0501037_0018936 Ga0501037_0018936_1110_1727 205
1275 3300049573 Ga0501037_0140022 Ga0501037_0140022_775_1392 205
1276 3300049573 Ga0501037_0194571 Ga0501037_0194571_141_758 205
1277 3300049574 Ga0501038_0140642 Ga0501038_0140642_722_1339 205
1278 3300049574 Ga0501038_0203618 Ga0501038_0203618_728_1345 205
1279 3300049574 Ga0501038_0741293 Ga0501038_0741293_55_672 205
1280 3300049575 Ga0501039_0099838 Ga0501039_0099838_401_1018 205
1281 3300049576 Ga0501040_0006026 Ga0501040_0006026_1403_2020 205
1282 3300049577 Ga0501041_0031708 Ga0501041_0031708_1016_1633 205
1283 3300049577 Ga0501041_0222424 Ga0501041_0222424_59_676 205
1284 3300049578 Ga0501042_0007090 Ga0501042_0007090_768_1385 205
1285 3300049578 Ga0501042_0210836 Ga0501042_0210836_574_1191 205
1286 3300049578 Ga0501042_0856644 Ga0501042_0856644_17_634 205
1287 3300049579 Ga0501043_0020010 Ga0501043_0020010_2117_2734 205
1288 3300049579 Ga0501043_0462899 Ga0501043_0462899_107_724 205
1289 3300049580 Ga0501046_0052251 Ga0501046_0052251_2334_2951 205
1290 3300049580 Ga0501046_0104794 Ga0501046_0104794_1428_2045 205
1291 3300049581 Ga0501047_0024481 Ga0501047_0024481_953_1570 205
1292 3300049581 Ga0501047_0035413 Ga0501047_0035413_2944_3561 205
1293 3300049581 Ga0501047_0060948 Ga0501047_0060948_273_890 205
1294 3300049581 Ga0501047_0394826 Ga0501047_0394826_566_1183 205
1295 3300049581 Ga0501047_0704524 Ga0501047_0704524_101_718 205
1296 3300049582 Ga0501048_0050138 Ga0501048_0050138_1131_1748 205
1297 3300049582 Ga0501048_0063127 Ga0501048_0063127_986_1603 205
1298 3300049582 Ga0501048_0071077 Ga0501048_0071077_73_690 205
1299 3300049586 Ga0501070_0000329 Ga0501070_0000329_17607_18224 205
1300 3300049587 Ga0501071_0043672 Ga0501071_0043672_1338_1955 205
1301 3300049587 Ga0501071_0205774 Ga0501071_0205774_206_823 205
1302 3300049588 Ga0501072_0284636 Ga0501072_0284636_291_908 205
1303 3300049590 Ga0501074_0174655 Ga0501074_0174655_297_914 205
1304 3300049590 Ga0501074_0514973 Ga0501074_0514973_152_769 205
1305 3300049591 Ga0501075_0134392 Ga0501075_0134392_1124_1741 205
1306 3300049591 Ga0501075_0143716 Ga0501075_0143716_191_808 205
1307 3300049591 Ga0501075_0278874 Ga0501075_0278874_280_897 205
1308 3300049592 Ga0501076_0008200 Ga0501076_0008200_4092_4709 205
1309 3300049593 Ga0501077_0189801 Ga0501077_0189801_229_846 205
1310 3300049593 Ga0501077_0543500 Ga0501077_0543500_87_704 205
1311 3300049671 Ga0501238_002774 Ga0501238_002774_1097_1714 205
1312 3300049686 Ga0501257_003510 Ga0501257_003510_2233_2850 205
1313 3300049741 Ga0501079_0028862 Ga0501079_0028862_3388_4005 205
1314 3300049742 Ga0501080_0160907 Ga0501080_0160907_1329_1946 205
1315 3300049742 Ga0501080_0230862 Ga0501080_0230862_183_800 205
1316 3300049743 Ga0501081_0048682 Ga0501081_0048682_1921_2538 205
1317 3300049770 Ga0501273_027996 Ga0501273_027996_90_707 205
1318 3300049822 Ga0501035_0001146 Ga0501035_0001146_8003_8620 205
1319 3300049822 Ga0501035_0057192 Ga0501035_0057192_1522_2139 205
1320 3300049822 Ga0501035_0216337 Ga0501035_0216337_995_1612 205
1321 3300049823 Ga0501044_0014747 Ga0501044_0014747_7352_7969 205
1322 3300049823 Ga0501044_0018956 Ga0501044_0018956_5707_6324 205
1323 3300049823 Ga0501044_0138142 Ga0501044_0138142_1451_2068 205
1324 3300049823 Ga0501044_1029363 Ga0501044_1029363_63_680 205
1325 3300049824 Ga0501045_0012830 Ga0501045_0012830_4293_4910 205
1326 3300049824 Ga0501045_0064576 Ga0501045_0064576_939_1556 205
1327 3300050489 nmdc:mga03683_102815_c1 nmdc:mga03683_102815_c1_21_638 205
1328 3300050491 nmdc:mga00v17_76660_c1 nmdc:mga00v17_76660_c1_1042_1659 205
1329 3300050492 nmdc:mga0yw44_283950_c1 nmdc:mga0yw44_283950_c1_281_898 205
1330 3300050492 nmdc:mga0yw44_40419_c1 nmdc:mga0yw44_40419_c1_514_1131 205
1331 3300050492 nmdc:mga0yw44_578169_c1 nmdc:mga0yw44_578169_c1_126_743 205
1332 3300050493 nmdc:mga0k408_99988_c1 nmdc:mga0k408_99988_c1_354_971 205
1333 3300050494 nmdc:mga06z11_2536_c1 nmdc:mga06z11_2536_c1_4322_4939 205
1334 3300050494 nmdc:mga06z11_398842_c1 nmdc:mga06z11_398842_c1_35_652 205
1335 3300050495 nmdc:mga04h51_3728_c1 nmdc:mga04h51_3728_c1_1048_1665 205
1336 3300050496 nmdc:mga07m45_132961_c1 nmdc:mga07m45_132961_c1_391_1008 205
1337 3300050496 nmdc:mga07m45_154896_c1 nmdc:mga07m45_154896_c1_163_780 205
1338 3300050507 nmdc:mga05p37_185239_c1 nmdc:mga05p37_185239_c1_259_876 205
1339 3300050512 nmdc:mga0n895_150649_c1 nmdc:mga0n895_150649_c1_1619_2236 205
1340 3300050512 nmdc:mga0n895_68361_c1 nmdc:mga0n895_68361_c1_1965_2582 205
1341 3300050513 nmdc:mga0rr50_351456_c1 nmdc:mga0rr50_351456_c1_466_1083 205
1342 3300050516 nmdc:mga0sz30_190741_c1 nmdc:mga0sz30_190741_c1_263_880 205
1343 3300050516 nmdc:mga0sz30_94027_c2 nmdc:mga0sz30_94027_c2_95_712 205
1344 3300053077 Ga0495601_0102887 Ga0495601_0102887_326_943 205
1345 3300053077 Ga0495601_0112525 Ga0495601_0112525_393_1010 205
1346 3300053077 Ga0495601_0215294 Ga0495601_0215294_525_1142 205
1347 3300053078 Ga0495612_0007827 Ga0495612_0007827_668_1390 205
1348 3300053078 Ga0495612_0027321 Ga0495612_0027321_970_1587 205
1349 3300053078 Ga0495612_0087489 Ga0495612_0087489_13_630 205
1350 3300053080 Ga0500635_0000253 Ga0500635_0000253_4675_5292 205
1351 3300053080 Ga0500635_0021631 Ga0500635_0021631_738_1355 205
1352 3300053080 Ga0500635_0059095 Ga0500635_0059095_421_1038 205
1353 3300053084 Ga0495595_0120370 Ga0495595_0120370_576_1193 205
1354 3300053084 Ga0495595_0231231 Ga0495595_0231231_165_782 205
1355 3300053085 Ga0495619_0030125 Ga0495619_0030125_2340_2957 205
1356 3300053085 Ga0495619_0034980 Ga0495619_0034980_2412_3029 205
1357 3300053085 Ga0495619_0223782 Ga0495619_0223782_383_1000 205
1358 3300053085 Ga0495619_0232128 Ga0495619_0232128_514_1131 205
1359 3300053086 Ga0500578_0000004 Ga0500578_0000004_115740_116357 205
1360 3300053086 Ga0500578_0143138 Ga0500578_0143138_98_715 205
1361 3300053087 Ga0500643_051721 Ga0500643_051721_61_678 205
1362 3300053088 Ga0500644_0015838 Ga0500644_0015838_1530_2147 205
1363 3300053093 Ga0500651_0290965 Ga0500651_0290965_280_897 205
1364 3300053094 Ga0500566_0000064 Ga0500566_0000064_44502_45119 205
1365 3300053096 Ga0500641_0000579 Ga0500641_0000579_2267_2884 205
1366 3300053096 Ga0500641_0005464 Ga0500641_0005464_3805_4422 205
1367 3300053099 Ga0500654_097567 Ga0500654_097567_272_889 205
1368 3300053103 Ga0500555_001693 Ga0500555_001693_2363_2980 205
1369 3300053103 Ga0500555_031479 Ga0500555_031479_472_1089 205
1370 3300053104 Ga0500556_0032494 Ga0500556_0032494_323_940 205
1371 3300053104 Ga0500556_0106605 Ga0500556_0106605_448_1065 205
1372 3300053105 Ga0500557_000039 Ga0500557_000039_62322_62939 205
1373 3300053108 Ga0500562_000608 Ga0500562_000608_3906_4523 205
1374 3300053108 Ga0500562_001033 Ga0500562_001033_2216_2833 205
1375 3300053111 Ga0500572_000026 Ga0500572_000026_41131_41748 205
1376 3300053111 Ga0500572_000344 Ga0500572_000344_12398_13015 205
1377 3300053111 Ga0500572_001098 Ga0500572_001098_1354_1971 205
1378 3300053115 Ga0500591_132517 Ga0500591_132517_97_714 205
1379 3300053116 Ga0500592_037410 Ga0500592_037410_132_749 205
1380 3300053116 Ga0500592_043485 Ga0500592_043485_101_718 205
1381 3300053118 Ga0500594_0000138 Ga0500594_0000138_19465_20082 205
1382 3300053119 Ga0500595_001915 Ga0500595_001915_1154_1771 205
1383 3300053119 Ga0500595_002372 Ga0500595_002372_6671_7288 205
1384 3300053119 Ga0500595_003808 Ga0500595_003808_5750_6367 205
1385 3300053119 Ga0500595_004822 Ga0500595_004822_1833_2450 205
1386 3300053119 Ga0500595_005581 Ga0500595_005581_3648_4265 205
1387 3300053119 Ga0500595_009864 Ga0500595_009864_2965_3582 205
1388 3300053119 Ga0500595_016291 Ga0500595_016291_2026_2643 205
1389 3300053120 Ga0500597_129962 Ga0500597_129962_45_662 205
1390 3300053121 Ga0500607_025494 Ga0500607_025494_512_1129 205
1391 3300053122 Ga0500608_000023 Ga0500608_000023_45602_46219 205
1392 3300053122 Ga0500608_019488 Ga0500608_019488_229_846 205
1393 3300053122 Ga0500608_141741 Ga0500608_141741_284_901 205
1394 3300053123 Ga0500614_008827 Ga0500614_008827_274_891 205
1395 3300053123 Ga0500614_010766 Ga0500614_010766_1126_1743 205
1396 3300053126 Ga0500621_016170 Ga0500621_016170_2004_2621 205
1397 3300053130 Ga0500642_0000063 Ga0500642_0000063_53117_53734 205
1398 3300053130 Ga0500642_0019596 Ga0500642_0019596_1091_1708 205
1399 3300053131 Ga0500652_079500 Ga0500652_079500_237_854 205
1400 3300053133 Ga0500655_034645 Ga0500655_034645_89_706 205
1401 3300053134 Ga0500658_0049187 Ga0500658_0049187_1071_1688 205
1402 3300053134 Ga0500658_0146711 Ga0500658_0146711_404_1021 205
1403 3300053136 Ga0500559_0000002 Ga0500559_0000002_259418_260035 205
1404 3300053136 Ga0500559_0001395 Ga0500559_0001395_13101_13718 205
1405 3300053136 Ga0500559_0003076 Ga0500559_0003076_5245_5862 205
1406 3300053136 Ga0500559_0007457 Ga0500559_0007457_1953_2570 205
1407 3300053136 Ga0500559_0146195 Ga0500559_0146195_186_803 205
1408 3300053136 Ga0500559_0180086 Ga0500559_0180086_217_834 205
1409 3300053137 Ga0500561_0046394 Ga0500561_0046394_449_1066 205
1410 3300053138 Ga0500564_000305 Ga0500564_000305_2872_3489 205
1411 3300053139 Ga0500568_0141317 Ga0500568_0141317_139_756 205
1412 3300053142 Ga0500577_0000092 Ga0500577_0000092_19737_20354 205
1413 3300053142 Ga0500577_0223170 Ga0500577_0223170_37_654 205
1414 3300053144 Ga0500585_141361 Ga0500585_141361_130_747 205
1415 3300053150 Ga0500603_025338 Ga0500603_025338_295_912 205
1416 3300053153 Ga0500616_0023510 Ga0500616_0023510_64_681 205
1417 3300053154 Ga0500619_003604 Ga0500619_003604_1200_1817 205
1418 3300053156 Ga0500622_0000284 Ga0500622_0000284_50938_51555 205
1419 3300053156 Ga0500622_0003739 Ga0500622_0003739_4643_5260 205
1420 3300053156 Ga0500622_0017705 Ga0500622_0017705_3109_3726 205
1421 3300053156 Ga0500622_0038142 Ga0500622_0038142_134_751 205
1422 3300053158 Ga0500627_0003805 Ga0500627_0003805_2623_3240 205
1423 3300053158 Ga0500627_0055665 Ga0500627_0055665_730_1347 205
1424 3300053159 Ga0500630_000572 Ga0500630_000572_5796_6413 205
1425 3300053160 Ga0500633_0120469 Ga0500633_0120469_191_808 205
1426 3300053161 Ga0500634_0041129 Ga0500634_0041129_111_755 205
1427 3300053162 Ga0500638_000124 Ga0500638_000124_3373_3990 205
1428 3300053162 Ga0500638_073702 Ga0500638_073702_98_715 205
1429 3300053162 Ga0500638_192661 Ga0500638_192661_141_758 205
1430 3300053163 Ga0500639_000353 Ga0500639_000353_5796_6413 205
1431 3300053163 Ga0500639_104745 Ga0500639_104745_111_728 205
1432 3300053163 Ga0500639_158560 Ga0500639_158560_299_916 205
1433 3300053177 Ga0500636_0027446 Ga0500636_0027446_1932_2549 205
1434 3300053177 Ga0500636_0207102 Ga0500636_0207102_396_1013 205
1435 3300053178 Ga0500637_0000356 Ga0500637_0000356_717_1334 205
1436 3300053178 Ga0500637_0053738 Ga0500637_0053738_1242_1859 205
1437 3300053725 Ga0500576_040143 Ga0500576_040143_1451_2068 205
1438 3300053729 Ga0500625_080811 Ga0500625_080811_513_1130 205
1439 3300053730 Ga0500645_014088 Ga0500645_014088_632_1249 205
1440 3300053735 Ga0500596_004103 Ga0500596_004103_2052_2669 205
1441 3300053735 Ga0500596_006575 Ga0500596_006575_1214_1831 205
1442 3300053736 Ga0500599_001756 Ga0500599_001756_1833_2450 205
1443 3300054114 Ga0501084_0001541 Ga0501084_0001541_2947_3564 205
1444 3300055283 Ga0500661_000328 Ga0500661_000328_6936_7553 205
1445 3300059477 Ga0587084_036967 Ga0587084_036967_12_629 205
1446 3300059477 Ga0587084_048941 Ga0587084_048941_104_721 205
1447 3300059477 Ga0587084_051779 Ga0587084_051779_98_715 205
1448 3300059477 Ga0587084_072327 Ga0587084_072327_14_631 205
1449 3300059493 Ga0587077_083954 Ga0587077_083954_15_632 205
1450 3300059506 Ga0587085_051521 Ga0587085_051521_106_723 205
1451 3300059507 Ga0587086_030546 Ga0587086_030546_83_700 205
1452 3300059623 Ga0587101_051517 Ga0587101_051517_81_698 205
1453 3300059626 Ga0587115_040151 Ga0587115_040151_100_717 205
1454 3300059639 Ga0587062_041186 Ga0587062_041186_27_644 205
1455 3300059641 Ga0587068_031220 Ga0587068_031220_166_783 205
1456 3300059641 Ga0587068_054066 Ga0587068_054066_14_631 205
1457 3300059643 Ga0587072_070570 Ga0587072_070570_109_726 205
1458 3300059647 Ga0587079_080167 Ga0587079_080167_107_724 205
1459 3300060353 Ga0501082_0003607 Ga0501082_0003607_3231_3848 205
1460 3300060353 Ga0501082_0273588 Ga0501082_0273588_618_1235 205
1461 3300060353 Ga0501082_0746699 Ga0501082_0746699_69_686 205
1462 3300061734 Ga0530510_0005706 Ga0530510_0005706_4197_4814 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

113

160

0.99

PF00163

Ribosomal_S4

Ribosomal protein S4/S9 N-terminal domain

23

112

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9801 48 150
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9616 48 150
1qd7-assembly1.cif.gz_C partial model for 30s ribosomal subunit 0.9579 44 205
6vwl-assembly1.cif.gz_c 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9514 45 203
1qd7-assembly1.cif.gz_C partial model for 30s ribosomal subunit 0.9462 44 205
ID Description Score Start End Superfamily
af_Q9LXG1_108_164_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9896 93 136 3.10.290.10
af_A0A0P0Y445_123_179_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9842 95 136 3.10.290.10
af_Q4DSJ7_105_180_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9778 93 136 3.10.290.10
af_C6TBL4_107_182_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9595 95 136 3.10.290.10
2qalD02 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9592 96 188 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A1E4F994-F1-model_v4 Small ribosomal subunit protein uS4 (30S ribosomal protein S4) 0.9864 53 205 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274
AF-A0A6A5LBZ0-F1-model_v4 deleted 0.9859 46 204
AF-A0A358B310-F1-model_v4 30S ribosomal protein S4 0.9856 88 204 GO:0003735
GO:0015935
GO:0019843
GO:0042274
AF-A0A848SWC6-F1-model_v4 Small ribosomal subunit protein uS4 (30S ribosomal protein S4) 0.9852 52 204 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274
AF-A0A3B8QXB5-F1-model_v4 30S ribosomal protein S4 0.9848 71 204 GO:0003735
GO:0015935
GO:0019843
GO:0042274

Feature Viewer

pLDDT pTM Quality
83.81 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map