F494060

General Info

Members Datasets Scaffolds Average Seq Length
1451 476 1451 68

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0694144|Ga0451793_0694144_31_234
Length 67
Sequence MATGTVKWFSDEKGFGFIAPDDQSKDLFVHYSALSGDVRSLHEGEKVQFETEQGPKGPAATQVVVLS

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
127 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
128 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
146 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
225 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
226 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
227 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
228 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
229 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
230 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
233 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
234 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
235 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
251 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
258 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
267 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
277 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
278 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
279 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
280 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
281 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
282 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
283 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
284 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
285 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
286 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
287 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
288 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
289 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
290 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
291 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
292 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
293 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
294 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
295 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
296 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
297 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
298 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
299 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
300 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
301 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
302 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
303 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
304 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
305 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
306 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
312 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
316 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
317 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
318 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
319 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
320 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
321 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
325 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
326 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
327 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
328 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
337 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
338 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
339 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
340 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
341 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
342 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
343 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
344 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
345 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
348 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
349 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
350 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
351 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
352 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
353 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
360 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
361 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
364 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
365 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
366 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
367 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
368 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
369 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
370 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
371 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
372 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
373 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
374 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
375 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
376 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
377 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
378 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
379 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
380 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
381 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
382 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
383 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
384 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
385 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
386 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
387 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
388 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
389 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
390 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
391 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
392 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
393 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
394 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
395 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
396 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
397 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
398 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
399 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
400 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
401 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
402 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
403 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
404 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
405 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
406 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
407 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
423 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
424 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
427 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
428 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
429 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
430 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
431 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
432 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
433 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
434 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
435 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
436 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
437 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
440 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
441 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
442 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
443 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
444 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
445 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
446 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
447 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
448 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
449 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
450 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
451 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
452 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
453 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
454 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
455 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
456 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
457 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
458 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
459 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
460 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
461 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
462 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
463 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
464 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
465 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
466 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
475 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
476 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 1.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 9.72
Rhizosphere 84.63
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c017779 3300000041 Bacteria 625
2 ARSoilOldRDRAFT_c018156 3300000044 Bacteria 612
3 LJNas_1012871 3300000546 Bacteria 891
4 LJQas_1033532 3300000549 Bacteria 603
5 JGI24746J21847_1000264 3300001977 Bacteria 7386
6 JGI24740J21852_10000802 3300001979 Bacteria 13809
7 JGI24750J21931_1071913 3300002070 Bacteria 566
8 JGI24748J21848_1000303 3300002074 Bacteria 5747
9 JGI24034J26672_10000615 3300002239 Bacteria 4579
10 JGI24742J22300_10006669 3300002244 Bacteria 1904
11 JGI25407J50210_10138803 3300003373 Bacteria 598
12 Ga0007410J51695_1013639 3300003574 Bacteria 1108
13 JGI25404J52841_10014116 3300003659 Bacteria 1732
14 JGI25405J52794_10092150 3300003911 Bacteria 671
15 Ga0058860_10111405 3300004801 Bacteria 580
16 Ga0058862_12534098 3300004803 Bacteria 564
17 Ga0070658_10012254 3300005327 Bacteria 6883
18 Ga0070658_10232616 3300005327 Bacteria 1561
19 Ga0070683_100002905 3300005329 Bacteria 13726
20 Ga0070683_100018262 3300005329 Bacteria 6208
21 Ga0070683_100037182 3300005329 Bacteria 4456
22 Ga0070683_100041908 3300005329 Bacteria 4214
23 Ga0070683_100112544 3300005329 Bacteria 2569
24 Ga0070683_100588351 3300005329 Bacteria 1065
25 Ga0070683_100695063 3300005329 Bacteria 974
26 Ga0070683_100855700 3300005329 Bacteria 872
27 Ga0070690_100157292 3300005330 Bacteria 1555
28 Ga0070690_100483865 3300005330 Bacteria 923
29 Ga0070670_100130756 3300005331 Bacteria 2168
30 Ga0070670_101322146 3300005331 Bacteria 660
31 Ga0070677_10000021 3300005333 Bacteria 47171
32 Ga0068869_100815548 3300005334 Bacteria 803
33 Ga0070666_10184453 3300005335 Bacteria 1464
34 Ga0070666_10614233 3300005335 Bacteria 794
35 Ga0070666_10709712 3300005335 Bacteria 738
36 Ga0070666_11173440 3300005335 Bacteria 572
37 Ga0070680_100385188 3300005336 Bacteria 1194
38 Ga0070680_101079468 3300005336 Bacteria 694
39 Ga0070682_100000009 3300005337 Bacteria 291635
40 Ga0070682_100000032 3300005337 Bacteria 155141
41 Ga0070682_100035814 3300005337 Bacteria 3032
42 Ga0070682_100154135 3300005337 Bacteria 1580
43 Ga0070682_100220727 3300005337 Bacteria 1349
44 Ga0070682_100246305 3300005337 Bacteria 1286
45 Ga0070682_101165043 3300005337 Bacteria 649
46 Ga0070682_101560054 3300005337 Bacteria 570
47 Ga0068868_100000568 3300005338 Bacteria 24761
48 Ga0068868_100200631 3300005338 Unclassified 1663
49 Ga0068868_100280721 3300005338 Bacteria 1410
50 Ga0070660_100247145 3300005339 Bacteria 1454
51 Ga0070660_100837140 3300005339 Bacteria 775
52 Ga0070689_100073966 3300005340 Bacteria 2666
53 Ga0070689_100815958 3300005340 Bacteria 821
54 Ga0070689_100847395 3300005340 Unclassified 806
55 Ga0070691_10000100 3300005341 Bacteria 25275
56 Ga0070661_100000255 3300005344 Bacteria 43552
57 Ga0070661_100108517 3300005344 Bacteria 2071
58 Ga0070661_101302108 3300005344 Bacteria 610
59 Ga0070692_10028024 3300005345 Bacteria 2797
60 Ga0070692_10507451 3300005345 Bacteria 783
61 Ga0070668_100115238 3300005347 Bacteria 2142
62 Ga0070668_100132935 3300005347 Bacteria 1998
63 Ga0070668_100173528 3300005347 Bacteria 1756
64 Ga0070668_102141522 3300005347 Bacteria 516
65 Ga0070675_100000022 3300005354 Bacteria 146580
66 Ga0070671_100068090 3300005355 Bacteria 2969
67 Ga0070671_101352399 3300005355 Bacteria 629
68 Ga0070674_100000001 3300005356 Bacteria 277173
69 Ga0070674_100542518 3300005356 Bacteria 974
70 Ga0070674_100666392 3300005356 Bacteria 886
71 Ga0070673_100037854 3300005364 Bacteria 3679
72 Ga0070673_101156713 3300005364 Bacteria 724
73 Ga0070688_100000732 3300005365 Bacteria 16204
74 Ga0070688_100000747 3300005365 Bacteria 16013
75 Ga0070688_100948068 3300005365 Bacteria 681
76 Ga0070659_100000051 3300005366 Bacteria 97520
77 Ga0070659_100040401 3300005366 Bacteria 3645
78 Ga0070659_100087751 3300005366 Bacteria 2491
79 Ga0070659_100614696 3300005366 Bacteria 935
80 Ga0070659_101211356 3300005366 Bacteria 668
81 Ga0070667_100009199 3300005367 Bacteria 8179
82 Ga0070667_100275540 3300005367 Bacteria 1509
83 Ga0070667_100388455 3300005367 Bacteria 1269
84 Ga0070703_10037461 3300005406 Bacteria 1494
85 Ga0070709_10023169 3300005434 Bacteria 3642
86 Ga0070709_10044380 3300005434 Bacteria 2752
87 Ga0070709_11144651 3300005434 Bacteria 624
88 Ga0070714_100000151 3300005435 Bacteria 55747
89 Ga0070714_100003558 3300005435 Bacteria 11647
90 Ga0070714_100015268 3300005435 Bacteria 6178
91 Ga0070714_100023795 3300005435 Bacteria 5037
92 Ga0070714_100109618 3300005435 Bacteria 2443
93 Ga0070714_100157491 3300005435 Bacteria 2052
94 Ga0070714_100205693 3300005435 Bacteria 1802
95 Ga0070714_101220129 3300005435 Bacteria 734
96 Ga0070714_101734941 3300005435 Bacteria 610
97 Ga0070713_100000101 3300005436 Bacteria 54832
98 Ga0070713_100113544 3300005436 Bacteria 2365
99 Ga0070713_100229388 3300005436 Bacteria 1687
100 Ga0070713_101228333 3300005436 Bacteria 726
101 Ga0070713_101296010 3300005436 Bacteria 706
102 Ga0070710_10000013 3300005437 Bacteria 117825
103 Ga0070710_10003212 3300005437 Bacteria 7746
104 Ga0070710_10059065 3300005437 Bacteria 2177
105 Ga0070710_10499654 3300005437 Unclassified 832
106 Ga0070710_11524414 3300005437 Bacteria 503
107 Ga0070701_10012489 3300005438 Bacteria 3834
108 Ga0070701_10436854 3300005438 Bacteria 837
109 Ga0070711_100011844 3300005439 Bacteria 5427
110 Ga0070711_100013085 3300005439 Bacteria 5203
111 Ga0070711_100026363 3300005439 Bacteria 3808
112 Ga0070711_100320214 3300005439 Bacteria 1239
113 Ga0070711_100380953 3300005439 Bacteria 1141
114 Ga0070711_100393762 3300005439 Bacteria 1123
115 Ga0070711_100672389 3300005439 Bacteria 870
116 Ga0070711_101004687 3300005439 Bacteria 716
117 Ga0070705_100054946 3300005440 Bacteria 2338
118 Ga0070705_100967898 3300005440 Bacteria 689
119 Ga0070700_100059590 3300005441 Bacteria 2404
120 Ga0070700_100399678 3300005441 Bacteria 1033
121 Ga0070694_100522392 3300005444 Unclassified 947
122 Ga0070708_100968439 3300005445 Bacteria 798
123 Ga0070708_101838356 3300005445 Bacteria 562
124 Ga0070663_100022260 3300005455 Bacteria 4234
125 Ga0070663_100874705 3300005455 Bacteria 775
126 Ga0070663_101589386 3300005455 Bacteria 583
127 Ga0070678_100002267 3300005456 Bacteria 10470
128 Ga0070678_100450554 3300005456 Unclassified 1127
129 Ga0070678_100874765 3300005456 Bacteria 820
130 Ga0070662_101311400 3300005457 Bacteria 623
131 Ga0070662_101782073 3300005457 Bacteria 532
132 Ga0070681_10034025 3300005458 Bacteria 5118
133 Ga0070681_10895674 3300005458 Bacteria 806
134 Ga0068867_100226888 3300005459 Bacteria 1508
135 Ga0068867_101264560 3300005459 Bacteria 680
136 Ga0070685_10000191 3300005466 Bacteria 41016
137 Ga0070685_11105670 3300005466 Bacteria 599
138 Ga0070698_101575433 3300005471 Bacteria 609
139 Ga0070679_100000365 3300005530 Bacteria 38496
140 Ga0070679_100001834 3300005530 Bacteria 19119
141 Ga0070679_100469335 3300005530 Bacteria 1203
142 Ga0070679_100652617 3300005530 Bacteria 995
143 Ga0070679_100893632 3300005530 Bacteria 832
144 Ga0070684_100005142 3300005535 Bacteria 10001
145 Ga0070684_100005515 3300005535 Bacteria 9706
146 Ga0070684_100013224 3300005535 Bacteria 6648
147 Ga0070684_100076227 3300005535 Bacteria 2959
148 Ga0070684_100122559 3300005535 Bacteria 2339
149 Ga0070684_100358467 3300005535 Bacteria 1342
150 Ga0070684_100565467 3300005535 Bacteria 1056
151 Ga0070684_100594482 3300005535 Bacteria 1029
152 Ga0070684_100894660 3300005535 Bacteria 832
153 Ga0070684_101203489 3300005535 Bacteria 713
154 Ga0068853_100005311 3300005539 Bacteria 10083
155 Ga0068853_100324553 3300005539 Bacteria 1428
156 Ga0068853_101161937 3300005539 Bacteria 745
157 Ga0070672_100001124 3300005543 Bacteria 16332
158 Ga0070686_100206313 3300005544 Bacteria 1412
159 Ga0070695_100130128 3300005545 Bacteria 1734
160 Ga0070696_101453332 3300005546 Bacteria 586
161 Ga0070693_100177676 3300005547 Bacteria 1368
162 Ga0070693_100716572 3300005547 Bacteria 734
163 Ga0070665_100000022 3300005548 Bacteria 379286
164 Ga0070665_100010578 3300005548 Bacteria 9340
165 Ga0070665_100589479 3300005548 Bacteria 1125
166 Ga0070665_100997839 3300005548 Bacteria 849
167 Ga0070665_101802844 3300005548 Bacteria 618
168 Ga0070704_100022121 3300005549 Bacteria 4133
169 Ga0070704_100072695 3300005549 Bacteria 2503
170 Ga0070704_100859455 3300005549 Unclassified 814
171 Ga0070704_101183311 3300005549 Bacteria 697
172 Ga0068855_101629433 3300005563 Bacteria 660
173 Ga0070664_100110301 3300005564 Bacteria 2401
174 Ga0070664_100208112 3300005564 Bacteria 1747
175 Ga0070664_100277146 3300005564 Bacteria 1512
176 Ga0070664_100829746 3300005564 Bacteria 865
177 Ga0070664_101283002 3300005564 Bacteria 691
178 Ga0070664_101285910 3300005564 Bacteria 691
179 Ga0068857_100541699 3300005577 Bacteria 1096
180 Ga0068857_100643077 3300005577 Bacteria 1005
181 Ga0068854_100000267 3300005578 Bacteria 35526
182 Ga0068854_100234337 3300005578 Bacteria 1459
183 Ga0068854_100737358 3300005578 Bacteria 854
184 Ga0068854_101482318 3300005578 Bacteria 615
185 Ga0068856_100009635 3300005614 Bacteria 9376
186 Ga0068856_100015804 3300005614 Bacteria 7300
187 Ga0068856_100416301 3300005614 Bacteria 1364
188 Ga0068856_100425025 3300005614 Bacteria 1349
189 Ga0068856_100495139 3300005614 Bacteria 1243
190 Ga0068856_100737046 3300005614 Bacteria 1005
191 Ga0068856_101517122 3300005614 Bacteria 684
192 Ga0070702_100323992 3300005615 Bacteria 1075
193 Ga0070702_101367278 3300005615 Bacteria 578
194 Ga0068852_100000132 3300005616 Bacteria 50593
195 Ga0068852_100012307 3300005616 Bacteria 6490
196 Ga0068852_100379691 3300005616 Bacteria 1386
197 Ga0068852_100724563 3300005616 Bacteria 1006
198 Ga0068859_100237876 3300005617 Bacteria 1910
199 Ga0068859_102610910 3300005617 Bacteria 556
200 Ga0068864_100000024 3300005618 Bacteria 252632
201 Ga0068864_100586418 3300005618 Bacteria 1081
202 Ga0068864_101952038 3300005618 Bacteria 593
203 Ga0068866_10000140 3300005718 Bacteria 32464
204 Ga0068866_10065404 3300005718 Bacteria 1902
205 Ga0068866_10190336 3300005718 Bacteria 1219
206 Ga0068866_10229542 3300005718 Unclassified 1125
207 Ga0068861_100246219 3300005719 Bacteria 1523
208 Ga0068861_100435744 3300005719 Bacteria 1171
209 Ga0068861_100442480 3300005719 Bacteria 1163
210 Ga0068861_100731146 3300005719 Bacteria 923
211 Ga0068861_101464799 3300005719 Unclassified 669
212 Ga0068851_10000258 3300005834 Bacteria 25137
213 Ga0068851_10226711 3300005834 Bacteria 1052
214 Ga0068870_10166804 3300005840 Bacteria 1311
215 Ga0068863_100000050 3300005841 Bacteria 130200
216 Ga0068863_100026840 3300005841 Bacteria 5493
217 Ga0068863_100047803 3300005841 Bacteria 4058
218 Ga0068863_100688724 3300005841 Bacteria 1015
219 Ga0068863_102079178 3300005841 Bacteria 578
220 Ga0068858_100000264 3300005842 Bacteria 55994
221 Ga0068858_100000545 3300005842 Bacteria 39201
222 Ga0068858_100303988 3300005842 Bacteria 1522
223 Ga0068858_100555336 3300005842 Bacteria 1112
224 Ga0068858_100594845 3300005842 Bacteria 1073
225 Ga0068860_100038935 3300005843 Bacteria 4548
226 Ga0068860_100335016 3300005843 Bacteria 1487
227 Ga0068860_101501185 3300005843 Bacteria 695
228 Ga0068860_101845784 3300005843 Bacteria 626
229 Ga0068862_100004764 3300005844 Bacteria 11416
230 Ga0068862_100606257 3300005844 Bacteria 1052
231 Ga0068862_101291200 3300005844 Bacteria 731
232 Ga0068862_101555572 3300005844 Bacteria 668
233 Ga0081455_10001231 3300005937 Bacteria 31996
234 Ga0081455_10015455 3300005937 Bacteria 7416
235 Ga0081455_10029996 3300005937 Bacteria 4949
236 Ga0081455_10031024 3300005937 Bacteria 4844
237 Ga0081455_10073852 3300005937 Bacteria 2818
238 Ga0081455_10218093 3300005937 Bacteria 1416
239 Ga0081455_10775709 3300005937 Bacteria 604
240 Ga0081538_10087786 3300005981 Bacteria 1622
241 Ga0081538_10096671 3300005981 Bacteria 1503
242 Ga0081540_1000181 3300005983 Bacteria 65791
243 Ga0081540_1009054 3300005983 Bacteria 6880
244 Ga0081539_10013181 3300005985 Bacteria 6257
245 Ga0081539_10080320 3300005985 Bacteria 1716
246 Ga0070717_10008036 3300006028 Bacteria 7864
247 Ga0070717_10010556 3300006028 Bacteria 6978
248 Ga0070717_10213753 3300006028 Bacteria 1693
249 Ga0075365_10007605 3300006038 Bacteria 6086
250 Ga0075365_10008408 3300006038 Bacteria 5856
251 Ga0075365_11012906 3300006038 Bacteria 585
252 Ga0075363_100477239 3300006048 Bacteria 739
253 Ga0075363_100536677 3300006048 Bacteria 697
254 Ga0075363_100550643 3300006048 Bacteria 688
255 Ga0075363_100686036 3300006048 Bacteria 618
256 Ga0075364_10019533 3300006051 Bacteria 4253
257 Ga0075364_10140748 3300006051 Bacteria 1623
258 Ga0075364_10258801 3300006051 Bacteria 1183
259 Ga0075364_10333695 3300006051 Bacteria 1033
260 Ga0075364_11105897 3300006051 Bacteria 538
261 Ga0070715_10032172 3300006163 Bacteria 2135
262 Ga0070715_10154509 3300006163 Unclassified 1128
263 Ga0070715_10209571 3300006163 Bacteria 995
264 Ga0070715_10282368 3300006163 Bacteria 881
265 Ga0070715_10365931 3300006163 Bacteria 792
266 Ga0070715_10718119 3300006163 Bacteria 599
267 Ga0070716_100183543 3300006173 Unclassified 1376
268 Ga0070716_100564047 3300006173 Bacteria 851
269 Ga0070716_100689960 3300006173 Bacteria 779
270 Ga0070712_100000657 3300006175 Bacteria 20381
271 Ga0070712_100009869 3300006175 Bacteria 6018
272 Ga0070712_100011524 3300006175 Bacteria 5609
273 Ga0070712_100019212 3300006175 Bacteria 4453
274 Ga0070712_100037327 3300006175 Bacteria 3311
275 Ga0070712_100254879 3300006175 Bacteria 1404
276 Ga0075367_10318716 3300006178 Bacteria 979
277 Ga0075367_10418612 3300006178 Bacteria 848
278 Ga0075367_10708753 3300006178 Bacteria 640
279 Ga0097621_100283123 3300006237 Bacteria 1460
280 Ga0097621_100441631 3300006237 Bacteria 1171
281 Ga0097621_100790245 3300006237 Bacteria 879
282 Ga0097621_101051813 3300006237 Bacteria 763
283 Ga0068871_101406233 3300006358 Bacteria 658
284 Ga0068871_101785415 3300006358 Bacteria 584
285 Ga0075428_101797806 3300006844 Bacteria 638
286 Ga0075430_100026888 3300006846 Bacteria 4893
287 Ga0075431_101311082 3300006847 Bacteria 685
288 Ga0075431_102020204 3300006847 Bacteria 532
289 Ga0075433_10027303 3300006852 Bacteria 4840
290 Ga0075433_10764813 3300006852 Bacteria 845
291 Ga0075434_101412171 3300006871 Bacteria 706
292 Ga0075429_100007806 3300006880 Bacteria 9294
293 Ga0075429_101480820 3300006880 Bacteria 591
294 Ga0068865_100000039 3300006881 Bacteria 73689
295 Ga0068865_100182082 3300006881 Bacteria 1619
296 Ga0068865_100300466 3300006881 Bacteria 1285
297 Ga0068865_100388849 3300006881 Bacteria 1140
298 Ga0068865_101903360 3300006881 Bacteria 539
299 Ga0075436_100311909 3300006914 Bacteria 1129
300 Ga0075436_100727621 3300006914 Bacteria 736
301 Ga0097620_100237873 3300006931 Bacteria 1910
302 Ga0097620_102610749 3300006931 Bacteria 556
303 Ga0075435_100924316 3300007076 Bacteria 761
304 Ga0075435_101464196 3300007076 Bacteria 599
305 Ga0105251_10196442 3300009011 Bacteria 909
306 Ga0105244_10441690 3300009036 Bacteria 598
307 Ga0105244_10445729 3300009036 Bacteria 595
308 Ga0105250_10095798 3300009092 Bacteria 1210
309 Ga0105240_10018089 3300009093 Bacteria 9476
310 Ga0105240_10359397 3300009093 Bacteria 1650
311 Ga0105240_10676751 3300009093 Bacteria 1129
312 Ga0105240_11137363 3300009093 Bacteria 829
313 Ga0105240_11180865 3300009093 Bacteria 811
314 Ga0111539_10018782 3300009094 Bacteria 8555
315 Ga0111539_11719964 3300009094 Bacteria 727
316 Ga0111539_11852941 3300009094 Bacteria 699
317 Ga0111539_11967287 3300009094 Bacteria 678
318 Ga0105245_10000022 3300009098 Bacteria 181225
319 Ga0105245_10000343 3300009098 Bacteria 43695
320 Ga0105245_10001788 3300009098 Bacteria 19573
321 Ga0105245_10002559 3300009098 Bacteria 16373
322 Ga0105245_10002902 3300009098 Bacteria 15382
323 Ga0105245_10022448 3300009098 Bacteria 5539
324 Ga0105245_10191596 3300009098 Bacteria 1958
325 Ga0105245_10571911 3300009098 Bacteria 1154
326 Ga0105245_11222106 3300009098 Bacteria 800
327 Ga0105245_12906342 3300009098 Bacteria 531
328 Ga0105247_10000369 3300009101 Bacteria 38254
329 Ga0105247_10282715 3300009101 Bacteria 1145
330 Ga0105247_10461345 3300009101 Bacteria 918
331 Ga0105247_10541884 3300009101 Bacteria 854
332 Ga0114129_10005080 3300009147 Bacteria 18523
333 Ga0114129_11978339 3300009147 Bacteria 705
334 Ga0114129_13369456 3300009147 Bacteria 515
335 Ga0105243_10009809 3300009148 Bacteria 7290
336 Ga0105243_10042664 3300009148 Bacteria 3552
337 Ga0105243_10135910 3300009148 Bacteria 2091
338 Ga0105243_10515646 3300009148 Bacteria 1136
339 Ga0105243_11019029 3300009148 Bacteria 832
340 Ga0105243_11465588 3300009148 Bacteria 705
341 Ga0105243_12189831 3300009148 Bacteria 589
342 Ga0105241_10056975 3300009174 Bacteria 2997
343 Ga0105241_10409507 3300009174 Bacteria 1191
344 Ga0105241_10494550 3300009174 Bacteria 1089
345 Ga0105241_10954262 3300009174 Bacteria 799
346 Ga0105241_12436678 3300009174 Bacteria 523
347 Ga0105242_10001159 3300009176 Bacteria 20774
348 Ga0105242_10004215 3300009176 Bacteria 11206
349 Ga0105242_10094968 3300009176 Bacteria 2516
350 Ga0105242_10358598 3300009176 Bacteria 1349
351 Ga0105242_10437236 3300009176 Unclassified 1230
352 Ga0105242_10747569 3300009176 Bacteria 962
353 Ga0105242_11174478 3300009176 Bacteria 785
354 Ga0105242_11541552 3300009176 Bacteria 696
355 Ga0105242_11707744 3300009176 Bacteria 666
356 Ga0105248_10000017 3300009177 Bacteria 298089
357 Ga0105248_11147998 3300009177 Bacteria 878
358 Ga0105248_11509352 3300009177 Bacteria 761
359 Ga0105237_10242710 3300009545 Bacteria 1803
360 Ga0105237_11866143 3300009545 Bacteria 609
361 Ga0105238_10000016 3300009551 Bacteria 236218
362 Ga0105238_10017286 3300009551 Bacteria 7328
363 Ga0105238_11641177 3300009551 Bacteria 673
364 Ga0105249_10000054 3300009553 Bacteria 162883
365 Ga0105249_10002503 3300009553 Bacteria 15901
366 Ga0105249_10312219 3300009553 Bacteria 1581
367 Ga0105249_10478066 3300009553 Bacteria 1288
368 Ga0105249_10722241 3300009553 Bacteria 1057
369 Ga0105249_11465468 3300009553 Bacteria 755
370 Ga0105249_11817301 3300009553 Bacteria 682
371 Ga0105249_11855234 3300009553 Bacteria 675
372 Ga0105249_12462007 3300009553 Bacteria 593
373 Ga0105239_10041190 3300010375 Bacteria 5062
374 Ga0105239_10153412 3300010375 Bacteria 2571
375 Ga0105239_10209023 3300010375 Bacteria 2187
376 Ga0105239_10289397 3300010375 Bacteria 1845
377 Ga0105239_10677098 3300010375 Bacteria 1179
378 Ga0105239_11358809 3300010375 Bacteria 820
379 Ga0105239_11622962 3300010375 Bacteria 748
380 Ga0105246_10009730 3300011119 Bacteria 5925
381 Ga0105246_10413925 3300011119 Bacteria 1123
382 Ga0105246_11145545 3300011119 Bacteria 713
383 Ga0105246_11682381 3300011119 Bacteria 602
384 Ga0157343_1011800 3300012488 Bacteria 683
385 Ga0157324_1052497 3300012506 Bacteria 535
386 Ga0157342_1010147 3300012507 Bacteria 959
387 Ga0157342_1061613 3300012507 Bacteria 552
388 Ga0157371_10004736 3300013102 Bacteria 11744
389 Ga0157371_10054234 3300013102 Bacteria 2848
390 Ga0157371_11383283 3300013102 Bacteria 546
391 Ga0157371_11665089 3300013102 Bacteria 500
392 Ga0157370_10101371 3300013104 Bacteria 2697
393 Ga0157370_10933340 3300013104 Bacteria 787
394 Ga0157369_10000803 3300013105 Bacteria 40158
395 Ga0157369_10043993 3300013105 Bacteria 4863
396 Ga0157369_11600670 3300013105 Bacteria 662
397 Ga0157369_12426651 3300013105 Bacteria 531
398 Ga0157374_10831985 3300013296 Bacteria 940
399 Ga0157374_10899454 3300013296 Bacteria 903
400 Ga0157374_11306109 3300013296 Bacteria 747
401 Ga0157374_11911736 3300013296 Bacteria 619
402 Ga0157374_12362037 3300013296 Bacteria 559
403 Ga0157374_12891741 3300013296 Bacteria 507
404 Ga0157378_10001452 3300013297 Bacteria 21356
405 Ga0157378_10073031 3300013297 Bacteria 3083
406 Ga0157378_10159661 3300013297 Bacteria 2107
407 Ga0157378_10305472 3300013297 Bacteria 1541
408 Ga0157378_10975895 3300013297 Bacteria 881
409 Ga0157378_11924505 3300013297 Bacteria 641
410 Ga0157378_12066828 3300013297 Bacteria 620
411 Ga0163162_10187821 3300013306 Bacteria 2194
412 Ga0163162_10237877 3300013306 Bacteria 1952
413 Ga0163162_10285977 3300013306 Bacteria 1781
414 Ga0163162_11688662 3300013306 Bacteria 723
415 Ga0157372_10000407 3300013307 Bacteria 47331
416 Ga0157372_10002666 3300013307 Bacteria 19326
417 Ga0157372_11227195 3300013307 Bacteria 866
418 Ga0157372_11840821 3300013307 Bacteria 696
419 Ga0157372_12527733 3300013307 Bacteria 589
420 Ga0157375_10024626 3300013308 Bacteria 5574
421 Ga0157375_10467281 3300013308 Bacteria 1427
422 Ga0157375_11715559 3300013308 Bacteria 744
423 Ga0157375_11866391 3300013308 Bacteria 713
424 Ga0163163_10581102 3300014325 Bacteria 1183
425 Ga0163163_10798730 3300014325 Bacteria 1007
426 Ga0163163_10913368 3300014325 Bacteria 941
427 Ga0163163_11505432 3300014325 Bacteria 734
428 Ga0163163_12214306 3300014325 Bacteria 609
429 Ga0157380_10000100 3300014326 Bacteria 48182
430 Ga0157380_10000192 3300014326 Bacteria 35608
431 Ga0157380_10540441 3300014326 Bacteria 1141
432 Ga0157380_10600237 3300014326 Bacteria 1089
433 Ga0157380_10991184 3300014326 Bacteria 873
434 Ga0157380_12392020 3300014326 Bacteria 593
435 Ga0157380_13176285 3300014326 Bacteria 524
436 Ga0157377_10081589 3300014745 Bacteria 1892
437 Ga0157377_10570903 3300014745 Bacteria 802
438 Ga0157377_10729519 3300014745 Bacteria 723
439 Ga0157379_10029391 3300014968 Bacteria 4888
440 Ga0157379_10041559 3300014968 Bacteria 4104
441 Ga0157379_10120901 3300014968 Bacteria 2355
442 Ga0157379_10316152 3300014968 Bacteria 1425
443 Ga0157379_10853163 3300014968 Bacteria 862
444 Ga0157379_12045233 3300014968 Bacteria 567
445 Ga0157376_10191794 3300014969 Bacteria 1874
446 Ga0157376_10244557 3300014969 Bacteria 1673
447 Ga0157376_10288731 3300014969 Bacteria 1548
448 Ga0157376_10393542 3300014969 Bacteria 1338
449 Ga0157376_10875294 3300014969 Bacteria 915
450 Ga0157376_11334672 3300014969 Bacteria 748
451 Ga0163161_10000103 3300017792 Bacteria 81496
452 Ga0163161_10062167 3300017792 Bacteria 2719
453 Ga0163161_10495226 3300017792 Bacteria 994
454 Ga0163161_11186619 3300017792 Bacteria 659
455 Ga0197907_10016208 3300020069 Bacteria 508
456 Ga0206356_10084229 3300020070 Bacteria 647
457 Ga0206355_1422539 3300020076 Bacteria 638
458 Ga0206350_10476675 3300020080 Bacteria 1065
459 Ga0206354_11122989 3300020081 Bacteria 761
460 Ga0206354_11416056 3300020081 Bacteria 513
461 Ga0206353_11780915 3300020082 Bacteria 1320
462 Ga0206353_12003865 3300020082 Bacteria 655
463 Ga0154015_1480330 3300020610 Bacteria 667
464 Ga0213873_10016109 3300021358 Bacteria 1685
465 Ga0213876_10034643 3300021384 Bacteria 2663
466 Ga0213875_10042168 3300021388 Bacteria 2144
467 Ga0224712_10207239 3300022467 Bacteria 893
468 Ga0224712_10271247 3300022467 Bacteria 788
469 Ga0207426_1047443 3300025302 Bacteria 1295
470 Ga0207656_10000279 3300025321 Bacteria 17686
471 Ga0207656_10012232 3300025321 Bacteria 3260
472 Ga0207656_10307282 3300025321 Bacteria 786
473 Ga0207653_10072275 3300025885 Bacteria 1181
474 Ga0207682_10000020 3300025893 Bacteria 64537
475 Ga0207692_10000003 3300025898 Bacteria 431531
476 Ga0207692_10026293 3300025898 Bacteria 2729
477 Ga0207692_10027859 3300025898 Unclassified 2665
478 Ga0207692_10119126 3300025898 Bacteria 1475
479 Ga0207642_10000066 3300025899 Bacteria 28858
480 Ga0207642_10164970 3300025899 Bacteria 1193
481 Ga0207642_10202560 3300025899 Bacteria 1097
482 Ga0207710_10000227 3300025900 Bacteria 48932
483 Ga0207710_10052958 3300025900 Bacteria 1825
484 Ga0207710_10144088 3300025900 Bacteria 1152
485 Ga0207710_10151754 3300025900 Bacteria 1124
486 Ga0207710_10264628 3300025900 Bacteria 862
487 Ga0207710_10406193 3300025900 Bacteria 699
488 Ga0207688_10056078 3300025901 Bacteria 2213
489 Ga0207688_10078776 3300025901 Bacteria 1879
490 Ga0207688_10560529 3300025901 Bacteria 718
491 Ga0207688_11069092 3300025901 Bacteria 509
492 Ga0207680_10002542 3300025903 Bacteria 8507
493 Ga0207680_10029138 3300025903 Bacteria 3098
494 Ga0207680_11051169 3300025903 Bacteria 583
495 Ga0207680_11183426 3300025903 Bacteria 545
496 Ga0207685_10122780 3300025905 Bacteria 1142
497 Ga0207685_10259272 3300025905 Unclassified 844
498 Ga0207685_10264776 3300025905 Bacteria 837
499 Ga0207699_10224906 3300025906 Bacteria 1283
500 Ga0207699_10240651 3300025906 Bacteria 1243
501 Ga0207699_11200285 3300025906 Bacteria 562
502 Ga0207699_11406489 3300025906 Bacteria 516
503 Ga0207699_11476203 3300025906 Bacteria 503
504 Ga0207645_10175133 3300025907 Bacteria 1407
505 Ga0207643_10172143 3300025908 Bacteria 1307
506 Ga0207643_10201370 3300025908 Bacteria 1212
507 Ga0207705_10029550 3300025909 Bacteria 3907
508 Ga0207705_10068852 3300025909 Bacteria 2563
509 Ga0207705_11202154 3300025909 Bacteria 581
510 Ga0207654_10206856 3300025911 Bacteria 1295
511 Ga0207707_10068205 3300025912 Bacteria 3099
512 Ga0207707_10751072 3300025912 Bacteria 816
513 Ga0207695_10367701 3300025913 Bacteria 1324
514 Ga0207695_10760500 3300025913 Bacteria 849
515 Ga0207695_10830166 3300025913 Bacteria 804
516 Ga0207695_11234634 3300025913 Bacteria 628
517 Ga0207671_10156193 3300025914 Bacteria 1765
518 Ga0207693_10002361 3300025915 Bacteria 16392
519 Ga0207693_10007537 3300025915 Bacteria 8941
520 Ga0207693_10010235 3300025915 Bacteria 7614
521 Ga0207693_10020454 3300025915 Bacteria 5264
522 Ga0207693_10037519 3300025915 Bacteria 3819
523 Ga0207693_10313540 3300025915 Bacteria 1228
524 Ga0207693_10314460 3300025915 Bacteria 1226
525 Ga0207693_10324132 3300025915 Bacteria 1206
526 Ga0207693_10345784 3300025915 Unclassified 1164
527 Ga0207693_10904662 3300025915 Bacteria 677
528 Ga0207663_10002757 3300025916 Bacteria 8472
529 Ga0207663_10018585 3300025916 Bacteria 3899
530 Ga0207663_10025553 3300025916 Bacteria 3416
531 Ga0207663_10042562 3300025916 Bacteria 2775
532 Ga0207663_10055710 3300025916 Bacteria 2482
533 Ga0207663_10081638 3300025916 Bacteria 2118
534 Ga0207663_10270231 3300025916 Bacteria 1259
535 Ga0207663_10299712 3300025916 Unclassified 1200
536 Ga0207662_10212314 3300025918 Bacteria 1257
537 Ga0207662_10893701 3300025918 Bacteria 629
538 Ga0207657_10079092 3300025919 Bacteria 2767
539 Ga0207657_10135510 3300025919 Bacteria 2015
540 Ga0207657_10449128 3300025919 Bacteria 1012
541 Ga0207657_10492682 3300025919 Bacteria 960
542 Ga0207649_10000015 3300025920 Bacteria 245662
543 Ga0207649_10590767 3300025920 Bacteria 853
544 Ga0207649_11579914 3300025920 Bacteria 519
545 Ga0207652_10000513 3300025921 Bacteria 39231
546 Ga0207652_10000536 3300025921 Bacteria 38532
547 Ga0207652_10655728 3300025921 Bacteria 938
548 Ga0207652_10809286 3300025921 Bacteria 832
549 Ga0207646_11422429 3300025922 Bacteria 602
550 Ga0207681_11807833 3300025923 Unclassified 510
551 Ga0207694_10000012 3300025924 Bacteria 411218
552 Ga0207694_10180031 3300025924 Bacteria 1714
553 Ga0207694_10939614 3300025924 Bacteria 731
554 Ga0207650_11660309 3300025925 Bacteria 542
555 Ga0207659_10000030 3300025926 Bacteria 124433
556 Ga0207659_11623278 3300025926 Bacteria 552
557 Ga0207687_10000025 3300025927 Bacteria 175177
558 Ga0207687_10000065 3300025927 Bacteria 80752
559 Ga0207687_10000109 3300025927 Bacteria 59406
560 Ga0207687_10001391 3300025927 Bacteria 16522
561 Ga0207687_10111608 3300025927 Bacteria 2030
562 Ga0207687_10163474 3300025927 Bacteria 1711
563 Ga0207687_10256456 3300025927 Bacteria 1392
564 Ga0207687_10381125 3300025927 Bacteria 1155
565 Ga0207700_10000019 3300025928 Bacteria 183117
566 Ga0207700_10336105 3300025928 Bacteria 1312
567 Ga0207700_10715429 3300025928 Bacteria 894
568 Ga0207664_10000152 3300025929 Bacteria 55754
569 Ga0207664_10000423 3300025929 Bacteria 30218
570 Ga0207664_10019380 3300025929 Bacteria 5027
571 Ga0207664_10057149 3300025929 Bacteria 3101
572 Ga0207664_10083570 3300025929 Bacteria 2603
573 Ga0207664_10127044 3300025929 Bacteria 2142
574 Ga0207664_10535542 3300025929 Bacteria 1050
575 Ga0207664_11116375 3300025929 Bacteria 705
576 Ga0207664_11879812 3300025929 Bacteria 521
577 Ga0207644_10198893 3300025931 Bacteria 1580
578 Ga0207644_11035707 3300025931 Bacteria 689
579 Ga0207690_10000054 3300025932 Bacteria 104097
580 Ga0207690_10010219 3300025932 Bacteria 5572
581 Ga0207690_10044238 3300025932 Bacteria 2934
582 Ga0207690_10072483 3300025932 Bacteria 2379
583 Ga0207690_11384070 3300025932 Bacteria 588
584 Ga0207706_10642614 3300025933 Bacteria 909
585 Ga0207686_10000035 3300025934 Bacteria 130483
586 Ga0207686_10022231 3300025934 Bacteria 3651
587 Ga0207686_10049109 3300025934 Bacteria 2618
588 Ga0207686_10157828 3300025934 Bacteria 1587
589 Ga0207686_10799566 3300025934 Bacteria 756
590 Ga0207686_11604696 3300025934 Bacteria 537
591 Ga0207686_11848633 3300025934 Bacteria 500
592 Ga0207709_10005656 3300025935 Bacteria 7067
593 Ga0207709_10084458 3300025935 Bacteria 2055
594 Ga0207709_10158267 3300025935 Bacteria 1577
595 Ga0207709_10578290 3300025935 Bacteria 887
596 Ga0207670_10022949 3300025936 Bacteria 3876
597 Ga0207670_10658423 3300025936 Bacteria 864
598 Ga0207669_10000002 3300025937 Bacteria 377651
599 Ga0207669_10699968 3300025937 Bacteria 833
600 Ga0207669_10977715 3300025937 Bacteria 710
601 Ga0207704_10000165 3300025938 Bacteria 35234
602 Ga0207704_10380060 3300025938 Bacteria 1108
603 Ga0207704_11021177 3300025938 Bacteria 700
604 Ga0207665_10071633 3300025939 Bacteria 2366
605 Ga0207665_10168246 3300025939 Bacteria 1581
606 Ga0207665_10471902 3300025939 Bacteria 966
607 Ga0207665_11604997 3300025939 Bacteria 516
608 Ga0207691_10000286 3300025940 Bacteria 49918
609 Ga0207711_10000011 3300025941 Bacteria 518817
610 Ga0207689_11211631 3300025942 Bacteria 635
611 Ga0207661_10000446 3300025944 Bacteria 26544
612 Ga0207661_10000545 3300025944 Bacteria 24110
613 Ga0207661_10001203 3300025944 Bacteria 17323
614 Ga0207661_10025673 3300025944 Bacteria 4482
615 Ga0207661_10087458 3300025944 Bacteria 2588
616 Ga0207661_10100687 3300025944 Bacteria 2426
617 Ga0207661_10127712 3300025944 Bacteria 2173
618 Ga0207661_10190888 3300025944 Bacteria 1796
619 Ga0207661_10422385 3300025944 Bacteria 1211
620 Ga0207661_11017261 3300025944 Bacteria 763
621 Ga0207661_11232326 3300025944 Bacteria 688
622 Ga0207679_10029307 3300025945 Bacteria 3831
623 Ga0207679_10267342 3300025945 Bacteria 1461
624 Ga0207679_10606926 3300025945 Bacteria 987
625 Ga0207679_11144755 3300025945 Bacteria 714
626 Ga0207679_11233745 3300025945 Bacteria 686
627 Ga0207667_10725815 3300025949 Bacteria 994
628 Ga0207651_10040641 3300025960 Bacteria 3079
629 Ga0207712_10000032 3300025961 Bacteria 210628
630 Ga0207712_10026153 3300025961 Bacteria 3885
631 Ga0207712_10590202 3300025961 Bacteria 960
632 Ga0207712_10966494 3300025961 Bacteria 755
633 Ga0207712_11277310 3300025961 Bacteria 656
634 Ga0207712_11326162 3300025961 Bacteria 643
635 Ga0207668_10004634 3300025972 Bacteria 8084
636 Ga0207668_10368051 3300025972 Bacteria 1206
637 Ga0207668_11219917 3300025972 Bacteria 676
638 Ga0207668_11741097 3300025972 Bacteria 562
639 Ga0207640_10000100 3300025981 Bacteria 66511
640 Ga0207640_10195709 3300025981 Bacteria 1527
641 Ga0207640_10843722 3300025981 Bacteria 797
642 Ga0207658_10025733 3300025986 Bacteria 4121
643 Ga0207658_10025957 3300025986 Bacteria 4104
644 Ga0207658_10126418 3300025986 Bacteria 2047
645 Ga0207658_10272644 3300025986 Bacteria 1447
646 Ga0207677_10001061 3300026023 Bacteria 15064
647 Ga0207703_10000547 3300026035 Bacteria 38608
648 Ga0207703_10014839 3300026035 Bacteria 6080
649 Ga0207703_10507667 3300026035 Bacteria 1132
650 Ga0207703_10616426 3300026035 Bacteria 1027
651 Ga0207639_10266357 3300026041 Bacteria 1501
652 Ga0207639_11086113 3300026041 Bacteria 750
653 Ga0207639_11147264 3300026041 Bacteria 729
654 Ga0207639_12107281 3300026041 Bacteria 525
655 Ga0207678_10002590 3300026067 Bacteria 16479
656 Ga0207708_10124829 3300026075 Bacteria 2008
657 Ga0207708_10168616 3300026075 Bacteria 1732
658 Ga0207708_10238474 3300026075 Bacteria 1462
659 Ga0207708_10864377 3300026075 Bacteria 781
660 Ga0207708_11143284 3300026075 Bacteria 680
661 Ga0207702_10000349 3300026078 Bacteria 52941
662 Ga0207702_10043084 3300026078 Bacteria 3788
663 Ga0207702_10049316 3300026078 Bacteria 3553
664 Ga0207641_10000295 3300026088 Bacteria 62363
665 Ga0207641_10002521 3300026088 Bacteria 16875
666 Ga0207641_10867976 3300026088 Bacteria 895
667 Ga0207641_10879534 3300026088 Bacteria 889
668 Ga0207648_12173696 3300026089 Bacteria 516
669 Ga0207676_10000048 3300026095 Bacteria 147853
670 Ga0207674_10191471 3300026116 Bacteria 1995
671 Ga0207675_100016463 3300026118 Bacteria 6906
672 Ga0207675_100412190 3300026118 Bacteria 1333
673 Ga0207675_101540311 3300026118 Bacteria 685
674 Ga0207683_10027789 3300026121 Bacteria 4889
675 Ga0207683_10040177 3300026121 Bacteria 4080
676 Ga0207683_11249861 3300026121 Bacteria 688
677 Ga0207683_11414713 3300026121 Bacteria 643
678 Ga0207698_10000014 3300026142 Bacteria 240703
679 Ga0207698_10081130 3300026142 Bacteria 2617
680 Ga0207698_10320133 3300026142 Bacteria 1452
681 Ga0207698_10462723 3300026142 Bacteria 1227
682 Ga0207698_10724244 3300026142 Bacteria 991
683 Ga0209813_10349401 3300027866 Bacteria 585
684 Ga0207428_11294118 3300027907 Bacteria 505
685 Ga0268266_10000029 3300028379 Bacteria 424015
686 Ga0268266_10000369 3300028379 Bacteria 69354
687 Ga0268266_10009239 3300028379 Bacteria 8697
688 Ga0268266_10514879 3300028379 Bacteria 1143
689 Ga0268266_11492501 3300028379 Bacteria 651
690 Ga0268266_11719249 3300028379 Bacteria 602
691 Ga0268265_10003212 3300028380 Bacteria 11865
692 Ga0268264_10035488 3300028381 Bacteria 4106
693 Ga0268264_10363173 3300028381 Bacteria 1382
694 Ga0268264_11712976 3300028381 Bacteria 639
695 Ga0265337_1149127 3300028556 Bacteria 633
696 Ga0265326_10000005 3300028558 Bacteria 257124
697 Ga0265326_10036848 3300028558 Bacteria 1391
698 Ga0265319_1000037 3300028563 Bacteria 115642
699 Ga0265319_1002387 3300028563 Bacteria 10311
700 Ga0265334_10000024 3300028573 Bacteria 118525
701 Ga0265334_10069882 3300028573 Bacteria 1310
702 Ga0265318_10194338 3300028577 Bacteria 742
703 Ga0265322_10153375 3300028654 Bacteria 658
704 Ga0265336_10011048 3300028666 Bacteria 3076
705 Ga0265336_10130968 3300028666 Bacteria 747
706 Ga0265336_10274886 3300028666 Bacteria 500
707 Ga0265338_10000051 3300028800 Bacteria 211202
708 Ga0265338_10005196 3300028800 Bacteria 17096
709 Ga0265324_10001239 3300029957 Bacteria 15080
710 Ga0265320_10152146 3300031240 Bacteria 1045
711 Ga0265320_10156189 3300031240 Bacteria 1029
712 Ga0265340_10334854 3300031247 Bacteria 669
713 Ga0265331_10004016 3300031250 Bacteria 9283
714 Ga0307513_10538384 3300031456 Bacteria 881
715 Ga0307408_101999855 3300031548 Bacteria 557
716 Ga0265342_10373431 3300031712 Bacteria 740
717 Ga0307405_10246304 3300031731 Bacteria 1327
718 Ga0307405_10292011 3300031731 Bacteria 1233
719 Ga0316577_10256329 3300031733 Bacteria 990
720 Ga0307413_10897045 3300031824 Bacteria 753
721 Ga0326468_10043821 3300031889 Bacteria 651
722 Ga0307406_10143885 3300031901 Bacteria 1692
723 Ga0307406_10376564 3300031901 Bacteria 1118
724 Ga0307407_10578244 3300031903 Bacteria 834
725 Ga0307407_10999688 3300031903 Bacteria 646
726 Ga0307412_10695292 3300031911 Bacteria 872
727 Ga0307409_100241412 3300031995 Bacteria 1645
728 Ga0307409_101510463 3300031995 Bacteria 699
729 Ga0307416_100150273 3300032002 Bacteria 2135
730 Ga0307416_101909882 3300032002 Bacteria 697
731 Ga0316053_118989 3300032120 Bacteria 530
732 Ga0307415_100007313 3300032126 Bacteria 6031
733 Ga0307415_101558695 3300032126 Bacteria 633
734 Ga0316583_10360288 3300032133 Bacteria 503
735 Ga0373949_0158769 3300035090 Bacteria 658
736 Ga0373923_0294143 3300035111 Bacteria 767
737 Ga0373923_0599769 3300035111 Bacteria 542
738 Ga0373932_0267290 3300035112 Bacteria 629
739 Ga0373945_0362006 3300035116 Bacteria 631
740 Ga0373953_0019266 3300035117 Bacteria 2536
741 Ga0373954_0098961 3300035118 Unclassified 1406
742 Ga0373954_0586130 3300035118 Bacteria 553
743 Ga0373956_0082690 3300035119 Bacteria 1475
744 Ga0373956_0213295 3300035119 Bacteria 916
745 Ga0373957_0020529 3300035120 Bacteria 2335
746 Ga0373946_0184999 3300035171 Bacteria 991
747 Ga0373955_0497206 3300035172 Bacteria 745
748 Ga0373955_0813477 3300035172 Unclassified 574
749 Ga0373935_0892602 3300035692 Unclassified 658
750 Ga0373935_1219170 3300035692 Unclassified 561
751 Ga0373933_0024811 3300035724 Bacteria 3434
752 Ga0373933_0104494 3300035724 Bacteria 1760
753 Ga0373933_0535756 3300035724 Archaea 768
754 Ga0373947_0609805 3300035725 Bacteria 744
755 Ga0373947_0692485 3300035725 Unclassified 695
756 Ga0373937_0028849 3300036401 Bacteria 5024
757 Ga0373937_0059441 3300036401 Bacteria 3513
758 Ga0373937_0239183 3300036401 Bacteria 1710
759 Ga0373937_1313014 3300036401 Archaea 671
760 Ga0373937_1547854 3300036401 Bacteria 610
761 Ga0265778_029579 3300036457 Bacteria 704
762 Ga0316582_0364133 3300036647 Bacteria 995
763 Ga0316584_0303208 3300036712 Bacteria 1156
764 Ga0373925_0248972 3300037068 Unclassified 1425
765 Ga0373925_0466880 3300037068 Bacteria 1035
766 Ga0373925_0971245 3300037068 Bacteria 700
767 Ga0395899_0280486 3300037312 Bacteria 1134
768 Ga0395900_0440975 3300037418 Bacteria 1260
769 Ga0395898_0124585 3300037466 Bacteria 2469
770 Ga0395898_0813900 3300037466 Bacteria 874
771 Ga0395898_0961364 3300037466 Bacteria 791
772 Ga0395898_1928231 3300037466 Bacteria 511
773 Ga0395905_0725754 3300037471 Bacteria 896
774 Ga0395905_0928884 3300037471 Bacteria 773
775 Ga0436364_0535431 3300037853 Bacteria 566
776 Ga0436364_0612522 3300037853 Bacteria 4104
777 Ga0436364_0722805 3300037853 Bacteria 680
778 Ga0436364_0770269 3300037853 Bacteria 1088
779 Ga0436364_1461187 3300037853 Bacteria 3963
780 Ga0395901_0307414 3300038443 Bacteria 1643
781 Ga0395901_0709859 3300038443 Bacteria 1002
782 Ga0395901_0943358 3300038443 Bacteria 842
783 Ga0395901_1096821 3300038443 Bacteria 767
784 Ga0395901_1698750 3300038443 Bacteria 583
785 Ga0436365_0640760 3300039437 Bacteria 615
786 Ga0436365_1596370 3300039437 Bacteria 3393
787 Ga0436365_1618718 3300039437 Bacteria 777
788 Ga0436360_0704697 3300039438 Bacteria 852
789 Ga0436360_0825171 3300039438 Bacteria 524
790 Ga0436363_0330401 3300039450 Bacteria 571
791 Ga0436362_0347766 3300039453 Bacteria 1955
792 Ga0436362_0998278 3300039453 Bacteria 750
793 Ga0451787_613514 3300041441 Bacteria 611
794 Ga0451791_0927836 3300041451 Bacteria 546
795 Ga0451793_0694144 3300041452 Bacteria 583
796 Ga0451797_0635860 3300041453 Bacteria 801
797 Ga0451795_1713463 3300041456 Bacteria 528
798 Ga0451800_0135496 3300041459 Bacteria 664
799 Ga0451800_0526380 3300041459 Bacteria 770
800 Ga0451800_1687827 3300041459 Bacteria 1117
801 Ga0451802_0629809 3300041460 Bacteria 1023
802 Ga0451804_0938937 3300041463 Bacteria 833
803 Ga0451807_0947727 3300041486 Bacteria 522
804 Ga0451807_1196866 3300041486 Bacteria 715
805 Ga0451833_0831630 3300041491 Bacteria 706
806 Ga0451833_1293110 3300041491 Bacteria 1099
807 Ga0451837_0165306 3300041494 Archaea 656
808 Ga0451837_0496799 3300041494 Bacteria 646
809 Ga0451839_1173009 3300041496 Bacteria 733
810 Ga0451841_1355594 3300041498 Bacteria 541
811 Ga0451845_0617187 3300041501 Unclassified 576
812 Ga0451847_0629914 3300041503 Bacteria 592
813 Ga0451849_0317970 3300041505 Bacteria 776
814 Ga0451849_0505893 3300041505 Bacteria 609
815 Ga0451849_0916961 3300041505 Bacteria 566
816 Ga0451851_0604415 3300041507 Bacteria 725
817 Ga0451853_1083256 3300041512 Bacteria 744
818 Ga0451853_2009781 3300041512 Bacteria 1258
819 Ga0451853_2933682 3300041512 Bacteria 612
820 Ga0439456_132018 3300042013 Bacteria 577
821 Ga0439463_120990 3300042016 Bacteria 677
822 Ga0439440_0284241 3300042993 Bacteria 512
823 Ga0466969_0010293 3300044656 Bacteria 4961
824 Ga0466972_0080620 3300044658 Bacteria 1550
825 Ga0466965_0154073 3300044683 Bacteria 1202
826 Ga0466965_0334932 3300044683 Bacteria 826
827 Ga0466965_0456148 3300044683 Bacteria 712
828 Ga0466966_0062341 3300044684 Bacteria 2351
829 Ga0466966_0106112 3300044684 Bacteria 1734
830 Ga0466966_0504986 3300044684 Bacteria 727
831 Ga0466961_0003485 3300044693 Bacteria 9807
832 Ga0466961_0036824 3300044693 Bacteria 3140
833 Ga0466961_0523441 3300044693 Bacteria 715
834 Ga0466963_0000051 3300044694 Bacteria 39254
835 Ga0466963_0001558 3300044694 Bacteria 12425
836 Ga0466963_0009227 3300044694 Bacteria 5939
837 Ga0466963_0036711 3300044694 Bacteria 3196
838 Ga0466963_0151290 3300044694 Bacteria 1611
839 Ga0466963_0477179 3300044694 Bacteria 880
840 Ga0466964_0666209 3300044706 Bacteria 577
841 Ga0466964_0710730 3300044706 Bacteria 561
842 Ga0466971_0106526 3300044719 Bacteria 1292
843 Ga0466971_0115589 3300044719 Bacteria 1240
844 Ga0466971_0499511 3300044719 Bacteria 600
845 Ga0466968_0058799 3300044735 Bacteria 1655
846 Ga0466968_0114308 3300044735 Bacteria 1216
847 Ga0466968_0303794 3300044735 Bacteria 768
848 Ga0466970_0134944 3300044765 Bacteria 1357
849 Ga0466970_0235263 3300044765 Bacteria 1024
850 Ga0466957_0001697 3300044842 Bacteria 11579
851 Ga0466957_0143814 3300044842 Bacteria 1538
852 Ga0466957_0193557 3300044842 Bacteria 1333
853 Ga0466957_0306046 3300044842 Bacteria 1069
854 Ga0466957_0514449 3300044842 Bacteria 831
855 Ga0466960_0056122 3300044901 Bacteria 1917
856 Ga0466960_0815413 3300044901 Bacteria 566
857 Ga0466960_0964989 3300044901 Bacteria 522
858 Ga0466960_0965477 3300044901 Bacteria 522
859 Ga0466959_0000609 3300045049 Bacteria 20893
860 Ga0466959_0027158 3300045049 Bacteria 4246
861 Ga0466959_0030880 3300045049 Unclassified 3967
862 Ga0466959_0060290 3300045049 Bacteria 2761
863 Ga0466959_0183608 3300045049 Bacteria 1462
864 Ga0466959_0345436 3300045049 Bacteria 1015
865 Ga0466959_0720906 3300045049 Unclassified 668
866 Ga0466958_0000990 3300045836 Bacteria 12838
867 Ga0466958_0008582 3300045836 Bacteria 5672
868 Ga0466958_0014638 3300045836 Unclassified 4479
869 Ga0466958_0075763 3300045836 Bacteria 2064
870 Ga0466958_0158435 3300045836 Bacteria 1429
871 Ga0466958_0189291 3300045836 Bacteria 1308
872 Ga0466967_0018734 3300045976 Bacteria 5544
873 Ga0466967_0143417 3300045976 Bacteria 2226
874 Ga0466967_2045828 3300045976 Bacteria 569
875 Ga0466967_2130551 3300045976 Bacteria 557
876 Ga0495592_0000608 3300046454 Bacteria 25303
877 Ga0495592_0093583 3300046454 Bacteria 2152
878 Ga0495592_0125901 3300046454 Bacteria 1798
879 Ga0495592_0304363 3300046454 Bacteria 1035
880 Ga0495592_0449080 3300046454 Bacteria 808
881 Ga0495592_0568152 3300046454 Bacteria 695
882 Ga0495603_0013380 3300046455 Bacteria 4964
883 Ga0495603_0022660 3300046455 Bacteria 3800
884 Ga0495603_0523989 3300046455 Bacteria 679
885 Ga0495591_036391 3300046458 Bacteria 1433
886 Ga0495629_0000201 3300046459 Bacteria 53022
887 Ga0495629_0005614 3300046459 Bacteria 9367
888 Ga0495629_0162200 3300046459 Bacteria 1553
889 Ga0495629_0203509 3300046459 Bacteria 1368
890 Ga0495629_0379570 3300046459 Bacteria 962
891 Ga0495629_0757088 3300046459 Bacteria 643
892 Ga0495629_0905110 3300046459 Bacteria 578
893 Ga0495629_0935544 3300046459 Bacteria 567
894 Ga0495641_0000010 3300046461 Bacteria 158798
895 Ga0495641_0020860 3300046461 Bacteria 3310
896 Ga0495641_0047547 3300046461 Bacteria 1969
897 Ga0495641_0171523 3300046461 Bacteria 971
898 Ga0495641_0325417 3300046461 Unclassified 694
899 Ga0495641_0329294 3300046461 Bacteria 689
900 Ga0495641_0446333 3300046461 Bacteria 588
901 Ga0495641_0525893 3300046461 Bacteria 540
902 Ga0495651_0005613 3300046462 Bacteria 9562
903 Ga0495651_0150509 3300046462 Bacteria 1678
904 Ga0495651_0175627 3300046462 Bacteria 1521
905 Ga0495651_0200196 3300046462 Bacteria 1398
906 Ga0495651_0403707 3300046462 Bacteria 892
907 Ga0495651_0546259 3300046462 Bacteria 737
908 Ga0495653_0019879 3300046463 Bacteria 5444
909 Ga0495653_0057561 3300046463 Bacteria 2958
910 Ga0495653_0066111 3300046463 Bacteria 2720
911 Ga0495653_0430227 3300046463 Bacteria 834
912 Ga0495653_0455607 3300046463 Bacteria 804
913 Ga0495653_0535638 3300046463 Bacteria 726
914 Ga0495653_0771205 3300046463 Bacteria 580
915 Ga0495580_0869412 3300046472 Bacteria 581
916 Ga0495582_0000002 3300046473 Bacteria 219909
917 Ga0495582_0286026 3300046473 Bacteria 947
918 Ga0495639_0064452 3300046475 Bacteria 1684
919 Ga0495639_0417418 3300046475 Bacteria 679
920 Ga0495662_0000162 3300046476 Bacteria 26288
921 Ga0495662_0088014 3300046476 Bacteria 1513
922 Ga0495662_0452385 3300046476 Bacteria 630
923 Ga0495662_0623586 3300046476 Bacteria 527
924 Ga0495664_0114317 3300046477 Bacteria 1631
925 Ga0495664_0151196 3300046477 Bacteria 1408
926 Ga0495664_0578460 3300046477 Bacteria 668
927 Ga0495584_0506966 3300046491 Bacteria 615
928 Ga0495594_0000001 3300046499 Bacteria 293051
929 Ga0495606_0000886 3300046507 Bacteria 44754
930 Ga0495608_0000042 3300046511 Bacteria 115906
931 Ga0495608_0002177 3300046511 Bacteria 14130
932 Ga0495608_0006477 3300046511 Bacteria 8311
933 Ga0495608_0141855 3300046511 Bacteria 1533
934 Ga0495608_0164767 3300046511 Bacteria 1408
935 Ga0495618_0000051 3300046514 Bacteria 87668
936 Ga0495618_0008515 3300046514 Bacteria 6202
937 Ga0495618_0053123 3300046514 Bacteria 2562
938 Ga0495618_0847232 3300046514 Bacteria 530
939 Ga0495620_0000472 3300046515 Bacteria 26231
940 Ga0495620_0184380 3300046515 Bacteria 806
941 Ga0495620_0425789 3300046515 Bacteria 502
942 Ga0495628_0000548 3300046516 Bacteria 34470
943 Ga0495628_0081094 3300046516 Bacteria 2520
944 Ga0495628_0095645 3300046516 Bacteria 2295
945 Ga0495628_0143540 3300046516 Bacteria 1821
946 Ga0495628_0144018 3300046516 Bacteria 1817
947 Ga0495628_0328904 3300046516 Bacteria 1127
948 Ga0495628_0633748 3300046516 Bacteria 760
949 Ga0495628_1165106 3300046516 Bacteria 524
950 Ga0495630_0000027 3300046517 Bacteria 146589
951 Ga0495630_0000125 3300046517 Bacteria 61325
952 Ga0495630_0000145 3300046517 Bacteria 54974
953 Ga0495630_0006964 3300046517 Bacteria 8060
954 Ga0495630_0065025 3300046517 Bacteria 2741
955 Ga0495630_0108853 3300046517 Bacteria 2099
956 Ga0495630_0131184 3300046517 Bacteria 1903
957 Ga0495630_0223381 3300046517 Bacteria 1438
958 Ga0495630_0709832 3300046517 Bacteria 769
959 Ga0495630_0905566 3300046517 Bacteria 672
960 Ga0495632_0206351 3300046519 Bacteria 893
961 Ga0495637_0272796 3300046520 Bacteria 605
962 Ga0495644_0008974 3300046523 Bacteria 3845
963 Ga0495663_0224679 3300046525 Bacteria 661
964 Ga0495652_0000009 3300046529 Bacteria 311000
965 Ga0495652_0007230 3300046529 Bacteria 10249
966 Ga0495652_0123660 3300046529 Bacteria 2059
967 Ga0495652_0169005 3300046529 Bacteria 1690
968 Ga0495652_0352349 3300046529 Bacteria 1054
969 Ga0495652_0628063 3300046529 Bacteria 730
970 Ga0495652_0853227 3300046529 Bacteria 603
971 Ga0495652_0886377 3300046529 Bacteria 589
972 Ga0495665_0181475 3300046531 Unclassified 1094
973 Ga0495640_0059281 3300046533 Bacteria 2608
974 Ga0495640_0359899 3300046533 Bacteria 897
975 Ga0495640_0443714 3300046533 Bacteria 793
976 Ga0495640_0637928 3300046533 Bacteria 641
977 Ga0495640_0653163 3300046533 Bacteria 633
978 Ga0495586_0001779 3300046535 Bacteria 11781
979 Ga0495586_0477093 3300046535 Bacteria 719
980 Ga0495587_0011085 3300046536 Bacteria 5718
981 Ga0495587_0053947 3300046536 Bacteria 2369
982 Ga0495587_0091663 3300046536 Bacteria 1755
983 Ga0495587_0216062 3300046536 Bacteria 1082
984 Ga0495587_0260393 3300046536 Bacteria 974
985 Ga0495587_0573402 3300046536 Bacteria 622
986 Ga0495598_0004201 3300046537 Bacteria 3106
987 Ga0495597_0183363 3300046542 Bacteria 845
988 Ga0495645_0055857 3300046543 Bacteria 2866
989 Ga0495645_0077580 3300046543 Bacteria 2388
990 Ga0495645_0931728 3300046543 Bacteria 514
991 Ga0495622_0000033 3300046557 Bacteria 124162
992 Ga0495667_0015882 3300046559 Bacteria 5090
993 Ga0495667_0579607 3300046559 Bacteria 700
994 Ga0495667_0759472 3300046559 Unclassified 599
995 Ga0495667_0993239 3300046559 Bacteria 512
996 Ga0495656_0000755 3300046615 Bacteria 10435
997 Ga0495668_0066408 3300046616 Bacteria 1985
998 Ga0495634_0000050 3300046642 Bacteria 94546
999 Ga0495634_0010013 3300046642 Bacteria 6959
1000 Ga0495634_0019613 3300046642 Bacteria 4803
1001 Ga0495634_0127583 3300046642 Bacteria 1624
1002 Ga0495634_0753739 3300046642 Bacteria 557
1003 Ga0495625_0000109 3300046660 Bacteria 125064
1004 Ga0495625_0079789 3300046660 Bacteria 2281
1005 Ga0495625_0248976 3300046660 Bacteria 1154
1006 Ga0495635_0000017 3300046663 Bacteria 195506
1007 Ga0495635_0005867 3300046663 Bacteria 8559
1008 Ga0495635_0009689 3300046663 Bacteria 6734
1009 Ga0495635_0116072 3300046663 Archaea 1827
1010 Ga0495635_0218574 3300046663 Bacteria 1289
1011 Ga0495635_0266219 3300046663 Bacteria 1153
1012 Ga0495588_0000204 3300046674 Bacteria 58892
1013 Ga0495588_0226026 3300046674 Bacteria 988
1014 Ga0495657_0000040 3300046675 Bacteria 115899
1015 Ga0495657_0001105 3300046675 Bacteria 23615
1016 Ga0495657_0003009 3300046675 Bacteria 13940
1017 Ga0495657_0017286 3300046675 Bacteria 5240
1018 Ga0495599_0213629 3300046678 Bacteria 1182
1019 Ga0495599_0369144 3300046678 Bacteria 858
1020 Ga0495599_0432083 3300046678 Bacteria 781
1021 Ga0495599_0628786 3300046678 Bacteria 623
1022 Ga0495599_0663451 3300046678 Bacteria 603
1023 Ga0495599_0696131 3300046678 Bacteria 586
1024 Ga0495623_0120699 3300046679 Bacteria 1578
1025 Ga0495623_0211094 3300046679 Bacteria 1111
1026 Ga0495623_0520507 3300046679 Bacteria 626
1027 Ga0495623_0622766 3300046679 Bacteria 559
1028 Ga0495646_0009344 3300046680 Bacteria 6219
1029 Ga0495646_0462372 3300046680 Bacteria 654
1030 Ga0495646_0509300 3300046680 Bacteria 617
1031 Ga0495646_0520106 3300046680 Bacteria 610
1032 Ga0495647_0000002 3300046681 Bacteria 174959
1033 Ga0495647_0000549 3300046681 Bacteria 11034
1034 Ga0495647_0034169 3300046681 Bacteria 1904
1035 Ga0495647_0291974 3300046681 Bacteria 733
1036 Ga0495647_0452593 3300046681 Bacteria 594
1037 Ga0495658_0000001 3300046683 Bacteria 385362
1038 Ga0495658_0062014 3300046683 Bacteria 2148
1039 Ga0495658_0433794 3300046683 Bacteria 839
1040 Ga0495658_0998829 3300046683 Bacteria 534
1041 Ga0495669_0000067 3300046684 Bacteria 68406
1042 Ga0495669_0524337 3300046684 Bacteria 576
1043 Ga0495613_0000067 3300046689 Bacteria 101960
1044 Ga0495613_0000155 3300046689 Bacteria 67203
1045 Ga0495613_0059310 3300046689 Bacteria 2806
1046 Ga0495613_0103859 3300046689 Bacteria 2052
1047 Ga0495613_0196177 3300046689 Unclassified 1425
1048 Ga0495624_0000005 3300046690 Bacteria 158127
1049 Ga0495624_0000031 3300046690 Bacteria 91702
1050 Ga0495624_0044655 3300046690 Bacteria 2824
1051 Ga0495670_0007376 3300046691 Bacteria 5405
1052 Ga0495671_0619710 3300046692 Bacteria 514
1053 Ga0495649_0002389 3300046694 Bacteria 13275
1054 Ga0495600_0000376 3300046809 Bacteria 23258
1055 Ga0495600_0000973 3300046809 Bacteria 15439
1056 Ga0495600_0002977 3300046809 Bacteria 9884
1057 Ga0495600_0287222 3300046809 Bacteria 1040
1058 Ga0495604_0000201 3300047317 Bacteria 54479
1059 Ga0495604_0000532 3300047317 Bacteria 33560
1060 Ga0495604_0003893 3300047317 Bacteria 11886
1061 Ga0495604_0109115 3300047317 Unclassified 2020
1062 Ga0495604_0267153 3300047317 Bacteria 1160
1063 Ga0495604_0301522 3300047317 Bacteria 1076
1064 Ga0495674_0000024 3300047319 Bacteria 141746
1065 Ga0495674_0050200 3300047319 Bacteria 3682
1066 Ga0495674_0105474 3300047319 Bacteria 2395
1067 Ga0495674_0108097 3300047319 Bacteria 2360
1068 Ga0495674_0190891 3300047319 Bacteria 1703
1069 Ga0495674_1193445 3300047319 Bacteria 575
1070 Ga0495674_1242468 3300047319 Bacteria 561
1071 Ga0495674_1322615 3300047319 Bacteria 540
1072 Ga0495672_0253355 3300047320 Bacteria 853
1073 Ga0495672_0554938 3300047320 Bacteria 503
1074 Ga0495676_0000928 3300047321 Bacteria 24577
1075 Ga0495676_0002393 3300047321 Bacteria 16657
1076 Ga0495676_0004042 3300047321 Bacteria 13356
1077 Ga0495676_0071674 3300047321 Bacteria 2663
1078 Ga0495676_0119830 3300047321 Bacteria 1916
1079 Ga0495676_0139174 3300047321 Bacteria 1741
1080 Ga0495676_0255666 3300047321 Unclassified 1193
1081 Ga0495676_0667152 3300047321 Bacteria 674
1082 Ga0495680_0001091 3300047322 Bacteria 30089
1083 Ga0495680_0001118 3300047322 Bacteria 29611
1084 Ga0495680_0010105 3300047322 Bacteria 8439
1085 Ga0495680_0313328 3300047322 Bacteria 1099
1086 Ga0495680_0336572 3300047322 Bacteria 1053
1087 Ga0495680_0912105 3300047322 Bacteria 567
1088 Ga0495675_0000036 3300047444 Bacteria 91842
1089 Ga0495675_0111872 3300047444 Bacteria 1704
1090 Ga0495675_0205780 3300047444 Bacteria 1196
1091 Ga0495675_0455278 3300047444 Bacteria 740
1092 Ga0495679_010174 3300047446 Bacteria 3712
1093 Ga0495679_189885 3300047446 Bacteria 542
1094 Ga0495685_214234 3300047447 Bacteria 615
1095 Ga0495673_0137981 3300047469 Bacteria 953
1096 Ga0495673_0139293 3300047469 Bacteria 947
1097 Ga0495684_0032611 3300047471 Bacteria 3999
1098 Ga0495684_0187403 3300047471 Bacteria 1531
1099 Ga0495684_0365280 3300047471 Bacteria 1021
1100 Ga0495686_0139975 3300047472 Bacteria 1428
1101 Ga0495686_0520246 3300047472 Bacteria 624
1102 Ga0495593_0024911 3300047673 Bacteria 3311
1103 Ga0495593_0061849 3300047673 Bacteria 1958
1104 Ga0495593_0263102 3300047673 Bacteria 863
1105 Ga0495593_0331788 3300047673 Bacteria 760
1106 Ga0495593_0463262 3300047673 Bacteria 635
1107 Ga0495593_0508448 3300047673 Bacteria 604
1108 Ga0495593_0640238 3300047673 Bacteria 534
1109 Ga0495602_0000268 3300048088 Bacteria 47860
1110 Ga0495602_0004572 3300048088 Bacteria 14436
1111 Ga0495602_0054444 3300048088 Bacteria 3532
1112 Ga0495602_0157967 3300048088 Bacteria 1774
1113 Ga0495602_0494859 3300048088 Bacteria 856
1114 Ga0495602_0642109 3300048088 Bacteria 726
1115 Ga0495602_0745394 3300048088 Bacteria 661
1116 Ga0495614_0260068 3300048089 Bacteria 796
1117 Ga0496100_0000006 3300048903 Bacteria 297429
1118 Ga0496100_0000019 3300048903 Bacteria 149995
1119 Ga0496100_0001337 3300048903 Bacteria 12070
1120 Ga0496100_0032537 3300048903 Bacteria 3254
1121 Ga0496100_0115175 3300048903 Bacteria 1874
1122 Ga0496100_1101158 3300048903 Bacteria 626
1123 Ga0496100_1613252 3300048903 Bacteria 513
1124 Ga0496100_1672908 3300048903 Bacteria 503
1125 Ga0496101_0000005 3300048904 Bacteria 331455
1126 Ga0496101_0000009 3300048904 Bacteria 297429
1127 Ga0496101_0000829 3300048904 Bacteria 18213
1128 Ga0496101_0062067 3300048904 Bacteria 2716
1129 Ga0496101_0354059 3300048904 Bacteria 1154
1130 Ga0496101_0748255 3300048904 Bacteria 771
1131 Ga0496101_0865931 3300048904 Bacteria 712
1132 Ga0496102_0000021 3300048905 Bacteria 246920
1133 Ga0496102_0005437 3300048905 Bacteria 10805
1134 Ga0496102_0105500 3300048905 Bacteria 2622
1135 Ga0496102_0137543 3300048905 Bacteria 2289
1136 Ga0496102_0141161 3300048905 Bacteria 2259
1137 Ga0496102_0183344 3300048905 Bacteria 1972
1138 Ga0496102_1008596 3300048905 Bacteria 753
1139 Ga0496102_1244101 3300048905 Bacteria 664
1140 Ga0496102_1350612 3300048905 Bacteria 632
1141 Ga0496102_1401549 3300048905 Bacteria 618
1142 Ga0496102_1706343 3300048905 Bacteria 548
1143 Ga0496102_1886083 3300048905 Bacteria 514
1144 Ga0496103_0000001 3300048906 Bacteria 643471
1145 Ga0496103_0020085 3300048906 Bacteria 4011
1146 Ga0496103_0075865 3300048906 Bacteria 2109
1147 Ga0496103_0289544 3300048906 Bacteria 1054
1148 Ga0496103_1046709 3300048906 Bacteria 507
1149 Ga0496104_0000008 3300048907 Bacteria 516976
1150 Ga0496104_0000029 3300048907 Bacteria 202968
1151 Ga0496104_0012727 3300048907 Bacteria 7578
1152 Ga0496104_0023237 3300048907 Bacteria 5700
1153 Ga0496104_0028341 3300048907 Bacteria 5191
1154 Ga0496104_0095403 3300048907 Bacteria 2845
1155 Ga0496104_0578546 3300048907 Bacteria 1033
1156 Ga0496104_0735380 3300048907 Bacteria 894
1157 Ga0496105_0000002 3300048908 Bacteria 753215
1158 Ga0496105_0000003 3300048908 Bacteria 713251
1159 Ga0496105_0000900 3300048908 Bacteria 20333
1160 Ga0496105_0035041 3300048908 Bacteria 4130
1161 Ga0496105_0062133 3300048908 Bacteria 3082
1162 Ga0496105_0557646 3300048908 Bacteria 893
1163 Ga0496105_0869562 3300048908 Bacteria 681
1164 Ga0496106_0000033 3300048909 Bacteria 131412
1165 Ga0496106_0000072 3300048909 Bacteria 80978
1166 Ga0496106_0000107 3300048909 Bacteria 64689
1167 Ga0496106_0147775 3300048909 Bacteria 1852
1168 Ga0496106_0206852 3300048909 Bacteria 1563
1169 Ga0496106_0278896 3300048909 Bacteria 1339
1170 Ga0496106_0314796 3300048909 Bacteria 1256
1171 Ga0496106_1051757 3300048909 Bacteria 639
1172 Ga0496107_0000004 3300048910 Bacteria 297680
1173 Ga0496107_0000015 3300048910 Bacteria 173644
1174 Ga0496107_0017021 3300048910 Bacteria 5111
1175 Ga0496107_0025196 3300048910 Bacteria 4209
1176 Ga0496107_0031448 3300048910 Bacteria 3788
1177 Ga0496107_0032416 3300048910 Bacteria 3735
1178 Ga0496107_1195972 3300048910 Bacteria 546
1179 Ga0496108_0000004 3300048911 Bacteria 545055
1180 Ga0496108_0000239 3300048911 Bacteria 49308
1181 Ga0496108_0007751 3300048911 Bacteria 8698
1182 Ga0496108_0085810 3300048911 Bacteria 2673
1183 Ga0496108_0108073 3300048911 Bacteria 2376
1184 Ga0496108_0196079 3300048911 Bacteria 1751
1185 Ga0496108_0251779 3300048911 Bacteria 1537
1186 Ga0496108_0332045 3300048911 Bacteria 1326
1187 Ga0496108_1088259 3300048911 Bacteria 680
1188 Ga0496109_0000011 3300048912 Bacteria 234908
1189 Ga0496109_0000031 3300048912 Bacteria 163998
1190 Ga0496109_0000034 3300048912 Bacteria 160397
1191 Ga0496109_0000731 3300048912 Bacteria 27343
1192 Ga0496109_0013927 3300048912 Bacteria 6993
1193 Ga0496109_0093605 3300048912 Bacteria 2781
1194 Ga0496109_0353842 3300048912 Bacteria 1387
1195 Ga0496109_0415065 3300048912 Bacteria 1272
1196 Ga0496109_0837894 3300048912 Bacteria 858
1197 Ga0496109_1287894 3300048912 Bacteria 667
1198 Ga0496110_0000171 3300048913 Bacteria 39922
1199 Ga0496110_0019142 3300048913 Bacteria 5755
1200 Ga0496110_0045312 3300048913 Bacteria 3844
1201 Ga0496110_0168253 3300048913 Bacteria 1988
1202 Ga0496110_0249761 3300048913 Bacteria 1614
1203 Ga0496110_0480180 3300048913 Bacteria 1132
1204 Ga0496110_0664665 3300048913 Bacteria 942
1205 Ga0496110_0922739 3300048913 Bacteria 779
1206 Ga0496110_1742049 3300048913 Bacteria 533
1207 Ga0496111_0000020 3300048914 Bacteria 67992
1208 Ga0496111_0031576 3300048914 Bacteria 3773
1209 Ga0496111_0060223 3300048914 Bacteria 2752
1210 Ga0496111_0071801 3300048914 Bacteria 2519
1211 Ga0496111_0085357 3300048914 Bacteria 2308
1212 Ga0496111_0132565 3300048914 Bacteria 1845
1213 Ga0496111_0135624 3300048914 Bacteria 1823
1214 Ga0496111_0158238 3300048914 Bacteria 1681
1215 Ga0496111_0586356 3300048914 Unclassified 817
1216 Ga0496111_1151675 3300048914 Bacteria 551
1217 Ga0496111_1253466 3300048914 Bacteria 524
1218 Ga0496112_0000002 3300048915 Bacteria 782039
1219 Ga0496112_0000641 3300048915 Bacteria 24272
1220 Ga0496112_0000966 3300048915 Bacteria 20913
1221 Ga0496112_0010462 3300048915 Bacteria 8414
1222 Ga0496112_0158935 3300048915 Bacteria 2226
1223 Ga0496112_0174482 3300048915 Bacteria 2115
1224 Ga0496112_0971373 3300048915 Bacteria 770
1225 Ga0496113_0000002 3300048916 Bacteria 220193
1226 Ga0496113_0012195 3300048916 Bacteria 5769
1227 Ga0496113_0038334 3300048916 Bacteria 3523
1228 Ga0496113_0060198 3300048916 Bacteria 2862
1229 Ga0496113_0100771 3300048916 Unclassified 2238
1230 Ga0496113_0158351 3300048916 Bacteria 1789
1231 Ga0496113_0211754 3300048916 Bacteria 1543
1232 Ga0496113_0459659 3300048916 Bacteria 1023
1233 Ga0496113_0555870 3300048916 Bacteria 920
1234 Ga0496114_0000003 3300048917 Bacteria 630981
1235 Ga0496114_0007441 3300048917 Bacteria 8658
1236 Ga0496114_0073011 3300048917 Bacteria 2887
1237 Ga0496114_0256870 3300048917 Bacteria 1538
1238 Ga0496114_0430099 3300048917 Bacteria 1169
1239 Ga0496114_0986656 3300048917 Bacteria 725
1240 Ga0496115_0000022 3300048918 Bacteria 164224
1241 Ga0496115_0000027 3300048918 Bacteria 145505
1242 Ga0496115_0028762 3300048918 Bacteria 4359
1243 Ga0496115_0040913 3300048918 Bacteria 3686
1244 Ga0496115_0275696 3300048918 Bacteria 1381
1245 Ga0496115_1470334 3300048918 Bacteria 500
1246 Ga0496116_0000138 3300048919 Bacteria 151606
1247 Ga0496117_0002715 3300048920 Bacteria 21760
1248 Ga0496118_0005655 3300048921 Bacteria 14094
1249 Ga0496119_0004108 3300048922 Bacteria 14674
1250 Ga0496119_0027003 3300048922 Bacteria 3962
1251 Ga0496119_0249476 3300048922 Bacteria 895
1252 Ga0496120_0001479 3300048923 Bacteria 27945
1253 Ga0496121_0019185 3300048924 Bacteria 6852
1254 Ga0496124_0055183 3300048927 Bacteria 3359
1255 Ga0496124_0166569 3300048927 Bacteria 1712
1256 Ga0496124_0242798 3300048927 Bacteria 1338
1257 Ga0496124_0322717 3300048927 Bacteria 1105
1258 Ga0496124_0452589 3300048927 Bacteria 875
1259 Ga0496124_0479413 3300048927 Bacteria 840
1260 Ga0496125_0072330 3300048928 Bacteria 2687
1261 Ga0496125_0198347 3300048928 Bacteria 1317
1262 Ga0496126_0012060 3300048929 Bacteria 8881
1263 Ga0496126_0154565 3300048929 Bacteria 1964
1264 Ga0501031_0003106 3300049568 Bacteria 10636
1265 Ga0501031_0168616 3300049568 Bacteria 1430
1266 Ga0501032_0001727 3300049569 Bacteria 17287
1267 Ga0501032_0305942 3300049569 Bacteria 1027
1268 Ga0501033_0001690 3300049570 Bacteria 19306
1269 Ga0501033_0388812 3300049570 Bacteria 974
1270 Ga0501033_0557172 3300049570 Bacteria 789
1271 Ga0501033_0709793 3300049570 Bacteria 684
1272 Ga0501034_0009811 3300049571 Bacteria 10010
1273 Ga0501034_0027484 3300049571 Bacteria 5788
1274 Ga0501034_0249219 3300049571 Bacteria 1720
1275 Ga0501034_0309404 3300049571 Bacteria 1515
1276 Ga0501034_0353026 3300049571 Bacteria 1398
1277 Ga0501034_0803057 3300049571 Bacteria 833
1278 Ga0501034_0852503 3300049571 Bacteria 801
1279 Ga0501036_0004060 3300049572 Bacteria 11773
1280 Ga0501037_0001236 3300049573 Bacteria 18847
1281 Ga0501037_0177320 3300049573 Bacteria 1513
1282 Ga0501037_0323198 3300049573 Bacteria 1068
1283 Ga0501038_0006748 3300049574 Bacteria 10603
1284 Ga0501038_0212169 3300049574 Bacteria 1548
1285 Ga0501039_0006866 3300049575 Bacteria 8659
1286 Ga0501039_0170167 3300049575 Bacteria 1713
1287 Ga0501040_0275607 3300049576 Bacteria 1201
1288 Ga0501040_0624102 3300049576 Bacteria 779
1289 Ga0501041_0018106 3300049577 Bacteria 4195
1290 Ga0501041_0149184 3300049577 Bacteria 1459
1291 Ga0501042_0004801 3300049578 Bacteria 8637
1292 Ga0501042_0017856 3300049578 Bacteria 4902
1293 Ga0501042_0033109 3300049578 Bacteria 3663
1294 Ga0501042_0218580 3300049578 Bacteria 1374
1295 Ga0501042_0688546 3300049578 Bacteria 743
1296 Ga0501043_0001769 3300049579 Bacteria 18577
1297 Ga0501043_0103029 3300049579 Bacteria 2243
1298 Ga0501043_0191316 3300049579 Bacteria 1591
1299 Ga0501046_0002090 3300049580 Bacteria 18929
1300 Ga0501046_0188740 3300049580 Bacteria 1538
1301 Ga0501046_0486508 3300049580 Bacteria 885
1302 Ga0501047_0397409 3300049581 Bacteria 1211
1303 Ga0501047_0552147 3300049581 Bacteria 976
1304 Ga0501048_0001315 3300049582 Bacteria 18841
1305 Ga0501048_0022208 3300049582 Bacteria 4643
1306 Ga0501048_0058589 3300049582 Bacteria 2730
1307 Ga0501048_0067099 3300049582 Bacteria 2536
1308 Ga0501048_0389744 3300049582 Bacteria 995
1309 Ga0501067_0582909 3300049583 Bacteria 627
1310 Ga0501068_0047971 3300049584 Bacteria 2578
1311 Ga0501068_0162812 3300049584 Bacteria 1406
1312 Ga0501069_0010535 3300049585 Bacteria 4896
1313 Ga0501069_0138701 3300049585 Bacteria 1394
1314 Ga0501070_0002097 3300049586 Bacteria 17495
1315 Ga0501070_0052099 3300049586 Bacteria 3397
1316 Ga0501070_0298523 3300049586 Bacteria 1312
1317 Ga0501070_0664052 3300049586 Bacteria 827
1318 Ga0501071_0030473 3300049587 Bacteria 3816
1319 Ga0501071_0045644 3300049587 Bacteria 3146
1320 Ga0501071_0592029 3300049587 Bacteria 852
1321 Ga0501071_0895107 3300049587 Bacteria 685
1322 Ga0501071_1524814 3300049587 Bacteria 516
1323 Ga0501072_0059464 3300049588 Bacteria 3013
1324 Ga0501072_0075026 3300049588 Bacteria 2674
1325 Ga0501072_0644853 3300049588 Bacteria 834
1326 Ga0501073_0001857 3300049589 Bacteria 15739
1327 Ga0501074_1027701 3300049590 Bacteria 579
1328 Ga0501075_0058206 3300049591 Bacteria 2910
1329 Ga0501075_1440465 3300049591 Bacteria 521
1330 Ga0501076_0376576 3300049592 Bacteria 1167
1331 Ga0501077_0669588 3300049593 Bacteria 667
1332 Ga0501077_0937020 3300049593 Bacteria 557
1333 Ga0501077_1141707 3300049593 Bacteria 501
1334 Ga0501079_0060419 3300049741 Bacteria 2923
1335 Ga0501079_0993310 3300049741 Bacteria 661
1336 Ga0501080_0110932 3300049742 Bacteria 2542
1337 Ga0501080_0265737 3300049742 Bacteria 1562
1338 Ga0501081_0163202 3300049743 Bacteria 1606
1339 Ga0501081_0471762 3300049743 Bacteria 933
1340 Ga0501083_0010313 3300049744 Bacteria 6581
1341 Ga0501083_0027896 3300049744 Bacteria 3893
1342 Ga0501083_0260089 3300049744 Bacteria 1129
1343 Ga0501083_0789865 3300049744 Bacteria 618
1344 Ga0501035_0000614 3300049822 Bacteria 39235
1345 Ga0501035_0293037 3300049822 Bacteria 1373
1346 Ga0501035_0468524 3300049822 Bacteria 1040
1347 Ga0501044_0008924 3300049823 Bacteria 10958
1348 Ga0501044_0047213 3300049823 Bacteria 4455
1349 Ga0501044_0194620 3300049823 Bacteria 1988
1350 Ga0501044_0679980 3300049823 Bacteria 916
1351 Ga0501044_1006431 3300049823 Bacteria 705
1352 Ga0501045_0021204 3300049824 Bacteria 4646
1353 Ga0501045_0026912 3300049824 Bacteria 4140
1354 Ga0501045_0211664 3300049824 Bacteria 1444
1355 Ga0501045_0687789 3300049824 Bacteria 755
1356 Ga0501045_1326648 3300049824 Bacteria 523
1357 nmdc:mga03n38_699591_c1 3300050490 Bacteria 584
1358 nmdc:mga00v17_165214_c1 3300050491 Bacteria 1426
1359 nmdc:mga00v17_305567_c1 3300050491 Bacteria 1033
1360 nmdc:mga00v17_591342_c1 3300050491 Bacteria 716
1361 nmdc:mga00v17_64055_c1 3300050491 Bacteria 2265
1362 nmdc:mga00v17_972744_c1 3300050491 Bacteria 535
1363 nmdc:mga0yw44_12752_c1 3300050492 Bacteria 4395
1364 nmdc:mga0yw44_39735_c1 3300050492 Bacteria 2792
1365 nmdc:mga0yw44_633568_c1 3300050492 Bacteria 727
1366 nmdc:mga0yw44_828347_c1 3300050492 Bacteria 628
1367 nmdc:mga06z11_274537_c1 3300050494 Bacteria 997
1368 nmdc:mga06z11_746930_c1 3300050494 Bacteria 596
1369 nmdc:mga04h51_362350_c1 3300050495 Bacteria 601
1370 nmdc:mga05p37_18367_c1 3300050507 Bacteria 8447
1371 nmdc:mga05p37_2021019_c1 3300050507 Bacteria 544
1372 nmdc:mga09592_1351765_c1 3300050508 Bacteria 584
1373 nmdc:mga0qj67_1472541_c1 3300050509 Bacteria 524
1374 nmdc:mga0qj67_30071_c1 3300050509 Bacteria 4224
1375 nmdc:mga06r32_1978587_c1 3300050510 Bacteria 517
1376 nmdc:mga06r32_640879_c1 3300050510 Bacteria 1031
1377 nmdc:mga08y16_1947765_c1 3300050511 Bacteria 538
1378 nmdc:mga0n895_1418451_c1 3300050512 Bacteria 662
1379 nmdc:mga0n895_944778_c1 3300050512 Bacteria 846
1380 nmdc:mga0rr50_1586846_c1 3300050513 Bacteria 552
1381 nmdc:mga0rr50_648129_c1 3300050513 Bacteria 901
1382 nmdc:mga08x19_835825_c1 3300050514 Bacteria 654
1383 nmdc:mga08x19_973734_c1 3300050514 Bacteria 603
1384 nmdc:mga0a205_4358_c1 3300050515 Bacteria 12691
1385 Ga0495601_0000019 3300053077 Bacteria 161673
1386 Ga0495601_0000231 3300053077 Bacteria 30020
1387 Ga0495601_0006135 3300053077 Bacteria 7009
1388 Ga0495601_0096863 3300053077 Bacteria 1903
1389 Ga0495601_0220065 3300053077 Bacteria 1240
1390 Ga0495601_0235092 3300053077 Bacteria 1197
1391 Ga0495601_0303765 3300053077 Bacteria 1039
1392 Ga0495601_0391549 3300053077 Bacteria 901
1393 Ga0495601_0404184 3300053077 Bacteria 885
1394 Ga0495601_0684054 3300053077 Bacteria 655
1395 Ga0495612_0000208 3300053078 Bacteria 24962
1396 Ga0495612_0005227 3300053078 Bacteria 5361
1397 Ga0495612_0005290 3300053078 Bacteria 5331
1398 Ga0495612_0063609 3300053078 Bacteria 1530
1399 Ga0495612_0181163 3300053078 Bacteria 925
1400 Ga0495612_0209430 3300053078 Bacteria 861
1401 Ga0495612_0448178 3300053078 Bacteria 589
1402 Ga0495655_0000008 3300053083 Bacteria 153535
1403 Ga0495655_0006464 3300053083 Bacteria 2131
1404 Ga0495595_0000009 3300053084 Bacteria 193039
1405 Ga0495595_0000831 3300053084 Bacteria 11810
1406 Ga0495595_0002127 3300053084 Bacteria 7697
1407 Ga0495595_0003003 3300053084 Bacteria 6667
1408 Ga0495595_0183731 3300053084 Bacteria 1037
1409 Ga0495595_0349571 3300053084 Bacteria 746
1410 Ga0495595_0466485 3300053084 Bacteria 642
1411 Ga0495595_0489443 3300053084 Bacteria 626
1412 Ga0495619_0000022 3300053085 Bacteria 184144
1413 Ga0495619_0000057 3300053085 Bacteria 93948
1414 Ga0495619_0000328 3300053085 Bacteria 33223
1415 Ga0495619_0001227 3300053085 Bacteria 16776
1416 Ga0495619_0002958 3300053085 Bacteria 11033
1417 Ga0495619_0064834 3300053085 Bacteria 2436
1418 Ga0495619_0080017 3300053085 Bacteria 2198
1419 Ga0495619_0128521 3300053085 Bacteria 1740
1420 Ga0495619_0158961 3300053085 Bacteria 1560
1421 Ga0495619_0406791 3300053085 Bacteria 939
1422 Ga0495619_0514701 3300053085 Bacteria 822
1423 Ga0495619_0674645 3300053085 Bacteria 704
1424 Ga0495619_0858507 3300053085 Unclassified 612
1425 Ga0495619_0979005 3300053085 Bacteria 566
1426 Ga0495619_1063801 3300053085 Bacteria 539
1427 Ga0500566_0002923 3300053094 Bacteria 10195
1428 Ga0500641_0017364 3300053096 Bacteria 2690
1429 Ga0500595_053008 3300053119 Bacteria 1250
1430 Ga0500614_001420 3300053123 Bacteria 5741
1431 Ga0500628_000023 3300053129 Bacteria 77818
1432 Ga0500658_0543660 3300053134 Bacteria 523
1433 Ga0501084_0046761 3300054114 Bacteria 3625
1434 Ga0501084_0213865 3300054114 Bacteria 1626
1435 Ga0501084_1196777 3300054114 Bacteria 637
1436 Ga0501084_1246791 3300054114 Bacteria 624
1437 Ga0587070_163734 3300059491 Unclassified 567
1438 Ga0587073_0156450 3300059492 Bacteria 649
1439 Ga0587085_099043 3300059506 Bacteria 613
1440 Ga0587088_097081 3300059508 Bacteria 653
1441 Ga0587090_124742 3300059510 Bacteria 562
1442 Ga0587091_093081 3300059511 Bacteria 695
1443 Ga0587091_245224 3300059511 Bacteria 500
1444 Ga0587094_098631 3300059513 Bacteria 562
1445 Ga0587067_106002 3300059640 Bacteria 657
1446 Ga0501082_0057158 3300060353 Bacteria 3361
1447 Ga0501082_0192299 3300060353 Bacteria 1775
1448 Ga0466962_0051066 3300061719 Bacteria 1977
1449 Ga0466962_0222087 3300061719 Bacteria 925
1450 Ga0466962_0344939 3300061719 Bacteria 741
1451 Ga0530510_0135953 3300061734 Bacteria 1810

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0347766 Ga0436362_0347766_730_918 62
2 3300049591 Ga0501075_1440465 Ga0501075_1440465_11_199 62
3 3300059491 Ga0587070_163734 Ga0587070_163734_107_295 62
4 3300061734 Ga0530510_0135953 Ga0530510_0135953_885_1073 62
5 3300046525 Ga0495663_0224679 Ga0495663_0224679_458_649 63
6 3300044719 Ga0466971_0499511 Ga0466971_0499511_120_314 64
7 3300048912 Ga0496109_0000731 Ga0496109_0000731_7684_7884 66
8 3300001979 JGI24740J21852_10000802 JGI24740J21852_1000080212 67
9 3300003373 JGI25407J50210_10138803 JGI25407J50210_101388031 67
10 3300003574 Ga0007410J51695_1013639 Ga0007410J51695_10136391 67
11 3300003659 JGI25404J52841_10014116 JGI25404J52841_100141162 67
12 3300004801 Ga0058860_10111405 Ga0058860_101114052 67
13 3300004803 Ga0058862_12534098 Ga0058862_125340981 67
14 3300005327 Ga0070658_10012254 Ga0070658_100122545 67
15 3300005327 Ga0070658_10232616 Ga0070658_102326162 67
16 3300005329 Ga0070683_100018262 Ga0070683_1000182622 67
17 3300005329 Ga0070683_100037182 Ga0070683_1000371825 67
18 3300005329 Ga0070683_100041908 Ga0070683_1000419082 67
19 3300005329 Ga0070683_100695063 Ga0070683_1006950632 67
20 3300005329 Ga0070683_100855700 Ga0070683_1008557002 67
21 3300005330 Ga0070690_100157292 Ga0070690_1001572922 67
22 3300005330 Ga0070690_100483865 Ga0070690_1004838651 67
23 3300005331 Ga0070670_100130756 Ga0070670_1001307562 67
24 3300005334 Ga0068869_100815548 Ga0068869_1008155482 67
25 3300005335 Ga0070666_10709712 Ga0070666_107097121 67
26 3300005337 Ga0070682_100000032 Ga0070682_10000003215 67
27 3300005337 Ga0070682_100220727 Ga0070682_1002207272 67
28 3300005337 Ga0070682_100246305 Ga0070682_1002463051 67
29 3300005338 Ga0068868_100000568 Ga0068868_10000056814 67
30 3300005338 Ga0068868_100200631 Ga0068868_1002006313 67
31 3300005338 Ga0068868_100280721 Ga0068868_1002807212 67
32 3300005339 Ga0070660_100247145 Ga0070660_1002471451 67
33 3300005339 Ga0070660_100837140 Ga0070660_1008371401 67
34 3300005340 Ga0070689_100815958 Ga0070689_1008159582 67
35 3300005340 Ga0070689_100847395 Ga0070689_1008473952 67
36 3300005344 Ga0070661_100000255 Ga0070661_10000025541 67
37 3300005344 Ga0070661_100108517 Ga0070661_1001085173 67
38 3300005345 Ga0070692_10028024 Ga0070692_100280243 67
39 3300005345 Ga0070692_10507451 Ga0070692_105074511 67
40 3300005347 Ga0070668_100132935 Ga0070668_1001329352 67
41 3300005347 Ga0070668_100173528 Ga0070668_1001735282 67
42 3300005354 Ga0070675_100000022 Ga0070675_100000022132 67
43 3300005356 Ga0070674_100666392 Ga0070674_1006663922 67
44 3300005364 Ga0070673_101156713 Ga0070673_1011567132 67
45 3300005365 Ga0070688_100000732 Ga0070688_1000007323 67
46 3300005365 Ga0070688_100000747 Ga0070688_10000074713 67
47 3300005365 Ga0070688_100948068 Ga0070688_1009480682 67
48 3300005366 Ga0070659_100000051 Ga0070659_10000005187 67
49 3300005366 Ga0070659_100087751 Ga0070659_1000877514 67
50 3300005366 Ga0070659_100614696 Ga0070659_1006146961 67
51 3300005406 Ga0070703_10037461 Ga0070703_100374612 67
52 3300005434 Ga0070709_10023169 Ga0070709_100231696 67
53 3300005434 Ga0070709_10044380 Ga0070709_100443802 67
54 3300005435 Ga0070714_100000151 Ga0070714_10000015164 67
55 3300005435 Ga0070714_100003558 Ga0070714_1000035587 67
56 3300005435 Ga0070714_100023795 Ga0070714_1000237952 67
57 3300005435 Ga0070714_100109618 Ga0070714_1001096182 67
58 3300005435 Ga0070714_100157491 Ga0070714_1001574912 67
59 3300005435 Ga0070714_100205693 Ga0070714_1002056932 67
60 3300005435 Ga0070714_101220129 Ga0070714_1012201292 67
61 3300005436 Ga0070713_100000101 Ga0070713_10000010133 67
62 3300005436 Ga0070713_100113544 Ga0070713_1001135442 67
63 3300005436 Ga0070713_100229388 Ga0070713_1002293885 67
64 3300005436 Ga0070713_101228333 Ga0070713_1012283331 67
65 3300005436 Ga0070713_101296010 Ga0070713_1012960102 67
66 3300005437 Ga0070710_10000013 Ga0070710_1000001366 67
67 3300005437 Ga0070710_10003212 Ga0070710_1000321210 67
68 3300005437 Ga0070710_10059065 Ga0070710_100590653 67
69 3300005437 Ga0070710_10499654 Ga0070710_104996542 67
70 3300005437 Ga0070710_11524414 Ga0070710_115244141 67
71 3300005438 Ga0070701_10436854 Ga0070701_104368542 67
72 3300005439 Ga0070711_100011844 Ga0070711_1000118449 67
73 3300005439 Ga0070711_100013085 Ga0070711_1000130854 67
74 3300005439 Ga0070711_100026363 Ga0070711_1000263635 67
75 3300005439 Ga0070711_100320214 Ga0070711_1003202142 67
76 3300005439 Ga0070711_101004687 Ga0070711_1010046871 67
77 3300005440 Ga0070705_100054946 Ga0070705_1000549463 67
78 3300005441 Ga0070700_100399678 Ga0070700_1003996782 67
79 3300005444 Ga0070694_100522392 Ga0070694_1005223921 67
80 3300005445 Ga0070708_100968439 Ga0070708_1009684391 67
81 3300005445 Ga0070708_101838356 Ga0070708_1018383561 67
82 3300005455 Ga0070663_100874705 Ga0070663_1008747052 67
83 3300005456 Ga0070678_100002267 Ga0070678_1000022673 67
84 3300005456 Ga0070678_100450554 Ga0070678_1004505541 67
85 3300005456 Ga0070678_100874765 Ga0070678_1008747651 67
86 3300005457 Ga0070662_101782073 Ga0070662_1017820731 67
87 3300005459 Ga0068867_100226888 Ga0068867_1002268882 67
88 3300005459 Ga0068867_101264560 Ga0068867_1012645602 67
89 3300005466 Ga0070685_10000191 Ga0070685_1000019132 67
90 3300005466 Ga0070685_11105670 Ga0070685_111056702 67
91 3300005530 Ga0070679_100652617 Ga0070679_1006526172 67
92 3300005530 Ga0070679_100893632 Ga0070679_1008936321 67
93 3300005535 Ga0070684_100005142 Ga0070684_10000514211 67
94 3300005535 Ga0070684_100122559 Ga0070684_1001225592 67
95 3300005535 Ga0070684_100358467 Ga0070684_1003584672 67
96 3300005535 Ga0070684_100565467 Ga0070684_1005654671 67
97 3300005535 Ga0070684_100894660 Ga0070684_1008946602 67
98 3300005535 Ga0070684_101203489 Ga0070684_1012034891 67
99 3300005539 Ga0068853_100324553 Ga0068853_1003245532 67
100 3300005539 Ga0068853_101161937 Ga0068853_1011619372 67
101 3300005543 Ga0070672_100001124 Ga0070672_10000112411 67
102 3300005546 Ga0070696_101453332 Ga0070696_1014533321 67
103 3300005547 Ga0070693_100177676 Ga0070693_1001776761 67
104 3300005547 Ga0070693_100716572 Ga0070693_1007165722 67
105 3300005548 Ga0070665_100010578 Ga0070665_1000105784 67
106 3300005548 Ga0070665_100997839 Ga0070665_1009978392 67
107 3300005549 Ga0070704_100022121 Ga0070704_1000221215 67
108 3300005549 Ga0070704_100859455 Ga0070704_1008594552 67
109 3300005549 Ga0070704_101183311 Ga0070704_1011833111 67
110 3300005564 Ga0070664_100208112 Ga0070664_1002081122 67
111 3300005564 Ga0070664_100277146 Ga0070664_1002771463 67
112 3300005564 Ga0070664_100829746 Ga0070664_1008297462 67
113 3300005578 Ga0068854_100000267 Ga0068854_10000026732 67
114 3300005578 Ga0068854_100737358 Ga0068854_1007373582 67
115 3300005614 Ga0068856_100015804 Ga0068856_10001580410 67
116 3300005614 Ga0068856_100495139 Ga0068856_1004951391 67
117 3300005614 Ga0068856_100737046 Ga0068856_1007370461 67
118 3300005614 Ga0068856_101517122 Ga0068856_1015171222 67
119 3300005615 Ga0070702_100323992 Ga0070702_1003239922 67
120 3300005615 Ga0070702_101367278 Ga0070702_1013672781 67
121 3300005616 Ga0068852_100000132 Ga0068852_10000013243 67
122 3300005616 Ga0068852_100012307 Ga0068852_1000123076 67
123 3300005616 Ga0068852_100379691 Ga0068852_1003796911 67
124 3300005618 Ga0068864_100586418 Ga0068864_1005864183 67
125 3300005618 Ga0068864_101952038 Ga0068864_1019520382 67
126 3300005718 Ga0068866_10190336 Ga0068866_101903362 67
127 3300005718 Ga0068866_10229542 Ga0068866_102295422 67
128 3300005719 Ga0068861_100246219 Ga0068861_1002462192 67
129 3300005719 Ga0068861_100435744 Ga0068861_1004357441 67
130 3300005719 Ga0068861_100731146 Ga0068861_1007311461 67
131 3300005719 Ga0068861_101464799 Ga0068861_1014647992 67
132 3300005834 Ga0068851_10000258 Ga0068851_100002584 67
133 3300005834 Ga0068851_10226711 Ga0068851_102267112 67
134 3300005840 Ga0068870_10166804 Ga0068870_101668042 67
135 3300005842 Ga0068858_100303988 Ga0068858_1003039883 67
136 3300005843 Ga0068860_101845784 Ga0068860_1018457842 67
137 3300005844 Ga0068862_100606257 Ga0068862_1006062571 67
138 3300005844 Ga0068862_101291200 Ga0068862_1012912002 67
139 3300005844 Ga0068862_101555572 Ga0068862_1015555722 67
140 3300005937 Ga0081455_10775709 Ga0081455_107757092 67
141 3300005983 Ga0081540_1000181 Ga0081540_100018125 67
142 3300005985 Ga0081539_10013181 Ga0081539_100131815 67
143 3300006028 Ga0070717_10008036 Ga0070717_100080364 67
144 3300006028 Ga0070717_10010556 Ga0070717_1001055611 67
145 3300006028 Ga0070717_10213753 Ga0070717_102137534 67
146 3300006038 Ga0075365_10007605 Ga0075365_100076052 67
147 3300006038 Ga0075365_10008408 Ga0075365_100084086 67
148 3300006048 Ga0075363_100550643 Ga0075363_1005506432 67
149 3300006048 Ga0075363_100686036 Ga0075363_1006860361 67
150 3300006051 Ga0075364_10019533 Ga0075364_100195332 67
151 3300006051 Ga0075364_10140748 Ga0075364_101407482 67
152 3300006051 Ga0075364_10258801 Ga0075364_102588012 67
153 3300006051 Ga0075364_11105897 Ga0075364_111058971 67
154 3300006163 Ga0070715_10154509 Ga0070715_101545092 67
155 3300006163 Ga0070715_10209571 Ga0070715_102095712 67
156 3300006163 Ga0070715_10282368 Ga0070715_102823682 67
157 3300006163 Ga0070715_10365931 Ga0070715_103659311 67
158 3300006173 Ga0070716_100183543 Ga0070716_1001835434 67
159 3300006173 Ga0070716_100564047 Ga0070716_1005640472 67
160 3300006175 Ga0070712_100000657 Ga0070712_10000065722 67
161 3300006175 Ga0070712_100009869 Ga0070712_1000098691 67
162 3300006175 Ga0070712_100011524 Ga0070712_1000115249 67
163 3300006175 Ga0070712_100019212 Ga0070712_1000192123 67
164 3300006175 Ga0070712_100037327 Ga0070712_1000373273 67
165 3300006175 Ga0070712_100254879 Ga0070712_1002548792 67
166 3300006178 Ga0075367_10318716 Ga0075367_103187162 67
167 3300006237 Ga0097621_100441631 Ga0097621_1004416312 67
168 3300006237 Ga0097621_101051813 Ga0097621_1010518132 67
169 3300006358 Ga0068871_101785415 Ga0068871_1017854151 67
170 3300006844 Ga0075428_101797806 Ga0075428_1017978061 67
171 3300006846 Ga0075430_100026888 Ga0075430_1000268882 67
172 3300006847 Ga0075431_101311082 Ga0075431_1013110822 67
173 3300006847 Ga0075431_102020204 Ga0075431_1020202042 67
174 3300006852 Ga0075433_10764813 Ga0075433_107648131 67
175 3300006871 Ga0075434_101412171 Ga0075434_1014121711 67
176 3300006880 Ga0075429_100007806 Ga0075429_10000780614 67
177 3300006881 Ga0068865_100000039 Ga0068865_10000003961 67
178 3300006881 Ga0068865_100182082 Ga0068865_1001820822 67
179 3300006914 Ga0075436_100311909 Ga0075436_1003119092 67
180 3300006914 Ga0075436_100727621 Ga0075436_1007276211 67
181 3300009093 Ga0105240_10018089 Ga0105240_100180898 67
182 3300009093 Ga0105240_11137363 Ga0105240_111373632 67
183 3300009093 Ga0105240_11180865 Ga0105240_111808652 67
184 3300009094 Ga0111539_10018782 Ga0111539_100187825 67
185 3300009098 Ga0105245_10001788 Ga0105245_100017884 67
186 3300009098 Ga0105245_10002559 Ga0105245_1000255916 67
187 3300009098 Ga0105245_10002902 Ga0105245_100029023 67
188 3300009098 Ga0105245_10022448 Ga0105245_100224487 67
189 3300009098 Ga0105245_11222106 Ga0105245_112221062 67
190 3300009101 Ga0105247_10000369 Ga0105247_1000036921 67
191 3300009101 Ga0105247_10461345 Ga0105247_104613452 67
192 3300009101 Ga0105247_10541884 Ga0105247_105418842 67
193 3300009147 Ga0114129_10005080 Ga0114129_100050802 67
194 3300009147 Ga0114129_11978339 Ga0114129_119783392 67
195 3300009148 Ga0105243_10009809 Ga0105243_100098092 67
196 3300009148 Ga0105243_10042664 Ga0105243_100426644 67
197 3300009148 Ga0105243_10515646 Ga0105243_105156462 67
198 3300009148 Ga0105243_11019029 Ga0105243_110190293 67
199 3300009148 Ga0105243_12189831 Ga0105243_121898311 67
200 3300009174 Ga0105241_10056975 Ga0105241_100569752 67
201 3300009174 Ga0105241_10409507 Ga0105241_104095073 67
202 3300009174 Ga0105241_10954262 Ga0105241_109542622 67
203 3300009174 Ga0105241_12436678 Ga0105241_124366781 67
204 3300009176 Ga0105242_10004215 Ga0105242_100042155 67
205 3300009176 Ga0105242_10358598 Ga0105242_103585981 67
206 3300009176 Ga0105242_10437236 Ga0105242_104372362 67
207 3300009176 Ga0105242_10747569 Ga0105242_107475692 67
208 3300009177 Ga0105248_10000017 Ga0105248_10000017127 67
209 3300009177 Ga0105248_11147998 Ga0105248_111479982 67
210 3300009177 Ga0105248_11509352 Ga0105248_115093522 67
211 3300009551 Ga0105238_10017286 Ga0105238_100172866 67
212 3300009551 Ga0105238_11641177 Ga0105238_116411771 67
213 3300009553 Ga0105249_10312219 Ga0105249_103122193 67
214 3300009553 Ga0105249_10722241 Ga0105249_107222411 67
215 3300009553 Ga0105249_11465468 Ga0105249_114654681 67
216 3300010375 Ga0105239_10289397 Ga0105239_102893972 67
217 3300010375 Ga0105239_11622962 Ga0105239_116229621 67
218 3300011119 Ga0105246_10009730 Ga0105246_100097307 67
219 3300012488 Ga0157343_1011800 Ga0157343_10118002 67
220 3300012507 Ga0157342_1010147 Ga0157342_10101471 67
221 3300013102 Ga0157371_10004736 Ga0157371_100047362 67
222 3300013102 Ga0157371_10054234 Ga0157371_100542342 67
223 3300013104 Ga0157370_10101371 Ga0157370_101013712 67
224 3300013105 Ga0157369_10000803 Ga0157369_1000080311 67
225 3300013105 Ga0157369_10043993 Ga0157369_100439935 67
226 3300013296 Ga0157374_10899454 Ga0157374_108994542 67
227 3300013296 Ga0157374_12362037 Ga0157374_123620371 67
228 3300013296 Ga0157374_12891741 Ga0157374_128917411 67
229 3300013297 Ga0157378_10001452 Ga0157378_1000145216 67
230 3300013297 Ga0157378_10073031 Ga0157378_100730312 67
231 3300013297 Ga0157378_10159661 Ga0157378_101596612 67
232 3300013297 Ga0157378_10305472 Ga0157378_103054722 67
233 3300013297 Ga0157378_10975895 Ga0157378_109758951 67
234 3300013297 Ga0157378_11924505 Ga0157378_119245051 67
235 3300013297 Ga0157378_12066828 Ga0157378_120668281 67
236 3300013306 Ga0163162_10237877 Ga0163162_102378773 67
237 3300013306 Ga0163162_11688662 Ga0163162_116886621 67
238 3300013307 Ga0157372_10000407 Ga0157372_1000040735 67
239 3300013307 Ga0157372_10002666 Ga0157372_100026666 67
240 3300013307 Ga0157372_12527733 Ga0157372_125277331 67
241 3300013308 Ga0157375_11866391 Ga0157375_118663912 67
242 3300014325 Ga0163163_10581102 Ga0163163_105811022 67
243 3300014325 Ga0163163_11505432 Ga0163163_115054321 67
244 3300014326 Ga0157380_10000100 Ga0157380_100001004 67
245 3300014326 Ga0157380_10540441 Ga0157380_105404412 67
246 3300014326 Ga0157380_10600237 Ga0157380_106002372 67
247 3300014326 Ga0157380_10991184 Ga0157380_109911842 67
248 3300014326 Ga0157380_13176285 Ga0157380_131762852 67
249 3300014745 Ga0157377_10081589 Ga0157377_100815892 67
250 3300014745 Ga0157377_10570903 Ga0157377_105709031 67
251 3300014968 Ga0157379_10041559 Ga0157379_100415592 67
252 3300014968 Ga0157379_10316152 Ga0157379_103161522 67
253 3300014969 Ga0157376_10191794 Ga0157376_101917942 67
254 3300014969 Ga0157376_10244557 Ga0157376_102445572 67
255 3300014969 Ga0157376_10288731 Ga0157376_102887312 67
256 3300014969 Ga0157376_11334672 Ga0157376_113346722 67
257 3300020069 Ga0197907_10016208 Ga0197907_100162081 67
258 3300020070 Ga0206356_10084229 Ga0206356_100842291 67
259 3300020080 Ga0206350_10476675 Ga0206350_104766754 67
260 3300020081 Ga0206354_11122989 Ga0206354_111229892 67
261 3300020082 Ga0206353_11780915 Ga0206353_117809152 67
262 3300020082 Ga0206353_12003865 Ga0206353_120038652 67
263 3300020610 Ga0154015_1480330 Ga0154015_14803302 67
264 3300021358 Ga0213873_10016109 Ga0213873_100161092 67
265 3300021384 Ga0213876_10034643 Ga0213876_100346432 67
266 3300021388 Ga0213875_10042168 Ga0213875_100421683 67
267 3300022467 Ga0224712_10207239 Ga0224712_102072391 67
268 3300022467 Ga0224712_10271247 Ga0224712_102712471 67
269 3300025302 Ga0207426_1047443 Ga0207426_10474432 67
270 3300025321 Ga0207656_10000279 Ga0207656_1000027915 67
271 3300025321 Ga0207656_10012232 Ga0207656_100122322 67
272 3300025321 Ga0207656_10307282 Ga0207656_103072821 67
273 3300025885 Ga0207653_10072275 Ga0207653_100722752 67
274 3300025898 Ga0207692_10000003 Ga0207692_10000003112 67
275 3300025898 Ga0207692_10026293 Ga0207692_100262932 67
276 3300025898 Ga0207692_10027859 Ga0207692_100278591 67
277 3300025898 Ga0207692_10119126 Ga0207692_101191262 67
278 3300025899 Ga0207642_10164970 Ga0207642_101649702 67
279 3300025899 Ga0207642_10202560 Ga0207642_102025602 67
280 3300025900 Ga0207710_10000227 Ga0207710_1000022721 67
281 3300025900 Ga0207710_10144088 Ga0207710_101440882 67
282 3300025900 Ga0207710_10264628 Ga0207710_102646282 67
283 3300025900 Ga0207710_10406193 Ga0207710_104061931 67
284 3300025901 Ga0207688_10056078 Ga0207688_100560782 67
285 3300025901 Ga0207688_10078776 Ga0207688_100787761 67
286 3300025901 Ga0207688_10560529 Ga0207688_105605292 67
287 3300025905 Ga0207685_10122780 Ga0207685_101227802 67
288 3300025905 Ga0207685_10259272 Ga0207685_102592722 67
289 3300025905 Ga0207685_10264776 Ga0207685_102647761 67
290 3300025906 Ga0207699_10224906 Ga0207699_102249061 67
291 3300025906 Ga0207699_10240651 Ga0207699_102406511 67
292 3300025906 Ga0207699_11200285 Ga0207699_112002852 67
293 3300025908 Ga0207643_10172143 Ga0207643_101721431 67
294 3300025908 Ga0207643_10201370 Ga0207643_102013702 67
295 3300025909 Ga0207705_10029550 Ga0207705_100295505 67
296 3300025909 Ga0207705_10068852 Ga0207705_100688522 67
297 3300025909 Ga0207705_11202154 Ga0207705_112021542 67
298 3300025911 Ga0207654_10206856 Ga0207654_102068562 67
299 3300025913 Ga0207695_10760500 Ga0207695_107605002 67
300 3300025913 Ga0207695_11234634 Ga0207695_112346342 67
301 3300025915 Ga0207693_10002361 Ga0207693_1000236110 67
302 3300025915 Ga0207693_10007537 Ga0207693_100075379 67
303 3300025915 Ga0207693_10010235 Ga0207693_100102354 67
304 3300025915 Ga0207693_10020454 Ga0207693_100204543 67
305 3300025915 Ga0207693_10037519 Ga0207693_100375193 67
306 3300025915 Ga0207693_10324132 Ga0207693_103241321 67
307 3300025915 Ga0207693_10345784 Ga0207693_103457843 67
308 3300025915 Ga0207693_10904662 Ga0207693_109046622 67
309 3300025916 Ga0207663_10018585 Ga0207663_100185852 67
310 3300025916 Ga0207663_10025553 Ga0207663_100255533 67
311 3300025916 Ga0207663_10042562 Ga0207663_100425621 67
312 3300025916 Ga0207663_10055710 Ga0207663_100557104 67
313 3300025916 Ga0207663_10081638 Ga0207663_100816384 67
314 3300025916 Ga0207663_10299712 Ga0207663_102997121 67
315 3300025918 Ga0207662_10212314 Ga0207662_102123142 67
316 3300025918 Ga0207662_10893701 Ga0207662_108937012 67
317 3300025919 Ga0207657_10079092 Ga0207657_100790921 67
318 3300025919 Ga0207657_10135510 Ga0207657_101355102 67
319 3300025919 Ga0207657_10449128 Ga0207657_104491282 67
320 3300025919 Ga0207657_10492682 Ga0207657_104926822 67
321 3300025920 Ga0207649_10000015 Ga0207649_1000001586 67
322 3300025920 Ga0207649_11579914 Ga0207649_115799141 67
323 3300025921 Ga0207652_10809286 Ga0207652_108092861 67
324 3300025922 Ga0207646_11422429 Ga0207646_114224291 67
325 3300025924 Ga0207694_10939614 Ga0207694_109396142 67
326 3300025925 Ga0207650_11660309 Ga0207650_116603091 67
327 3300025926 Ga0207659_10000030 Ga0207659_100000304 67
328 3300025926 Ga0207659_11623278 Ga0207659_116232782 67
329 3300025927 Ga0207687_10000025 Ga0207687_10000025158 67
330 3300025927 Ga0207687_10001391 Ga0207687_1000139116 67
331 3300025927 Ga0207687_10163474 Ga0207687_101634742 67
332 3300025927 Ga0207687_10256456 Ga0207687_102564562 67
333 3300025928 Ga0207700_10000019 Ga0207700_1000001932 67
334 3300025928 Ga0207700_10336105 Ga0207700_103361051 67
335 3300025928 Ga0207700_10715429 Ga0207700_107154293 67
336 3300025929 Ga0207664_10000152 Ga0207664_100001526 67
337 3300025929 Ga0207664_10000423 Ga0207664_1000042325 67
338 3300025929 Ga0207664_10019380 Ga0207664_100193802 67
339 3300025929 Ga0207664_10083570 Ga0207664_100835702 67
340 3300025929 Ga0207664_10127044 Ga0207664_101270442 67
341 3300025929 Ga0207664_10535542 Ga0207664_105355421 67
342 3300025929 Ga0207664_11116375 Ga0207664_111163752 67
343 3300025929 Ga0207664_11879812 Ga0207664_118798122 67
344 3300025932 Ga0207690_10000054 Ga0207690_1000005462 67
345 3300025932 Ga0207690_10010219 Ga0207690_100102193 67
346 3300025932 Ga0207690_10072483 Ga0207690_100724832 67
347 3300025932 Ga0207690_11384070 Ga0207690_113840701 67
348 3300025933 Ga0207706_10642614 Ga0207706_106426142 67
349 3300025934 Ga0207686_10022231 Ga0207686_100222312 67
350 3300025934 Ga0207686_11604696 Ga0207686_116046962 67
351 3300025934 Ga0207686_11848633 Ga0207686_118486331 67
352 3300025935 Ga0207709_10005656 Ga0207709_100056565 67
353 3300025935 Ga0207709_10158267 Ga0207709_101582671 67
354 3300025935 Ga0207709_10578290 Ga0207709_105782902 67
355 3300025936 Ga0207670_10022949 Ga0207670_100229492 67
356 3300025937 Ga0207669_10699968 Ga0207669_106999681 67
357 3300025938 Ga0207704_10000165 Ga0207704_100001652 67
358 3300025939 Ga0207665_10071633 Ga0207665_100716334 67
359 3300025939 Ga0207665_10471902 Ga0207665_104719022 67
360 3300025940 Ga0207691_10000286 Ga0207691_100002864 67
361 3300025941 Ga0207711_10000011 Ga0207711_10000011174 67
362 3300025944 Ga0207661_10000545 Ga0207661_1000054520 67
363 3300025944 Ga0207661_10001203 Ga0207661_1000120314 67
364 3300025944 Ga0207661_10025673 Ga0207661_100256732 67
365 3300025944 Ga0207661_10190888 Ga0207661_101908882 67
366 3300025944 Ga0207661_10422385 Ga0207661_104223851 67
367 3300025944 Ga0207661_11017261 Ga0207661_110172612 67
368 3300025945 Ga0207679_10267342 Ga0207679_102673422 67
369 3300025945 Ga0207679_10606926 Ga0207679_106069262 67
370 3300025945 Ga0207679_11233745 Ga0207679_112337452 67
371 3300025961 Ga0207712_10590202 Ga0207712_105902022 67
372 3300025961 Ga0207712_10966494 Ga0207712_109664942 67
373 3300025972 Ga0207668_10368051 Ga0207668_103680511 67
374 3300025972 Ga0207668_11741097 Ga0207668_117410971 67
375 3300025981 Ga0207640_10000100 Ga0207640_1000010066 67
376 3300025981 Ga0207640_10195709 Ga0207640_101957091 67
377 3300025981 Ga0207640_10843722 Ga0207640_108437222 67
378 3300025986 Ga0207658_10272644 Ga0207658_102726442 67
379 3300026023 Ga0207677_10001061 Ga0207677_100010612 67
380 3300026035 Ga0207703_10616426 Ga0207703_106164261 67
381 3300026041 Ga0207639_10266357 Ga0207639_102663572 67
382 3300026041 Ga0207639_11086113 Ga0207639_110861132 67
383 3300026075 Ga0207708_10238474 Ga0207708_102384742 67
384 3300026075 Ga0207708_10864377 Ga0207708_108643771 67
385 3300026078 Ga0207702_10000349 Ga0207702_1000034939 67
386 3300026078 Ga0207702_10049316 Ga0207702_100493164 67
387 3300026088 Ga0207641_10867976 Ga0207641_108679761 67
388 3300026089 Ga0207648_12173696 Ga0207648_121736962 67
389 3300026118 Ga0207675_100016463 Ga0207675_1000164632 67
390 3300026118 Ga0207675_101540311 Ga0207675_1015403111 67
391 3300026121 Ga0207683_10027789 Ga0207683_100277892 67
392 3300026121 Ga0207683_10040177 Ga0207683_100401774 67
393 3300026121 Ga0207683_11414713 Ga0207683_114147132 67
394 3300026142 Ga0207698_10000014 Ga0207698_10000014192 67
395 3300026142 Ga0207698_10081130 Ga0207698_100811301 67
396 3300026142 Ga0207698_10320133 Ga0207698_103201332 67
397 3300026142 Ga0207698_10724244 Ga0207698_107242441 67
398 3300027866 Ga0209813_10349401 Ga0209813_103494011 67
399 3300027907 Ga0207428_11294118 Ga0207428_112941181 67
400 3300028379 Ga0268266_10009239 Ga0268266_100092394 67
401 3300028379 Ga0268266_11492501 Ga0268266_114925011 67
402 3300028381 Ga0268264_11712976 Ga0268264_117129762 67
403 3300028556 Ga0265337_1149127 Ga0265337_11491272 67
404 3300028558 Ga0265326_10000005 Ga0265326_1000000551 67
405 3300028563 Ga0265319_1002387 Ga0265319_10023877 67
406 3300028573 Ga0265334_10000024 Ga0265334_10000024101 67
407 3300028577 Ga0265318_10194338 Ga0265318_101943381 67
408 3300028654 Ga0265322_10153375 Ga0265322_101533752 67
409 3300028666 Ga0265336_10011048 Ga0265336_100110482 67
410 3300028800 Ga0265338_10005196 Ga0265338_1000519614 67
411 3300029957 Ga0265324_10001239 Ga0265324_1000123911 67
412 3300031240 Ga0265320_10156189 Ga0265320_101561892 67
413 3300031247 Ga0265340_10334854 Ga0265340_103348542 67
414 3300031731 Ga0307405_10246304 Ga0307405_102463042 67
415 3300031731 Ga0307405_10292011 Ga0307405_102920111 67
416 3300031733 Ga0316577_10256329 Ga0316577_102563291 67
417 3300031824 Ga0307413_10897045 Ga0307413_108970452 67
418 3300031889 Ga0326468_10043821 Ga0326468_100438212 67
419 3300031901 Ga0307406_10143885 Ga0307406_101438853 67
420 3300031901 Ga0307406_10376564 Ga0307406_103765641 67
421 3300031903 Ga0307407_10578244 Ga0307407_105782441 67
422 3300031903 Ga0307407_10999688 Ga0307407_109996882 67
423 3300031911 Ga0307412_10695292 Ga0307412_106952921 67
424 3300031995 Ga0307409_100241412 Ga0307409_1002414122 67
425 3300031995 Ga0307409_101510463 Ga0307409_1015104632 67
426 3300032002 Ga0307416_100150273 Ga0307416_1001502733 67
427 3300032002 Ga0307416_101909882 Ga0307416_1019098822 67
428 3300032120 Ga0316053_118989 Ga0316053_1189891 67
429 3300032126 Ga0307415_100007313 Ga0307415_1000073133 67
430 3300032126 Ga0307415_101558695 Ga0307415_1015586952 67
431 3300035090 Ga0373949_0158769 Ga0373949_0158769_168_371 67
432 3300035111 Ga0373923_0294143 Ga0373923_0294143_406_609 67
433 3300035112 Ga0373932_0267290 Ga0373932_0267290_394_597 67
434 3300035116 Ga0373945_0362006 Ga0373945_0362006_357_560 67
435 3300035117 Ga0373953_0019266 Ga0373953_0019266_1624_1827 67
436 3300035118 Ga0373954_0098961 Ga0373954_0098961_1181_1384 67
437 3300035119 Ga0373956_0082690 Ga0373956_0082690_214_417 67
438 3300035120 Ga0373957_0020529 Ga0373957_0020529_422_625 67
439 3300035171 Ga0373946_0184999 Ga0373946_0184999_282_485 67
440 3300035172 Ga0373955_0813477 Ga0373955_0813477_13_216 67
441 3300035692 Ga0373935_0892602 Ga0373935_0892602_407_610 67
442 3300035692 Ga0373935_1219170 Ga0373935_1219170_140_343 67
443 3300035724 Ga0373933_0024811 Ga0373933_0024811_1172_1375 67
444 3300035725 Ga0373947_0609805 Ga0373947_0609805_70_273 67
445 3300035725 Ga0373947_0692485 Ga0373947_0692485_339_542 67
446 3300036401 Ga0373937_0028849 Ga0373937_0028849_2017_2220 67
447 3300036647 Ga0316582_0364133 Ga0316582_0364133_574_777 67
448 3300036712 Ga0316584_0303208 Ga0316584_0303208_854_1057 67
449 3300037068 Ga0373925_0248972 Ga0373925_0248972_685_888 67
450 3300037068 Ga0373925_0466880 Ga0373925_0466880_12_215 67
451 3300037418 Ga0395900_0440975 Ga0395900_0440975_234_437 67
452 3300037466 Ga0395898_0961364 Ga0395898_0961364_54_257 67
453 3300037853 Ga0436364_0535431 Ga0436364_0535431_334_537 67
454 3300037853 Ga0436364_0612522 Ga0436364_0612522_656_859 67
455 3300037853 Ga0436364_0722805 Ga0436364_0722805_91_294 67
456 3300037853 Ga0436364_0770269 Ga0436364_0770269_616_819 67
457 3300037853 Ga0436364_1461187 Ga0436364_1461187_2161_2364 67
458 3300038443 Ga0395901_0943358 Ga0395901_0943358_49_252 67
459 3300039437 Ga0436365_0640760 Ga0436365_0640760_71_274 67
460 3300039437 Ga0436365_1596370 Ga0436365_1596370_868_1071 67
461 3300039437 Ga0436365_1618718 Ga0436365_1618718_356_559 67
462 3300039438 Ga0436360_0704697 Ga0436360_0704697_235_453 67
463 3300039438 Ga0436360_0825171 Ga0436360_0825171_138_341 67
464 3300039450 Ga0436363_0330401 Ga0436363_0330401_44_247 67
465 3300039453 Ga0436362_0998278 Ga0436362_0998278_266_469 67
466 3300041452 Ga0451793_0694144 Ga0451793_0694144_31_234 67
467 3300041453 Ga0451797_0635860 Ga0451797_0635860_60_263 67
468 3300041456 Ga0451795_1713463 Ga0451795_1713463_59_262 67
469 3300041459 Ga0451800_1687827 Ga0451800_1687827_741_944 67
470 3300041491 Ga0451833_0831630 Ga0451833_0831630_259_462 67
471 3300041494 Ga0451837_0165306 Ga0451837_0165306_153_356 67
472 3300041494 Ga0451837_0496799 Ga0451837_0496799_209_430 67
473 3300041498 Ga0451841_1355594 Ga0451841_1355594_42_257 67
474 3300041503 Ga0451847_0629914 Ga0451847_0629914_164_367 67
475 3300041505 Ga0451849_0916961 Ga0451849_0916961_289_492 67
476 3300041512 Ga0451853_2933682 Ga0451853_2933682_142_345 67
477 3300042013 Ga0439456_132018 Ga0439456_132018_210_413 67
478 3300042016 Ga0439463_120990 Ga0439463_120990_373_576 67
479 3300044656 Ga0466969_0010293 Ga0466969_0010293_634_837 67
480 3300044658 Ga0466972_0080620 Ga0466972_0080620_999_1202 67
481 3300044683 Ga0466965_0154073 Ga0466965_0154073_593_796 67
482 3300044683 Ga0466965_0334932 Ga0466965_0334932_581_784 67
483 3300044683 Ga0466965_0456148 Ga0466965_0456148_422_625 67
484 3300044684 Ga0466966_0062341 Ga0466966_0062341_768_971 67
485 3300044684 Ga0466966_0106112 Ga0466966_0106112_720_923 67
486 3300044684 Ga0466966_0504986 Ga0466966_0504986_159_362 67
487 3300044693 Ga0466961_0003485 Ga0466961_0003485_2263_2466 67
488 3300044693 Ga0466961_0036824 Ga0466961_0036824_2036_2239 67
489 3300044693 Ga0466961_0523441 Ga0466961_0523441_290_493 67
490 3300044694 Ga0466963_0001558 Ga0466963_0001558_848_1051 67
491 3300044694 Ga0466963_0009227 Ga0466963_0009227_2142_2345 67
492 3300044694 Ga0466963_0151290 Ga0466963_0151290_1147_1350 67
493 3300044694 Ga0466963_0477179 Ga0466963_0477179_87_290 67
494 3300044706 Ga0466964_0666209 Ga0466964_0666209_329_532 67
495 3300044706 Ga0466964_0710730 Ga0466964_0710730_177_380 67
496 3300044719 Ga0466971_0106526 Ga0466971_0106526_886_1089 67
497 3300044719 Ga0466971_0115589 Ga0466971_0115589_636_839 67
498 3300044735 Ga0466968_0058799 Ga0466968_0058799_1442_1645 67
499 3300044735 Ga0466968_0114308 Ga0466968_0114308_531_734 67
500 3300044735 Ga0466968_0303794 Ga0466968_0303794_350_553 67
501 3300044765 Ga0466970_0134944 Ga0466970_0134944_52_255 67
502 3300044765 Ga0466970_0235263 Ga0466970_0235263_677_880 67
503 3300044842 Ga0466957_0001697 Ga0466957_0001697_864_1067 67
504 3300044842 Ga0466957_0143814 Ga0466957_0143814_472_675 67
505 3300044842 Ga0466957_0193557 Ga0466957_0193557_550_753 67
506 3300044842 Ga0466957_0306046 Ga0466957_0306046_778_981 67
507 3300044842 Ga0466957_0514449 Ga0466957_0514449_526_729 67
508 3300044901 Ga0466960_0056122 Ga0466960_0056122_1494_1697 67
509 3300044901 Ga0466960_0815413 Ga0466960_0815413_27_230 67
510 3300044901 Ga0466960_0965477 Ga0466960_0965477_304_507 67
511 3300045049 Ga0466959_0000609 Ga0466959_0000609_17376_17579 67
512 3300045049 Ga0466959_0027158 Ga0466959_0027158_2316_2519 67
513 3300045049 Ga0466959_0030880 Ga0466959_0030880_253_456 67
514 3300045049 Ga0466959_0060290 Ga0466959_0060290_226_429 67
515 3300045049 Ga0466959_0183608 Ga0466959_0183608_696_899 67
516 3300045049 Ga0466959_0345436 Ga0466959_0345436_518_721 67
517 3300045049 Ga0466959_0720906 Ga0466959_0720906_267_470 67
518 3300045836 Ga0466958_0000990 Ga0466958_0000990_3931_4134 67
519 3300045836 Ga0466958_0008582 Ga0466958_0008582_3125_3328 67
520 3300045836 Ga0466958_0014638 Ga0466958_0014638_231_434 67
521 3300045836 Ga0466958_0075763 Ga0466958_0075763_816_1019 67
522 3300045836 Ga0466958_0158435 Ga0466958_0158435_574_777 67
523 3300045836 Ga0466958_0189291 Ga0466958_0189291_573_776 67
524 3300045976 Ga0466967_0018734 Ga0466967_0018734_333_536 67
525 3300045976 Ga0466967_2045828 Ga0466967_2045828_251_454 67
526 3300046454 Ga0495592_0093583 Ga0495592_0093583_1090_1293 67
527 3300046454 Ga0495592_0449080 Ga0495592_0449080_257_460 67
528 3300046459 Ga0495629_0000201 Ga0495629_0000201_12878_13081 67
529 3300046459 Ga0495629_0757088 Ga0495629_0757088_56_259 67
530 3300046461 Ga0495641_0020860 Ga0495641_0020860_2367_2570 67
531 3300046461 Ga0495641_0325417 Ga0495641_0325417_94_297 67
532 3300046461 Ga0495641_0329294 Ga0495641_0329294_167_370 67
533 3300046461 Ga0495641_0446333 Ga0495641_0446333_159_362 67
534 3300046461 Ga0495641_0525893 Ga0495641_0525893_74_277 67
535 3300046462 Ga0495651_0005613 Ga0495651_0005613_4138_4341 67
536 3300046462 Ga0495651_0546259 Ga0495651_0546259_157_360 67
537 3300046463 Ga0495653_0019879 Ga0495653_0019879_1009_1212 67
538 3300046463 Ga0495653_0771205 Ga0495653_0771205_117_320 67
539 3300046472 Ga0495580_0869412 Ga0495580_0869412_364_567 67
540 3300046473 Ga0495582_0286026 Ga0495582_0286026_81_284 67
541 3300046476 Ga0495662_0452385 Ga0495662_0452385_37_240 67
542 3300046476 Ga0495662_0623586 Ga0495662_0623586_273_476 67
543 3300046477 Ga0495664_0114317 Ga0495664_0114317_321_524 67
544 3300046507 Ga0495606_0000886 Ga0495606_0000886_35628_35831 67
545 3300046511 Ga0495608_0000042 Ga0495608_0000042_104961_105164 67
546 3300046511 Ga0495608_0006477 Ga0495608_0006477_988_1191 67
547 3300046514 Ga0495618_0008515 Ga0495618_0008515_2692_2895 67
548 3300046514 Ga0495618_0847232 Ga0495618_0847232_130_333 67
549 3300046517 Ga0495630_0000027 Ga0495630_0000027_88027_88230 67
550 3300046517 Ga0495630_0709832 Ga0495630_0709832_527_730 67
551 3300046520 Ga0495637_0272796 Ga0495637_0272796_326_529 67
552 3300046529 Ga0495652_0123660 Ga0495652_0123660_1570_1773 67
553 3300046529 Ga0495652_0169005 Ga0495652_0169005_336_539 67
554 3300046529 Ga0495652_0628063 Ga0495652_0628063_70_273 67
555 3300046531 Ga0495665_0181475 Ga0495665_0181475_549_752 67
556 3300046533 Ga0495640_0443714 Ga0495640_0443714_70_273 67
557 3300046533 Ga0495640_0653163 Ga0495640_0653163_139_342 67
558 3300046536 Ga0495587_0260393 Ga0495587_0260393_154_357 67
559 3300046542 Ga0495597_0183363 Ga0495597_0183363_303_506 67
560 3300046543 Ga0495645_0931728 Ga0495645_0931728_150_353 67
561 3300046559 Ga0495667_0015882 Ga0495667_0015882_1284_1487 67
562 3300046559 Ga0495667_0579607 Ga0495667_0579607_400_603 67
563 3300046642 Ga0495634_0127583 Ga0495634_0127583_1053_1256 67
564 3300046660 Ga0495625_0000109 Ga0495625_0000109_713_916 67
565 3300046660 Ga0495625_0079789 Ga0495625_0079789_1520_1723 67
566 3300046663 Ga0495635_0005867 Ga0495635_0005867_4893_5096 67
567 3300046674 Ga0495588_0000204 Ga0495588_0000204_51563_51766 67
568 3300046675 Ga0495657_0000040 Ga0495657_0000040_104961_105164 67
569 3300046675 Ga0495657_0003009 Ga0495657_0003009_3237_3440 67
570 3300046678 Ga0495599_0432083 Ga0495599_0432083_537_740 67
571 3300046679 Ga0495623_0120699 Ga0495623_0120699_571_774 67
572 3300046679 Ga0495623_0622766 Ga0495623_0622766_150_353 67
573 3300046680 Ga0495646_0009344 Ga0495646_0009344_4817_5020 67
574 3300046680 Ga0495646_0520106 Ga0495646_0520106_277_480 67
575 3300046681 Ga0495647_0034169 Ga0495647_0034169_1152_1355 67
576 3300046681 Ga0495647_0452593 Ga0495647_0452593_319_522 67
577 3300046683 Ga0495658_0062014 Ga0495658_0062014_879_1082 67
578 3300046689 Ga0495613_0000155 Ga0495613_0000155_48363_48566 67
579 3300046689 Ga0495613_0059310 Ga0495613_0059310_795_998 67
580 3300046689 Ga0495613_0196177 Ga0495613_0196177_929_1132 67
581 3300046690 Ga0495624_0000031 Ga0495624_0000031_85409_85612 67
582 3300046809 Ga0495600_0000973 Ga0495600_0000973_11586_11789 67
583 3300046809 Ga0495600_0002977 Ga0495600_0002977_3208_3411 67
584 3300047317 Ga0495604_0000201 Ga0495604_0000201_32075_32278 67
585 3300047317 Ga0495604_0003893 Ga0495604_0003893_7096_7299 67
586 3300047317 Ga0495604_0267153 Ga0495604_0267153_451_654 67
587 3300047317 Ga0495604_0301522 Ga0495604_0301522_138_341 67
588 3300047319 Ga0495674_0050200 Ga0495674_0050200_994_1197 67
589 3300047319 Ga0495674_1193445 Ga0495674_1193445_157_360 67
590 3300047319 Ga0495674_1242468 Ga0495674_1242468_241_444 67
591 3300047320 Ga0495672_0253355 Ga0495672_0253355_572_775 67
592 3300047321 Ga0495676_0071674 Ga0495676_0071674_548_751 67
593 3300047321 Ga0495676_0119830 Ga0495676_0119830_252_455 67
594 3300047321 Ga0495676_0255666 Ga0495676_0255666_402_605 67
595 3300047322 Ga0495680_0010105 Ga0495680_0010105_8214_8417 67
596 3300047444 Ga0495675_0000036 Ga0495675_0000036_24547_24750 67
597 3300047444 Ga0495675_0205780 Ga0495675_0205780_153_356 67
598 3300047471 Ga0495684_0032611 Ga0495684_0032611_1393_1596 67
599 3300047673 Ga0495593_0024911 Ga0495593_0024911_74_277 67
600 3300047673 Ga0495593_0263102 Ga0495593_0263102_434_637 67
601 3300047673 Ga0495593_0463262 Ga0495593_0463262_265_468 67
602 3300048088 Ga0495602_0000268 Ga0495602_0000268_27839_28042 67
603 3300048088 Ga0495602_0157967 Ga0495602_0157967_438_641 67
604 3300048903 Ga0496100_0001337 Ga0496100_0001337_7409_7612 67
605 3300048903 Ga0496100_0032537 Ga0496100_0032537_192_395 67
606 3300048903 Ga0496100_1101158 Ga0496100_1101158_128_331 67
607 3300048903 Ga0496100_1613252 Ga0496100_1613252_123_326 67
608 3300048904 Ga0496101_0000829 Ga0496101_0000829_4332_4535 67
609 3300048904 Ga0496101_0062067 Ga0496101_0062067_2064_2267 67
610 3300048904 Ga0496101_0354059 Ga0496101_0354059_620_823 67
611 3300048904 Ga0496101_0865931 Ga0496101_0865931_499_702 67
612 3300048905 Ga0496102_0005437 Ga0496102_0005437_9520_9723 67
613 3300048905 Ga0496102_0141161 Ga0496102_0141161_908_1111 67
614 3300048905 Ga0496102_1244101 Ga0496102_1244101_389_592 67
615 3300048905 Ga0496102_1706343 Ga0496102_1706343_307_510 67
616 3300048906 Ga0496103_0020085 Ga0496103_0020085_460_663 67
617 3300048906 Ga0496103_0289544 Ga0496103_0289544_453_656 67
618 3300048907 Ga0496104_0000029 Ga0496104_0000029_64750_64953 67
619 3300048907 Ga0496104_0012727 Ga0496104_0012727_993_1196 67
620 3300048907 Ga0496104_0023237 Ga0496104_0023237_676_879 67
621 3300048907 Ga0496104_0028341 Ga0496104_0028341_2646_2849 67
622 3300048907 Ga0496104_0095403 Ga0496104_0095403_2523_2726 67
623 3300048907 Ga0496104_0735380 Ga0496104_0735380_368_571 67
624 3300048908 Ga0496105_0000002 Ga0496105_0000002_64750_64953 67
625 3300048908 Ga0496105_0035041 Ga0496105_0035041_2210_2413 67
626 3300048908 Ga0496105_0062133 Ga0496105_0062133_2014_2217 67
627 3300048909 Ga0496106_0147775 Ga0496106_0147775_326_529 67
628 3300048909 Ga0496106_0278896 Ga0496106_0278896_102_305 67
629 3300048909 Ga0496106_1051757 Ga0496106_1051757_265_468 67
630 3300048910 Ga0496107_0017021 Ga0496107_0017021_374_577 67
631 3300048910 Ga0496107_1195972 Ga0496107_1195972_65_268 67
632 3300048911 Ga0496108_0000239 Ga0496108_0000239_27878_28081 67
633 3300048911 Ga0496108_0085810 Ga0496108_0085810_2378_2581 67
634 3300048911 Ga0496108_0196079 Ga0496108_0196079_1157_1360 67
635 3300048911 Ga0496108_0251779 Ga0496108_0251779_1014_1217 67
636 3300048912 Ga0496109_0000011 Ga0496109_0000011_171040_171243 67
637 3300048912 Ga0496109_0000034 Ga0496109_0000034_10385_10588 67
638 3300048912 Ga0496109_0013927 Ga0496109_0013927_6323_6526 67
639 3300048912 Ga0496109_0093605 Ga0496109_0093605_1816_2019 67
640 3300048912 Ga0496109_0415065 Ga0496109_0415065_518_721 67
641 3300048912 Ga0496109_0837894 Ga0496109_0837894_502_705 67
642 3300048913 Ga0496110_0000171 Ga0496110_0000171_10088_10291 67
643 3300048913 Ga0496110_0168253 Ga0496110_0168253_947_1150 67
644 3300048913 Ga0496110_0480180 Ga0496110_0480180_644_847 67
645 3300048913 Ga0496110_1742049 Ga0496110_1742049_64_267 67
646 3300048914 Ga0496111_0000020 Ga0496111_0000020_29692_29895 67
647 3300048914 Ga0496111_0031576 Ga0496111_0031576_1588_1791 67
648 3300048914 Ga0496111_0060223 Ga0496111_0060223_540_743 67
649 3300048914 Ga0496111_0586356 Ga0496111_0586356_335_538 67
650 3300048915 Ga0496112_0000641 Ga0496112_0000641_22770_22973 67
651 3300048915 Ga0496112_0000966 Ga0496112_0000966_15558_15761 67
652 3300048915 Ga0496112_0010462 Ga0496112_0010462_962_1165 67
653 3300048915 Ga0496112_0158935 Ga0496112_0158935_481_684 67
654 3300048916 Ga0496113_0000002 Ga0496113_0000002_188809_189012 67
655 3300048916 Ga0496113_0100771 Ga0496113_0100771_59_262 67
656 3300048916 Ga0496113_0158351 Ga0496113_0158351_489_692 67
657 3300048917 Ga0496114_0073011 Ga0496114_0073011_1884_2087 67
658 3300048917 Ga0496114_0256870 Ga0496114_0256870_133_336 67
659 3300048918 Ga0496115_0040913 Ga0496115_0040913_97_300 67
660 3300048918 Ga0496115_1470334 Ga0496115_1470334_237_440 67
661 3300048922 Ga0496119_0027003 Ga0496119_0027003_2352_2555 67
662 3300048927 Ga0496124_0166569 Ga0496124_0166569_296_499 67
663 3300048927 Ga0496124_0242798 Ga0496124_0242798_20_223 67
664 3300048927 Ga0496124_0322717 Ga0496124_0322717_594_797 67
665 3300048927 Ga0496124_0452589 Ga0496124_0452589_620_835 67
666 3300049569 Ga0501032_0305942 Ga0501032_0305942_738_941 67
667 3300049570 Ga0501033_0388812 Ga0501033_0388812_302_505 67
668 3300049570 Ga0501033_0557172 Ga0501033_0557172_73_294 67
669 3300049570 Ga0501033_0709793 Ga0501033_0709793_61_264 67
670 3300049571 Ga0501034_0009811 Ga0501034_0009811_3368_3589 67
671 3300049571 Ga0501034_0027484 Ga0501034_0027484_1748_1969 67
672 3300049571 Ga0501034_0309404 Ga0501034_0309404_593_814 67
673 3300049571 Ga0501034_0803057 Ga0501034_0803057_463_684 67
674 3300049571 Ga0501034_0852503 Ga0501034_0852503_295_498 67
675 3300049573 Ga0501037_0177320 Ga0501037_0177320_238_441 67
676 3300049573 Ga0501037_0323198 Ga0501037_0323198_230_433 67
677 3300049574 Ga0501038_0212169 Ga0501038_0212169_565_768 67
678 3300049576 Ga0501040_0275607 Ga0501040_0275607_402_605 67
679 3300049577 Ga0501041_0018106 Ga0501041_0018106_850_1053 67
680 3300049577 Ga0501041_0149184 Ga0501041_0149184_1231_1434 67
681 3300049578 Ga0501042_0033109 Ga0501042_0033109_1637_1840 67
682 3300049578 Ga0501042_0218580 Ga0501042_0218580_649_852 67
683 3300049579 Ga0501043_0103029 Ga0501043_0103029_951_1154 67
684 3300049580 Ga0501046_0188740 Ga0501046_0188740_535_738 67
685 3300049581 Ga0501047_0552147 Ga0501047_0552147_591_812 67
686 3300049582 Ga0501048_0022208 Ga0501048_0022208_3702_3905 67
687 3300049582 Ga0501048_0067099 Ga0501048_0067099_744_947 67
688 3300049582 Ga0501048_0389744 Ga0501048_0389744_10_213 67
689 3300049584 Ga0501068_0162812 Ga0501068_0162812_646_849 67
690 3300049586 Ga0501070_0052099 Ga0501070_0052099_1979_2182 67
691 3300049586 Ga0501070_0664052 Ga0501070_0664052_80_301 67
692 3300049587 Ga0501071_0592029 Ga0501071_0592029_631_834 67
693 3300049588 Ga0501072_0059464 Ga0501072_0059464_974_1177 67
694 3300049588 Ga0501072_0644853 Ga0501072_0644853_365_568 67
695 3300049590 Ga0501074_1027701 Ga0501074_1027701_28_231 67
696 3300049593 Ga0501077_1141707 Ga0501077_1141707_266_469 67
697 3300049741 Ga0501079_0060419 Ga0501079_0060419_2036_2239 67
698 3300049742 Ga0501080_0265737 Ga0501080_0265737_1079_1282 67
699 3300049743 Ga0501081_0471762 Ga0501081_0471762_48_251 67
700 3300049744 Ga0501083_0260089 Ga0501083_0260089_323_526 67
701 3300049822 Ga0501035_0293037 Ga0501035_0293037_280_483 67
702 3300049822 Ga0501035_0468524 Ga0501035_0468524_179_382 67
703 3300049823 Ga0501044_0047213 Ga0501044_0047213_575_796 67
704 3300049823 Ga0501044_0679980 Ga0501044_0679980_499_702 67
705 3300049824 Ga0501045_0021204 Ga0501045_0021204_3541_3744 67
706 3300049824 Ga0501045_0687789 Ga0501045_0687789_263_466 67
707 3300049824 Ga0501045_1326648 Ga0501045_1326648_291_494 67
708 3300050490 nmdc:mga03n38_699591_c1 nmdc:mga03n38_699591_c1_237_440 67
709 3300050491 nmdc:mga00v17_165214_c1 nmdc:mga00v17_165214_c1_859_1074 67
710 3300050491 nmdc:mga00v17_305567_c1 nmdc:mga00v17_305567_c1_336_539 67
711 3300050491 nmdc:mga00v17_591342_c1 nmdc:mga00v17_591342_c1_338_553 67
712 3300050491 nmdc:mga00v17_64055_c1 nmdc:mga00v17_64055_c1_313_516 67
713 3300050492 nmdc:mga0yw44_12752_c1 nmdc:mga0yw44_12752_c1_669_872 67
714 3300050492 nmdc:mga0yw44_39735_c1 nmdc:mga0yw44_39735_c1_2250_2453 67
715 3300050492 nmdc:mga0yw44_633568_c1 nmdc:mga0yw44_633568_c1_61_276 67
716 3300050494 nmdc:mga06z11_274537_c1 nmdc:mga06z11_274537_c1_651_854 67
717 3300050495 nmdc:mga04h51_362350_c1 nmdc:mga04h51_362350_c1_71_274 67
718 3300050507 nmdc:mga05p37_18367_c1 nmdc:mga05p37_18367_c1_1101_1304 67
719 3300050507 nmdc:mga05p37_2021019_c1 nmdc:mga05p37_2021019_c1_202_405 67
720 3300050509 nmdc:mga0qj67_1472541_c1 nmdc:mga0qj67_1472541_c1_37_240 67
721 3300050509 nmdc:mga0qj67_30071_c1 nmdc:mga0qj67_30071_c1_2261_2464 67
722 3300050510 nmdc:mga06r32_1978587_c1 nmdc:mga06r32_1978587_c1_195_398 67
723 3300050510 nmdc:mga06r32_640879_c1 nmdc:mga06r32_640879_c1_234_437 67
724 3300050511 nmdc:mga08y16_1947765_c1 nmdc:mga08y16_1947765_c1_321_524 67
725 3300050512 nmdc:mga0n895_944778_c1 nmdc:mga0n895_944778_c1_547_750 67
726 3300050513 nmdc:mga0rr50_1586846_c1 nmdc:mga0rr50_1586846_c1_332_535 67
727 3300053077 Ga0495601_0000019 Ga0495601_0000019_48587_48790 67
728 3300053077 Ga0495601_0303765 Ga0495601_0303765_436_639 67
729 3300053077 Ga0495601_0404184 Ga0495601_0404184_550_753 67
730 3300053077 Ga0495601_0684054 Ga0495601_0684054_389_592 67
731 3300053078 Ga0495612_0209430 Ga0495612_0209430_641_844 67
732 3300053083 Ga0495655_0006464 Ga0495655_0006464_1763_1966 67
733 3300053084 Ga0495595_0000009 Ga0495595_0000009_87876_88079 67
734 3300053084 Ga0495595_0002127 Ga0495595_0002127_6457_6660 67
735 3300053084 Ga0495595_0003003 Ga0495595_0003003_1277_1480 67
736 3300053085 Ga0495619_0000022 Ga0495619_0000022_39557_39760 67
737 3300053085 Ga0495619_0000057 Ga0495619_0000057_10735_10938 67
738 3300053085 Ga0495619_0001227 Ga0495619_0001227_12722_12925 67
739 3300053085 Ga0495619_0858507 Ga0495619_0858507_255_458 67
740 3300053085 Ga0495619_0979005 Ga0495619_0979005_47_250 67
741 3300054114 Ga0501084_0213865 Ga0501084_0213865_19_222 67
742 3300059492 Ga0587073_0156450 Ga0587073_0156450_363_566 67
743 3300059506 Ga0587085_099043 Ga0587085_099043_88_291 67
744 3300059508 Ga0587088_097081 Ga0587088_097081_88_291 67
745 3300059510 Ga0587090_124742 Ga0587090_124742_88_291 67
746 3300059511 Ga0587091_093081 Ga0587091_093081_88_291 67
747 3300059511 Ga0587091_245224 Ga0587091_245224_92_295 67
748 3300059513 Ga0587094_098631 Ga0587094_098631_88_291 67
749 3300059640 Ga0587067_106002 Ga0587067_106002_365_568 67
750 3300060353 Ga0501082_0192299 Ga0501082_0192299_533_736 67
751 3300061719 Ga0466962_0051066 Ga0466962_0051066_114_317 67
752 3300061719 Ga0466962_0222087 Ga0466962_0222087_161_364 67
753 3300061719 Ga0466962_0344939 Ga0466962_0344939_389_592 67
754 3300000041 ARcpr5oldR_c017779 ARcpr5oldR_0177792 68
755 3300000044 ARSoilOldRDRAFT_c018156 ARSoilOldRDRAFT_0181561 68
756 3300000546 LJNas_1012871 LJNas_10128712 68
757 3300000549 LJQas_1033532 LJQas_10335321 68
758 3300001977 JGI24746J21847_1000264 JGI24746J21847_10002643 68
759 3300002070 JGI24750J21931_1071913 JGI24750J21931_10719132 68
760 3300002074 JGI24748J21848_1000303 JGI24748J21848_10003034 68
761 3300002239 JGI24034J26672_10000615 JGI24034J26672_100006153 68
762 3300002244 JGI24742J22300_10006669 JGI24742J22300_100066692 68
763 3300003911 JGI25405J52794_10092150 JGI25405J52794_100921501 68
764 3300005329 Ga0070683_100002905 Ga0070683_1000029054 68
765 3300005329 Ga0070683_100112544 Ga0070683_1001125442 68
766 3300005329 Ga0070683_100588351 Ga0070683_1005883512 68
767 3300005331 Ga0070670_101322146 Ga0070670_1013221462 68
768 3300005333 Ga0070677_10000021 Ga0070677_100000218 68
769 3300005335 Ga0070666_10184453 Ga0070666_101844532 68
770 3300005335 Ga0070666_10614233 Ga0070666_106142332 68
771 3300005335 Ga0070666_11173440 Ga0070666_111734401 68
772 3300005336 Ga0070680_100385188 Ga0070680_1003851882 68
773 3300005336 Ga0070680_101079468 Ga0070680_1010794682 68
774 3300005337 Ga0070682_100000009 Ga0070682_100000009135 68
775 3300005337 Ga0070682_100035814 Ga0070682_1000358142 68
776 3300005337 Ga0070682_100154135 Ga0070682_1001541352 68
777 3300005337 Ga0070682_101165043 Ga0070682_1011650431 68
778 3300005337 Ga0070682_101560054 Ga0070682_1015600542 68
779 3300005340 Ga0070689_100073966 Ga0070689_1000739662 68
780 3300005341 Ga0070691_10000100 Ga0070691_1000010011 68
781 3300005344 Ga0070661_101302108 Ga0070661_1013021082 68
782 3300005347 Ga0070668_100115238 Ga0070668_1001152382 68
783 3300005347 Ga0070668_102141522 Ga0070668_1021415221 68
784 3300005355 Ga0070671_100068090 Ga0070671_1000680902 68
785 3300005355 Ga0070671_101352399 Ga0070671_1013523991 68
786 3300005356 Ga0070674_100000001 Ga0070674_100000001273 68
787 3300005356 Ga0070674_100542518 Ga0070674_1005425182 68
788 3300005364 Ga0070673_100037854 Ga0070673_1000378542 68
789 3300005366 Ga0070659_100040401 Ga0070659_1000404012 68
790 3300005366 Ga0070659_101211356 Ga0070659_1012113562 68
791 3300005367 Ga0070667_100009199 Ga0070667_1000091997 68
792 3300005367 Ga0070667_100275540 Ga0070667_1002755402 68
793 3300005367 Ga0070667_100388455 Ga0070667_1003884552 68
794 3300005434 Ga0070709_11144651 Ga0070709_111446511 68
795 3300005435 Ga0070714_100015268 Ga0070714_1000152681 68
796 3300005435 Ga0070714_101734941 Ga0070714_1017349411 68
797 3300005438 Ga0070701_10012489 Ga0070701_100124892 68
798 3300005439 Ga0070711_100380953 Ga0070711_1003809532 68
799 3300005439 Ga0070711_100393762 Ga0070711_1003937621 68
800 3300005439 Ga0070711_100672389 Ga0070711_1006723892 68
801 3300005440 Ga0070705_100967898 Ga0070705_1009678982 68
802 3300005441 Ga0070700_100059590 Ga0070700_1000595902 68
803 3300005455 Ga0070663_100022260 Ga0070663_1000222605 68
804 3300005455 Ga0070663_101589386 Ga0070663_1015893861 68
805 3300005457 Ga0070662_101311400 Ga0070662_1013114001 68
806 3300005458 Ga0070681_10034025 Ga0070681_100340252 68
807 3300005458 Ga0070681_10895674 Ga0070681_108956742 68
808 3300005471 Ga0070698_101575433 Ga0070698_1015754332 68
809 3300005530 Ga0070679_100000365 Ga0070679_10000036528 68
810 3300005530 Ga0070679_100001834 Ga0070679_1000018348 68
811 3300005530 Ga0070679_100469335 Ga0070679_1004693351 68
812 3300005535 Ga0070684_100005515 Ga0070684_10000551510 68
813 3300005535 Ga0070684_100013224 Ga0070684_1000132244 68
814 3300005535 Ga0070684_100076227 Ga0070684_1000762271 68
815 3300005535 Ga0070684_100594482 Ga0070684_1005944822 68
816 3300005539 Ga0068853_100005311 Ga0068853_1000053115 68
817 3300005544 Ga0070686_100206313 Ga0070686_1002063131 68
818 3300005545 Ga0070695_100130128 Ga0070695_1001301282 68
819 3300005548 Ga0070665_100000022 Ga0070665_100000022239 68
820 3300005548 Ga0070665_100589479 Ga0070665_1005894792 68
821 3300005548 Ga0070665_101802844 Ga0070665_1018028442 68
822 3300005549 Ga0070704_100072695 Ga0070704_1000726953 68
823 3300005563 Ga0068855_101629433 Ga0068855_1016294332 68
824 3300005564 Ga0070664_100110301 Ga0070664_1001103012 68
825 3300005564 Ga0070664_101283002 Ga0070664_1012830022 68
826 3300005564 Ga0070664_101285910 Ga0070664_1012859102 68
827 3300005577 Ga0068857_100541699 Ga0068857_1005416992 68
828 3300005577 Ga0068857_100643077 Ga0068857_1006430771 68
829 3300005578 Ga0068854_100234337 Ga0068854_1002343371 68
830 3300005578 Ga0068854_101482318 Ga0068854_1014823181 68
831 3300005614 Ga0068856_100009635 Ga0068856_1000096352 68
832 3300005614 Ga0068856_100416301 Ga0068856_1004163011 68
833 3300005614 Ga0068856_100425025 Ga0068856_1004250252 68
834 3300005616 Ga0068852_100724563 Ga0068852_1007245632 68
835 3300005617 Ga0068859_100237876 Ga0068859_1002378764 68
836 3300005617 Ga0068859_102610910 Ga0068859_1026109101 68
837 3300005618 Ga0068864_100000024 Ga0068864_100000024206 68
838 3300005718 Ga0068866_10000140 Ga0068866_1000014015 68
839 3300005718 Ga0068866_10065404 Ga0068866_100654042 68
840 3300005719 Ga0068861_100442480 Ga0068861_1004424802 68
841 3300005841 Ga0068863_100000050 Ga0068863_10000005092 68
842 3300005841 Ga0068863_100026840 Ga0068863_1000268402 68
843 3300005841 Ga0068863_100047803 Ga0068863_1000478032 68
844 3300005841 Ga0068863_100688724 Ga0068863_1006887241 68
845 3300005841 Ga0068863_102079178 Ga0068863_1020791781 68
846 3300005842 Ga0068858_100000264 Ga0068858_10000026425 68
847 3300005842 Ga0068858_100000545 Ga0068858_10000054516 68
848 3300005842 Ga0068858_100555336 Ga0068858_1005553362 68
849 3300005842 Ga0068858_100594845 Ga0068858_1005948452 68
850 3300005843 Ga0068860_100038935 Ga0068860_1000389352 68
851 3300005843 Ga0068860_100335016 Ga0068860_1003350162 68
852 3300005843 Ga0068860_101501185 Ga0068860_1015011852 68
853 3300005844 Ga0068862_100004764 Ga0068862_1000047645 68
854 3300005937 Ga0081455_10001231 Ga0081455_1000123130 68
855 3300005937 Ga0081455_10015455 Ga0081455_100154556 68
856 3300005937 Ga0081455_10029996 Ga0081455_100299965 68
857 3300005937 Ga0081455_10031024 Ga0081455_100310244 68
858 3300005937 Ga0081455_10073852 Ga0081455_100738522 68
859 3300005937 Ga0081455_10218093 Ga0081455_102180933 68
860 3300005981 Ga0081538_10087786 Ga0081538_100877863 68
861 3300005981 Ga0081538_10096671 Ga0081538_100966713 68
862 3300005983 Ga0081540_1009054 Ga0081540_10090544 68
863 3300005985 Ga0081539_10080320 Ga0081539_100803202 68
864 3300006038 Ga0075365_11012906 Ga0075365_110129062 68
865 3300006048 Ga0075363_100477239 Ga0075363_1004772391 68
866 3300006048 Ga0075363_100536677 Ga0075363_1005366772 68
867 3300006051 Ga0075364_10333695 Ga0075364_103336952 68
868 3300006163 Ga0070715_10032172 Ga0070715_100321722 68
869 3300006163 Ga0070715_10718119 Ga0070715_107181191 68
870 3300006173 Ga0070716_100689960 Ga0070716_1006899604 68
871 3300006178 Ga0075367_10418612 Ga0075367_104186122 68
872 3300006178 Ga0075367_10708753 Ga0075367_107087531 68
873 3300006237 Ga0097621_100283123 Ga0097621_1002831232 68
874 3300006237 Ga0097621_100790245 Ga0097621_1007902452 68
875 3300006358 Ga0068871_101406233 Ga0068871_1014062332 68
876 3300006852 Ga0075433_10027303 Ga0075433_100273032 68
877 3300006880 Ga0075429_101480820 Ga0075429_1014808202 68
878 3300006881 Ga0068865_100300466 Ga0068865_1003004662 68
879 3300006881 Ga0068865_100388849 Ga0068865_1003888492 68
880 3300006881 Ga0068865_101903360 Ga0068865_1019033601 68
881 3300006931 Ga0097620_100237873 Ga0097620_1002378732 68
882 3300006931 Ga0097620_102610749 Ga0097620_1026107491 68
883 3300007076 Ga0075435_100924316 Ga0075435_1009243162 68
884 3300007076 Ga0075435_101464196 Ga0075435_1014641962 68
885 3300009011 Ga0105251_10196442 Ga0105251_101964422 68
886 3300009036 Ga0105244_10441690 Ga0105244_104416901 68
887 3300009036 Ga0105244_10445729 Ga0105244_104457291 68
888 3300009092 Ga0105250_10095798 Ga0105250_100957982 68
889 3300009093 Ga0105240_10359397 Ga0105240_103593972 68
890 3300009093 Ga0105240_10676751 Ga0105240_106767512 68
891 3300009094 Ga0111539_11719964 Ga0111539_117199642 68
892 3300009094 Ga0111539_11852941 Ga0111539_118529411 68
893 3300009094 Ga0111539_11967287 Ga0111539_119672871 68
894 3300009098 Ga0105245_10000022 Ga0105245_1000002236 68
895 3300009098 Ga0105245_10000343 Ga0105245_100003434 68
896 3300009098 Ga0105245_10191596 Ga0105245_101915962 68
897 3300009098 Ga0105245_10571911 Ga0105245_105719112 68
898 3300009098 Ga0105245_12906342 Ga0105245_129063421 68
899 3300009101 Ga0105247_10282715 Ga0105247_102827152 68
900 3300009147 Ga0114129_13369456 Ga0114129_133694561 68
901 3300009148 Ga0105243_10135910 Ga0105243_101359101 68
902 3300009148 Ga0105243_11465588 Ga0105243_114655881 68
903 3300009174 Ga0105241_10494550 Ga0105241_104945502 68
904 3300009176 Ga0105242_10001159 Ga0105242_1000115913 68
905 3300009176 Ga0105242_10094968 Ga0105242_100949682 68
906 3300009176 Ga0105242_11174478 Ga0105242_111744781 68
907 3300009176 Ga0105242_11541552 Ga0105242_115415522 68
908 3300009176 Ga0105242_11707744 Ga0105242_117077442 68
909 3300009545 Ga0105237_10242710 Ga0105237_102427102 68
910 3300009545 Ga0105237_11866143 Ga0105237_118661432 68
911 3300009551 Ga0105238_10000016 Ga0105238_1000001687 68
912 3300009553 Ga0105249_10000054 Ga0105249_1000005497 68
913 3300009553 Ga0105249_10002503 Ga0105249_1000250316 68
914 3300009553 Ga0105249_10478066 Ga0105249_104780661 68
915 3300009553 Ga0105249_11817301 Ga0105249_118173011 68
916 3300009553 Ga0105249_11855234 Ga0105249_118552341 68
917 3300009553 Ga0105249_12462007 Ga0105249_124620071 68
918 3300010375 Ga0105239_10041190 Ga0105239_100411904 68
919 3300010375 Ga0105239_10153412 Ga0105239_101534122 68
920 3300010375 Ga0105239_10209023 Ga0105239_102090232 68
921 3300010375 Ga0105239_10677098 Ga0105239_106770982 68
922 3300010375 Ga0105239_11358809 Ga0105239_113588092 68
923 3300011119 Ga0105246_10413925 Ga0105246_104139251 68
924 3300011119 Ga0105246_11145545 Ga0105246_111455451 68
925 3300011119 Ga0105246_11682381 Ga0105246_116823812 68
926 3300012506 Ga0157324_1052497 Ga0157324_10524972 68
927 3300012507 Ga0157342_1061613 Ga0157342_10616131 68
928 3300013102 Ga0157371_11383283 Ga0157371_113832831 68
929 3300013102 Ga0157371_11665089 Ga0157371_116650892 68
930 3300013104 Ga0157370_10933340 Ga0157370_109333401 68
931 3300013105 Ga0157369_11600670 Ga0157369_116006702 68
932 3300013105 Ga0157369_12426651 Ga0157369_124266512 68
933 3300013296 Ga0157374_10831985 Ga0157374_108319852 68
934 3300013296 Ga0157374_11306109 Ga0157374_113061091 68
935 3300013296 Ga0157374_11911736 Ga0157374_119117362 68
936 3300013306 Ga0163162_10187821 Ga0163162_101878212 68
937 3300013306 Ga0163162_10285977 Ga0163162_102859771 68
938 3300013307 Ga0157372_11227195 Ga0157372_112271952 68
939 3300013307 Ga0157372_11840821 Ga0157372_118408212 68
940 3300013308 Ga0157375_10024626 Ga0157375_100246262 68
941 3300013308 Ga0157375_10467281 Ga0157375_104672812 68
942 3300013308 Ga0157375_11715559 Ga0157375_117155592 68
943 3300014325 Ga0163163_10798730 Ga0163163_107987302 68
944 3300014325 Ga0163163_10913368 Ga0163163_109133681 68
945 3300014325 Ga0163163_12214306 Ga0163163_122143061 68
946 3300014326 Ga0157380_10000192 Ga0157380_1000019214 68
947 3300014326 Ga0157380_12392020 Ga0157380_123920201 68
948 3300014745 Ga0157377_10729519 Ga0157377_107295191 68
949 3300014968 Ga0157379_10029391 Ga0157379_100293915 68
950 3300014968 Ga0157379_10120901 Ga0157379_101209013 68
951 3300014968 Ga0157379_10853163 Ga0157379_108531632 68
952 3300014968 Ga0157379_12045233 Ga0157379_120452331 68
953 3300014969 Ga0157376_10393542 Ga0157376_103935421 68
954 3300014969 Ga0157376_10875294 Ga0157376_108752941 68
955 3300017792 Ga0163161_10000103 Ga0163161_1000010348 68
956 3300017792 Ga0163161_10062167 Ga0163161_100621672 68
957 3300017792 Ga0163161_10495226 Ga0163161_104952262 68
958 3300017792 Ga0163161_11186619 Ga0163161_111866191 68
959 3300020076 Ga0206355_1422539 Ga0206355_14225392 68
960 3300020081 Ga0206354_11416056 Ga0206354_114160562 68
961 3300025893 Ga0207682_10000020 Ga0207682_1000002061 68
962 3300025899 Ga0207642_10000066 Ga0207642_1000006616 68
963 3300025900 Ga0207710_10052958 Ga0207710_100529582 68
964 3300025900 Ga0207710_10151754 Ga0207710_101517542 68
965 3300025901 Ga0207688_11069092 Ga0207688_110690921 68
966 3300025903 Ga0207680_10002542 Ga0207680_100025424 68
967 3300025903 Ga0207680_10029138 Ga0207680_100291383 68
968 3300025903 Ga0207680_11051169 Ga0207680_110511692 68
969 3300025903 Ga0207680_11183426 Ga0207680_111834262 68
970 3300025906 Ga0207699_11406489 Ga0207699_114064891 68
971 3300025906 Ga0207699_11476203 Ga0207699_114762032 68
972 3300025907 Ga0207645_10175133 Ga0207645_101751332 68
973 3300025912 Ga0207707_10068205 Ga0207707_100682052 68
974 3300025912 Ga0207707_10751072 Ga0207707_107510722 68
975 3300025913 Ga0207695_10367701 Ga0207695_103677012 68
976 3300025913 Ga0207695_10830166 Ga0207695_108301662 68
977 3300025914 Ga0207671_10156193 Ga0207671_101561933 68
978 3300025915 Ga0207693_10313540 Ga0207693_103135404 68
979 3300025915 Ga0207693_10314460 Ga0207693_103144602 68
980 3300025916 Ga0207663_10002757 Ga0207663_100027572 68
981 3300025916 Ga0207663_10270231 Ga0207663_102702311 68
982 3300025920 Ga0207649_10590767 Ga0207649_105907671 68
983 3300025921 Ga0207652_10000513 Ga0207652_1000051334 68
984 3300025921 Ga0207652_10000536 Ga0207652_1000053626 68
985 3300025921 Ga0207652_10655728 Ga0207652_106557282 68
986 3300025923 Ga0207681_11807833 Ga0207681_118078331 68
987 3300025924 Ga0207694_10000012 Ga0207694_10000012334 68
988 3300025924 Ga0207694_10180031 Ga0207694_101800312 68
989 3300025927 Ga0207687_10000065 Ga0207687_1000006542 68
990 3300025927 Ga0207687_10000109 Ga0207687_100001094 68
991 3300025927 Ga0207687_10111608 Ga0207687_101116082 68
992 3300025927 Ga0207687_10381125 Ga0207687_103811252 68
993 3300025929 Ga0207664_10057149 Ga0207664_100571492 68
994 3300025931 Ga0207644_10198893 Ga0207644_101988932 68
995 3300025931 Ga0207644_11035707 Ga0207644_110357071 68
996 3300025932 Ga0207690_10044238 Ga0207690_100442383 68
997 3300025934 Ga0207686_10000035 Ga0207686_1000003525 68
998 3300025934 Ga0207686_10049109 Ga0207686_100491092 68
999 3300025934 Ga0207686_10157828 Ga0207686_101578282 68
1000 3300025934 Ga0207686_10799566 Ga0207686_107995662 68
1001 3300025935 Ga0207709_10084458 Ga0207709_100844582 68
1002 3300025936 Ga0207670_10658423 Ga0207670_106584232 68
1003 3300025937 Ga0207669_10000002 Ga0207669_1000000277 68
1004 3300025937 Ga0207669_10977715 Ga0207669_109777151 68
1005 3300025938 Ga0207704_10380060 Ga0207704_103800601 68
1006 3300025938 Ga0207704_11021177 Ga0207704_110211773 68
1007 3300025939 Ga0207665_10168246 Ga0207665_101682462 68
1008 3300025939 Ga0207665_11604997 Ga0207665_116049971 68
1009 3300025942 Ga0207689_11211631 Ga0207689_112116312 68
1010 3300025944 Ga0207661_10000446 Ga0207661_1000044619 68
1011 3300025944 Ga0207661_10087458 Ga0207661_100874582 68
1012 3300025944 Ga0207661_10100687 Ga0207661_101006872 68
1013 3300025944 Ga0207661_10127712 Ga0207661_101277122 68
1014 3300025944 Ga0207661_11232326 Ga0207661_112323261 68
1015 3300025945 Ga0207679_10029307 Ga0207679_100293073 68
1016 3300025945 Ga0207679_11144755 Ga0207679_111447551 68
1017 3300025949 Ga0207667_10725815 Ga0207667_107258152 68
1018 3300025960 Ga0207651_10040641 Ga0207651_100406413 68
1019 3300025961 Ga0207712_10000032 Ga0207712_1000003268 68
1020 3300025961 Ga0207712_10026153 Ga0207712_100261532 68
1021 3300025961 Ga0207712_11277310 Ga0207712_112773101 68
1022 3300025961 Ga0207712_11326162 Ga0207712_113261621 68
1023 3300025972 Ga0207668_10004634 Ga0207668_100046347 68
1024 3300025972 Ga0207668_11219917 Ga0207668_112199171 68
1025 3300025986 Ga0207658_10025733 Ga0207658_100257334 68
1026 3300025986 Ga0207658_10025957 Ga0207658_100259572 68
1027 3300025986 Ga0207658_10126418 Ga0207658_101264182 68
1028 3300026035 Ga0207703_10000547 Ga0207703_1000054716 68
1029 3300026035 Ga0207703_10014839 Ga0207703_100148394 68
1030 3300026035 Ga0207703_10507667 Ga0207703_105076672 68
1031 3300026041 Ga0207639_11147264 Ga0207639_111472641 68
1032 3300026041 Ga0207639_12107281 Ga0207639_121072812 68
1033 3300026067 Ga0207678_10002590 Ga0207678_1000259011 68
1034 3300026075 Ga0207708_10124829 Ga0207708_101248292 68
1035 3300026075 Ga0207708_10168616 Ga0207708_101686162 68
1036 3300026075 Ga0207708_11143284 Ga0207708_111432842 68
1037 3300026078 Ga0207702_10043084 Ga0207702_100430842 68
1038 3300026088 Ga0207641_10000295 Ga0207641_1000029517 68
1039 3300026088 Ga0207641_10002521 Ga0207641_1000252115 68
1040 3300026088 Ga0207641_10879534 Ga0207641_108795342 68
1041 3300026095 Ga0207676_10000048 Ga0207676_1000004847 68
1042 3300026116 Ga0207674_10191471 Ga0207674_101914712 68
1043 3300026118 Ga0207675_100412190 Ga0207675_1004121902 68
1044 3300026121 Ga0207683_11249861 Ga0207683_112498611 68
1045 3300026142 Ga0207698_10462723 Ga0207698_104627232 68
1046 3300028379 Ga0268266_10000029 Ga0268266_10000029215 68
1047 3300028379 Ga0268266_10000369 Ga0268266_1000036964 68
1048 3300028379 Ga0268266_10514879 Ga0268266_105148792 68
1049 3300028379 Ga0268266_11719249 Ga0268266_117192491 68
1050 3300028380 Ga0268265_10003212 Ga0268265_1000321213 68
1051 3300028381 Ga0268264_10035488 Ga0268264_100354882 68
1052 3300028381 Ga0268264_10363173 Ga0268264_103631732 68
1053 3300028558 Ga0265326_10036848 Ga0265326_100368482 68
1054 3300028563 Ga0265319_1000037 Ga0265319_100003764 68
1055 3300028573 Ga0265334_10069882 Ga0265334_100698821 68
1056 3300028666 Ga0265336_10130968 Ga0265336_101309682 68
1057 3300028666 Ga0265336_10274886 Ga0265336_102748862 68
1058 3300028800 Ga0265338_10000051 Ga0265338_10000051165 68
1059 3300031240 Ga0265320_10152146 Ga0265320_101521462 68
1060 3300031250 Ga0265331_10004016 Ga0265331_100040168 68
1061 3300031456 Ga0307513_10538384 Ga0307513_105383841 68
1062 3300031548 Ga0307408_101999855 Ga0307408_1019998551 68
1063 3300031712 Ga0265342_10373431 Ga0265342_103734312 68
1064 3300032133 Ga0316583_10360288 Ga0316583_103602881 68
1065 3300035111 Ga0373923_0599769 Ga0373923_0599769_65_271 68
1066 3300035118 Ga0373954_0586130 Ga0373954_0586130_143_349 68
1067 3300035119 Ga0373956_0213295 Ga0373956_0213295_602_808 68
1068 3300035172 Ga0373955_0497206 Ga0373955_0497206_344_550 68
1069 3300035724 Ga0373933_0104494 Ga0373933_0104494_1001_1207 68
1070 3300035724 Ga0373933_0535756 Ga0373933_0535756_417_623 68
1071 3300036401 Ga0373937_0059441 Ga0373937_0059441_370_576 68
1072 3300036401 Ga0373937_0239183 Ga0373937_0239183_200_406 68
1073 3300036401 Ga0373937_1313014 Ga0373937_1313014_312_518 68
1074 3300036401 Ga0373937_1547854 Ga0373937_1547854_96_302 68
1075 3300036457 Ga0265778_029579 Ga0265778_029579_320_526 68
1076 3300037068 Ga0373925_0971245 Ga0373925_0971245_41_247 68
1077 3300037312 Ga0395899_0280486 Ga0395899_0280486_373_579 68
1078 3300037466 Ga0395898_0124585 Ga0395898_0124585_1300_1506 68
1079 3300037466 Ga0395898_0813900 Ga0395898_0813900_345_551 68
1080 3300037466 Ga0395898_1928231 Ga0395898_1928231_146_352 68
1081 3300037471 Ga0395905_0725754 Ga0395905_0725754_415_621 68
1082 3300037471 Ga0395905_0928884 Ga0395905_0928884_308_514 68
1083 3300038443 Ga0395901_0307414 Ga0395901_0307414_732_938 68
1084 3300038443 Ga0395901_0709859 Ga0395901_0709859_311_517 68
1085 3300038443 Ga0395901_1096821 Ga0395901_1096821_68_274 68
1086 3300038443 Ga0395901_1698750 Ga0395901_1698750_53_259 68
1087 3300041441 Ga0451787_613514 Ga0451787_613514_196_402 68
1088 3300041451 Ga0451791_0927836 Ga0451791_0927836_213_419 68
1089 3300041459 Ga0451800_0135496 Ga0451800_0135496_313_519 68
1090 3300041459 Ga0451800_0526380 Ga0451800_0526380_418_624 68
1091 3300041460 Ga0451802_0629809 Ga0451802_0629809_292_498 68
1092 3300041463 Ga0451804_0938937 Ga0451804_0938937_234_440 68
1093 3300041486 Ga0451807_0947727 Ga0451807_0947727_53_259 68
1094 3300041486 Ga0451807_1196866 Ga0451807_1196866_209_415 68
1095 3300041491 Ga0451833_1293110 Ga0451833_1293110_341_547 68
1096 3300041496 Ga0451839_1173009 Ga0451839_1173009_176_382 68
1097 3300041501 Ga0451845_0617187 Ga0451845_0617187_346_552 68
1098 3300041505 Ga0451849_0317970 Ga0451849_0317970_241_447 68
1099 3300041505 Ga0451849_0505893 Ga0451849_0505893_388_594 68
1100 3300041507 Ga0451851_0604415 Ga0451851_0604415_348_554 68
1101 3300041512 Ga0451853_1083256 Ga0451853_1083256_181_387 68
1102 3300041512 Ga0451853_2009781 Ga0451853_2009781_511_717 68
1103 3300042993 Ga0439440_0284241 Ga0439440_0284241_185_391 68
1104 3300044694 Ga0466963_0000051 Ga0466963_0000051_30907_31113 68
1105 3300044694 Ga0466963_0036711 Ga0466963_0036711_1225_1431 68
1106 3300044901 Ga0466960_0964989 Ga0466960_0964989_183_389 68
1107 3300045976 Ga0466967_0143417 Ga0466967_0143417_1426_1632 68
1108 3300045976 Ga0466967_2130551 Ga0466967_2130551_287_493 68
1109 3300046454 Ga0495592_0000608 Ga0495592_0000608_7619_7825 68
1110 3300046454 Ga0495592_0125901 Ga0495592_0125901_1489_1695 68
1111 3300046454 Ga0495592_0304363 Ga0495592_0304363_88_294 68
1112 3300046454 Ga0495592_0568152 Ga0495592_0568152_217_423 68
1113 3300046455 Ga0495603_0013380 Ga0495603_0013380_2025_2231 68
1114 3300046455 Ga0495603_0022660 Ga0495603_0022660_3214_3420 68
1115 3300046455 Ga0495603_0523989 Ga0495603_0523989_314_520 68
1116 3300046458 Ga0495591_036391 Ga0495591_036391_806_1012 68
1117 3300046459 Ga0495629_0005614 Ga0495629_0005614_7482_7688 68
1118 3300046459 Ga0495629_0162200 Ga0495629_0162200_1157_1363 68
1119 3300046459 Ga0495629_0203509 Ga0495629_0203509_404_610 68
1120 3300046459 Ga0495629_0379570 Ga0495629_0379570_677_883 68
1121 3300046459 Ga0495629_0905110 Ga0495629_0905110_229_435 68
1122 3300046459 Ga0495629_0935544 Ga0495629_0935544_59_265 68
1123 3300046461 Ga0495641_0000010 Ga0495641_0000010_120973_121179 68
1124 3300046461 Ga0495641_0047547 Ga0495641_0047547_201_407 68
1125 3300046461 Ga0495641_0171523 Ga0495641_0171523_582_788 68
1126 3300046462 Ga0495651_0150509 Ga0495651_0150509_1222_1428 68
1127 3300046462 Ga0495651_0175627 Ga0495651_0175627_1017_1223 68
1128 3300046462 Ga0495651_0200196 Ga0495651_0200196_709_915 68
1129 3300046462 Ga0495651_0403707 Ga0495651_0403707_26_232 68
1130 3300046463 Ga0495653_0057561 Ga0495653_0057561_2526_2732 68
1131 3300046463 Ga0495653_0066111 Ga0495653_0066111_2310_2516 68
1132 3300046463 Ga0495653_0430227 Ga0495653_0430227_557_763 68
1133 3300046463 Ga0495653_0455607 Ga0495653_0455607_372_578 68
1134 3300046463 Ga0495653_0535638 Ga0495653_0535638_488_694 68
1135 3300046473 Ga0495582_0000002 Ga0495582_0000002_52977_53183 68
1136 3300046475 Ga0495639_0064452 Ga0495639_0064452_1103_1309 68
1137 3300046475 Ga0495639_0417418 Ga0495639_0417418_219_425 68
1138 3300046476 Ga0495662_0000162 Ga0495662_0000162_7482_7688 68
1139 3300046476 Ga0495662_0088014 Ga0495662_0088014_903_1109 68
1140 3300046477 Ga0495664_0151196 Ga0495664_0151196_1126_1332 68
1141 3300046477 Ga0495664_0578460 Ga0495664_0578460_385_591 68
1142 3300046491 Ga0495584_0506966 Ga0495584_0506966_103_309 68
1143 3300046499 Ga0495594_0000001 Ga0495594_0000001_161221_161427 68
1144 3300046511 Ga0495608_0002177 Ga0495608_0002177_1984_2190 68
1145 3300046511 Ga0495608_0141855 Ga0495608_0141855_199_405 68
1146 3300046511 Ga0495608_0164767 Ga0495608_0164767_1111_1317 68
1147 3300046514 Ga0495618_0000051 Ga0495618_0000051_66953_67159 68
1148 3300046514 Ga0495618_0053123 Ga0495618_0053123_747_953 68
1149 3300046515 Ga0495620_0000472 Ga0495620_0000472_23083_23289 68
1150 3300046515 Ga0495620_0184380 Ga0495620_0184380_441_647 68
1151 3300046515 Ga0495620_0425789 Ga0495620_0425789_206_412 68
1152 3300046516 Ga0495628_0000548 Ga0495628_0000548_14965_15171 68
1153 3300046516 Ga0495628_0081094 Ga0495628_0081094_303_509 68
1154 3300046516 Ga0495628_0095645 Ga0495628_0095645_1863_2069 68
1155 3300046516 Ga0495628_0143540 Ga0495628_0143540_378_584 68
1156 3300046516 Ga0495628_0144018 Ga0495628_0144018_1473_1679 68
1157 3300046516 Ga0495628_0328904 Ga0495628_0328904_755_961 68
1158 3300046516 Ga0495628_0633748 Ga0495628_0633748_266_472 68
1159 3300046516 Ga0495628_1165106 Ga0495628_1165106_32_238 68
1160 3300046517 Ga0495630_0000125 Ga0495630_0000125_7051_7257 68
1161 3300046517 Ga0495630_0000145 Ga0495630_0000145_54071_54277 68
1162 3300046517 Ga0495630_0006964 Ga0495630_0006964_3246_3452 68
1163 3300046517 Ga0495630_0065025 Ga0495630_0065025_971_1177 68
1164 3300046517 Ga0495630_0108853 Ga0495630_0108853_911_1117 68
1165 3300046517 Ga0495630_0131184 Ga0495630_0131184_1482_1688 68
1166 3300046517 Ga0495630_0223381 Ga0495630_0223381_1038_1244 68
1167 3300046517 Ga0495630_0905566 Ga0495630_0905566_361_567 68
1168 3300046519 Ga0495632_0206351 Ga0495632_0206351_439_645 68
1169 3300046523 Ga0495644_0008974 Ga0495644_0008974_993_1199 68
1170 3300046529 Ga0495652_0000009 Ga0495652_0000009_99638_99844 68
1171 3300046529 Ga0495652_0007230 Ga0495652_0007230_2725_2931 68
1172 3300046529 Ga0495652_0352349 Ga0495652_0352349_62_268 68
1173 3300046529 Ga0495652_0853227 Ga0495652_0853227_218_424 68
1174 3300046529 Ga0495652_0886377 Ga0495652_0886377_224_430 68
1175 3300046533 Ga0495640_0059281 Ga0495640_0059281_1157_1363 68
1176 3300046533 Ga0495640_0359899 Ga0495640_0359899_569_775 68
1177 3300046533 Ga0495640_0637928 Ga0495640_0637928_234_440 68
1178 3300046535 Ga0495586_0001779 Ga0495586_0001779_7385_7591 68
1179 3300046535 Ga0495586_0477093 Ga0495586_0477093_261_467 68
1180 3300046536 Ga0495587_0011085 Ga0495587_0011085_1199_1405 68
1181 3300046536 Ga0495587_0053947 Ga0495587_0053947_688_894 68
1182 3300046536 Ga0495587_0091663 Ga0495587_0091663_632_838 68
1183 3300046536 Ga0495587_0216062 Ga0495587_0216062_339_545 68
1184 3300046536 Ga0495587_0573402 Ga0495587_0573402_274_480 68
1185 3300046537 Ga0495598_0004201 Ga0495598_0004201_912_1118 68
1186 3300046543 Ga0495645_0055857 Ga0495645_0055857_1020_1226 68
1187 3300046543 Ga0495645_0077580 Ga0495645_0077580_12_218 68
1188 3300046557 Ga0495622_0000033 Ga0495622_0000033_73426_73632 68
1189 3300046559 Ga0495667_0759472 Ga0495667_0759472_359_565 68
1190 3300046559 Ga0495667_0993239 Ga0495667_0993239_129_338 68
1191 3300046615 Ga0495656_0000755 Ga0495656_0000755_3840_4046 68
1192 3300046616 Ga0495668_0066408 Ga0495668_0066408_1679_1885 68
1193 3300046642 Ga0495634_0000050 Ga0495634_0000050_30430_30636 68
1194 3300046642 Ga0495634_0010013 Ga0495634_0010013_1901_2107 68
1195 3300046642 Ga0495634_0019613 Ga0495634_0019613_4266_4472 68
1196 3300046642 Ga0495634_0753739 Ga0495634_0753739_263_469 68
1197 3300046660 Ga0495625_0248976 Ga0495625_0248976_67_273 68
1198 3300046663 Ga0495635_0000017 Ga0495635_0000017_44584_44790 68
1199 3300046663 Ga0495635_0009689 Ga0495635_0009689_1779_1985 68
1200 3300046663 Ga0495635_0116072 Ga0495635_0116072_65_271 68
1201 3300046663 Ga0495635_0218574 Ga0495635_0218574_47_253 68
1202 3300046663 Ga0495635_0266219 Ga0495635_0266219_857_1063 68
1203 3300046674 Ga0495588_0226026 Ga0495588_0226026_528_734 68
1204 3300046675 Ga0495657_0001105 Ga0495657_0001105_17850_18056 68
1205 3300046675 Ga0495657_0017286 Ga0495657_0017286_1238_1444 68
1206 3300046678 Ga0495599_0213629 Ga0495599_0213629_870_1076 68
1207 3300046678 Ga0495599_0369144 Ga0495599_0369144_24_230 68
1208 3300046678 Ga0495599_0628786 Ga0495599_0628786_333_539 68
1209 3300046678 Ga0495599_0663451 Ga0495599_0663451_187_393 68
1210 3300046678 Ga0495599_0696131 Ga0495599_0696131_197_403 68
1211 3300046679 Ga0495623_0211094 Ga0495623_0211094_756_962 68
1212 3300046679 Ga0495623_0520507 Ga0495623_0520507_180_386 68
1213 3300046680 Ga0495646_0462372 Ga0495646_0462372_258_464 68
1214 3300046680 Ga0495646_0509300 Ga0495646_0509300_153_359 68
1215 3300046681 Ga0495647_0000002 Ga0495647_0000002_125145_125351 68
1216 3300046681 Ga0495647_0000549 Ga0495647_0000549_8829_9035 68
1217 3300046681 Ga0495647_0291974 Ga0495647_0291974_442_648 68
1218 3300046683 Ga0495658_0000001 Ga0495658_0000001_339085_339291 68
1219 3300046683 Ga0495658_0433794 Ga0495658_0433794_25_231 68
1220 3300046683 Ga0495658_0998829 Ga0495658_0998829_37_243 68
1221 3300046684 Ga0495669_0000067 Ga0495669_0000067_49729_49935 68
1222 3300046684 Ga0495669_0524337 Ga0495669_0524337_217_423 68
1223 3300046689 Ga0495613_0000067 Ga0495613_0000067_36533_36739 68
1224 3300046689 Ga0495613_0103859 Ga0495613_0103859_1103_1309 68
1225 3300046690 Ga0495624_0000005 Ga0495624_0000005_123814_124020 68
1226 3300046690 Ga0495624_0044655 Ga0495624_0044655_1684_1890 68
1227 3300046691 Ga0495670_0007376 Ga0495670_0007376_129_335 68
1228 3300046692 Ga0495671_0619710 Ga0495671_0619710_266_472 68
1229 3300046694 Ga0495649_0002389 Ga0495649_0002389_3724_3930 68
1230 3300046809 Ga0495600_0000376 Ga0495600_0000376_20332_20538 68
1231 3300046809 Ga0495600_0287222 Ga0495600_0287222_788_994 68
1232 3300047317 Ga0495604_0000532 Ga0495604_0000532_23689_23895 68
1233 3300047317 Ga0495604_0109115 Ga0495604_0109115_1766_1972 68
1234 3300047319 Ga0495674_0000024 Ga0495674_0000024_116066_116272 68
1235 3300047319 Ga0495674_0105474 Ga0495674_0105474_1637_1843 68
1236 3300047319 Ga0495674_0108097 Ga0495674_0108097_532_738 68
1237 3300047319 Ga0495674_0190891 Ga0495674_0190891_74_280 68
1238 3300047319 Ga0495674_1322615 Ga0495674_1322615_211_417 68
1239 3300047320 Ga0495672_0554938 Ga0495672_0554938_32_238 68
1240 3300047321 Ga0495676_0000928 Ga0495676_0000928_10707_10913 68
1241 3300047321 Ga0495676_0002393 Ga0495676_0002393_2820_3026 68
1242 3300047321 Ga0495676_0004042 Ga0495676_0004042_8482_8688 68
1243 3300047321 Ga0495676_0139174 Ga0495676_0139174_144_350 68
1244 3300047321 Ga0495676_0667152 Ga0495676_0667152_366_572 68
1245 3300047322 Ga0495680_0001091 Ga0495680_0001091_23_229 68
1246 3300047322 Ga0495680_0001118 Ga0495680_0001118_2944_3150 68
1247 3300047322 Ga0495680_0313328 Ga0495680_0313328_810_1016 68
1248 3300047322 Ga0495680_0336572 Ga0495680_0336572_200_406 68
1249 3300047322 Ga0495680_0912105 Ga0495680_0912105_256_462 68
1250 3300047444 Ga0495675_0111872 Ga0495675_0111872_431_637 68
1251 3300047444 Ga0495675_0455278 Ga0495675_0455278_232_438 68
1252 3300047446 Ga0495679_010174 Ga0495679_010174_2987_3193 68
1253 3300047446 Ga0495679_189885 Ga0495679_189885_22_228 68
1254 3300047447 Ga0495685_214234 Ga0495685_214234_299_505 68
1255 3300047469 Ga0495673_0137981 Ga0495673_0137981_635_841 68
1256 3300047469 Ga0495673_0139293 Ga0495673_0139293_568_774 68
1257 3300047471 Ga0495684_0187403 Ga0495684_0187403_835_1041 68
1258 3300047471 Ga0495684_0365280 Ga0495684_0365280_605_811 68
1259 3300047472 Ga0495686_0139975 Ga0495686_0139975_496_702 68
1260 3300047472 Ga0495686_0520246 Ga0495686_0520246_221_427 68
1261 3300047673 Ga0495593_0061849 Ga0495593_0061849_1645_1851 68
1262 3300047673 Ga0495593_0331788 Ga0495593_0331788_466_672 68
1263 3300047673 Ga0495593_0508448 Ga0495593_0508448_366_572 68
1264 3300047673 Ga0495593_0640238 Ga0495593_0640238_65_271 68
1265 3300048088 Ga0495602_0004572 Ga0495602_0004572_1376_1582 68
1266 3300048088 Ga0495602_0054444 Ga0495602_0054444_3275_3481 68
1267 3300048088 Ga0495602_0494859 Ga0495602_0494859_264_470 68
1268 3300048088 Ga0495602_0642109 Ga0495602_0642109_345_551 68
1269 3300048088 Ga0495602_0745394 Ga0495602_0745394_300_506 68
1270 3300048089 Ga0495614_0260068 Ga0495614_0260068_256_462 68
1271 3300048903 Ga0496100_0000006 Ga0496100_0000006_165752_165958 68
1272 3300048903 Ga0496100_0000019 Ga0496100_0000019_115746_115952 68
1273 3300048903 Ga0496100_0115175 Ga0496100_0115175_699_908 68
1274 3300048903 Ga0496100_1672908 Ga0496100_1672908_65_271 68
1275 3300048904 Ga0496101_0000005 Ga0496101_0000005_115746_115952 68
1276 3300048904 Ga0496101_0000009 Ga0496101_0000009_165752_165958 68
1277 3300048904 Ga0496101_0748255 Ga0496101_0748255_79_285 68
1278 3300048905 Ga0496102_0000021 Ga0496102_0000021_47533_47739 68
1279 3300048905 Ga0496102_0105500 Ga0496102_0105500_931_1140 68
1280 3300048905 Ga0496102_0137543 Ga0496102_0137543_2023_2229 68
1281 3300048905 Ga0496102_0183344 Ga0496102_0183344_421_627 68
1282 3300048905 Ga0496102_1008596 Ga0496102_1008596_266_472 68
1283 3300048905 Ga0496102_1350612 Ga0496102_1350612_220_426 68
1284 3300048905 Ga0496102_1401549 Ga0496102_1401549_361_567 68
1285 3300048905 Ga0496102_1886083 Ga0496102_1886083_268_474 68
1286 3300048906 Ga0496103_0000001 Ga0496103_0000001_548168_548374 68
1287 3300048906 Ga0496103_0075865 Ga0496103_0075865_223_429 68
1288 3300048906 Ga0496103_1046709 Ga0496103_1046709_49_255 68
1289 3300048907 Ga0496104_0000008 Ga0496104_0000008_355297_355503 68
1290 3300048907 Ga0496104_0578546 Ga0496104_0578546_220_429 68
1291 3300048908 Ga0496105_0000003 Ga0496105_0000003_355297_355503 68
1292 3300048908 Ga0496105_0000900 Ga0496105_0000900_8043_8249 68
1293 3300048908 Ga0496105_0557646 Ga0496105_0557646_81_290 68
1294 3300048908 Ga0496105_0869562 Ga0496105_0869562_457_663 68
1295 3300048909 Ga0496106_0000033 Ga0496106_0000033_65735_65941 68
1296 3300048909 Ga0496106_0000072 Ga0496106_0000072_35572_35778 68
1297 3300048909 Ga0496106_0000107 Ga0496106_0000107_50874_51080 68
1298 3300048909 Ga0496106_0206852 Ga0496106_0206852_303_512 68
1299 3300048909 Ga0496106_0314796 Ga0496106_0314796_826_1032 68
1300 3300048910 Ga0496107_0000004 Ga0496107_0000004_115963_116169 68
1301 3300048910 Ga0496107_0000015 Ga0496107_0000015_61980_62186 68
1302 3300048910 Ga0496107_0025196 Ga0496107_0025196_3187_3393 68
1303 3300048910 Ga0496107_0031448 Ga0496107_0031448_2230_2439 68
1304 3300048910 Ga0496107_0032416 Ga0496107_0032416_2722_2928 68
1305 3300048911 Ga0496108_0000004 Ga0496108_0000004_216393_216599 68
1306 3300048911 Ga0496108_0007751 Ga0496108_0007751_2114_2320 68
1307 3300048911 Ga0496108_0108073 Ga0496108_0108073_662_868 68
1308 3300048911 Ga0496108_0332045 Ga0496108_0332045_557_763 68
1309 3300048911 Ga0496108_1088259 Ga0496108_1088259_379_585 68
1310 3300048912 Ga0496109_0000031 Ga0496109_0000031_62606_62812 68
1311 3300048912 Ga0496109_0353842 Ga0496109_0353842_1053_1259 68
1312 3300048912 Ga0496109_1287894 Ga0496109_1287894_293_499 68
1313 3300048913 Ga0496110_0019142 Ga0496110_0019142_3066_3272 68
1314 3300048913 Ga0496110_0045312 Ga0496110_0045312_1104_1310 68
1315 3300048913 Ga0496110_0249761 Ga0496110_0249761_533_739 68
1316 3300048913 Ga0496110_0664665 Ga0496110_0664665_674_880 68
1317 3300048913 Ga0496110_0922739 Ga0496110_0922739_300_509 68
1318 3300048914 Ga0496111_0071801 Ga0496111_0071801_1788_1994 68
1319 3300048914 Ga0496111_0085357 Ga0496111_0085357_1550_1759 68
1320 3300048914 Ga0496111_0132565 Ga0496111_0132565_1280_1486 68
1321 3300048914 Ga0496111_0135624 Ga0496111_0135624_1592_1798 68
1322 3300048914 Ga0496111_0158238 Ga0496111_0158238_818_1024 68
1323 3300048914 Ga0496111_1151675 Ga0496111_1151675_100_306 68
1324 3300048914 Ga0496111_1253466 Ga0496111_1253466_158_364 68
1325 3300048915 Ga0496112_0000002 Ga0496112_0000002_85268_85474 68
1326 3300048915 Ga0496112_0174482 Ga0496112_0174482_1804_2010 68
1327 3300048915 Ga0496112_0971373 Ga0496112_0971373_441_647 68
1328 3300048916 Ga0496113_0012195 Ga0496113_0012195_5270_5479 68
1329 3300048916 Ga0496113_0038334 Ga0496113_0038334_70_276 68
1330 3300048916 Ga0496113_0060198 Ga0496113_0060198_2490_2696 68
1331 3300048916 Ga0496113_0211754 Ga0496113_0211754_1252_1458 68
1332 3300048916 Ga0496113_0459659 Ga0496113_0459659_480_686 68
1333 3300048916 Ga0496113_0555870 Ga0496113_0555870_106_312 68
1334 3300048917 Ga0496114_0000003 Ga0496114_0000003_275269_275475 68
1335 3300048917 Ga0496114_0007441 Ga0496114_0007441_5587_5793 68
1336 3300048917 Ga0496114_0430099 Ga0496114_0430099_273_479 68
1337 3300048917 Ga0496114_0986656 Ga0496114_0986656_337_546 68
1338 3300048918 Ga0496115_0000022 Ga0496115_0000022_1607_1813 68
1339 3300048918 Ga0496115_0000027 Ga0496115_0000027_1555_1761 68
1340 3300048918 Ga0496115_0028762 Ga0496115_0028762_2892_3101 68
1341 3300048918 Ga0496115_0275696 Ga0496115_0275696_443_649 68
1342 3300048919 Ga0496116_0000138 Ga0496116_0000138_29053_29259 68
1343 3300048920 Ga0496117_0002715 Ga0496117_0002715_13773_13979 68
1344 3300048921 Ga0496118_0005655 Ga0496118_0005655_13742_13948 68
1345 3300048922 Ga0496119_0004108 Ga0496119_0004108_14073_14279 68
1346 3300048922 Ga0496119_0249476 Ga0496119_0249476_290_496 68
1347 3300048923 Ga0496120_0001479 Ga0496120_0001479_24824_25030 68
1348 3300048924 Ga0496121_0019185 Ga0496121_0019185_1657_1863 68
1349 3300048927 Ga0496124_0055183 Ga0496124_0055183_1883_2089 68
1350 3300048927 Ga0496124_0479413 Ga0496124_0479413_288_494 68
1351 3300048928 Ga0496125_0072330 Ga0496125_0072330_684_890 68
1352 3300048928 Ga0496125_0198347 Ga0496125_0198347_966_1172 68
1353 3300048929 Ga0496126_0012060 Ga0496126_0012060_689_895 68
1354 3300048929 Ga0496126_0154565 Ga0496126_0154565_1669_1875 68
1355 3300049568 Ga0501031_0003106 Ga0501031_0003106_10342_10548 68
1356 3300049568 Ga0501031_0168616 Ga0501031_0168616_1180_1386 68
1357 3300049569 Ga0501032_0001727 Ga0501032_0001727_6317_6523 68
1358 3300049570 Ga0501033_0001690 Ga0501033_0001690_10945_11151 68
1359 3300049571 Ga0501034_0249219 Ga0501034_0249219_888_1094 68
1360 3300049571 Ga0501034_0353026 Ga0501034_0353026_333_539 68
1361 3300049572 Ga0501036_0004060 Ga0501036_0004060_3429_3635 68
1362 3300049573 Ga0501037_0001236 Ga0501037_0001236_8388_8594 68
1363 3300049574 Ga0501038_0006748 Ga0501038_0006748_1982_2188 68
1364 3300049575 Ga0501039_0006866 Ga0501039_0006866_6107_6313 68
1365 3300049575 Ga0501039_0170167 Ga0501039_0170167_260_466 68
1366 3300049576 Ga0501040_0624102 Ga0501040_0624102_547_753 68
1367 3300049578 Ga0501042_0004801 Ga0501042_0004801_1503_1709 68
1368 3300049578 Ga0501042_0017856 Ga0501042_0017856_3259_3465 68
1369 3300049578 Ga0501042_0688546 Ga0501042_0688546_267_473 68
1370 3300049579 Ga0501043_0001769 Ga0501043_0001769_8157_8363 68
1371 3300049579 Ga0501043_0191316 Ga0501043_0191316_1007_1213 68
1372 3300049580 Ga0501046_0002090 Ga0501046_0002090_8410_8616 68
1373 3300049580 Ga0501046_0486508 Ga0501046_0486508_434_640 68
1374 3300049581 Ga0501047_0397409 Ga0501047_0397409_80_286 68
1375 3300049582 Ga0501048_0001315 Ga0501048_0001315_10236_10442 68
1376 3300049582 Ga0501048_0058589 Ga0501048_0058589_1215_1421 68
1377 3300049583 Ga0501067_0582909 Ga0501067_0582909_268_474 68
1378 3300049584 Ga0501068_0047971 Ga0501068_0047971_70_276 68
1379 3300049585 Ga0501069_0010535 Ga0501069_0010535_2188_2394 68
1380 3300049585 Ga0501069_0138701 Ga0501069_0138701_852_1058 68
1381 3300049586 Ga0501070_0002097 Ga0501070_0002097_10952_11158 68
1382 3300049586 Ga0501070_0298523 Ga0501070_0298523_69_275 68
1383 3300049587 Ga0501071_0030473 Ga0501071_0030473_239_445 68
1384 3300049587 Ga0501071_0045644 Ga0501071_0045644_1051_1257 68
1385 3300049587 Ga0501071_0895107 Ga0501071_0895107_165_371 68
1386 3300049587 Ga0501071_1524814 Ga0501071_1524814_27_233 68
1387 3300049588 Ga0501072_0075026 Ga0501072_0075026_2212_2418 68
1388 3300049589 Ga0501073_0001857 Ga0501073_0001857_10329_10535 68
1389 3300049591 Ga0501075_0058206 Ga0501075_0058206_1001_1207 68
1390 3300049592 Ga0501076_0376576 Ga0501076_0376576_831_1037 68
1391 3300049593 Ga0501077_0669588 Ga0501077_0669588_155_361 68
1392 3300049593 Ga0501077_0937020 Ga0501077_0937020_307_513 68
1393 3300049741 Ga0501079_0993310 Ga0501079_0993310_216_422 68
1394 3300049742 Ga0501080_0110932 Ga0501080_0110932_1188_1394 68
1395 3300049743 Ga0501081_0163202 Ga0501081_0163202_720_926 68
1396 3300049744 Ga0501083_0010313 Ga0501083_0010313_6310_6516 68
1397 3300049744 Ga0501083_0027896 Ga0501083_0027896_2961_3167 68
1398 3300049744 Ga0501083_0789865 Ga0501083_0789865_41_247 68
1399 3300049822 Ga0501035_0000614 Ga0501035_0000614_10952_11158 68
1400 3300049823 Ga0501044_0008924 Ga0501044_0008924_10342_10548 68
1401 3300049823 Ga0501044_0194620 Ga0501044_0194620_213_419 68
1402 3300049823 Ga0501044_1006431 Ga0501044_1006431_451_657 68
1403 3300049824 Ga0501045_0026912 Ga0501045_0026912_1360_1566 68
1404 3300049824 Ga0501045_0211664 Ga0501045_0211664_1164_1370 68
1405 3300050491 nmdc:mga00v17_972744_c1 nmdc:mga00v17_972744_c1_128_337 68
1406 3300050492 nmdc:mga0yw44_828347_c1 nmdc:mga0yw44_828347_c1_381_590 68
1407 3300050494 nmdc:mga06z11_746930_c1 nmdc:mga06z11_746930_c1_206_412 68
1408 3300050508 nmdc:mga09592_1351765_c1 nmdc:mga09592_1351765_c1_301_507 68
1409 3300050512 nmdc:mga0n895_1418451_c1 nmdc:mga0n895_1418451_c1_381_587 68
1410 3300050513 nmdc:mga0rr50_648129_c1 nmdc:mga0rr50_648129_c1_336_542 68
1411 3300050514 nmdc:mga08x19_835825_c1 nmdc:mga08x19_835825_c1_45_251 68
1412 3300050514 nmdc:mga08x19_973734_c1 nmdc:mga08x19_973734_c1_31_237 68
1413 3300050515 nmdc:mga0a205_4358_c1 nmdc:mga0a205_4358_c1_11807_12013 68
1414 3300053077 Ga0495601_0000231 Ga0495601_0000231_5551_5757 68
1415 3300053077 Ga0495601_0006135 Ga0495601_0006135_626_832 68
1416 3300053077 Ga0495601_0096863 Ga0495601_0096863_896_1102 68
1417 3300053077 Ga0495601_0220065 Ga0495601_0220065_18_224 68
1418 3300053077 Ga0495601_0235092 Ga0495601_0235092_760_966 68
1419 3300053077 Ga0495601_0391549 Ga0495601_0391549_215_421 68
1420 3300053078 Ga0495612_0000208 Ga0495612_0000208_10092_10298 68
1421 3300053078 Ga0495612_0005227 Ga0495612_0005227_1011_1217 68
1422 3300053078 Ga0495612_0005290 Ga0495612_0005290_59_265 68
1423 3300053078 Ga0495612_0063609 Ga0495612_0063609_108_314 68
1424 3300053078 Ga0495612_0181163 Ga0495612_0181163_591_797 68
1425 3300053078 Ga0495612_0448178 Ga0495612_0448178_285_491 68
1426 3300053083 Ga0495655_0000008 Ga0495655_0000008_93800_94006 68
1427 3300053084 Ga0495595_0000831 Ga0495595_0000831_9955_10161 68
1428 3300053084 Ga0495595_0183731 Ga0495595_0183731_21_227 68
1429 3300053084 Ga0495595_0349571 Ga0495595_0349571_530_736 68
1430 3300053084 Ga0495595_0466485 Ga0495595_0466485_389_595 68
1431 3300053084 Ga0495595_0489443 Ga0495595_0489443_265_471 68
1432 3300053085 Ga0495619_0000328 Ga0495619_0000328_13026_13232 68
1433 3300053085 Ga0495619_0002958 Ga0495619_0002958_4420_4626 68
1434 3300053085 Ga0495619_0064834 Ga0495619_0064834_1306_1512 68
1435 3300053085 Ga0495619_0080017 Ga0495619_0080017_1187_1393 68
1436 3300053085 Ga0495619_0128521 Ga0495619_0128521_75_281 68
1437 3300053085 Ga0495619_0158961 Ga0495619_0158961_955_1161 68
1438 3300053085 Ga0495619_0406791 Ga0495619_0406791_659_865 68
1439 3300053085 Ga0495619_0514701 Ga0495619_0514701_288_494 68
1440 3300053085 Ga0495619_0674645 Ga0495619_0674645_442_648 68
1441 3300053085 Ga0495619_1063801 Ga0495619_1063801_176_382 68
1442 3300053094 Ga0500566_0002923 Ga0500566_0002923_1341_1547 68
1443 3300053096 Ga0500641_0017364 Ga0500641_0017364_1355_1561 68
1444 3300053119 Ga0500595_053008 Ga0500595_053008_328_534 68
1445 3300053123 Ga0500614_001420 Ga0500614_001420_3571_3777 68
1446 3300053129 Ga0500628_000023 Ga0500628_000023_48714_48920 68
1447 3300053134 Ga0500658_0543660 Ga0500658_0543660_32_238 68
1448 3300054114 Ga0501084_0046761 Ga0501084_0046761_1279_1485 68
1449 3300054114 Ga0501084_1196777 Ga0501084_1196777_365_571 68
1450 3300054114 Ga0501084_1246791 Ga0501084_1246791_288_494 68
1451 3300060353 Ga0501082_0057158 Ga0501082_0057158_826_1032 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

2

66

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9851 2 67
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9835 1 67
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9698 1 68
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9692 1 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9679 1 67
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9748 2 64 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9711 2 64 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9696 2 64 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9661 2 64 2.40.50.140
af_P91398_61_146_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.961 2 64 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7V1NBD5-F1-model_v4 Cold shock domain-containing protein 1.007 2 67 GO:0003676
GO:0005737
AF-A0A372BZ07-F1-model_v4 Cold-shock protein 1.006 2 67 GO:0003676
GO:0005829
AF-A0A4U0YJC9-F1-model_v4 Cold-shock protein 1.006 1 65 GO:0003676
GO:0005829
AF-Q8FLY0-F1-model_v4 CSD domain-containing protein 1.006 2 67 GO:0003677
GO:0005737
AF-A0A4V6NDQ2-F1-model_v4 deleted 1.005 1 67

Feature Viewer

pLDDT pTM Quality
92.34 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map