F494011
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1444 | 517 | 2888 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_101247949|Ga0068860_1012479492 |
| Length | 80 |
| Sequence | MRARVTVTLKAGVLDPQGQAITGSLKSLGFSGVNAVRQGKVFDLEIADGGDPAEARMTLAAMCEKLLANTVIENYAIEIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 100 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 135 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 232 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 238 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 242 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 243 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 247 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 248 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 249 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 251 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 252 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 255 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 261 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 262 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 263 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 264 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 271 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 272 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 278 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 284 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 285 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 289 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 291 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 296 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 297 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 298 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 299 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 300 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 301 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 310 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 311 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 312 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 313 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 314 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 315 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 318 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 396 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 397 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 398 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 399 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 406 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 409 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 410 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 411 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 412 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 413 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 416 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 442 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 450 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 451 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 452 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 453 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 454 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 455 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 456 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 457 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 470 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 474 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 476 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 477 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 478 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 479 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 480 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 482 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 483 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 485 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 486 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 487 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 488 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 489 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 490 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 491 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 493 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 494 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 501 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 503 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 504 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 507 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 508 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 509 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.41 |
| Metatranscriptomes | 1.59 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.99 |
| Nodule | 0.42 |
| Rhizoplane | 5.33 |
| Rhizosphere | 83.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068860_101247949 | 3300005843 | Bacteria | 764 |
| 2 | JGI24740J21852_10038726 | 3300001979 | Bacteria | 1460 |
| 3 | JGI25165J46597_1038986 | 3300003214 | Bacteria | 610 |
| 4 | JGI25153J46596_10011207 | 3300003215 | Bacteria | 3981 |
| 5 | Ga0007409J51694_1118107 | 3300003575 | Bacteria | 921 |
| 6 | Ga0032354_1111692 | 3300003693 | Bacteria | 770 |
| 7 | Ga0058862_10037920 | 3300004803 | Bacteria | 862 |
| 8 | Ga0065712_10042515 | 3300005290 | Bacteria | 888 |
| 9 | Ga0070658_10089051 | 3300005327 | Bacteria | 2541 |
| 10 | Ga0070658_10489556 | 3300005327 | Bacteria | 1062 |
| 11 | Ga0070658_10502259 | 3300005327 | Bacteria | 1048 |
| 12 | Ga0070676_10376667 | 3300005328 | Bacteria | 982 |
| 13 | Ga0070683_100050446 | 3300005329 | Bacteria | 3852 |
| 14 | Ga0070683_100444165 | 3300005329 | Bacteria | 1238 |
| 15 | Ga0070683_101225927 | 3300005329 | Bacteria | 721 |
| 16 | Ga0070690_100034297 | 3300005330 | Bacteria | 3180 |
| 17 | Ga0070670_101035705 | 3300005331 | Bacteria | 747 |
| 18 | Ga0068869_100508235 | 3300005334 | Bacteria | 1007 |
| 19 | Ga0070680_100014585 | 3300005336 | Bacteria | 6146 |
| 20 | Ga0070680_100146643 | 3300005336 | Bacteria | 1980 |
| 21 | Ga0070680_100323382 | 3300005336 | Bacteria | 1309 |
| 22 | Ga0070680_101100616 | 3300005336 | Bacteria | 687 |
| 23 | Ga0070680_101159975 | 3300005336 | Bacteria | 668 |
| 24 | Ga0070682_101604025 | 3300005337 | Bacteria | 562 |
| 25 | Ga0068868_100007983 | 3300005338 | Bacteria | 7562 |
| 26 | Ga0068868_101389008 | 3300005338 | Bacteria | 655 |
| 27 | Ga0068868_101646901 | 3300005338 | Bacteria | 604 |
| 28 | Ga0070660_100018796 | 3300005339 | Bacteria | 5056 |
| 29 | Ga0070660_100076919 | 3300005339 | Bacteria | 2614 |
| 30 | Ga0070660_100169367 | 3300005339 | Bacteria | 1763 |
| 31 | Ga0070689_101010652 | 3300005340 | Bacteria | 740 |
| 32 | Ga0070691_10109451 | 3300005341 | Bacteria | 1380 |
| 33 | Ga0070691_10407234 | 3300005341 | Bacteria | 768 |
| 34 | Ga0070687_100313489 | 3300005343 | Bacteria | 1000 |
| 35 | Ga0070661_100170923 | 3300005344 | Bacteria | 1650 |
| 36 | Ga0070661_100269311 | 3300005344 | Bacteria | 1319 |
| 37 | Ga0070661_101399787 | 3300005344 | Bacteria | 588 |
| 38 | Ga0070692_10653784 | 3300005345 | Bacteria | 702 |
| 39 | Ga0070668_100327321 | 3300005347 | Bacteria | 1291 |
| 40 | Ga0070668_100497588 | 3300005347 | Bacteria | 1055 |
| 41 | Ga0070668_100733085 | 3300005347 | Bacteria | 874 |
| 42 | Ga0070669_100755351 | 3300005353 | Bacteria | 824 |
| 43 | Ga0070675_100324458 | 3300005354 | Bacteria | 1360 |
| 44 | Ga0070675_100467864 | 3300005354 | Bacteria | 1132 |
| 45 | Ga0070675_101298476 | 3300005354 | Bacteria | 671 |
| 46 | Ga0070671_100388795 | 3300005355 | Bacteria | 1193 |
| 47 | Ga0070671_102068819 | 3300005355 | Bacteria | 507 |
| 48 | Ga0070674_100532374 | 3300005356 | Bacteria | 983 |
| 49 | Ga0070674_101662508 | 3300005356 | Bacteria | 577 |
| 50 | Ga0070673_100160006 | 3300005364 | Bacteria | 1914 |
| 51 | Ga0070673_100160421 | 3300005364 | Bacteria | 1912 |
| 52 | Ga0070673_100762197 | 3300005364 | Bacteria | 892 |
| 53 | Ga0070673_100774574 | 3300005364 | Bacteria | 885 |
| 54 | Ga0070688_100323672 | 3300005365 | Bacteria | 1121 |
| 55 | Ga0070688_100422322 | 3300005365 | Bacteria | 991 |
| 56 | Ga0070688_100434120 | 3300005365 | Bacteria | 979 |
| 57 | Ga0070659_100734185 | 3300005366 | Bacteria | 856 |
| 58 | Ga0070659_101551190 | 3300005366 | Bacteria | 591 |
| 59 | Ga0070659_101892808 | 3300005366 | Bacteria | 535 |
| 60 | Ga0070667_100173437 | 3300005367 | Bacteria | 1905 |
| 61 | Ga0070709_10001922 | 3300005434 | Bacteria | 11290 |
| 62 | Ga0070709_10006846 | 3300005434 | Bacteria | 6226 |
| 63 | Ga0070709_10337280 | 3300005434 | Bacteria | 1110 |
| 64 | Ga0070709_10341778 | 3300005434 | Bacteria | 1103 |
| 65 | Ga0070709_10729890 | 3300005434 | Bacteria | 773 |
| 66 | Ga0070709_11788244 | 3300005434 | Bacteria | 503 |
| 67 | Ga0070714_100027376 | 3300005435 | Bacteria | 4720 |
| 68 | Ga0070714_100397788 | 3300005435 | Bacteria | 1301 |
| 69 | Ga0070714_101080465 | 3300005435 | Bacteria | 782 |
| 70 | Ga0070713_100062104 | 3300005436 | Bacteria | 3128 |
| 71 | Ga0070713_100189270 | 3300005436 | Bacteria | 1854 |
| 72 | Ga0070713_100304693 | 3300005436 | Bacteria | 1467 |
| 73 | Ga0070713_100464431 | 3300005436 | Bacteria | 1190 |
| 74 | Ga0070713_100526435 | 3300005436 | Bacteria | 1117 |
| 75 | Ga0070713_101292969 | 3300005436 | Bacteria | 707 |
| 76 | Ga0070713_102375773 | 3300005436 | Bacteria | 513 |
| 77 | Ga0070710_10071503 | 3300005437 | Bacteria | 2001 |
| 78 | Ga0070710_10718745 | 3300005437 | Bacteria | 706 |
| 79 | Ga0070710_10824735 | 3300005437 | Bacteria | 664 |
| 80 | Ga0070701_10478843 | 3300005438 | Bacteria | 804 |
| 81 | Ga0070711_100062959 | 3300005439 | Bacteria | 2587 |
| 82 | Ga0070711_100175987 | 3300005439 | Bacteria | 1635 |
| 83 | Ga0070711_100222251 | 3300005439 | Bacteria | 1469 |
| 84 | Ga0070711_100462344 | 3300005439 | Bacteria | 1040 |
| 85 | Ga0070711_100679055 | 3300005439 | Bacteria | 866 |
| 86 | Ga0070711_101575590 | 3300005439 | Bacteria | 574 |
| 87 | Ga0070705_100596162 | 3300005440 | Bacteria | 854 |
| 88 | Ga0070700_101360586 | 3300005441 | Bacteria | 599 |
| 89 | Ga0070694_100435890 | 3300005444 | Bacteria | 1032 |
| 90 | Ga0070663_100073256 | 3300005455 | Bacteria | 2498 |
| 91 | Ga0070663_101975297 | 3300005455 | Bacteria | 525 |
| 92 | Ga0070678_101690446 | 3300005456 | Bacteria | 595 |
| 93 | Ga0070678_101753506 | 3300005456 | Bacteria | 585 |
| 94 | Ga0070662_100988667 | 3300005457 | Bacteria | 720 |
| 95 | Ga0070681_10123510 | 3300005458 | Bacteria | 2521 |
| 96 | Ga0070681_10162202 | 3300005458 | Bacteria | 2159 |
| 97 | Ga0070681_10196016 | 3300005458 | Bacteria | 1939 |
| 98 | Ga0070681_10308624 | 3300005458 | Bacteria | 1491 |
| 99 | Ga0070681_10383342 | 3300005458 | Bacteria | 1316 |
| 100 | Ga0070681_11762779 | 3300005458 | Bacteria | 546 |
| 101 | Ga0068867_100373644 | 3300005459 | Bacteria | 1196 |
| 102 | Ga0070685_10326596 | 3300005466 | Bacteria | 1042 |
| 103 | Ga0070685_10331635 | 3300005466 | Bacteria | 1034 |
| 104 | Ga0070685_11276852 | 3300005466 | Bacteria | 560 |
| 105 | Ga0070698_101168366 | 3300005471 | Bacteria | 719 |
| 106 | Ga0070699_100300023 | 3300005518 | Bacteria | 1441 |
| 107 | Ga0070679_100042509 | 3300005530 | Bacteria | 4526 |
| 108 | Ga0070679_100043946 | 3300005530 | Bacteria | 4449 |
| 109 | Ga0070679_100058513 | 3300005530 | Bacteria | 3840 |
| 110 | Ga0070679_100069794 | 3300005530 | Bacteria | 3505 |
| 111 | Ga0070679_100162721 | 3300005530 | Bacteria | 2205 |
| 112 | Ga0070679_100315120 | 3300005530 | Bacteria | 1514 |
| 113 | Ga0070679_100344254 | 3300005530 | Bacteria | 1439 |
| 114 | Ga0070679_100442812 | 3300005530 | Bacteria | 1244 |
| 115 | Ga0070679_100656427 | 3300005530 | Bacteria | 992 |
| 116 | Ga0070679_101474637 | 3300005530 | Bacteria | 627 |
| 117 | Ga0070684_100065831 | 3300005535 | Bacteria | 3181 |
| 118 | Ga0070684_100111751 | 3300005535 | Bacteria | 2450 |
| 119 | Ga0070697_100118005 | 3300005536 | Bacteria | 2217 |
| 120 | Ga0068853_100027752 | 3300005539 | Bacteria | 4758 |
| 121 | Ga0068853_100055096 | 3300005539 | Bacteria | 3427 |
| 122 | Ga0068853_100106927 | 3300005539 | Bacteria | 2480 |
| 123 | Ga0068853_100268078 | 3300005539 | Bacteria | 1571 |
| 124 | Ga0068853_100929848 | 3300005539 | Bacteria | 836 |
| 125 | Ga0068853_101478683 | 3300005539 | Bacteria | 658 |
| 126 | Ga0070695_100828005 | 3300005545 | Bacteria | 743 |
| 127 | Ga0070695_101415274 | 3300005545 | Bacteria | 577 |
| 128 | Ga0070696_101458738 | 3300005546 | Bacteria | 585 |
| 129 | Ga0070696_101501589 | 3300005546 | Bacteria | 577 |
| 130 | Ga0070696_101568876 | 3300005546 | Bacteria | 565 |
| 131 | Ga0070693_100009073 | 3300005547 | Bacteria | 4936 |
| 132 | Ga0070693_100498196 | 3300005547 | Bacteria | 864 |
| 133 | Ga0070693_100651303 | 3300005547 | Bacteria | 766 |
| 134 | Ga0070665_100081722 | 3300005548 | Bacteria | 3236 |
| 135 | Ga0068855_100071444 | 3300005563 | Bacteria | 4036 |
| 136 | Ga0068855_100279415 | 3300005563 | Bacteria | 1854 |
| 137 | Ga0068855_100452753 | 3300005563 | Bacteria | 1400 |
| 138 | Ga0068855_101294751 | 3300005563 | Bacteria | 755 |
| 139 | Ga0068855_101351131 | 3300005563 | Bacteria | 736 |
| 140 | Ga0068855_101489573 | 3300005563 | Bacteria | 695 |
| 141 | Ga0070664_100209977 | 3300005564 | Bacteria | 1740 |
| 142 | Ga0070664_101150212 | 3300005564 | Bacteria | 731 |
| 143 | Ga0068857_100386466 | 3300005577 | Bacteria | 1300 |
| 144 | Ga0068857_100521839 | 3300005577 | Bacteria | 1116 |
| 145 | Ga0068857_100756657 | 3300005577 | Bacteria | 926 |
| 146 | Ga0068857_102466580 | 3300005577 | Bacteria | 511 |
| 147 | Ga0068854_100137184 | 3300005578 | Bacteria | 1874 |
| 148 | Ga0068854_100556478 | 3300005578 | Bacteria | 974 |
| 149 | Ga0068856_100022099 | 3300005614 | Bacteria | 6186 |
| 150 | Ga0068856_100123820 | 3300005614 | Bacteria | 2588 |
| 151 | Ga0068856_100230012 | 3300005614 | Bacteria | 1869 |
| 152 | Ga0068856_100353700 | 3300005614 | Bacteria | 1487 |
| 153 | Ga0068856_100422800 | 3300005614 | Bacteria | 1352 |
| 154 | Ga0068856_100482624 | 3300005614 | Bacteria | 1260 |
| 155 | Ga0068852_100006203 | 3300005616 | Bacteria | 8619 |
| 156 | Ga0068852_100282245 | 3300005616 | Bacteria | 1601 |
| 157 | Ga0068852_100310948 | 3300005616 | Bacteria | 1528 |
| 158 | Ga0068852_101081361 | 3300005616 | Bacteria | 822 |
| 159 | Ga0068859_100838170 | 3300005617 | Bacteria | 1006 |
| 160 | Ga0068864_100383119 | 3300005618 | Bacteria | 1333 |
| 161 | Ga0068866_10814766 | 3300005718 | Bacteria | 650 |
| 162 | Ga0068861_100257980 | 3300005719 | Bacteria | 1491 |
| 163 | Ga0068861_100561445 | 3300005719 | Bacteria | 1042 |
| 164 | Ga0068851_10158510 | 3300005834 | Bacteria | 1242 |
| 165 | Ga0068851_10233305 | 3300005834 | Bacteria | 1038 |
| 166 | Ga0068870_10179585 | 3300005840 | Bacteria | 1269 |
| 167 | Ga0068863_100435669 | 3300005841 | Bacteria | 1285 |
| 168 | Ga0068858_100054511 | 3300005842 | Bacteria | 3697 |
| 169 | Ga0068858_100310199 | 3300005842 | Bacteria | 1506 |
| 170 | Ga0068858_100541351 | 3300005842 | Bacteria | 1127 |
| 171 | Ga0068858_100897402 | 3300005842 | Bacteria | 867 |
| 172 | Ga0068858_101053816 | 3300005842 | Bacteria | 798 |
| 173 | Ga0068860_100670482 | 3300005843 | Bacteria | 1045 |
| 174 | Ga0068862_101901690 | 3300005844 | Bacteria | 605 |
| 175 | Ga0081455_10008039 | 3300005937 | Bacteria | 11017 |
| 176 | Ga0081455_10038420 | 3300005937 | Bacteria | 4240 |
| 177 | Ga0081455_10948579 | 3300005937 | Bacteria | 534 |
| 178 | Ga0081538_10009052 | 3300005981 | Bacteria | 8356 |
| 179 | Ga0081538_10015393 | 3300005981 | Bacteria | 5922 |
| 180 | Ga0081538_10040078 | 3300005981 | Bacteria | 2993 |
| 181 | Ga0081540_1054331 | 3300005983 | Bacteria | 1958 |
| 182 | Ga0081540_1200769 | 3300005983 | Bacteria | 725 |
| 183 | Ga0081540_1226993 | 3300005983 | Bacteria | 661 |
| 184 | Ga0081539_10312281 | 3300005985 | Bacteria | 671 |
| 185 | Ga0070717_10145504 | 3300006028 | Bacteria | 2047 |
| 186 | Ga0070717_10536905 | 3300006028 | Bacteria | 1059 |
| 187 | Ga0070717_11430790 | 3300006028 | Bacteria | 628 |
| 188 | Ga0075365_10038001 | 3300006038 | Bacteria | 3126 |
| 189 | Ga0075365_10767283 | 3300006038 | Bacteria | 681 |
| 190 | Ga0075368_10527513 | 3300006042 | Bacteria | 529 |
| 191 | Ga0075363_100299367 | 3300006048 | Bacteria | 933 |
| 192 | Ga0075364_10113671 | 3300006051 | Bacteria | 1808 |
| 193 | Ga0075364_10585104 | 3300006051 | Bacteria | 763 |
| 194 | Ga0075364_10810557 | 3300006051 | Bacteria | 638 |
| 195 | Ga0070715_10171109 | 3300006163 | Bacteria | 1082 |
| 196 | Ga0070715_10572506 | 3300006163 | Bacteria | 658 |
| 197 | Ga0070716_100312484 | 3300006173 | Bacteria | 1098 |
| 198 | Ga0070716_100936264 | 3300006173 | Bacteria | 681 |
| 199 | Ga0070712_100064075 | 3300006175 | Bacteria | 2605 |
| 200 | Ga0070712_100236287 | 3300006175 | Bacteria | 1454 |
| 201 | Ga0070712_100589946 | 3300006175 | Bacteria | 940 |
| 202 | Ga0075362_10009301 | 3300006177 | Bacteria | 3796 |
| 203 | Ga0075362_10321975 | 3300006177 | Bacteria | 770 |
| 204 | Ga0075362_10592236 | 3300006177 | Bacteria | 573 |
| 205 | Ga0075369_10225457 | 3300006186 | Bacteria | 868 |
| 206 | Ga0075366_10036787 | 3300006195 | Bacteria | 2886 |
| 207 | Ga0097621_102004878 | 3300006237 | Bacteria | 553 |
| 208 | Ga0068871_100867804 | 3300006358 | Bacteria | 835 |
| 209 | Ga0068871_100916110 | 3300006358 | Bacteria | 813 |
| 210 | Ga0075428_100160641 | 3300006844 | Bacteria | 2439 |
| 211 | Ga0075428_100304673 | 3300006844 | Bacteria | 1713 |
| 212 | Ga0075428_101094247 | 3300006844 | Bacteria | 842 |
| 213 | Ga0075428_102001018 | 3300006844 | Bacteria | 600 |
| 214 | Ga0075430_100000160 | 3300006846 | Bacteria | 44139 |
| 215 | Ga0075430_100026884 | 3300006846 | Bacteria | 4893 |
| 216 | Ga0075430_100069892 | 3300006846 | Bacteria | 2945 |
| 217 | Ga0075430_101663818 | 3300006846 | Bacteria | 524 |
| 218 | Ga0075431_100266156 | 3300006847 | Bacteria | 1738 |
| 219 | Ga0075431_100333821 | 3300006847 | Bacteria | 1527 |
| 220 | Ga0075431_100581937 | 3300006847 | Bacteria | 1105 |
| 221 | Ga0075431_100914215 | 3300006847 | Bacteria | 847 |
| 222 | Ga0075431_101308563 | 3300006847 | Bacteria | 686 |
| 223 | Ga0075433_10025352 | 3300006852 | Bacteria | 5011 |
| 224 | Ga0075433_10199152 | 3300006852 | Bacteria | 1781 |
| 225 | Ga0075434_100039061 | 3300006871 | Bacteria | 4703 |
| 226 | Ga0075434_100562438 | 3300006871 | Bacteria | 1160 |
| 227 | Ga0075434_100783587 | 3300006871 | Bacteria | 970 |
| 228 | Ga0075434_101078024 | 3300006871 | Bacteria | 817 |
| 229 | Ga0075429_100267141 | 3300006880 | Bacteria | 1498 |
| 230 | Ga0075429_100432121 | 3300006880 | Bacteria | 1154 |
| 231 | Ga0075429_100762560 | 3300006880 | Bacteria | 847 |
| 232 | Ga0068865_100118311 | 3300006881 | Bacteria | 1966 |
| 233 | Ga0068865_100158349 | 3300006881 | Bacteria | 1725 |
| 234 | Ga0068865_100421428 | 3300006881 | Bacteria | 1098 |
| 235 | Ga0075436_100286507 | 3300006914 | Bacteria | 1178 |
| 236 | Ga0097620_100838180 | 3300006931 | Bacteria | 1006 |
| 237 | Ga0099824_1013749 | 3300006942 | Bacteria | 8291 |
| 238 | Ga0099822_1002198 | 3300006943 | Bacteria | 24094 |
| 239 | Ga0075435_100189206 | 3300007076 | Bacteria | 1742 |
| 240 | Ga0075435_100222774 | 3300007076 | Bacteria | 1602 |
| 241 | Ga0075435_100487847 | 3300007076 | Bacteria | 1065 |
| 242 | Ga0075435_100508301 | 3300007076 | Bacteria | 1042 |
| 243 | Ga0099795_10006840 | 3300007788 | Bacteria | 3137 |
| 244 | Ga0099795_10008109 | 3300007788 | Bacteria | 2976 |
| 245 | Ga0099795_10180133 | 3300007788 | Bacteria | 882 |
| 246 | Ga0105240_10069299 | 3300009093 | Bacteria | 4366 |
| 247 | Ga0105240_10078594 | 3300009093 | Bacteria | 4062 |
| 248 | Ga0105240_10174589 | 3300009093 | Bacteria | 2541 |
| 249 | Ga0105240_10748694 | 3300009093 | Bacteria | 1062 |
| 250 | Ga0105240_11496942 | 3300009093 | Bacteria | 708 |
| 251 | Ga0105240_12062754 | 3300009093 | Bacteria | 592 |
| 252 | Ga0111539_10088305 | 3300009094 | Bacteria | 3642 |
| 253 | Ga0111539_10371050 | 3300009094 | Bacteria | 1666 |
| 254 | Ga0111539_10821120 | 3300009094 | Bacteria | 1082 |
| 255 | Ga0111539_11018887 | 3300009094 | Bacteria | 962 |
| 256 | Ga0111539_12717923 | 3300009094 | Bacteria | 574 |
| 257 | Ga0111539_13024242 | 3300009094 | Bacteria | 543 |
| 258 | Ga0105245_10018589 | 3300009098 | Bacteria | 6078 |
| 259 | Ga0105245_11952243 | 3300009098 | Bacteria | 640 |
| 260 | Ga0105245_12973268 | 3300009098 | Bacteria | 525 |
| 261 | Ga0105247_10043643 | 3300009101 | Bacteria | 2748 |
| 262 | Ga0105247_10277017 | 3300009101 | Bacteria | 1156 |
| 263 | Ga0105247_10557797 | 3300009101 | Bacteria | 843 |
| 264 | Ga0114129_10008525 | 3300009147 | Bacteria | 14611 |
| 265 | Ga0114129_10194916 | 3300009147 | Bacteria | 2748 |
| 266 | Ga0114129_10978363 | 3300009147 | Bacteria | 1067 |
| 267 | Ga0114129_11278018 | 3300009147 | Bacteria | 910 |
| 268 | Ga0114129_11327606 | 3300009147 | Bacteria | 890 |
| 269 | Ga0114129_13051102 | 3300009147 | Bacteria | 549 |
| 270 | Ga0105243_11034803 | 3300009148 | Bacteria | 826 |
| 271 | Ga0105241_10008048 | 3300009174 | Bacteria | 7755 |
| 272 | Ga0105241_10685135 | 3300009174 | Bacteria | 934 |
| 273 | Ga0105241_11186854 | 3300009174 | Bacteria | 722 |
| 274 | Ga0105241_11310093 | 3300009174 | Bacteria | 690 |
| 275 | Ga0105242_10061833 | 3300009176 | Bacteria | 3080 |
| 276 | Ga0105242_12701456 | 3300009176 | Bacteria | 546 |
| 277 | Ga0105248_10194835 | 3300009177 | Bacteria | 2283 |
| 278 | Ga0105237_10019778 | 3300009545 | Bacteria | 6952 |
| 279 | Ga0105237_10836697 | 3300009545 | Bacteria | 927 |
| 280 | Ga0105237_12242920 | 3300009545 | Bacteria | 556 |
| 281 | Ga0105238_10003838 | 3300009551 | Bacteria | 14926 |
| 282 | Ga0105238_10059220 | 3300009551 | Bacteria | 3837 |
| 283 | Ga0105238_10071815 | 3300009551 | Bacteria | 3458 |
| 284 | Ga0105238_10085833 | 3300009551 | Bacteria | 3135 |
| 285 | Ga0105238_10101038 | 3300009551 | Bacteria | 2867 |
| 286 | Ga0105238_10206694 | 3300009551 | Bacteria | 1939 |
| 287 | Ga0105238_10383998 | 3300009551 | Bacteria | 1396 |
| 288 | Ga0105238_11556954 | 3300009551 | Bacteria | 690 |
| 289 | Ga0105249_10977734 | 3300009553 | Bacteria | 915 |
| 290 | Ga0105249_11798556 | 3300009553 | Bacteria | 685 |
| 291 | Ga0105249_11926515 | 3300009553 | Bacteria | 664 |
| 292 | Ga0105249_13255056 | 3300009553 | Bacteria | 522 |
| 293 | Ga0099796_10010986 | 3300010159 | Bacteria | 2511 |
| 294 | Ga0099796_10021839 | 3300010159 | Bacteria | 1977 |
| 295 | Ga0099796_10100135 | 3300010159 | Bacteria | 1089 |
| 296 | Ga0099796_10149337 | 3300010159 | Bacteria | 919 |
| 297 | Ga0099796_10181829 | 3300010159 | Bacteria | 844 |
| 298 | Ga0105239_10177276 | 3300010375 | Bacteria | 2384 |
| 299 | Ga0105239_10185725 | 3300010375 | Bacteria | 2326 |
| 300 | Ga0105239_10373336 | 3300010375 | Bacteria | 1612 |
| 301 | Ga0105239_10476891 | 3300010375 | Bacteria | 1417 |
| 302 | Ga0105239_11147972 | 3300010375 | Bacteria | 895 |
| 303 | Ga0105239_11575296 | 3300010375 | Bacteria | 760 |
| 304 | Ga0105239_12638560 | 3300010375 | Bacteria | 586 |
| 305 | Ga0105239_13105477 | 3300010375 | Bacteria | 541 |
| 306 | Ga0105246_10139077 | 3300011119 | Bacteria | 1824 |
| 307 | Ga0157373_10149708 | 3300013100 | Bacteria | 1641 |
| 308 | Ga0157371_10165678 | 3300013102 | Bacteria | 1578 |
| 309 | Ga0157371_10339044 | 3300013102 | Bacteria | 1093 |
| 310 | Ga0157370_10012038 | 3300013104 | Bacteria | 9005 |
| 311 | Ga0157370_10118016 | 3300013104 | Bacteria | 2478 |
| 312 | Ga0157370_10265931 | 3300013104 | Bacteria | 1585 |
| 313 | Ga0157370_11155821 | 3300013104 | Bacteria | 699 |
| 314 | Ga0157370_11398506 | 3300013104 | Bacteria | 630 |
| 315 | Ga0157370_11437008 | 3300013104 | Bacteria | 620 |
| 316 | Ga0157369_10070831 | 3300013105 | Bacteria | 3745 |
| 317 | Ga0157369_10104293 | 3300013105 | Bacteria | 3020 |
| 318 | Ga0157369_10258809 | 3300013105 | Bacteria | 1815 |
| 319 | Ga0157374_10920909 | 3300013296 | Bacteria | 892 |
| 320 | Ga0157374_11900804 | 3300013296 | Bacteria | 621 |
| 321 | Ga0157378_10337769 | 3300013297 | Bacteria | 1468 |
| 322 | Ga0157378_10488980 | 3300013297 | Bacteria | 1227 |
| 323 | Ga0157372_10192928 | 3300013307 | Bacteria | 2359 |
| 324 | Ga0157372_10243395 | 3300013307 | Bacteria | 2087 |
| 325 | Ga0157372_10253838 | 3300013307 | Bacteria | 2042 |
| 326 | Ga0157372_10997979 | 3300013307 | Bacteria | 970 |
| 327 | Ga0157375_10396786 | 3300013308 | Bacteria | 1546 |
| 328 | Ga0157375_11464024 | 3300013308 | Bacteria | 805 |
| 329 | Ga0157375_11699528 | 3300013308 | Bacteria | 747 |
| 330 | Ga0157375_12749920 | 3300013308 | Bacteria | 588 |
| 331 | Ga0157375_13076237 | 3300013308 | Bacteria | 557 |
| 332 | Ga0157375_13406518 | 3300013308 | Bacteria | 530 |
| 333 | Ga0157375_13627347 | 3300013308 | Bacteria | 513 |
| 334 | Ga0163163_10036579 | 3300014325 | Bacteria | 4770 |
| 335 | Ga0163163_10246255 | 3300014325 | Bacteria | 1838 |
| 336 | Ga0163163_10429967 | 3300014325 | Bacteria | 1379 |
| 337 | Ga0157380_10119849 | 3300014326 | Bacteria | 2227 |
| 338 | Ga0157380_10133063 | 3300014326 | Bacteria | 2125 |
| 339 | Ga0157380_11420715 | 3300014326 | Bacteria | 745 |
| 340 | Ga0157380_11591017 | 3300014326 | Bacteria | 709 |
| 341 | Ga0157380_11894671 | 3300014326 | Bacteria | 657 |
| 342 | Ga0157377_10291571 | 3300014745 | Bacteria | 1073 |
| 343 | Ga0157376_10152308 | 3300014969 | Bacteria | 2087 |
| 344 | Ga0157376_11212059 | 3300014969 | Bacteria | 783 |
| 345 | Ga0157376_11912712 | 3300014969 | Bacteria | 630 |
| 346 | Ga0163161_10432020 | 3300017792 | Bacteria | 1061 |
| 347 | Ga0163161_11621345 | 3300017792 | Bacteria | 571 |
| 348 | Ga0197907_10153463 | 3300020069 | Bacteria | 1230 |
| 349 | Ga0197907_10562205 | 3300020069 | Bacteria | 929 |
| 350 | Ga0206356_11628268 | 3300020070 | Bacteria | 858 |
| 351 | Ga0206349_1963553 | 3300020075 | Bacteria | 547 |
| 352 | Ga0206355_1155059 | 3300020076 | Bacteria | 616 |
| 353 | Ga0206355_1586693 | 3300020076 | Bacteria | 1042 |
| 354 | Ga0206350_11537303 | 3300020080 | Bacteria | 1990 |
| 355 | Ga0206354_10229610 | 3300020081 | Bacteria | 519 |
| 356 | Ga0206354_11369879 | 3300020081 | Bacteria | 1308 |
| 357 | Ga0206353_10403358 | 3300020082 | Bacteria | 1356 |
| 358 | Ga0206353_10574770 | 3300020082 | Bacteria | 595 |
| 359 | Ga0206353_10738894 | 3300020082 | Bacteria | 1382 |
| 360 | Ga0213873_10012440 | 3300021358 | Bacteria | 1844 |
| 361 | Ga0213876_10001998 | 3300021384 | Bacteria | 12203 |
| 362 | Ga0213876_10104712 | 3300021384 | Bacteria | 1501 |
| 363 | Ga0213876_10204714 | 3300021384 | Bacteria | 1049 |
| 364 | Ga0213876_10223968 | 3300021384 | Bacteria | 1000 |
| 365 | Ga0213875_10022315 | 3300021388 | Bacteria | 3029 |
| 366 | Ga0224712_10005831 | 3300022467 | Bacteria | 3465 |
| 367 | Ga0224712_10256092 | 3300022467 | Bacteria | 810 |
| 368 | Ga0224572_1055618 | 3300024225 | Bacteria | 735 |
| 369 | Ga0209233_1006999 | 3300025261 | Bacteria | 3603 |
| 370 | Ga0207666_1049812 | 3300025271 | Bacteria | 663 |
| 371 | Ga0209025_1008156 | 3300025294 | Bacteria | 7591 |
| 372 | Ga0209758_1000158 | 3300025297 | Bacteria | 156129 |
| 373 | Ga0209758_1033723 | 3300025297 | Bacteria | 2050 |
| 374 | Ga0209758_1070698 | 3300025297 | Bacteria | 1099 |
| 375 | Ga0207697_10060887 | 3300025315 | Bacteria | 1570 |
| 376 | Ga0207697_10166643 | 3300025315 | Bacteria | 962 |
| 377 | Ga0207656_10479005 | 3300025321 | Bacteria | 631 |
| 378 | Ga0207653_10081843 | 3300025885 | Bacteria | 1119 |
| 379 | Ga0207682_10489555 | 3300025893 | Bacteria | 582 |
| 380 | Ga0207692_10237251 | 3300025898 | Bacteria | 1088 |
| 381 | Ga0207642_10080060 | 3300025899 | Bacteria | 1583 |
| 382 | Ga0207642_10568390 | 3300025899 | Bacteria | 702 |
| 383 | Ga0207642_10743516 | 3300025899 | Bacteria | 621 |
| 384 | Ga0207710_10161882 | 3300025900 | Bacteria | 1090 |
| 385 | Ga0207710_10234069 | 3300025900 | Bacteria | 915 |
| 386 | Ga0207710_10719578 | 3300025900 | Bacteria | 524 |
| 387 | Ga0207688_10023980 | 3300025901 | Bacteria | 3345 |
| 388 | Ga0207688_10087606 | 3300025901 | Bacteria | 1785 |
| 389 | Ga0207688_10272198 | 3300025901 | Bacteria | 1030 |
| 390 | Ga0207688_10438902 | 3300025901 | Bacteria | 813 |
| 391 | Ga0207688_10442830 | 3300025901 | Bacteria | 809 |
| 392 | Ga0207688_10510028 | 3300025901 | Bacteria | 754 |
| 393 | Ga0207688_10534448 | 3300025901 | Bacteria | 736 |
| 394 | Ga0207688_10554721 | 3300025901 | Bacteria | 722 |
| 395 | Ga0207680_10134413 | 3300025903 | Bacteria | 1633 |
| 396 | Ga0207680_10440720 | 3300025903 | Bacteria | 924 |
| 397 | Ga0207680_10838274 | 3300025903 | Bacteria | 659 |
| 398 | Ga0207647_10121117 | 3300025904 | Bacteria | 1543 |
| 399 | Ga0207647_10189237 | 3300025904 | Bacteria | 1193 |
| 400 | Ga0207647_10201530 | 3300025904 | Bacteria | 1151 |
| 401 | Ga0207647_10533437 | 3300025904 | Bacteria | 652 |
| 402 | Ga0207685_10659464 | 3300025905 | Bacteria | 566 |
| 403 | Ga0207699_10265868 | 3300025906 | Bacteria | 1187 |
| 404 | Ga0207699_10483017 | 3300025906 | Bacteria | 892 |
| 405 | Ga0207699_11038511 | 3300025906 | Bacteria | 606 |
| 406 | Ga0207699_11129009 | 3300025906 | Bacteria | 580 |
| 407 | Ga0207699_11230923 | 3300025906 | Bacteria | 554 |
| 408 | Ga0207645_10041051 | 3300025907 | Bacteria | 2963 |
| 409 | Ga0207645_10309325 | 3300025907 | Bacteria | 1053 |
| 410 | Ga0207645_10335540 | 3300025907 | Bacteria | 1010 |
| 411 | Ga0207645_10525239 | 3300025907 | Bacteria | 802 |
| 412 | Ga0207645_10863828 | 3300025907 | Bacteria | 615 |
| 413 | Ga0207643_10387217 | 3300025908 | Bacteria | 882 |
| 414 | Ga0207643_10548929 | 3300025908 | Bacteria | 741 |
| 415 | Ga0207705_10097947 | 3300025909 | Bacteria | 2154 |
| 416 | Ga0207705_10454412 | 3300025909 | Bacteria | 993 |
| 417 | Ga0207705_10711956 | 3300025909 | Bacteria | 780 |
| 418 | Ga0207705_11076898 | 3300025909 | Bacteria | 620 |
| 419 | Ga0207684_11476687 | 3300025910 | Bacteria | 554 |
| 420 | Ga0207654_10028860 | 3300025911 | Bacteria | 3029 |
| 421 | Ga0207654_10080502 | 3300025911 | Bacteria | 1959 |
| 422 | Ga0207654_10418730 | 3300025911 | Bacteria | 934 |
| 423 | Ga0207707_10002462 | 3300025912 | Bacteria | 16661 |
| 424 | Ga0207707_10120132 | 3300025912 | Bacteria | 2297 |
| 425 | Ga0207707_10135704 | 3300025912 | Bacteria | 2151 |
| 426 | Ga0207707_10144629 | 3300025912 | Bacteria | 2078 |
| 427 | Ga0207707_10166809 | 3300025912 | Bacteria | 1924 |
| 428 | Ga0207707_10346988 | 3300025912 | Bacteria | 1279 |
| 429 | Ga0207707_11165985 | 3300025912 | Bacteria | 625 |
| 430 | Ga0207707_11326976 | 3300025912 | Bacteria | 577 |
| 431 | Ga0207695_10008678 | 3300025913 | Bacteria | 12683 |
| 432 | Ga0207695_10043567 | 3300025913 | Bacteria | 4782 |
| 433 | Ga0207695_10133941 | 3300025913 | Bacteria | 2433 |
| 434 | Ga0207695_10255866 | 3300025913 | Bacteria | 1650 |
| 435 | Ga0207695_10283252 | 3300025913 | Bacteria | 1551 |
| 436 | Ga0207695_10694948 | 3300025913 | Bacteria | 898 |
| 437 | Ga0207695_10855645 | 3300025913 | Bacteria | 789 |
| 438 | Ga0207695_10943799 | 3300025913 | Bacteria | 742 |
| 439 | Ga0207671_10024032 | 3300025914 | Bacteria | 4587 |
| 440 | Ga0207671_10028663 | 3300025914 | Bacteria | 4159 |
| 441 | Ga0207671_10083358 | 3300025914 | Bacteria | 2400 |
| 442 | Ga0207671_10327880 | 3300025914 | Bacteria | 1212 |
| 443 | Ga0207671_10933611 | 3300025914 | Bacteria | 685 |
| 444 | Ga0207693_10006335 | 3300025915 | Bacteria | 9811 |
| 445 | Ga0207693_10094152 | 3300025915 | Bacteria | 2348 |
| 446 | Ga0207693_10118589 | 3300025915 | Bacteria | 2078 |
| 447 | Ga0207693_10376181 | 3300025915 | Bacteria | 1111 |
| 448 | Ga0207693_11440118 | 3300025915 | Bacteria | 510 |
| 449 | Ga0207663_10304888 | 3300025916 | Bacteria | 1191 |
| 450 | Ga0207663_10507510 | 3300025916 | Bacteria | 937 |
| 451 | Ga0207663_10754160 | 3300025916 | Bacteria | 773 |
| 452 | Ga0207660_10014479 | 3300025917 | Bacteria | 5189 |
| 453 | Ga0207660_10034374 | 3300025917 | Bacteria | 3514 |
| 454 | Ga0207660_10070414 | 3300025917 | Bacteria | 2542 |
| 455 | Ga0207660_10192047 | 3300025917 | Bacteria | 1591 |
| 456 | Ga0207660_10259840 | 3300025917 | Bacteria | 1373 |
| 457 | Ga0207660_10269647 | 3300025917 | Bacteria | 1348 |
| 458 | Ga0207660_10895929 | 3300025917 | Bacteria | 724 |
| 459 | Ga0207660_10927320 | 3300025917 | Bacteria | 710 |
| 460 | Ga0207662_10098654 | 3300025918 | Bacteria | 1808 |
| 461 | Ga0207662_10105157 | 3300025918 | Bacteria | 1754 |
| 462 | Ga0207662_10238567 | 3300025918 | Bacteria | 1190 |
| 463 | Ga0207657_10010418 | 3300025919 | Bacteria | 9280 |
| 464 | Ga0207657_10015111 | 3300025919 | Bacteria | 7498 |
| 465 | Ga0207657_10051357 | 3300025919 | Bacteria | 3584 |
| 466 | Ga0207657_10111222 | 3300025919 | Bacteria | 2262 |
| 467 | Ga0207657_10254454 | 3300025919 | Bacteria | 1399 |
| 468 | Ga0207649_10141728 | 3300025920 | Bacteria | 1646 |
| 469 | Ga0207649_10235489 | 3300025920 | Bacteria | 1311 |
| 470 | Ga0207649_10285801 | 3300025920 | Bacteria | 1201 |
| 471 | Ga0207649_11405383 | 3300025920 | Bacteria | 552 |
| 472 | Ga0207652_10070098 | 3300025921 | Bacteria | 3044 |
| 473 | Ga0207652_10113322 | 3300025921 | Bacteria | 2407 |
| 474 | Ga0207652_10163555 | 3300025921 | Bacteria | 1995 |
| 475 | Ga0207652_10202579 | 3300025921 | Bacteria | 1786 |
| 476 | Ga0207652_10215686 | 3300025921 | Bacteria | 1729 |
| 477 | Ga0207652_10257614 | 3300025921 | Bacteria | 1574 |
| 478 | Ga0207652_10348509 | 3300025921 | Bacteria | 1336 |
| 479 | Ga0207652_10615620 | 3300025921 | Bacteria | 973 |
| 480 | Ga0207652_10657695 | 3300025921 | Bacteria | 937 |
| 481 | Ga0207681_10555456 | 3300025923 | Bacteria | 945 |
| 482 | Ga0207681_10657884 | 3300025923 | Bacteria | 869 |
| 483 | Ga0207694_10000131 | 3300025924 | Bacteria | 76343 |
| 484 | Ga0207694_10017080 | 3300025924 | Bacteria | 5482 |
| 485 | Ga0207694_10052393 | 3300025924 | Bacteria | 3163 |
| 486 | Ga0207694_10098451 | 3300025924 | Bacteria | 2315 |
| 487 | Ga0207694_10400964 | 3300025924 | Bacteria | 1140 |
| 488 | Ga0207694_10924153 | 3300025924 | Bacteria | 738 |
| 489 | Ga0207694_11158871 | 3300025924 | Bacteria | 654 |
| 490 | Ga0207694_11307657 | 3300025924 | Bacteria | 613 |
| 491 | Ga0207650_10667973 | 3300025925 | Bacteria | 877 |
| 492 | Ga0207650_10980541 | 3300025925 | Bacteria | 719 |
| 493 | Ga0207659_10058734 | 3300025926 | Bacteria | 2762 |
| 494 | Ga0207659_11457497 | 3300025926 | Bacteria | 586 |
| 495 | Ga0207687_10051484 | 3300025927 | Bacteria | 2871 |
| 496 | Ga0207687_10066068 | 3300025927 | Bacteria | 2570 |
| 497 | Ga0207687_10316214 | 3300025927 | Bacteria | 1262 |
| 498 | Ga0207687_10372198 | 3300025927 | Bacteria | 1168 |
| 499 | Ga0207687_11031157 | 3300025927 | Bacteria | 706 |
| 500 | Ga0207687_11059995 | 3300025927 | Bacteria | 696 |
| 501 | Ga0207700_10121454 | 3300025928 | Bacteria | 2119 |
| 502 | Ga0207700_10139885 | 3300025928 | Bacteria | 1988 |
| 503 | Ga0207700_10169673 | 3300025928 | Bacteria | 1819 |
| 504 | Ga0207700_10318937 | 3300025928 | Bacteria | 1346 |
| 505 | Ga0207700_10384962 | 3300025928 | Bacteria | 1227 |
| 506 | Ga0207700_11412255 | 3300025928 | Bacteria | 619 |
| 507 | Ga0207664_10013204 | 3300025929 | Bacteria | 5918 |
| 508 | Ga0207664_10188517 | 3300025929 | Bacteria | 1774 |
| 509 | Ga0207664_10349754 | 3300025929 | Bacteria | 1308 |
| 510 | Ga0207664_11023849 | 3300025929 | Bacteria | 740 |
| 511 | Ga0207664_11406503 | 3300025929 | Bacteria | 618 |
| 512 | Ga0207644_10607524 | 3300025931 | Bacteria | 908 |
| 513 | Ga0207644_11395869 | 3300025931 | Bacteria | 588 |
| 514 | Ga0207644_11445561 | 3300025931 | Bacteria | 577 |
| 515 | Ga0207690_10378930 | 3300025932 | Bacteria | 1124 |
| 516 | Ga0207690_10816458 | 3300025932 | Bacteria | 771 |
| 517 | Ga0207690_11699793 | 3300025932 | Bacteria | 527 |
| 518 | Ga0207706_10238535 | 3300025933 | Bacteria | 1590 |
| 519 | Ga0207706_10376236 | 3300025933 | Bacteria | 1233 |
| 520 | Ga0207686_10306875 | 3300025934 | Bacteria | 1181 |
| 521 | Ga0207686_10567364 | 3300025934 | Bacteria | 889 |
| 522 | Ga0207686_11181630 | 3300025934 | Bacteria | 626 |
| 523 | Ga0207686_11268417 | 3300025934 | Bacteria | 604 |
| 524 | Ga0207686_11308336 | 3300025934 | Bacteria | 595 |
| 525 | Ga0207709_10378051 | 3300025935 | Bacteria | 1077 |
| 526 | Ga0207709_10679275 | 3300025935 | Bacteria | 822 |
| 527 | Ga0207709_11705995 | 3300025935 | Bacteria | 524 |
| 528 | Ga0207670_10483325 | 3300025936 | Bacteria | 1003 |
| 529 | Ga0207670_10876273 | 3300025936 | Bacteria | 751 |
| 530 | Ga0207669_10590397 | 3300025937 | Bacteria | 901 |
| 531 | Ga0207704_10381179 | 3300025938 | Bacteria | 1107 |
| 532 | Ga0207704_11097340 | 3300025938 | Bacteria | 676 |
| 533 | Ga0207665_10093767 | 3300025939 | Bacteria | 2085 |
| 534 | Ga0207665_10156686 | 3300025939 | Bacteria | 1635 |
| 535 | Ga0207665_10538390 | 3300025939 | Bacteria | 906 |
| 536 | Ga0207665_11120148 | 3300025939 | Bacteria | 628 |
| 537 | Ga0207691_10109959 | 3300025940 | Bacteria | 2452 |
| 538 | Ga0207691_10338956 | 3300025940 | Bacteria | 1287 |
| 539 | Ga0207691_10378322 | 3300025940 | Bacteria | 1209 |
| 540 | Ga0207711_10566014 | 3300025941 | Bacteria | 1060 |
| 541 | Ga0207711_10646607 | 3300025941 | Bacteria | 986 |
| 542 | Ga0207711_11580752 | 3300025941 | Bacteria | 599 |
| 543 | Ga0207689_10283116 | 3300025942 | Bacteria | 1373 |
| 544 | Ga0207689_10356813 | 3300025942 | Bacteria | 1216 |
| 545 | Ga0207689_11097820 | 3300025942 | Bacteria | 671 |
| 546 | Ga0207661_10134171 | 3300025944 | Bacteria | 2125 |
| 547 | Ga0207661_10312338 | 3300025944 | Bacteria | 1411 |
| 548 | Ga0207661_10507115 | 3300025944 | Bacteria | 1102 |
| 549 | Ga0207661_11023139 | 3300025944 | Bacteria | 761 |
| 550 | Ga0207661_11445891 | 3300025944 | Bacteria | 630 |
| 551 | Ga0207679_10134482 | 3300025945 | Bacteria | 1989 |
| 552 | Ga0207679_10580051 | 3300025945 | Bacteria | 1009 |
| 553 | Ga0207679_10603655 | 3300025945 | Bacteria | 989 |
| 554 | Ga0207679_11118091 | 3300025945 | Bacteria | 723 |
| 555 | Ga0207679_11335824 | 3300025945 | Bacteria | 658 |
| 556 | Ga0207679_11601543 | 3300025945 | Bacteria | 597 |
| 557 | Ga0207667_10003395 | 3300025949 | Bacteria | 19649 |
| 558 | Ga0207667_10028084 | 3300025949 | Bacteria | 6113 |
| 559 | Ga0207667_10037024 | 3300025949 | Bacteria | 5220 |
| 560 | Ga0207667_10093645 | 3300025949 | Bacteria | 3102 |
| 561 | Ga0207667_10106551 | 3300025949 | Bacteria | 2891 |
| 562 | Ga0207667_10187762 | 3300025949 | Bacteria | 2121 |
| 563 | Ga0207667_10209148 | 3300025949 | Bacteria | 2000 |
| 564 | Ga0207667_10254703 | 3300025949 | Bacteria | 1796 |
| 565 | Ga0207667_10996978 | 3300025949 | Bacteria | 825 |
| 566 | Ga0207667_11731198 | 3300025949 | Bacteria | 591 |
| 567 | Ga0207667_11750772 | 3300025949 | Bacteria | 587 |
| 568 | Ga0207651_10197922 | 3300025960 | Bacteria | 1608 |
| 569 | Ga0207651_11003188 | 3300025960 | Bacteria | 746 |
| 570 | Ga0207651_11075585 | 3300025960 | Bacteria | 720 |
| 571 | Ga0207651_11854572 | 3300025960 | Bacteria | 542 |
| 572 | Ga0207712_10143112 | 3300025961 | Bacteria | 1838 |
| 573 | Ga0207712_11538804 | 3300025961 | Bacteria | 596 |
| 574 | Ga0207712_11794073 | 3300025961 | Bacteria | 550 |
| 575 | Ga0207668_10021038 | 3300025972 | Bacteria | 4155 |
| 576 | Ga0207668_10285380 | 3300025972 | Bacteria | 1355 |
| 577 | Ga0207668_10558029 | 3300025972 | Bacteria | 993 |
| 578 | Ga0207668_11653573 | 3300025972 | Bacteria | 578 |
| 579 | Ga0207640_10493870 | 3300025981 | Bacteria | 1018 |
| 580 | Ga0207640_11870078 | 3300025981 | Bacteria | 543 |
| 581 | Ga0207658_10261485 | 3300025986 | Bacteria | 1475 |
| 582 | Ga0207658_11995076 | 3300025986 | Bacteria | 528 |
| 583 | Ga0207677_10072204 | 3300026023 | Bacteria | 2439 |
| 584 | Ga0207677_10117535 | 3300026023 | Bacteria | 1993 |
| 585 | Ga0207677_10240025 | 3300026023 | Bacteria | 1465 |
| 586 | Ga0207703_10078418 | 3300026035 | Bacteria | 2744 |
| 587 | Ga0207703_10265177 | 3300026035 | Bacteria | 1554 |
| 588 | Ga0207703_10668424 | 3300026035 | Bacteria | 986 |
| 589 | Ga0207703_11213045 | 3300026035 | Bacteria | 725 |
| 590 | Ga0207639_10144693 | 3300026041 | Bacteria | 1984 |
| 591 | Ga0207639_10225659 | 3300026041 | Bacteria | 1620 |
| 592 | Ga0207639_10248114 | 3300026041 | Bacteria | 1551 |
| 593 | Ga0207639_10359443 | 3300026041 | Bacteria | 1303 |
| 594 | Ga0207639_10560095 | 3300026041 | Bacteria | 1050 |
| 595 | Ga0207639_10701292 | 3300026041 | Bacteria | 939 |
| 596 | Ga0207639_10932998 | 3300026041 | Bacteria | 812 |
| 597 | Ga0207639_11133279 | 3300026041 | Bacteria | 734 |
| 598 | Ga0207639_11156561 | 3300026041 | Bacteria | 726 |
| 599 | Ga0207639_11635626 | 3300026041 | Bacteria | 604 |
| 600 | Ga0207678_10072593 | 3300026067 | Bacteria | 2949 |
| 601 | Ga0207678_10297766 | 3300026067 | Bacteria | 1386 |
| 602 | Ga0207678_10367948 | 3300026067 | Bacteria | 1241 |
| 603 | Ga0207678_10375438 | 3300026067 | Bacteria | 1229 |
| 604 | Ga0207678_10834336 | 3300026067 | Bacteria | 814 |
| 605 | Ga0207678_11434023 | 3300026067 | Bacteria | 610 |
| 606 | Ga0207678_11890598 | 3300026067 | Bacteria | 521 |
| 607 | Ga0207678_11995560 | 3300026067 | Bacteria | 505 |
| 608 | Ga0207708_11378489 | 3300026075 | Bacteria | 618 |
| 609 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 610 | Ga0207702_10064501 | 3300026078 | Bacteria | 3135 |
| 611 | Ga0207702_10139358 | 3300026078 | Bacteria | 2193 |
| 612 | Ga0207702_10186112 | 3300026078 | Bacteria | 1915 |
| 613 | Ga0207702_10195381 | 3300026078 | Bacteria | 1872 |
| 614 | Ga0207702_10204982 | 3300026078 | Bacteria | 1830 |
| 615 | Ga0207702_10401780 | 3300026078 | Bacteria | 1321 |
| 616 | Ga0207702_10533570 | 3300026078 | Bacteria | 1146 |
| 617 | Ga0207641_10250063 | 3300026088 | Bacteria | 1655 |
| 618 | Ga0207641_10443238 | 3300026088 | Bacteria | 1254 |
| 619 | Ga0207641_11165306 | 3300026088 | Bacteria | 770 |
| 620 | Ga0207641_11697790 | 3300026088 | Bacteria | 633 |
| 621 | Ga0207648_10048974 | 3300026089 | Bacteria | 3699 |
| 622 | Ga0207648_10106063 | 3300026089 | Bacteria | 2465 |
| 623 | Ga0207648_10128591 | 3300026089 | Bacteria | 2229 |
| 624 | Ga0207676_10039245 | 3300026095 | Bacteria | 3621 |
| 625 | Ga0207676_10864448 | 3300026095 | Bacteria | 885 |
| 626 | Ga0207674_10006041 | 3300026116 | Bacteria | 14325 |
| 627 | Ga0207674_10402890 | 3300026116 | Bacteria | 1322 |
| 628 | Ga0207674_10775997 | 3300026116 | Bacteria | 925 |
| 629 | Ga0207674_10901603 | 3300026116 | Bacteria | 852 |
| 630 | Ga0207674_11007966 | 3300026116 | Bacteria | 802 |
| 631 | Ga0207674_11605451 | 3300026116 | Bacteria | 619 |
| 632 | Ga0207675_100353332 | 3300026118 | Bacteria | 1441 |
| 633 | Ga0207675_101597889 | 3300026118 | Bacteria | 672 |
| 634 | Ga0207683_10049694 | 3300026121 | Bacteria | 3672 |
| 635 | Ga0207683_10309642 | 3300026121 | Bacteria | 1445 |
| 636 | Ga0207683_10428023 | 3300026121 | Bacteria | 1219 |
| 637 | Ga0207683_10496604 | 3300026121 | Bacteria | 1127 |
| 638 | Ga0207683_10680796 | 3300026121 | Bacteria | 953 |
| 639 | Ga0207683_12066700 | 3300026121 | Bacteria | 518 |
| 640 | Ga0207683_12173990 | 3300026121 | Bacteria | 503 |
| 641 | Ga0207698_10068911 | 3300026142 | Bacteria | 2795 |
| 642 | Ga0207698_10118539 | 3300026142 | Bacteria | 2235 |
| 643 | Ga0207698_10335700 | 3300026142 | Bacteria | 1421 |
| 644 | Ga0207698_10504843 | 3300026142 | Bacteria | 1178 |
| 645 | Ga0207698_10782700 | 3300026142 | Bacteria | 955 |
| 646 | Ga0207698_10891043 | 3300026142 | Bacteria | 896 |
| 647 | Ga0207698_11827730 | 3300026142 | Bacteria | 623 |
| 648 | Ga0207698_12575972 | 3300026142 | Bacteria | 518 |
| 649 | Ga0209589_1000018 | 3300027357 | Bacteria | 192614 |
| 650 | Ga0209489_100026 | 3300027361 | Bacteria | 192614 |
| 651 | Ga0209700_100035 | 3300027363 | Bacteria | 192614 |
| 652 | Ga0209179_1003566 | 3300027512 | Bacteria | 2257 |
| 653 | Ga0209983_1061965 | 3300027665 | Bacteria | 827 |
| 654 | Ga0209971_1132274 | 3300027682 | Bacteria | 614 |
| 655 | Ga0209813_10389203 | 3300027866 | Bacteria | 559 |
| 656 | Ga0209974_10005374 | 3300027876 | Bacteria | 4511 |
| 657 | Ga0207428_10164099 | 3300027907 | Bacteria | 1685 |
| 658 | Ga0207428_10498267 | 3300027907 | Bacteria | 885 |
| 659 | Ga0207428_11285237 | 3300027907 | Bacteria | 507 |
| 660 | Ga0268266_10041491 | 3300028379 | Bacteria | 3926 |
| 661 | Ga0268266_10055561 | 3300028379 | Bacteria | 3404 |
| 662 | Ga0268266_10099751 | 3300028379 | Bacteria | 2557 |
| 663 | Ga0268266_10125162 | 3300028379 | Bacteria | 2292 |
| 664 | Ga0268266_10249765 | 3300028379 | Bacteria | 1640 |
| 665 | Ga0268265_10908779 | 3300028380 | Bacteria | 865 |
| 666 | Ga0268265_11363369 | 3300028380 | Bacteria | 710 |
| 667 | Ga0268265_11403393 | 3300028380 | Bacteria | 700 |
| 668 | Ga0268264_10185255 | 3300028381 | Bacteria | 1894 |
| 669 | Ga0268264_10208676 | 3300028381 | Bacteria | 1792 |
| 670 | Ga0268264_10354350 | 3300028381 | Bacteria | 1398 |
| 671 | Ga0268264_11372735 | 3300028381 | Bacteria | 717 |
| 672 | Ga0268264_11810928 | 3300028381 | Bacteria | 621 |
| 673 | Ga0265337_1004966 | 3300028556 | Bacteria | 5405 |
| 674 | Ga0265326_10002505 | 3300028558 | Bacteria | 6188 |
| 675 | Ga0265319_1024209 | 3300028563 | Bacteria | 2188 |
| 676 | Ga0265334_10009869 | 3300028573 | Bacteria | 4035 |
| 677 | Ga0265334_10031806 | 3300028573 | Bacteria | 2107 |
| 678 | Ga0265318_10032974 | 3300028577 | Bacteria | 2001 |
| 679 | Ga0265323_10000768 | 3300028653 | Bacteria | 17199 |
| 680 | Ga0265322_10063957 | 3300028654 | Bacteria | 1043 |
| 681 | Ga0265336_10000106 | 3300028666 | Bacteria | 63839 |
| 682 | Ga0307517_10000049 | 3300028786 | Bacteria | 160368 |
| 683 | Ga0307517_10278634 | 3300028786 | Bacteria | 955 |
| 684 | Ga0307515_10016148 | 3300028794 | Bacteria | 13692 |
| 685 | Ga0265338_10000065 | 3300028800 | Bacteria | 188966 |
| 686 | Ga0265338_10077416 | 3300028800 | Bacteria | 2811 |
| 687 | Ga0265338_10398738 | 3300028800 | Bacteria | 981 |
| 688 | Ga0307511_10333882 | 3300030521 | Bacteria | 662 |
| 689 | Ga0265330_10018889 | 3300031235 | Bacteria | 3163 |
| 690 | Ga0265330_10019298 | 3300031235 | Bacteria | 3126 |
| 691 | Ga0265330_10030431 | 3300031235 | Bacteria | 2423 |
| 692 | Ga0265330_10055416 | 3300031235 | Bacteria | 1731 |
| 693 | Ga0265330_10267661 | 3300031235 | Bacteria | 720 |
| 694 | Ga0265330_10290213 | 3300031235 | Bacteria | 689 |
| 695 | Ga0265332_10337870 | 3300031238 | Bacteria | 622 |
| 696 | Ga0265328_10194554 | 3300031239 | Bacteria | 769 |
| 697 | Ga0265328_10227067 | 3300031239 | Bacteria | 712 |
| 698 | Ga0265325_10034658 | 3300031241 | Bacteria | 2684 |
| 699 | Ga0265325_10038631 | 3300031241 | Bacteria | 2518 |
| 700 | Ga0265325_10069404 | 3300031241 | Bacteria | 1772 |
| 701 | Ga0265325_10108010 | 3300031241 | Bacteria | 1355 |
| 702 | Ga0265325_10231225 | 3300031241 | Bacteria | 843 |
| 703 | Ga0265325_10368395 | 3300031241 | Bacteria | 633 |
| 704 | Ga0265325_10373578 | 3300031241 | Bacteria | 627 |
| 705 | Ga0265340_10005873 | 3300031247 | Bacteria | 6790 |
| 706 | Ga0265340_10070286 | 3300031247 | Bacteria | 1660 |
| 707 | Ga0265340_10330983 | 3300031247 | Bacteria | 674 |
| 708 | Ga0265340_10438184 | 3300031247 | Bacteria | 576 |
| 709 | Ga0265339_10053590 | 3300031249 | Bacteria | 2194 |
| 710 | Ga0265339_10064485 | 3300031249 | Bacteria | 1965 |
| 711 | Ga0265339_10081687 | 3300031249 | Bacteria | 1707 |
| 712 | Ga0265339_10158596 | 3300031249 | Bacteria | 1140 |
| 713 | Ga0265331_10011078 | 3300031250 | Bacteria | 4947 |
| 714 | Ga0265331_10475833 | 3300031250 | Bacteria | 562 |
| 715 | Ga0265316_10429511 | 3300031344 | Bacteria | 949 |
| 716 | Ga0265316_10603379 | 3300031344 | Bacteria | 778 |
| 717 | Ga0265316_11210069 | 3300031344 | Bacteria | 522 |
| 718 | Ga0307513_10458312 | 3300031456 | Bacteria | 998 |
| 719 | Ga0307509_10731822 | 3300031507 | Bacteria | 655 |
| 720 | Ga0307408_101286607 | 3300031548 | Bacteria | 685 |
| 721 | Ga0307408_101323912 | 3300031548 | Bacteria | 676 |
| 722 | Ga0307408_102305909 | 3300031548 | Bacteria | 521 |
| 723 | Ga0265313_10035653 | 3300031595 | Bacteria | 2503 |
| 724 | Ga0265313_10204953 | 3300031595 | Bacteria | 819 |
| 725 | Ga0307508_10212244 | 3300031616 | Bacteria | 1536 |
| 726 | Ga0316575_10133268 | 3300031665 | Bacteria | 1020 |
| 727 | Ga0265314_10000279 | 3300031711 | Bacteria | 74300 |
| 728 | Ga0265314_10005600 | 3300031711 | Bacteria | 11288 |
| 729 | Ga0265314_10038487 | 3300031711 | Bacteria | 3454 |
| 730 | Ga0265314_10239446 | 3300031711 | Bacteria | 1048 |
| 731 | Ga0265342_10001581 | 3300031712 | Bacteria | 21006 |
| 732 | Ga0265342_10013091 | 3300031712 | Bacteria | 5582 |
| 733 | Ga0265342_10151435 | 3300031712 | Bacteria | 1288 |
| 734 | Ga0265342_10476347 | 3300031712 | Bacteria | 639 |
| 735 | Ga0307516_10051007 | 3300031730 | Bacteria | 4057 |
| 736 | Ga0307516_10538117 | 3300031730 | Bacteria | 822 |
| 737 | Ga0307405_10202195 | 3300031731 | Bacteria | 1444 |
| 738 | Ga0307406_10155118 | 3300031901 | Bacteria | 1639 |
| 739 | Ga0307409_100525607 | 3300031995 | Bacteria | 1157 |
| 740 | Ga0307416_100462769 | 3300032002 | Bacteria | 1324 |
| 741 | Ga0307416_100609237 | 3300032002 | Bacteria | 1173 |
| 742 | Ga0307411_12195026 | 3300032005 | Bacteria | 518 |
| 743 | Ga0307415_100533689 | 3300032126 | Bacteria | 1032 |
| 744 | Ga0307415_100911381 | 3300032126 | Bacteria | 811 |
| 745 | Ga0316583_10175831 | 3300032133 | Bacteria | 745 |
| 746 | Ga0307510_10337755 | 3300033180 | Bacteria | 959 |
| 747 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 748 | Ga0373930_0040959 | 3300034816 | Bacteria | 987 |
| 749 | Ga0373959_0110686 | 3300034820 | Bacteria | 663 |
| 750 | Ga0373934_0240648 | 3300035086 | Bacteria | 748 |
| 751 | Ga0373940_0350042 | 3300035088 | Bacteria | 518 |
| 752 | Ga0373923_0417610 | 3300035111 | Bacteria | 647 |
| 753 | Ga0373932_0404685 | 3300035112 | Bacteria | 528 |
| 754 | Ga0373936_0279229 | 3300035113 | Bacteria | 750 |
| 755 | Ga0373936_0631592 | 3300035113 | Bacteria | 504 |
| 756 | Ga0373939_0003718 | 3300035114 | Bacteria | 3593 |
| 757 | Ga0373939_0055838 | 3300035114 | Bacteria | 1241 |
| 758 | Ga0373941_0531161 | 3300035115 | Bacteria | 504 |
| 759 | Ga0373945_0105923 | 3300035116 | Bacteria | 1105 |
| 760 | Ga0373953_0124631 | 3300035117 | Bacteria | 1096 |
| 761 | Ga0373954_0011204 | 3300035118 | Bacteria | 3969 |
| 762 | Ga0373954_0130675 | 3300035118 | Bacteria | 1222 |
| 763 | Ga0373954_0180290 | 3300035118 | Bacteria | 1036 |
| 764 | Ga0373956_0409857 | 3300035119 | Bacteria | 647 |
| 765 | Ga0373956_0596608 | 3300035119 | Bacteria | 527 |
| 766 | Ga0373957_0016906 | 3300035120 | Bacteria | 2533 |
| 767 | Ga0373957_0092473 | 3300035120 | Bacteria | 1204 |
| 768 | Ga0373957_0132514 | 3300035120 | Bacteria | 1015 |
| 769 | Ga0373960_0360705 | 3300035121 | Bacteria | 553 |
| 770 | Ga0373943_0033778 | 3300035170 | Bacteria | 2439 |
| 771 | Ga0373943_0545490 | 3300035170 | Bacteria | 680 |
| 772 | Ga0373943_0893079 | 3300035170 | Bacteria | 531 |
| 773 | Ga0373946_0269737 | 3300035171 | Bacteria | 835 |
| 774 | Ga0373946_0379081 | 3300035171 | Bacteria | 711 |
| 775 | Ga0373955_0001156 | 3300035172 | Bacteria | 11200 |
| 776 | Ga0373942_0167962 | 3300035207 | Bacteria | 713 |
| 777 | Ga0373961_0014310 | 3300035241 | Bacteria | 2014 |
| 778 | Ga0373961_0192126 | 3300035241 | Bacteria | 716 |
| 779 | Ga0373962_0329989 | 3300035242 | Bacteria | 547 |
| 780 | Ga0373924_0337576 | 3300035410 | Bacteria | 671 |
| 781 | Ga0373924_0399201 | 3300035410 | Bacteria | 614 |
| 782 | Ga0373931_0036913 | 3300035691 | Bacteria | 2550 |
| 783 | Ga0373931_0038552 | 3300035691 | Bacteria | 2500 |
| 784 | Ga0373931_0313222 | 3300035691 | Bacteria | 972 |
| 785 | Ga0373931_1247317 | 3300035691 | Bacteria | 510 |
| 786 | Ga0373935_0116430 | 3300035692 | Bacteria | 1780 |
| 787 | Ga0373935_0294845 | 3300035692 | Bacteria | 1145 |
| 788 | Ga0373935_0380273 | 3300035692 | Bacteria | 1011 |
| 789 | Ga0373927_0030250 | 3300035695 | Bacteria | 3533 |
| 790 | Ga0373927_0835362 | 3300035695 | Bacteria | 608 |
| 791 | Ga0373933_0004332 | 3300035724 | Bacteria | 7794 |
| 792 | Ga0373933_0381208 | 3300035724 | Bacteria | 918 |
| 793 | Ga0373947_0083958 | 3300035725 | Bacteria | 1976 |
| 794 | Ga0373947_0294252 | 3300035725 | Bacteria | 1081 |
| 795 | Ga0373947_0363296 | 3300035725 | Bacteria | 973 |
| 796 | Ga0373947_0623017 | 3300035725 | Bacteria | 735 |
| 797 | Ga0373947_0640206 | 3300035725 | Bacteria | 725 |
| 798 | Ga0373947_0658093 | 3300035725 | Bacteria | 714 |
| 799 | Ga0373937_0002645 | 3300036401 | Bacteria | 14924 |
| 800 | Ga0373937_0009243 | 3300036401 | Bacteria | 8556 |
| 801 | Ga0373937_0081830 | 3300036401 | Bacteria | 2987 |
| 802 | Ga0373937_0195039 | 3300036401 | Bacteria | 1903 |
| 803 | Ga0373925_0071117 | 3300037068 | Bacteria | 2631 |
| 804 | Ga0373925_0173466 | 3300037068 | Bacteria | 1703 |
| 805 | Ga0373925_0209046 | 3300037068 | Bacteria | 1554 |
| 806 | Ga0373925_0269099 | 3300037068 | Bacteria | 1370 |
| 807 | Ga0373925_0393766 | 3300037068 | Bacteria | 1129 |
| 808 | Ga0373925_1524620 | 3300037068 | Bacteria | 547 |
| 809 | Ga0395899_0016160 | 3300037312 | Bacteria | 5689 |
| 810 | Ga0395899_0672063 | 3300037312 | Bacteria | 652 |
| 811 | Ga0395900_0011017 | 3300037418 | Bacteria | 9242 |
| 812 | Ga0395900_0035233 | 3300037418 | Bacteria | 5155 |
| 813 | Ga0395900_0167515 | 3300037418 | Bacteria | 2238 |
| 814 | Ga0395898_0065883 | 3300037466 | Bacteria | 3511 |
| 815 | Ga0395898_0630433 | 3300037466 | Bacteria | 1014 |
| 816 | Ga0395905_0366851 | 3300037471 | Bacteria | 1333 |
| 817 | Ga0436364_0073049 | 3300037853 | Bacteria | 812 |
| 818 | Ga0436364_0292514 | 3300037853 | Bacteria | 2382 |
| 819 | Ga0436364_0328516 | 3300037853 | Bacteria | 1705 |
| 820 | Ga0436364_1059106 | 3300037853 | Bacteria | 1252 |
| 821 | Ga0395901_0069511 | 3300038443 | Bacteria | 3667 |
| 822 | Ga0395901_0968506 | 3300038443 | Bacteria | 828 |
| 823 | Ga0395901_1275916 | 3300038443 | Bacteria | 697 |
| 824 | Ga0395901_1561870 | 3300038443 | Bacteria | 614 |
| 825 | Ga0436365_0100274 | 3300039437 | Bacteria | 1920 |
| 826 | Ga0436365_0240210 | 3300039437 | Bacteria | 20191 |
| 827 | Ga0436365_0319787 | 3300039437 | Bacteria | 1353 |
| 828 | Ga0436365_0769093 | 3300039437 | Bacteria | 1364 |
| 829 | Ga0436365_1322638 | 3300039437 | Bacteria | 1229 |
| 830 | Ga0436365_1378525 | 3300039437 | Bacteria | 663 |
| 831 | Ga0436365_1580673 | 3300039437 | Bacteria | 615 |
| 832 | Ga0436365_1749134 | 3300039437 | Bacteria | 573 |
| 833 | Ga0436365_1884131 | 3300039437 | Bacteria | 813 |
| 834 | Ga0436360_0102150 | 3300039438 | Bacteria | 944 |
| 835 | Ga0436360_1140528 | 3300039438 | Bacteria | 709 |
| 836 | Ga0436361_0236411 | 3300039447 | Bacteria | 836 |
| 837 | Ga0436361_0777969 | 3300039447 | Bacteria | 1088 |
| 838 | Ga0436363_0425847 | 3300039450 | Bacteria | 558 |
| 839 | Ga0436363_0762675 | 3300039450 | Bacteria | 907 |
| 840 | Ga0436363_0928586 | 3300039450 | Bacteria | 881 |
| 841 | Ga0436362_0248055 | 3300039453 | Bacteria | 522 |
| 842 | Ga0436362_0344107 | 3300039453 | Bacteria | 3399 |
| 843 | Ga0436362_1029622 | 3300039453 | Bacteria | 834 |
| 844 | Ga0439465_0188535 | 3300041413 | Bacteria | 748 |
| 845 | Ga0451791_0376676 | 3300041451 | Bacteria | 851 |
| 846 | Ga0451798_0632243 | 3300041458 | Bacteria | 748 |
| 847 | Ga0451804_0738228 | 3300041463 | Bacteria | 619 |
| 848 | Ga0451807_0427715 | 3300041486 | Bacteria | 595 |
| 849 | Ga0451833_0003391 | 3300041491 | Bacteria | 651 |
| 850 | Ga0451833_1307367 | 3300041491 | Bacteria | 529 |
| 851 | Ga0451839_1205220 | 3300041496 | Bacteria | 767 |
| 852 | Ga0439448_0111400 | 3300042005 | Bacteria | 935 |
| 853 | Ga0439459_0048924 | 3300042438 | Bacteria | 922 |
| 854 | Ga0439459_0096259 | 3300042438 | Bacteria | 718 |
| 855 | Ga0466961_0613003 | 3300044693 | Bacteria | 654 |
| 856 | Ga0466963_0053946 | 3300044694 | Bacteria | 2670 |
| 857 | Ga0466963_0403348 | 3300044694 | Bacteria | 964 |
| 858 | Ga0466963_1317424 | 3300044694 | Bacteria | 507 |
| 859 | Ga0466964_0195905 | 3300044706 | Bacteria | 967 |
| 860 | Ga0466964_0290216 | 3300044706 | Bacteria | 821 |
| 861 | Ga0466957_0664820 | 3300044842 | Bacteria | 733 |
| 862 | Ga0466957_0842140 | 3300044842 | Bacteria | 653 |
| 863 | Ga0466967_0050075 | 3300045976 | Bacteria | 3656 |
| 864 | Ga0466967_0176195 | 3300045976 | Bacteria | 2014 |
| 865 | Ga0466967_0228217 | 3300045976 | Bacteria | 1772 |
| 866 | Ga0466967_0469931 | 3300045976 | Bacteria | 1231 |
| 867 | Ga0466967_0534720 | 3300045976 | Bacteria | 1153 |
| 868 | Ga0466967_0689569 | 3300045976 | Bacteria | 1011 |
| 869 | Ga0495592_0153061 | 3300046454 | Bacteria | 1593 |
| 870 | Ga0495592_0216009 | 3300046454 | Bacteria | 1285 |
| 871 | Ga0495592_0513563 | 3300046454 | Bacteria | 742 |
| 872 | Ga0495592_0580358 | 3300046454 | Bacteria | 686 |
| 873 | Ga0495592_0713168 | 3300046454 | Bacteria | 602 |
| 874 | Ga0495603_0138183 | 3300046455 | Bacteria | 1418 |
| 875 | Ga0495603_0179594 | 3300046455 | Bacteria | 1225 |
| 876 | Ga0495603_0644533 | 3300046455 | Bacteria | 606 |
| 877 | Ga0495590_0258848 | 3300046457 | Bacteria | 649 |
| 878 | Ga0495629_0587474 | 3300046459 | Bacteria | 746 |
| 879 | Ga0495629_1107088 | 3300046459 | Bacteria | 512 |
| 880 | Ga0495638_0183183 | 3300046460 | Bacteria | 1193 |
| 881 | Ga0495638_0241576 | 3300046460 | Bacteria | 1000 |
| 882 | Ga0495651_0222603 | 3300046462 | Bacteria | 1305 |
| 883 | Ga0495651_0371690 | 3300046462 | Bacteria | 940 |
| 884 | Ga0495651_0493885 | 3300046462 | Bacteria | 784 |
| 885 | Ga0495651_0666716 | 3300046462 | Bacteria | 651 |
| 886 | Ga0495653_0083390 | 3300046463 | Bacteria | 2357 |
| 887 | Ga0495653_0391244 | 3300046463 | Bacteria | 886 |
| 888 | Ga0495580_0344039 | 3300046472 | Bacteria | 1011 |
| 889 | Ga0495580_0427950 | 3300046472 | Bacteria | 890 |
| 890 | Ga0495582_0087759 | 3300046473 | Bacteria | 1732 |
| 891 | Ga0495639_0075941 | 3300046475 | Bacteria | 1558 |
| 892 | Ga0495662_0070764 | 3300046476 | Bacteria | 1690 |
| 893 | Ga0495662_0543184 | 3300046476 | Bacteria | 569 |
| 894 | Ga0495664_0155701 | 3300046477 | Bacteria | 1386 |
| 895 | Ga0495664_0163895 | 3300046477 | Bacteria | 1349 |
| 896 | Ga0495664_0451667 | 3300046477 | Bacteria | 770 |
| 897 | Ga0495584_0049523 | 3300046491 | Bacteria | 2117 |
| 898 | Ga0495585_0027259 | 3300046492 | Bacteria | 3260 |
| 899 | Ga0495585_0069838 | 3300046492 | Bacteria | 1917 |
| 900 | Ga0495585_0241639 | 3300046492 | Bacteria | 904 |
| 901 | Ga0495594_0210874 | 3300046499 | Bacteria | 1107 |
| 902 | Ga0495607_0089064 | 3300046501 | Bacteria | 1676 |
| 903 | Ga0495583_0232497 | 3300046506 | Bacteria | 743 |
| 904 | Ga0495608_0376056 | 3300046511 | Bacteria | 871 |
| 905 | Ga0495608_0472963 | 3300046511 | Bacteria | 761 |
| 906 | Ga0495608_0671573 | 3300046511 | Bacteria | 618 |
| 907 | Ga0495610_0140653 | 3300046512 | Bacteria | 1039 |
| 908 | Ga0495610_0392143 | 3300046512 | Bacteria | 514 |
| 909 | Ga0495616_0275474 | 3300046513 | Bacteria | 716 |
| 910 | Ga0495616_0469300 | 3300046513 | Bacteria | 507 |
| 911 | Ga0495618_0143385 | 3300046514 | Bacteria | 1528 |
| 912 | Ga0495618_0175314 | 3300046514 | Bacteria | 1363 |
| 913 | Ga0495628_0186603 | 3300046516 | Bacteria | 1567 |
| 914 | Ga0495628_0719569 | 3300046516 | Bacteria | 704 |
| 915 | Ga0495630_0048011 | 3300046517 | Bacteria | 3194 |
| 916 | Ga0495630_0133090 | 3300046517 | Bacteria | 1889 |
| 917 | Ga0495630_0299001 | 3300046517 | Bacteria | 1230 |
| 918 | Ga0495630_0335599 | 3300046517 | Bacteria | 1156 |
| 919 | Ga0495630_0652592 | 3300046517 | Bacteria | 806 |
| 920 | Ga0495630_1271631 | 3300046517 | Bacteria | 555 |
| 921 | Ga0495631_0189854 | 3300046518 | Bacteria | 880 |
| 922 | Ga0495632_0304676 | 3300046519 | Bacteria | 706 |
| 923 | Ga0495643_0265263 | 3300046522 | Bacteria | 796 |
| 924 | Ga0495643_0289963 | 3300046522 | Bacteria | 749 |
| 925 | Ga0495644_0133874 | 3300046523 | Bacteria | 945 |
| 926 | Ga0495663_0068414 | 3300046525 | Bacteria | 1128 |
| 927 | Ga0495663_0159269 | 3300046525 | Bacteria | 774 |
| 928 | Ga0495642_0299187 | 3300046528 | Bacteria | 705 |
| 929 | Ga0495642_0454582 | 3300046528 | Bacteria | 566 |
| 930 | Ga0495652_0045076 | 3300046529 | Bacteria | 3795 |
| 931 | Ga0495652_0189843 | 3300046529 | Bacteria | 1569 |
| 932 | Ga0495665_0245770 | 3300046531 | Bacteria | 922 |
| 933 | Ga0495640_0780270 | 3300046533 | Bacteria | 570 |
| 934 | Ga0495586_0790312 | 3300046535 | Bacteria | 547 |
| 935 | Ga0495598_0010889 | 3300046537 | Bacteria | 2190 |
| 936 | Ga0495609_0227648 | 3300046538 | Bacteria | 773 |
| 937 | Ga0495609_0282149 | 3300046538 | Bacteria | 679 |
| 938 | Ga0495609_0285029 | 3300046538 | Bacteria | 675 |
| 939 | Ga0495621_0029547 | 3300046539 | Bacteria | 1869 |
| 940 | Ga0495645_0141873 | 3300046543 | Bacteria | 1675 |
| 941 | Ga0495645_0285748 | 3300046543 | Bacteria | 1083 |
| 942 | Ga0495633_0061493 | 3300046558 | Bacteria | 1758 |
| 943 | Ga0495633_0203873 | 3300046558 | Bacteria | 907 |
| 944 | Ga0495667_0099573 | 3300046559 | Bacteria | 1881 |
| 945 | Ga0495667_0220702 | 3300046559 | Bacteria | 1210 |
| 946 | Ga0495656_0021230 | 3300046615 | Bacteria | 2526 |
| 947 | Ga0495656_0053723 | 3300046615 | Bacteria | 1731 |
| 948 | Ga0495634_0075249 | 3300046642 | Bacteria | 2218 |
| 949 | Ga0495634_0518249 | 3300046642 | Bacteria | 698 |
| 950 | Ga0495634_0820268 | 3300046642 | Bacteria | 530 |
| 951 | Ga0495611_0351367 | 3300046648 | Bacteria | 676 |
| 952 | Ga0495625_0515479 | 3300046660 | Bacteria | 729 |
| 953 | Ga0495635_0225530 | 3300046663 | Bacteria | 1267 |
| 954 | Ga0495635_0433090 | 3300046663 | Bacteria | 871 |
| 955 | Ga0495659_0007740 | 3300046664 | Bacteria | 3408 |
| 956 | Ga0495659_0020845 | 3300046664 | Bacteria | 2205 |
| 957 | Ga0495659_0076988 | 3300046664 | Bacteria | 1259 |
| 958 | Ga0495588_0004075 | 3300046674 | Bacteria | 6432 |
| 959 | Ga0495588_0145430 | 3300046674 | Bacteria | 1253 |
| 960 | Ga0495657_0330645 | 3300046675 | Bacteria | 904 |
| 961 | Ga0495623_0170314 | 3300046679 | Bacteria | 1273 |
| 962 | Ga0495623_0412606 | 3300046679 | Bacteria | 725 |
| 963 | Ga0495623_0539276 | 3300046679 | Bacteria | 612 |
| 964 | Ga0495646_0556401 | 3300046680 | Bacteria | 585 |
| 965 | Ga0495646_0596124 | 3300046680 | Bacteria | 561 |
| 966 | Ga0495647_0369891 | 3300046681 | Bacteria | 655 |
| 967 | Ga0495658_0050898 | 3300046683 | Bacteria | 2345 |
| 968 | Ga0495658_0151800 | 3300046683 | Bacteria | 1423 |
| 969 | Ga0495669_0272223 | 3300046684 | Bacteria | 814 |
| 970 | Ga0495669_0653146 | 3300046684 | Bacteria | 511 |
| 971 | Ga0495613_0425698 | 3300046689 | Bacteria | 903 |
| 972 | Ga0495613_1069084 | 3300046689 | Bacteria | 516 |
| 973 | Ga0495624_0228367 | 3300046690 | Bacteria | 1128 |
| 974 | Ga0495624_0283586 | 3300046690 | Bacteria | 1000 |
| 975 | Ga0495670_0061360 | 3300046691 | Bacteria | 1890 |
| 976 | Ga0495670_0347768 | 3300046691 | Bacteria | 798 |
| 977 | Ga0495670_0705509 | 3300046691 | Bacteria | 550 |
| 978 | Ga0495589_0320157 | 3300046794 | Bacteria | 717 |
| 979 | Ga0495600_0026554 | 3300046809 | Bacteria | 3738 |
| 980 | Ga0495600_0036563 | 3300046809 | Bacteria | 3192 |
| 981 | Ga0495600_0131182 | 3300046809 | Bacteria | 1629 |
| 982 | Ga0495600_0489647 | 3300046809 | Bacteria | 757 |
| 983 | Ga0495581_0166707 | 3300047315 | Bacteria | 1288 |
| 984 | Ga0495581_0451895 | 3300047315 | Bacteria | 748 |
| 985 | Ga0495604_0044602 | 3300047317 | Bacteria | 3463 |
| 986 | Ga0495604_0404266 | 3300047317 | Bacteria | 899 |
| 987 | Ga0495636_0662386 | 3300047318 | Bacteria | 513 |
| 988 | Ga0495674_0069187 | 3300047319 | Bacteria | 3053 |
| 989 | Ga0495674_0074745 | 3300047319 | Bacteria | 2917 |
| 990 | Ga0495672_0411430 | 3300047320 | Bacteria | 617 |
| 991 | Ga0495672_0558339 | 3300047320 | Bacteria | 501 |
| 992 | Ga0495676_0108457 | 3300047321 | Bacteria | 2042 |
| 993 | Ga0495676_0467814 | 3300047321 | Bacteria | 830 |
| 994 | Ga0495680_0055741 | 3300047322 | Bacteria | 3064 |
| 995 | Ga0495680_0266840 | 3300047322 | Bacteria | 1209 |
| 996 | Ga0495680_1085824 | 3300047322 | Bacteria | 506 |
| 997 | Ga0495683_0237225 | 3300047323 | Bacteria | 806 |
| 998 | Ga0495675_0654886 | 3300047444 | Bacteria | 591 |
| 999 | Ga0495677_0134655 | 3300047445 | Bacteria | 947 |
| 1000 | Ga0495685_041479 | 3300047447 | Bacteria | 1573 |
| 1001 | Ga0495673_0019962 | 3300047469 | Bacteria | 3347 |
| 1002 | Ga0495673_0362873 | 3300047469 | Bacteria | 509 |
| 1003 | Ga0495684_0460164 | 3300047471 | Bacteria | 882 |
| 1004 | Ga0495686_0061480 | 3300047472 | Bacteria | 2332 |
| 1005 | Ga0495686_0200816 | 3300047472 | Bacteria | 1144 |
| 1006 | Ga0495593_0108357 | 3300047673 | Bacteria | 1420 |
| 1007 | Ga0495593_0275611 | 3300047673 | Bacteria | 842 |
| 1008 | Ga0495602_0130662 | 3300048088 | Bacteria | 2004 |
| 1009 | Ga0495602_0519251 | 3300048088 | Bacteria | 830 |
| 1010 | Ga0495615_0060334 | 3300048090 | Bacteria | 999 |
| 1011 | Ga0495615_0134522 | 3300048090 | Bacteria | 725 |
| 1012 | Ga0496100_0190606 | 3300048903 | Bacteria | 1488 |
| 1013 | Ga0496100_0352606 | 3300048903 | Bacteria | 1112 |
| 1014 | Ga0496100_0549709 | 3300048903 | Bacteria | 893 |
| 1015 | Ga0496100_1373750 | 3300048903 | Bacteria | 557 |
| 1016 | Ga0496100_1565766 | 3300048903 | Bacteria | 521 |
| 1017 | Ga0496101_0036355 | 3300048904 | Bacteria | 3488 |
| 1018 | Ga0496101_0081293 | 3300048904 | Bacteria | 2396 |
| 1019 | Ga0496102_0002717 | 3300048905 | Bacteria | 15055 |
| 1020 | Ga0496102_0160243 | 3300048905 | Bacteria | 2116 |
| 1021 | Ga0496102_0335270 | 3300048905 | Bacteria | 1424 |
| 1022 | Ga0496102_0617869 | 3300048905 | Bacteria | 1007 |
| 1023 | Ga0496102_0618200 | 3300048905 | Bacteria | 1006 |
| 1024 | Ga0496103_0056811 | 3300048906 | Bacteria | 2430 |
| 1025 | Ga0496103_0071931 | 3300048906 | Bacteria | 2165 |
| 1026 | Ga0496104_0002941 | 3300048907 | Bacteria | 14675 |
| 1027 | Ga0496104_0029175 | 3300048907 | Bacteria | 5117 |
| 1028 | Ga0496104_0075863 | 3300048907 | Bacteria | 3201 |
| 1029 | Ga0496104_0454515 | 3300048907 | Bacteria | 1192 |
| 1030 | Ga0496104_0459207 | 3300048907 | Bacteria | 1185 |
| 1031 | Ga0496104_0942522 | 3300048907 | Bacteria | 768 |
| 1032 | Ga0496105_0005733 | 3300048908 | Bacteria | 9457 |
| 1033 | Ga0496105_0017928 | 3300048908 | Bacteria | 5682 |
| 1034 | Ga0496105_0074254 | 3300048908 | Bacteria | 2809 |
| 1035 | Ga0496105_0294135 | 3300048908 | Bacteria | 1307 |
| 1036 | Ga0496105_0313483 | 3300048908 | Bacteria | 1259 |
| 1037 | Ga0496106_0014967 | 3300048909 | Bacteria | 5739 |
| 1038 | Ga0496106_0016026 | 3300048909 | Bacteria | 5542 |
| 1039 | Ga0496106_0084769 | 3300048909 | Bacteria | 2438 |
| 1040 | Ga0496106_0297696 | 3300048909 | Bacteria | 1293 |
| 1041 | Ga0496106_0383888 | 3300048909 | Bacteria | 1129 |
| 1042 | Ga0496107_0001922 | 3300048910 | Bacteria | 13186 |
| 1043 | Ga0496107_0348539 | 3300048910 | Bacteria | 1102 |
| 1044 | Ga0496107_0455858 | 3300048910 | Bacteria | 950 |
| 1045 | Ga0496108_0030372 | 3300048911 | Bacteria | 4478 |
| 1046 | Ga0496108_0056465 | 3300048911 | Bacteria | 3299 |
| 1047 | Ga0496108_0620605 | 3300048911 | Bacteria | 941 |
| 1048 | Ga0496108_0771812 | 3300048911 | Bacteria | 830 |
| 1049 | Ga0496108_0932025 | 3300048911 | Bacteria | 744 |
| 1050 | Ga0496108_1541789 | 3300048911 | Bacteria | 552 |
| 1051 | Ga0496109_0009086 | 3300048912 | Bacteria | 8461 |
| 1052 | Ga0496109_0090304 | 3300048912 | Bacteria | 2833 |
| 1053 | Ga0496109_0123380 | 3300048912 | Bacteria | 2414 |
| 1054 | Ga0496109_0341369 | 3300048912 | Bacteria | 1414 |
| 1055 | Ga0496109_0486359 | 3300048912 | Bacteria | 1165 |
| 1056 | Ga0496109_1823163 | 3300048912 | Bacteria | 541 |
| 1057 | Ga0496110_0038281 | 3300048913 | Bacteria | 4172 |
| 1058 | Ga0496110_0113484 | 3300048913 | Bacteria | 2437 |
| 1059 | Ga0496110_0200625 | 3300048913 | Bacteria | 1812 |
| 1060 | Ga0496110_0238575 | 3300048913 | Bacteria | 1654 |
| 1061 | Ga0496110_0813146 | 3300048913 | Bacteria | 839 |
| 1062 | Ga0496110_1078655 | 3300048913 | Bacteria | 711 |
| 1063 | Ga0496111_0097742 | 3300048914 | Bacteria | 2155 |
| 1064 | Ga0496111_0177095 | 3300048914 | Bacteria | 1585 |
| 1065 | Ga0496111_0199569 | 3300048914 | Bacteria | 1487 |
| 1066 | Ga0496112_0002573 | 3300048915 | Bacteria | 14654 |
| 1067 | Ga0496112_0007029 | 3300048915 | Bacteria | 9942 |
| 1068 | Ga0496112_0125937 | 3300048915 | Bacteria | 2533 |
| 1069 | Ga0496112_0261604 | 3300048915 | Bacteria | 1679 |
| 1070 | Ga0496112_0449154 | 3300048915 | Bacteria | 1227 |
| 1071 | Ga0496112_0527468 | 3300048915 | Bacteria | 1115 |
| 1072 | Ga0496112_1017784 | 3300048915 | Bacteria | 748 |
| 1073 | Ga0496112_1375693 | 3300048915 | Bacteria | 621 |
| 1074 | Ga0496113_0013099 | 3300048916 | Bacteria | 5601 |
| 1075 | Ga0496113_0031098 | 3300048916 | Bacteria | 3871 |
| 1076 | Ga0496113_0382057 | 3300048916 | Bacteria | 1130 |
| 1077 | Ga0496114_0002764 | 3300048917 | Bacteria | 13432 |
| 1078 | Ga0496114_0014426 | 3300048917 | Bacteria | 6344 |
| 1079 | Ga0496114_0393571 | 3300048917 | Bacteria | 1227 |
| 1080 | Ga0496114_0810483 | 3300048917 | Bacteria | 815 |
| 1081 | Ga0496115_0002584 | 3300048918 | Bacteria | 12996 |
| 1082 | Ga0496115_0179761 | 3300048918 | Bacteria | 1749 |
| 1083 | Ga0496115_0207303 | 3300048918 | Bacteria | 1619 |
| 1084 | Ga0496115_0789722 | 3300048918 | Bacteria | 740 |
| 1085 | Ga0496116_0412377 | 3300048919 | Bacteria | 593 |
| 1086 | Ga0496117_0014771 | 3300048920 | Bacteria | 6702 |
| 1087 | Ga0496117_0553394 | 3300048920 | Bacteria | 547 |
| 1088 | Ga0496118_0280439 | 3300048921 | Bacteria | 928 |
| 1089 | Ga0496122_0058323 | 3300048925 | Bacteria | 2859 |
| 1090 | Ga0496122_0067307 | 3300048925 | Bacteria | 2581 |
| 1091 | Ga0496122_0284740 | 3300048925 | Bacteria | 901 |
| 1092 | Ga0496123_0051308 | 3300048926 | Bacteria | 2748 |
| 1093 | Ga0496123_0499237 | 3300048926 | Bacteria | 532 |
| 1094 | Ga0496124_0043751 | 3300048927 | Bacteria | 3847 |
| 1095 | Ga0496124_0129566 | 3300048927 | Bacteria | 2006 |
| 1096 | Ga0496124_0537831 | 3300048927 | Bacteria | 774 |
| 1097 | Ga0496125_0157834 | 3300048928 | Bacteria | 1546 |
| 1098 | Ga0496125_0420089 | 3300048928 | Bacteria | 775 |
| 1099 | Ga0496126_0033861 | 3300048929 | Bacteria | 4805 |
| 1100 | Ga0496126_0054724 | 3300048929 | Bacteria | 3612 |
| 1101 | Ga0496126_0082115 | 3300048929 | Bacteria | 2848 |
| 1102 | Ga0496126_0118549 | 3300048929 | Bacteria | 2298 |
| 1103 | Ga0496126_0180895 | 3300048929 | Bacteria | 1791 |
| 1104 | Ga0496126_0426376 | 3300048929 | Bacteria | 1071 |
| 1105 | Ga0501031_0007305 | 3300049568 | Bacteria | 7207 |
| 1106 | Ga0501031_0026899 | 3300049568 | Bacteria | 3749 |
| 1107 | Ga0501031_0032706 | 3300049568 | Bacteria | 3391 |
| 1108 | Ga0501031_0303793 | 3300049568 | Bacteria | 1034 |
| 1109 | Ga0501031_0407277 | 3300049568 | Bacteria | 879 |
| 1110 | Ga0501032_0003464 | 3300049569 | Bacteria | 12086 |
| 1111 | Ga0501032_0027450 | 3300049569 | Bacteria | 3912 |
| 1112 | Ga0501032_0041713 | 3300049569 | Bacteria | 3115 |
| 1113 | Ga0501032_0160672 | 3300049569 | Bacteria | 1475 |
| 1114 | Ga0501032_0165828 | 3300049569 | Bacteria | 1449 |
| 1115 | Ga0501032_0343154 | 3300049569 | Bacteria | 962 |
| 1116 | Ga0501033_0000523 | 3300049570 | Bacteria | 35975 |
| 1117 | Ga0501033_0025990 | 3300049570 | Bacteria | 4406 |
| 1118 | Ga0501033_0031583 | 3300049570 | Bacteria | 3978 |
| 1119 | Ga0501033_0582565 | 3300049570 | Bacteria | 768 |
| 1120 | Ga0501033_0951721 | 3300049570 | Bacteria | 575 |
| 1121 | Ga0501033_1182470 | 3300049570 | Bacteria | 507 |
| 1122 | Ga0501034_0000244 | 3300049571 | Bacteria | 100222 |
| 1123 | Ga0501034_0001899 | 3300049571 | Bacteria | 26478 |
| 1124 | Ga0501034_0025626 | 3300049571 | Bacteria | 6005 |
| 1125 | Ga0501034_0043426 | 3300049571 | Bacteria | 4550 |
| 1126 | Ga0501034_0052541 | 3300049571 | Bacteria | 4104 |
| 1127 | Ga0501034_0064860 | 3300049571 | Bacteria | 3665 |
| 1128 | Ga0501034_0085570 | 3300049571 | Bacteria | 3154 |
| 1129 | Ga0501034_0091553 | 3300049571 | Bacteria | 3038 |
| 1130 | Ga0501034_0102308 | 3300049571 | Bacteria | 2858 |
| 1131 | Ga0501034_0173224 | 3300049571 | Bacteria | 2124 |
| 1132 | Ga0501034_0366143 | 3300049571 | Bacteria | 1368 |
| 1133 | Ga0501034_0371724 | 3300049571 | Bacteria | 1355 |
| 1134 | Ga0501034_0426375 | 3300049571 | Bacteria | 1247 |
| 1135 | Ga0501034_0833469 | 3300049571 | Bacteria | 813 |
| 1136 | Ga0501034_1295284 | 3300049571 | Bacteria | 605 |
| 1137 | Ga0501034_1631875 | 3300049571 | Bacteria | 518 |
| 1138 | Ga0501036_0001110 | 3300049572 | Bacteria | 20451 |
| 1139 | Ga0501036_0033599 | 3300049572 | Bacteria | 4337 |
| 1140 | Ga0501036_0051128 | 3300049572 | Bacteria | 3499 |
| 1141 | Ga0501036_0055614 | 3300049572 | Bacteria | 3352 |
| 1142 | Ga0501036_0063933 | 3300049572 | Bacteria | 3115 |
| 1143 | Ga0501036_0154923 | 3300049572 | Bacteria | 1932 |
| 1144 | Ga0501036_0424537 | 3300049572 | Bacteria | 1108 |
| 1145 | Ga0501036_1282126 | 3300049572 | Bacteria | 596 |
| 1146 | Ga0501037_0015888 | 3300049573 | Bacteria | 5542 |
| 1147 | Ga0501037_0016521 | 3300049573 | Bacteria | 5432 |
| 1148 | Ga0501037_0022009 | 3300049573 | Bacteria | 4719 |
| 1149 | Ga0501037_0023191 | 3300049573 | Bacteria | 4589 |
| 1150 | Ga0501037_0035338 | 3300049573 | Bacteria | 3685 |
| 1151 | Ga0501037_0262861 | 3300049573 | Bacteria | 1205 |
| 1152 | Ga0501037_1076075 | 3300049573 | Bacteria | 521 |
| 1153 | Ga0501038_0008819 | 3300049574 | Bacteria | 9250 |
| 1154 | Ga0501038_0022305 | 3300049574 | Bacteria | 5675 |
| 1155 | Ga0501038_0044703 | 3300049574 | Bacteria | 3846 |
| 1156 | Ga0501038_0054012 | 3300049574 | Bacteria | 3455 |
| 1157 | Ga0501038_0471250 | 3300049574 | Bacteria | 963 |
| 1158 | Ga0501038_0612683 | 3300049574 | Bacteria | 823 |
| 1159 | Ga0501039_0021072 | 3300049575 | Bacteria | 4999 |
| 1160 | Ga0501039_0031296 | 3300049575 | Bacteria | 4101 |
| 1161 | Ga0501039_0068215 | 3300049575 | Bacteria | 2761 |
| 1162 | Ga0501039_0185825 | 3300049575 | Bacteria | 1634 |
| 1163 | Ga0501039_0186238 | 3300049575 | Bacteria | 1632 |
| 1164 | Ga0501039_0333318 | 3300049575 | Bacteria | 1192 |
| 1165 | Ga0501041_0395008 | 3300049577 | Bacteria | 876 |
| 1166 | Ga0501042_0202945 | 3300049578 | Bacteria | 1429 |
| 1167 | Ga0501042_0488139 | 3300049578 | Bacteria | 894 |
| 1168 | Ga0501043_0000380 | 3300049579 | Bacteria | 40427 |
| 1169 | Ga0501043_0006697 | 3300049579 | Bacteria | 9203 |
| 1170 | Ga0501043_0019608 | 3300049579 | Bacteria | 5307 |
| 1171 | Ga0501043_0026393 | 3300049579 | Bacteria | 4557 |
| 1172 | Ga0501043_0055833 | 3300049579 | Bacteria | 3102 |
| 1173 | Ga0501043_0275968 | 3300049579 | Bacteria | 1289 |
| 1174 | Ga0501043_0745086 | 3300049579 | Bacteria | 713 |
| 1175 | Ga0501046_0007508 | 3300049580 | Bacteria | 9569 |
| 1176 | Ga0501046_0009446 | 3300049580 | Bacteria | 8430 |
| 1177 | Ga0501046_0036728 | 3300049580 | Bacteria | 3941 |
| 1178 | Ga0501046_0146595 | 3300049580 | Bacteria | 1782 |
| 1179 | Ga0501047_0000521 | 3300049581 | Bacteria | 41643 |
| 1180 | Ga0501047_0005189 | 3300049581 | Bacteria | 12227 |
| 1181 | Ga0501047_0030190 | 3300049581 | Bacteria | 5226 |
| 1182 | Ga0501047_0068797 | 3300049581 | Bacteria | 3410 |
| 1183 | Ga0501047_0098722 | 3300049581 | Bacteria | 2799 |
| 1184 | Ga0501047_0130130 | 3300049581 | Bacteria | 2397 |
| 1185 | Ga0501047_0243872 | 3300049581 | Bacteria | 1646 |
| 1186 | Ga0501047_0325419 | 3300049581 | Bacteria | 1376 |
| 1187 | Ga0501047_0616871 | 3300049581 | Bacteria | 905 |
| 1188 | Ga0501047_0926115 | 3300049581 | Bacteria | 685 |
| 1189 | Ga0501048_0000424 | 3300049582 | Bacteria | 29683 |
| 1190 | Ga0501048_0004846 | 3300049582 | Bacteria | 10256 |
| 1191 | Ga0501048_0294372 | 3300049582 | Bacteria | 1155 |
| 1192 | Ga0501048_0597826 | 3300049582 | Bacteria | 792 |
| 1193 | Ga0501067_0194643 | 3300049583 | Bacteria | 1129 |
| 1194 | Ga0501067_0195512 | 3300049583 | Bacteria | 1127 |
| 1195 | Ga0501067_0256582 | 3300049583 | Bacteria | 973 |
| 1196 | Ga0501067_0281019 | 3300049583 | Bacteria | 927 |
| 1197 | Ga0501067_0635334 | 3300049583 | Bacteria | 599 |
| 1198 | Ga0501067_0643769 | 3300049583 | Bacteria | 595 |
| 1199 | Ga0501068_0003418 | 3300049584 | Bacteria | 8543 |
| 1200 | Ga0501068_0262260 | 3300049584 | Bacteria | 1102 |
| 1201 | Ga0501069_0012683 | 3300049585 | Bacteria | 4484 |
| 1202 | Ga0501069_0016017 | 3300049585 | Bacteria | 4021 |
| 1203 | Ga0501069_0018041 | 3300049585 | Bacteria | 3806 |
| 1204 | Ga0501069_0019206 | 3300049585 | Bacteria | 3693 |
| 1205 | Ga0501069_0177979 | 3300049585 | Bacteria | 1229 |
| 1206 | Ga0501069_0205130 | 3300049585 | Bacteria | 1143 |
| 1207 | Ga0501069_0213732 | 3300049585 | Bacteria | 1119 |
| 1208 | Ga0501069_0444635 | 3300049585 | Bacteria | 770 |
| 1209 | Ga0501070_0007500 | 3300049586 | Bacteria | 9266 |
| 1210 | Ga0501070_0011437 | 3300049586 | Bacteria | 7498 |
| 1211 | Ga0501070_0016197 | 3300049586 | Bacteria | 6264 |
| 1212 | Ga0501070_0024817 | 3300049586 | Bacteria | 5027 |
| 1213 | Ga0501070_0036225 | 3300049586 | Bacteria | 4120 |
| 1214 | Ga0501070_0195976 | 3300049586 | Bacteria | 1659 |
| 1215 | Ga0501070_0350821 | 3300049586 | Bacteria | 1197 |
| 1216 | Ga0501070_0422475 | 3300049586 | Bacteria | 1076 |
| 1217 | Ga0501070_0444694 | 3300049586 | Bacteria | 1045 |
| 1218 | Ga0501070_0483043 | 3300049586 | Bacteria | 996 |
| 1219 | Ga0501070_0665296 | 3300049586 | Bacteria | 826 |
| 1220 | Ga0501070_0787463 | 3300049586 | Bacteria | 747 |
| 1221 | Ga0501071_0006065 | 3300049587 | Bacteria | 7831 |
| 1222 | Ga0501071_0201317 | 3300049587 | Bacteria | 1495 |
| 1223 | Ga0501071_0574898 | 3300049587 | Bacteria | 866 |
| 1224 | Ga0501071_0881555 | 3300049587 | Bacteria | 690 |
| 1225 | Ga0501071_1282452 | 3300049587 | Bacteria | 566 |
| 1226 | Ga0501071_1456162 | 3300049587 | Bacteria | 529 |
| 1227 | Ga0501072_0102571 | 3300049588 | Bacteria | 2274 |
| 1228 | Ga0501072_0134575 | 3300049588 | Bacteria | 1971 |
| 1229 | Ga0501072_0342943 | 3300049588 | Bacteria | 1186 |
| 1230 | Ga0501073_0003978 | 3300049589 | Bacteria | 11086 |
| 1231 | Ga0501073_0040392 | 3300049589 | Bacteria | 3302 |
| 1232 | Ga0501073_0168203 | 3300049589 | Bacteria | 1518 |
| 1233 | Ga0501073_0288425 | 3300049589 | Bacteria | 1132 |
| 1234 | Ga0501073_0485297 | 3300049589 | Bacteria | 855 |
| 1235 | Ga0501073_0509793 | 3300049589 | Bacteria | 832 |
| 1236 | Ga0501073_0699090 | 3300049589 | Bacteria | 699 |
| 1237 | Ga0501073_0900771 | 3300049589 | Bacteria | 609 |
| 1238 | Ga0501073_1217048 | 3300049589 | Bacteria | 517 |
| 1239 | Ga0501074_0036354 | 3300049590 | Bacteria | 3567 |
| 1240 | Ga0501074_0046359 | 3300049590 | Bacteria | 3142 |
| 1241 | Ga0501074_0192385 | 3300049590 | Bacteria | 1454 |
| 1242 | Ga0501074_0327635 | 3300049590 | Bacteria | 1087 |
| 1243 | Ga0501074_0540447 | 3300049590 | Bacteria | 825 |
| 1244 | Ga0501074_0586624 | 3300049590 | Bacteria | 788 |
| 1245 | Ga0501074_0978368 | 3300049590 | Bacteria | 595 |
| 1246 | Ga0501074_1051128 | 3300049590 | Bacteria | 572 |
| 1247 | Ga0501074_1296034 | 3300049590 | Bacteria | 510 |
| 1248 | Ga0501075_1018460 | 3300049591 | Bacteria | 629 |
| 1249 | Ga0501075_1202174 | 3300049591 | Bacteria | 575 |
| 1250 | Ga0501076_0453461 | 3300049592 | Bacteria | 1056 |
| 1251 | Ga0501077_0669814 | 3300049593 | Bacteria | 667 |
| 1252 | Ga0501257_194851 | 3300049686 | Bacteria | 580 |
| 1253 | Ga0501079_0471977 | 3300049741 | Bacteria | 986 |
| 1254 | Ga0501080_0000112 | 3300049742 | Bacteria | 56408 |
| 1255 | Ga0501080_0007633 | 3300049742 | Bacteria | 9779 |
| 1256 | Ga0501080_0030524 | 3300049742 | Bacteria | 5022 |
| 1257 | Ga0501080_0057546 | 3300049742 | Bacteria | 3619 |
| 1258 | Ga0501080_0082182 | 3300049742 | Bacteria | 2992 |
| 1259 | Ga0501080_0339542 | 3300049742 | Bacteria | 1357 |
| 1260 | Ga0501080_0420435 | 3300049742 | Bacteria | 1201 |
| 1261 | Ga0501080_0665352 | 3300049742 | Bacteria | 920 |
| 1262 | Ga0501080_0705034 | 3300049742 | Bacteria | 890 |
| 1263 | Ga0501080_0717799 | 3300049742 | Bacteria | 881 |
| 1264 | Ga0501081_0097284 | 3300049743 | Bacteria | 2077 |
| 1265 | Ga0501081_0276849 | 3300049743 | Bacteria | 1228 |
| 1266 | Ga0501081_0458287 | 3300049743 | Bacteria | 948 |
| 1267 | Ga0501081_1016023 | 3300049743 | Bacteria | 627 |
| 1268 | Ga0501083_0006103 | 3300049744 | Bacteria | 8539 |
| 1269 | Ga0501083_0011763 | 3300049744 | Bacteria | 6134 |
| 1270 | Ga0501083_0024733 | 3300049744 | Bacteria | 4159 |
| 1271 | Ga0501083_0339484 | 3300049744 | Bacteria | 977 |
| 1272 | Ga0501083_0416082 | 3300049744 | Bacteria | 875 |
| 1273 | Ga0501083_0464387 | 3300049744 | Bacteria | 824 |
| 1274 | Ga0501083_0474824 | 3300049744 | Bacteria | 814 |
| 1275 | Ga0501083_0604406 | 3300049744 | Bacteria | 713 |
| 1276 | Ga0501083_0816798 | 3300049744 | Bacteria | 607 |
| 1277 | Ga0501035_0015935 | 3300049822 | Bacteria | 6935 |
| 1278 | Ga0501035_0018834 | 3300049822 | Bacteria | 6360 |
| 1279 | Ga0501035_0133597 | 3300049822 | Bacteria | 2162 |
| 1280 | Ga0501035_0150556 | 3300049822 | Bacteria | 2019 |
| 1281 | Ga0501035_0296812 | 3300049822 | Bacteria | 1362 |
| 1282 | Ga0501044_0004299 | 3300049823 | Bacteria | 15974 |
| 1283 | Ga0501044_0024093 | 3300049823 | Bacteria | 6466 |
| 1284 | Ga0501044_0065711 | 3300049823 | Bacteria | 3699 |
| 1285 | Ga0501044_0085913 | 3300049823 | Bacteria | 3179 |
| 1286 | Ga0501044_0102116 | 3300049823 | Bacteria | 2884 |
| 1287 | Ga0501044_0134956 | 3300049823 | Bacteria | 2459 |
| 1288 | Ga0501044_0167788 | 3300049823 | Bacteria | 2168 |
| 1289 | Ga0501044_0325949 | 3300049823 | Bacteria | 1459 |
| 1290 | Ga0501044_0520922 | 3300049823 | Bacteria | 1088 |
| 1291 | Ga0501044_0558284 | 3300049823 | Bacteria | 1041 |
| 1292 | Ga0501044_0642508 | 3300049823 | Bacteria | 951 |
| 1293 | Ga0501044_1129306 | 3300049823 | Bacteria | 652 |
| 1294 | Ga0501044_1425840 | 3300049823 | Bacteria | 558 |
| 1295 | Ga0501045_0034195 | 3300049824 | Bacteria | 3688 |
| 1296 | Ga0501045_0605438 | 3300049824 | Bacteria | 811 |
| 1297 | Ga0501045_0644780 | 3300049824 | Bacteria | 783 |
| 1298 | nmdc:mga03683_55294_c1 | 3300050489 | Bacteria | 1666 |
| 1299 | nmdc:mga03683_56534_c2 | 3300050489 | Bacteria | 830 |
| 1300 | nmdc:mga03n38_276591_c1 | 3300050490 | Bacteria | 895 |
| 1301 | nmdc:mga03n38_907620_c1 | 3300050490 | Bacteria | 518 |
| 1302 | nmdc:mga00v17_120777_c1 | 3300050491 | Bacteria | 1237 |
| 1303 | nmdc:mga00v17_353319_c1 | 3300050491 | Bacteria | 955 |
| 1304 | nmdc:mga0yw44_1003219_c1 | 3300050492 | Bacteria | 565 |
| 1305 | nmdc:mga0yw44_1025129_c1 | 3300050492 | Bacteria | 558 |
| 1306 | nmdc:mga0yw44_186918_c1 | 3300050492 | Bacteria | 1365 |
| 1307 | nmdc:mga0yw44_28483_c1 | 3300050492 | Bacteria | 3213 |
| 1308 | nmdc:mga0yw44_31676_c1 | 3300050492 | Bacteria | 3077 |
| 1309 | nmdc:mga0yw44_32289_c1 | 3300050492 | Bacteria | 3050 |
| 1310 | nmdc:mga0k408_26017_c1 | 3300050493 | Bacteria | 3317 |
| 1311 | nmdc:mga0k408_300135_c1 | 3300050493 | Bacteria | 959 |
| 1312 | nmdc:mga06z11_38399_c1 | 3300050494 | Bacteria | 2378 |
| 1313 | nmdc:mga06z11_474709_c1 | 3300050494 | Bacteria | 757 |
| 1314 | nmdc:mga04h51_84942_c1 | 3300050495 | Bacteria | 1130 |
| 1315 | nmdc:mga07m45_311878_c1 | 3300050496 | Bacteria | 915 |
| 1316 | nmdc:mga05p37_1107618_c1 | 3300050507 | Bacteria | 828 |
| 1317 | nmdc:mga05p37_1602956_c1 | 3300050507 | Bacteria | 641 |
| 1318 | nmdc:mga05p37_32622_c1 | 3300050507 | Bacteria | 6370 |
| 1319 | nmdc:mga05p37_690326_c1 | 3300050507 | Bacteria | 1136 |
| 1320 | nmdc:mga09592_1630694_c1 | 3300050508 | Bacteria | 522 |
| 1321 | nmdc:mga09592_271584_c1 | 3300050508 | Bacteria | 1470 |
| 1322 | nmdc:mga09592_346412_c1 | 3300050508 | Bacteria | 1286 |
| 1323 | nmdc:mga0qj67_1478629_c1 | 3300050509 | Bacteria | 523 |
| 1324 | nmdc:mga0qj67_30661_c1 | 3300050509 | Bacteria | 4187 |
| 1325 | nmdc:mga0qj67_54997_c1 | 3300050509 | Bacteria | 3152 |
| 1326 | nmdc:mga0qj67_64_c1 | 3300050509 | Bacteria | 77795 |
| 1327 | nmdc:mga06r32_1128416_c1 | 3300050510 | Bacteria | 732 |
| 1328 | nmdc:mga06r32_1518803_c1 | 3300050510 | Bacteria | 610 |
| 1329 | nmdc:mga06r32_219896_c1 | 3300050510 | Bacteria | 1888 |
| 1330 | nmdc:mga06r32_668407_c1 | 3300050510 | Bacteria | 1006 |
| 1331 | nmdc:mga08y16_184437_c1 | 3300050511 | Bacteria | 2166 |
| 1332 | nmdc:mga08y16_2109952_c1 | 3300050511 | Bacteria | 511 |
| 1333 | nmdc:mga08y16_273732_c1 | 3300050511 | Bacteria | 1742 |
| 1334 | nmdc:mga08y16_298073_c1 | 3300050511 | Bacteria | 1662 |
| 1335 | nmdc:mga0n895_374112_c1 | 3300050512 | Bacteria | 1442 |
| 1336 | nmdc:mga0n895_42898_c1 | 3300050512 | Bacteria | 4404 |
| 1337 | nmdc:mga0n895_6291_c1 | 3300050512 | Bacteria | 10065 |
| 1338 | nmdc:mga0n895_64463_c1 | 3300050512 | Bacteria | 3624 |
| 1339 | nmdc:mga0n895_714984_c1 | 3300050512 | Bacteria | 997 |
| 1340 | nmdc:mga0rr50_327667_c1 | 3300050513 | Bacteria | 1285 |
| 1341 | nmdc:mga0rr50_353313_c1 | 3300050513 | Bacteria | 1236 |
| 1342 | nmdc:mga0rr50_434605_c1 | 3300050513 | Bacteria | 1111 |
| 1343 | nmdc:mga08x19_4095_c1 | 3300050514 | Bacteria | 8648 |
| 1344 | nmdc:mga0a205_19348_c2 | 3300050515 | Bacteria | 5383 |
| 1345 | nmdc:mga0a205_211695_c1 | 3300050515 | Bacteria | 1826 |
| 1346 | nmdc:mga0a205_523146_c1 | 3300050515 | Bacteria | 1042 |
| 1347 | nmdc:mga0sz30_162599_c1 | 3300050516 | Bacteria | 598 |
| 1348 | nmdc:mga0sz30_369702_c1 | 3300050516 | Bacteria | 641 |
| 1349 | nmdc:mga0sz30_87805_c1 | 3300050516 | Bacteria | 1351 |
| 1350 | Ga0495601_0001005 | 3300053077 | Bacteria | 15446 |
| 1351 | Ga0495601_0001502 | 3300053077 | Bacteria | 12858 |
| 1352 | Ga0495601_0276964 | 3300053077 | Bacteria | 1094 |
| 1353 | Ga0495601_0891888 | 3300053077 | Bacteria | 562 |
| 1354 | Ga0495601_0988601 | 3300053077 | Bacteria | 529 |
| 1355 | Ga0495612_0078690 | 3300053078 | Bacteria | 1383 |
| 1356 | Ga0495612_0157233 | 3300053078 | Bacteria | 991 |
| 1357 | Ga0495612_0268218 | 3300053078 | Bacteria | 761 |
| 1358 | Ga0495612_0417392 | 3300053078 | Bacteria | 611 |
| 1359 | Ga0500635_0095768 | 3300053080 | Bacteria | 1086 |
| 1360 | Ga0495655_0036965 | 3300053083 | Bacteria | 1224 |
| 1361 | Ga0495655_0236188 | 3300053083 | Bacteria | 610 |
| 1362 | Ga0495595_0000987 | 3300053084 | Bacteria | 10965 |
| 1363 | Ga0495595_0054776 | 3300053084 | Bacteria | 1855 |
| 1364 | Ga0495619_0000161 | 3300053085 | Bacteria | 49400 |
| 1365 | Ga0495619_0006746 | 3300053085 | Bacteria | 7262 |
| 1366 | Ga0495619_0642297 | 3300053085 | Bacteria | 724 |
| 1367 | Ga0500643_001129 | 3300053087 | Bacteria | 15933 |
| 1368 | Ga0500643_086825 | 3300053087 | Bacteria | 855 |
| 1369 | Ga0500643_150371 | 3300053087 | Bacteria | 625 |
| 1370 | Ga0500644_0002768 | 3300053088 | Bacteria | 4372 |
| 1371 | Ga0500583_0558446 | 3300053092 | Bacteria | 531 |
| 1372 | Ga0500651_0006160 | 3300053093 | Bacteria | 6891 |
| 1373 | Ga0500651_0083955 | 3300053093 | Bacteria | 1970 |
| 1374 | Ga0500651_0582998 | 3300053093 | Bacteria | 608 |
| 1375 | Ga0500566_0163606 | 3300053094 | Bacteria | 1157 |
| 1376 | Ga0500566_0211256 | 3300053094 | Bacteria | 972 |
| 1377 | Ga0500640_031993 | 3300053095 | Bacteria | 2307 |
| 1378 | Ga0500641_0159594 | 3300053096 | Bacteria | 972 |
| 1379 | Ga0500641_0370541 | 3300053096 | Bacteria | 570 |
| 1380 | Ga0500572_002430 | 3300053111 | Bacteria | 4485 |
| 1381 | Ga0500592_076881 | 3300053116 | Bacteria | 553 |
| 1382 | Ga0500594_0068367 | 3300053118 | Bacteria | 1039 |
| 1383 | Ga0500595_000056 | 3300053119 | Bacteria | 83521 |
| 1384 | Ga0500595_009755 | 3300053119 | Bacteria | 3859 |
| 1385 | Ga0500595_074125 | 3300053119 | Bacteria | 1005 |
| 1386 | Ga0500595_121715 | 3300053119 | Bacteria | 737 |
| 1387 | Ga0500607_051599 | 3300053121 | Bacteria | 2186 |
| 1388 | Ga0500608_106842 | 3300053122 | Bacteria | 1288 |
| 1389 | Ga0500608_176252 | 3300053122 | Bacteria | 911 |
| 1390 | Ga0500608_291454 | 3300053122 | Bacteria | 611 |
| 1391 | Ga0500614_009286 | 3300053123 | Bacteria | 2097 |
| 1392 | Ga0500621_193686 | 3300053126 | Bacteria | 726 |
| 1393 | Ga0500642_0135948 | 3300053130 | Bacteria | 1152 |
| 1394 | Ga0500642_0201847 | 3300053130 | Bacteria | 925 |
| 1395 | Ga0500652_000030 | 3300053131 | Bacteria | 90754 |
| 1396 | Ga0500652_120098 | 3300053131 | Bacteria | 1098 |
| 1397 | Ga0500655_029480 | 3300053133 | Bacteria | 1053 |
| 1398 | Ga0500658_0130580 | 3300053134 | Bacteria | 1120 |
| 1399 | Ga0500658_0408077 | 3300053134 | Bacteria | 621 |
| 1400 | Ga0500559_0042567 | 3300053136 | Bacteria | 1981 |
| 1401 | Ga0500559_0154758 | 3300053136 | Bacteria | 1076 |
| 1402 | Ga0500561_0089912 | 3300053137 | Bacteria | 907 |
| 1403 | Ga0500561_0180128 | 3300053137 | Bacteria | 665 |
| 1404 | Ga0500564_161358 | 3300053138 | Bacteria | 948 |
| 1405 | Ga0500568_0025558 | 3300053139 | Bacteria | 2490 |
| 1406 | Ga0500568_0243133 | 3300053139 | Bacteria | 656 |
| 1407 | Ga0500577_0050367 | 3300053142 | Bacteria | 1561 |
| 1408 | Ga0500588_0247853 | 3300053146 | Bacteria | 668 |
| 1409 | Ga0500590_213529 | 3300053148 | Bacteria | 803 |
| 1410 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 1411 | Ga0500616_0090724 | 3300053153 | Bacteria | 1514 |
| 1412 | Ga0500620_020681 | 3300053155 | Bacteria | 1956 |
| 1413 | Ga0500627_0319172 | 3300053158 | Bacteria | 675 |
| 1414 | Ga0500627_0427818 | 3300053158 | Bacteria | 560 |
| 1415 | Ga0500627_0488193 | 3300053158 | Bacteria | 514 |
| 1416 | Ga0500633_0140075 | 3300053160 | Bacteria | 905 |
| 1417 | Ga0500634_0133905 | 3300053161 | Bacteria | 1185 |
| 1418 | Ga0500638_176301 | 3300053162 | Bacteria | 926 |
| 1419 | Ga0500636_0011608 | 3300053177 | Bacteria | 5156 |
| 1420 | Ga0500636_0028470 | 3300053177 | Bacteria | 3299 |
| 1421 | Ga0500636_0045018 | 3300053177 | Bacteria | 2603 |
| 1422 | Ga0500637_0275733 | 3300053178 | Bacteria | 928 |
| 1423 | Ga0500576_112303 | 3300053725 | Bacteria | 1090 |
| 1424 | Ga0500645_000532 | 3300053730 | Bacteria | 25475 |
| 1425 | Ga0500645_108749 | 3300053730 | Bacteria | 779 |
| 1426 | Ga0501084_0122229 | 3300054114 | Bacteria | 2189 |
| 1427 | Ga0501084_0151938 | 3300054114 | Bacteria | 1952 |
| 1428 | Ga0501084_0281502 | 3300054114 | Bacteria | 1404 |
| 1429 | Ga0501084_1738663 | 3300054114 | Bacteria | 521 |
| 1430 | Ga0587084_041071 | 3300059477 | Bacteria | 786 |
| 1431 | Ga0587077_173207 | 3300059493 | Bacteria | 579 |
| 1432 | Ga0587083_0114664 | 3300059505 | Bacteria | 689 |
| 1433 | Ga0587090_161839 | 3300059510 | Bacteria | 514 |
| 1434 | Ga0587098_102561 | 3300059604 | Bacteria | 500 |
| 1435 | Ga0587111_0023142 | 3300060346 | Bacteria | 1213 |
| 1436 | Ga0501082_0016603 | 3300060353 | Bacteria | 6338 |
| 1437 | Ga0501082_0060204 | 3300060353 | Bacteria | 3270 |
| 1438 | Ga0501082_0206503 | 3300060353 | Bacteria | 1709 |
| 1439 | Ga0501082_0249729 | 3300060353 | Bacteria | 1544 |
| 1440 | Ga0501082_0687711 | 3300060353 | Bacteria | 895 |
| 1441 | Ga0501082_0726373 | 3300060353 | Bacteria | 869 |
| 1442 | Ga0530510_0250961 | 3300061734 | Bacteria | 1319 |
| 1443 | Ga0530510_0488110 | 3300061734 | Bacteria | 933 |
| 1444 | Ga0530510_1187921 | 3300061734 | Bacteria | 585 |
| 1445 | Ga0068860_101247949 | |||
| 1446 | JGI24740J21852_10038726 | |||
| 1447 | JGI25165J46597_1038986 | |||
| 1448 | JGI25153J46596_10011207 | |||
| 1449 | Ga0007409J51694_1118107 | |||
| 1450 | Ga0032354_1111692 | |||
| 1451 | Ga0058862_10037920 | |||
| 1452 | Ga0065712_10042515 | |||
| 1453 | Ga0070658_10089051 | |||
| 1454 | Ga0070658_10489556 | |||
| 1455 | Ga0070658_10502259 | |||
| 1456 | Ga0070676_10376667 | |||
| 1457 | Ga0070683_100050446 | |||
| 1458 | Ga0070683_100444165 | |||
| 1459 | Ga0070683_101225927 | |||
| 1460 | Ga0070690_100034297 | |||
| 1461 | Ga0070670_101035705 | |||
| 1462 | Ga0068869_100508235 | |||
| 1463 | Ga0070680_100014585 | |||
| 1464 | Ga0070680_100146643 | |||
| 1465 | Ga0070680_100323382 | |||
| 1466 | Ga0070680_101100616 | |||
| 1467 | Ga0070680_101159975 | |||
| 1468 | Ga0070682_101604025 | |||
| 1469 | Ga0068868_100007983 | |||
| 1470 | Ga0068868_101389008 | |||
| 1471 | Ga0068868_101646901 | |||
| 1472 | Ga0070660_100018796 | |||
| 1473 | Ga0070660_100076919 | |||
| 1474 | Ga0070660_100169367 | |||
| 1475 | Ga0070689_101010652 | |||
| 1476 | Ga0070691_10109451 | |||
| 1477 | Ga0070691_10407234 | |||
| 1478 | Ga0070687_100313489 | |||
| 1479 | Ga0070661_100170923 | |||
| 1480 | Ga0070661_100269311 | |||
| 1481 | Ga0070661_101399787 | |||
| 1482 | Ga0070692_10653784 | |||
| 1483 | Ga0070668_100327321 | |||
| 1484 | Ga0070668_100497588 | |||
| 1485 | Ga0070668_100733085 | |||
| 1486 | Ga0070669_100755351 | |||
| 1487 | Ga0070675_100324458 | |||
| 1488 | Ga0070675_100467864 | |||
| 1489 | Ga0070675_101298476 | |||
| 1490 | Ga0070671_100388795 | |||
| 1491 | Ga0070671_102068819 | |||
| 1492 | Ga0070674_100532374 | |||
| 1493 | Ga0070674_101662508 | |||
| 1494 | Ga0070673_100160006 | |||
| 1495 | Ga0070673_100160421 | |||
| 1496 | Ga0070673_100762197 | |||
| 1497 | Ga0070673_100774574 | |||
| 1498 | Ga0070688_100323672 | |||
| 1499 | Ga0070688_100422322 | |||
| 1500 | Ga0070688_100434120 | |||
| 1501 | Ga0070659_100734185 | |||
| 1502 | Ga0070659_101551190 | |||
| 1503 | Ga0070659_101892808 | |||
| 1504 | Ga0070667_100173437 | |||
| 1505 | Ga0070709_10001922 | |||
| 1506 | Ga0070709_10006846 | |||
| 1507 | Ga0070709_10337280 | |||
| 1508 | Ga0070709_10341778 | |||
| 1509 | Ga0070709_10729890 | |||
| 1510 | Ga0070709_11788244 | |||
| 1511 | Ga0070714_100027376 | |||
| 1512 | Ga0070714_100397788 | |||
| 1513 | Ga0070714_101080465 | |||
| 1514 | Ga0070713_100062104 | |||
| 1515 | Ga0070713_100189270 | |||
| 1516 | Ga0070713_100304693 | |||
| 1517 | Ga0070713_100464431 | |||
| 1518 | Ga0070713_100526435 | |||
| 1519 | Ga0070713_101292969 | |||
| 1520 | Ga0070713_102375773 | |||
| 1521 | Ga0070710_10071503 | |||
| 1522 | Ga0070710_10718745 | |||
| 1523 | Ga0070710_10824735 | |||
| 1524 | Ga0070701_10478843 | |||
| 1525 | Ga0070711_100062959 | |||
| 1526 | Ga0070711_100175987 | |||
| 1527 | Ga0070711_100222251 | |||
| 1528 | Ga0070711_100462344 | |||
| 1529 | Ga0070711_100679055 | |||
| 1530 | Ga0070711_101575590 | |||
| 1531 | Ga0070705_100596162 | |||
| 1532 | Ga0070700_101360586 | |||
| 1533 | Ga0070694_100435890 | |||
| 1534 | Ga0070663_100073256 | |||
| 1535 | Ga0070663_101975297 | |||
| 1536 | Ga0070678_101690446 | |||
| 1537 | Ga0070678_101753506 | |||
| 1538 | Ga0070662_100988667 | |||
| 1539 | Ga0070681_10123510 | |||
| 1540 | Ga0070681_10162202 | |||
| 1541 | Ga0070681_10196016 | |||
| 1542 | Ga0070681_10308624 | |||
| 1543 | Ga0070681_10383342 | |||
| 1544 | Ga0070681_11762779 | |||
| 1545 | Ga0068867_100373644 | |||
| 1546 | Ga0070685_10326596 | |||
| 1547 | Ga0070685_10331635 | |||
| 1548 | Ga0070685_11276852 | |||
| 1549 | Ga0070698_101168366 | |||
| 1550 | Ga0070699_100300023 | |||
| 1551 | Ga0070679_100042509 | |||
| 1552 | Ga0070679_100043946 | |||
| 1553 | Ga0070679_100058513 | |||
| 1554 | Ga0070679_100069794 | |||
| 1555 | Ga0070679_100162721 | |||
| 1556 | Ga0070679_100315120 | |||
| 1557 | Ga0070679_100344254 | |||
| 1558 | Ga0070679_100442812 | |||
| 1559 | Ga0070679_100656427 | |||
| 1560 | Ga0070679_101474637 | |||
| 1561 | Ga0070684_100065831 | |||
| 1562 | Ga0070684_100111751 | |||
| 1563 | Ga0070697_100118005 | |||
| 1564 | Ga0068853_100027752 | |||
| 1565 | Ga0068853_100055096 | |||
| 1566 | Ga0068853_100106927 | |||
| 1567 | Ga0068853_100268078 | |||
| 1568 | Ga0068853_100929848 | |||
| 1569 | Ga0068853_101478683 | |||
| 1570 | Ga0070695_100828005 | |||
| 1571 | Ga0070695_101415274 | |||
| 1572 | Ga0070696_101458738 | |||
| 1573 | Ga0070696_101501589 | |||
| 1574 | Ga0070696_101568876 | |||
| 1575 | Ga0070693_100009073 | |||
| 1576 | Ga0070693_100498196 | |||
| 1577 | Ga0070693_100651303 | |||
| 1578 | Ga0070665_100081722 | |||
| 1579 | Ga0068855_100071444 | |||
| 1580 | Ga0068855_100279415 | |||
| 1581 | Ga0068855_100452753 | |||
| 1582 | Ga0068855_101294751 | |||
| 1583 | Ga0068855_101351131 | |||
| 1584 | Ga0068855_101489573 | |||
| 1585 | Ga0070664_100209977 | |||
| 1586 | Ga0070664_101150212 | |||
| 1587 | Ga0068857_100386466 | |||
| 1588 | Ga0068857_100521839 | |||
| 1589 | Ga0068857_100756657 | |||
| 1590 | Ga0068857_102466580 | |||
| 1591 | Ga0068854_100137184 | |||
| 1592 | Ga0068854_100556478 | |||
| 1593 | Ga0068856_100022099 | |||
| 1594 | Ga0068856_100123820 | |||
| 1595 | Ga0068856_100230012 | |||
| 1596 | Ga0068856_100353700 | |||
| 1597 | Ga0068856_100422800 | |||
| 1598 | Ga0068856_100482624 | |||
| 1599 | Ga0068852_100006203 | |||
| 1600 | Ga0068852_100282245 | |||
| 1601 | Ga0068852_100310948 | |||
| 1602 | Ga0068852_101081361 | |||
| 1603 | Ga0068859_100838170 | |||
| 1604 | Ga0068864_100383119 | |||
| 1605 | Ga0068866_10814766 | |||
| 1606 | Ga0068861_100257980 | |||
| 1607 | Ga0068861_100561445 | |||
| 1608 | Ga0068851_10158510 | |||
| 1609 | Ga0068851_10233305 | |||
| 1610 | Ga0068870_10179585 | |||
| 1611 | Ga0068863_100435669 | |||
| 1612 | Ga0068858_100054511 | |||
| 1613 | Ga0068858_100310199 | |||
| 1614 | Ga0068858_100541351 | |||
| 1615 | Ga0068858_100897402 | |||
| 1616 | Ga0068858_101053816 | |||
| 1617 | Ga0068860_100670482 | |||
| 1618 | Ga0068862_101901690 | |||
| 1619 | Ga0081455_10008039 | |||
| 1620 | Ga0081455_10038420 | |||
| 1621 | Ga0081455_10948579 | |||
| 1622 | Ga0081538_10009052 | |||
| 1623 | Ga0081538_10015393 | |||
| 1624 | Ga0081538_10040078 | |||
| 1625 | Ga0081540_1054331 | |||
| 1626 | Ga0081540_1200769 | |||
| 1627 | Ga0081540_1226993 | |||
| 1628 | Ga0081539_10312281 | |||
| 1629 | Ga0070717_10145504 | |||
| 1630 | Ga0070717_10536905 | |||
| 1631 | Ga0070717_11430790 | |||
| 1632 | Ga0075365_10038001 | |||
| 1633 | Ga0075365_10767283 | |||
| 1634 | Ga0075368_10527513 | |||
| 1635 | Ga0075363_100299367 | |||
| 1636 | Ga0075364_10113671 | |||
| 1637 | Ga0075364_10585104 | |||
| 1638 | Ga0075364_10810557 | |||
| 1639 | Ga0070715_10171109 | |||
| 1640 | Ga0070715_10572506 | |||
| 1641 | Ga0070716_100312484 | |||
| 1642 | Ga0070716_100936264 | |||
| 1643 | Ga0070712_100064075 | |||
| 1644 | Ga0070712_100236287 | |||
| 1645 | Ga0070712_100589946 | |||
| 1646 | Ga0075362_10009301 | |||
| 1647 | Ga0075362_10321975 | |||
| 1648 | Ga0075362_10592236 | |||
| 1649 | Ga0075369_10225457 | |||
| 1650 | Ga0075366_10036787 | |||
| 1651 | Ga0097621_102004878 | |||
| 1652 | Ga0068871_100867804 | |||
| 1653 | Ga0068871_100916110 | |||
| 1654 | Ga0075428_100160641 | |||
| 1655 | Ga0075428_100304673 | |||
| 1656 | Ga0075428_101094247 | |||
| 1657 | Ga0075428_102001018 | |||
| 1658 | Ga0075430_100000160 | |||
| 1659 | Ga0075430_100026884 | |||
| 1660 | Ga0075430_100069892 | |||
| 1661 | Ga0075430_101663818 | |||
| 1662 | Ga0075431_100266156 | |||
| 1663 | Ga0075431_100333821 | |||
| 1664 | Ga0075431_100581937 | |||
| 1665 | Ga0075431_100914215 | |||
| 1666 | Ga0075431_101308563 | |||
| 1667 | Ga0075433_10025352 | |||
| 1668 | Ga0075433_10199152 | |||
| 1669 | Ga0075434_100039061 | |||
| 1670 | Ga0075434_100562438 | |||
| 1671 | Ga0075434_100783587 | |||
| 1672 | Ga0075434_101078024 | |||
| 1673 | Ga0075429_100267141 | |||
| 1674 | Ga0075429_100432121 | |||
| 1675 | Ga0075429_100762560 | |||
| 1676 | Ga0068865_100118311 | |||
| 1677 | Ga0068865_100158349 | |||
| 1678 | Ga0068865_100421428 | |||
| 1679 | Ga0075436_100286507 | |||
| 1680 | Ga0097620_100838180 | |||
| 1681 | Ga0099824_1013749 | |||
| 1682 | Ga0099822_1002198 | |||
| 1683 | Ga0075435_100189206 | |||
| 1684 | Ga0075435_100222774 | |||
| 1685 | Ga0075435_100487847 | |||
| 1686 | Ga0075435_100508301 | |||
| 1687 | Ga0099795_10006840 | |||
| 1688 | Ga0099795_10008109 | |||
| 1689 | Ga0099795_10180133 | |||
| 1690 | Ga0105240_10069299 | |||
| 1691 | Ga0105240_10078594 | |||
| 1692 | Ga0105240_10174589 | |||
| 1693 | Ga0105240_10748694 | |||
| 1694 | Ga0105240_11496942 | |||
| 1695 | Ga0105240_12062754 | |||
| 1696 | Ga0111539_10088305 | |||
| 1697 | Ga0111539_10371050 | |||
| 1698 | Ga0111539_10821120 | |||
| 1699 | Ga0111539_11018887 | |||
| 1700 | Ga0111539_12717923 | |||
| 1701 | Ga0111539_13024242 | |||
| 1702 | Ga0105245_10018589 | |||
| 1703 | Ga0105245_11952243 | |||
| 1704 | Ga0105245_12973268 | |||
| 1705 | Ga0105247_10043643 | |||
| 1706 | Ga0105247_10277017 | |||
| 1707 | Ga0105247_10557797 | |||
| 1708 | Ga0114129_10008525 | |||
| 1709 | Ga0114129_10194916 | |||
| 1710 | Ga0114129_10978363 | |||
| 1711 | Ga0114129_11278018 | |||
| 1712 | Ga0114129_11327606 | |||
| 1713 | Ga0114129_13051102 | |||
| 1714 | Ga0105243_11034803 | |||
| 1715 | Ga0105241_10008048 | |||
| 1716 | Ga0105241_10685135 | |||
| 1717 | Ga0105241_11186854 | |||
| 1718 | Ga0105241_11310093 | |||
| 1719 | Ga0105242_10061833 | |||
| 1720 | Ga0105242_12701456 | |||
| 1721 | Ga0105248_10194835 | |||
| 1722 | Ga0105237_10019778 | |||
| 1723 | Ga0105237_10836697 | |||
| 1724 | Ga0105237_12242920 | |||
| 1725 | Ga0105238_10003838 | |||
| 1726 | Ga0105238_10059220 | |||
| 1727 | Ga0105238_10071815 | |||
| 1728 | Ga0105238_10085833 | |||
| 1729 | Ga0105238_10101038 | |||
| 1730 | Ga0105238_10206694 | |||
| 1731 | Ga0105238_10383998 | |||
| 1732 | Ga0105238_11556954 | |||
| 1733 | Ga0105249_10977734 | |||
| 1734 | Ga0105249_11798556 | |||
| 1735 | Ga0105249_11926515 | |||
| 1736 | Ga0105249_13255056 | |||
| 1737 | Ga0099796_10010986 | |||
| 1738 | Ga0099796_10021839 | |||
| 1739 | Ga0099796_10100135 | |||
| 1740 | Ga0099796_10149337 | |||
| 1741 | Ga0099796_10181829 | |||
| 1742 | Ga0105239_10177276 | |||
| 1743 | Ga0105239_10185725 | |||
| 1744 | Ga0105239_10373336 | |||
| 1745 | Ga0105239_10476891 | |||
| 1746 | Ga0105239_11147972 | |||
| 1747 | Ga0105239_11575296 | |||
| 1748 | Ga0105239_12638560 | |||
| 1749 | Ga0105239_13105477 | |||
| 1750 | Ga0105246_10139077 | |||
| 1751 | Ga0157373_10149708 | |||
| 1752 | Ga0157371_10165678 | |||
| 1753 | Ga0157371_10339044 | |||
| 1754 | Ga0157370_10012038 | |||
| 1755 | Ga0157370_10118016 | |||
| 1756 | Ga0157370_10265931 | |||
| 1757 | Ga0157370_11155821 | |||
| 1758 | Ga0157370_11398506 | |||
| 1759 | Ga0157370_11437008 | |||
| 1760 | Ga0157369_10070831 | |||
| 1761 | Ga0157369_10104293 | |||
| 1762 | Ga0157369_10258809 | |||
| 1763 | Ga0157374_10920909 | |||
| 1764 | Ga0157374_11900804 | |||
| 1765 | Ga0157378_10337769 | |||
| 1766 | Ga0157378_10488980 | |||
| 1767 | Ga0157372_10192928 | |||
| 1768 | Ga0157372_10243395 | |||
| 1769 | Ga0157372_10253838 | |||
| 1770 | Ga0157372_10997979 | |||
| 1771 | Ga0157375_10396786 | |||
| 1772 | Ga0157375_11464024 | |||
| 1773 | Ga0157375_11699528 | |||
| 1774 | Ga0157375_12749920 | |||
| 1775 | Ga0157375_13076237 | |||
| 1776 | Ga0157375_13406518 | |||
| 1777 | Ga0157375_13627347 | |||
| 1778 | Ga0163163_10036579 | |||
| 1779 | Ga0163163_10246255 | |||
| 1780 | Ga0163163_10429967 | |||
| 1781 | Ga0157380_10119849 | |||
| 1782 | Ga0157380_10133063 | |||
| 1783 | Ga0157380_11420715 | |||
| 1784 | Ga0157380_11591017 | |||
| 1785 | Ga0157380_11894671 | |||
| 1786 | Ga0157377_10291571 | |||
| 1787 | Ga0157376_10152308 | |||
| 1788 | Ga0157376_11212059 | |||
| 1789 | Ga0157376_11912712 | |||
| 1790 | Ga0163161_10432020 | |||
| 1791 | Ga0163161_11621345 | |||
| 1792 | Ga0197907_10153463 | |||
| 1793 | Ga0197907_10562205 | |||
| 1794 | Ga0206356_11628268 | |||
| 1795 | Ga0206349_1963553 | |||
| 1796 | Ga0206355_1155059 | |||
| 1797 | Ga0206355_1586693 | |||
| 1798 | Ga0206350_11537303 | |||
| 1799 | Ga0206354_10229610 | |||
| 1800 | Ga0206354_11369879 | |||
| 1801 | Ga0206353_10403358 | |||
| 1802 | Ga0206353_10574770 | |||
| 1803 | Ga0206353_10738894 | |||
| 1804 | Ga0213873_10012440 | |||
| 1805 | Ga0213876_10001998 | |||
| 1806 | Ga0213876_10104712 | |||
| 1807 | Ga0213876_10204714 | |||
| 1808 | Ga0213876_10223968 | |||
| 1809 | Ga0213875_10022315 | |||
| 1810 | Ga0224712_10005831 | |||
| 1811 | Ga0224712_10256092 | |||
| 1812 | Ga0224572_1055618 | |||
| 1813 | Ga0209233_1006999 | |||
| 1814 | Ga0207666_1049812 | |||
| 1815 | Ga0209025_1008156 | |||
| 1816 | Ga0209758_1000158 | |||
| 1817 | Ga0209758_1033723 | |||
| 1818 | Ga0209758_1070698 | |||
| 1819 | Ga0207697_10060887 | |||
| 1820 | Ga0207697_10166643 | |||
| 1821 | Ga0207656_10479005 | |||
| 1822 | Ga0207653_10081843 | |||
| 1823 | Ga0207682_10489555 | |||
| 1824 | Ga0207692_10237251 | |||
| 1825 | Ga0207642_10080060 | |||
| 1826 | Ga0207642_10568390 | |||
| 1827 | Ga0207642_10743516 | |||
| 1828 | Ga0207710_10161882 | |||
| 1829 | Ga0207710_10234069 | |||
| 1830 | Ga0207710_10719578 | |||
| 1831 | Ga0207688_10023980 | |||
| 1832 | Ga0207688_10087606 | |||
| 1833 | Ga0207688_10272198 | |||
| 1834 | Ga0207688_10438902 | |||
| 1835 | Ga0207688_10442830 | |||
| 1836 | Ga0207688_10510028 | |||
| 1837 | Ga0207688_10534448 | |||
| 1838 | Ga0207688_10554721 | |||
| 1839 | Ga0207680_10134413 | |||
| 1840 | Ga0207680_10440720 | |||
| 1841 | Ga0207680_10838274 | |||
| 1842 | Ga0207647_10121117 | |||
| 1843 | Ga0207647_10189237 | |||
| 1844 | Ga0207647_10201530 | |||
| 1845 | Ga0207647_10533437 | |||
| 1846 | Ga0207685_10659464 | |||
| 1847 | Ga0207699_10265868 | |||
| 1848 | Ga0207699_10483017 | |||
| 1849 | Ga0207699_11038511 | |||
| 1850 | Ga0207699_11129009 | |||
| 1851 | Ga0207699_11230923 | |||
| 1852 | Ga0207645_10041051 | |||
| 1853 | Ga0207645_10309325 | |||
| 1854 | Ga0207645_10335540 | |||
| 1855 | Ga0207645_10525239 | |||
| 1856 | Ga0207645_10863828 | |||
| 1857 | Ga0207643_10387217 | |||
| 1858 | Ga0207643_10548929 | |||
| 1859 | Ga0207705_10097947 | |||
| 1860 | Ga0207705_10454412 | |||
| 1861 | Ga0207705_10711956 | |||
| 1862 | Ga0207705_11076898 | |||
| 1863 | Ga0207684_11476687 | |||
| 1864 | Ga0207654_10028860 | |||
| 1865 | Ga0207654_10080502 | |||
| 1866 | Ga0207654_10418730 | |||
| 1867 | Ga0207707_10002462 | |||
| 1868 | Ga0207707_10120132 | |||
| 1869 | Ga0207707_10135704 | |||
| 1870 | Ga0207707_10144629 | |||
| 1871 | Ga0207707_10166809 | |||
| 1872 | Ga0207707_10346988 | |||
| 1873 | Ga0207707_11165985 | |||
| 1874 | Ga0207707_11326976 | |||
| 1875 | Ga0207695_10008678 | |||
| 1876 | Ga0207695_10043567 | |||
| 1877 | Ga0207695_10133941 | |||
| 1878 | Ga0207695_10255866 | |||
| 1879 | Ga0207695_10283252 | |||
| 1880 | Ga0207695_10694948 | |||
| 1881 | Ga0207695_10855645 | |||
| 1882 | Ga0207695_10943799 | |||
| 1883 | Ga0207671_10024032 | |||
| 1884 | Ga0207671_10028663 | |||
| 1885 | Ga0207671_10083358 | |||
| 1886 | Ga0207671_10327880 | |||
| 1887 | Ga0207671_10933611 | |||
| 1888 | Ga0207693_10006335 | |||
| 1889 | Ga0207693_10094152 | |||
| 1890 | Ga0207693_10118589 | |||
| 1891 | Ga0207693_10376181 | |||
| 1892 | Ga0207693_11440118 | |||
| 1893 | Ga0207663_10304888 | |||
| 1894 | Ga0207663_10507510 | |||
| 1895 | Ga0207663_10754160 | |||
| 1896 | Ga0207660_10014479 | |||
| 1897 | Ga0207660_10034374 | |||
| 1898 | Ga0207660_10070414 | |||
| 1899 | Ga0207660_10192047 | |||
| 1900 | Ga0207660_10259840 | |||
| 1901 | Ga0207660_10269647 | |||
| 1902 | Ga0207660_10895929 | |||
| 1903 | Ga0207660_10927320 | |||
| 1904 | Ga0207662_10098654 | |||
| 1905 | Ga0207662_10105157 | |||
| 1906 | Ga0207662_10238567 | |||
| 1907 | Ga0207657_10010418 | |||
| 1908 | Ga0207657_10015111 | |||
| 1909 | Ga0207657_10051357 | |||
| 1910 | Ga0207657_10111222 | |||
| 1911 | Ga0207657_10254454 | |||
| 1912 | Ga0207649_10141728 | |||
| 1913 | Ga0207649_10235489 | |||
| 1914 | Ga0207649_10285801 | |||
| 1915 | Ga0207649_11405383 | |||
| 1916 | Ga0207652_10070098 | |||
| 1917 | Ga0207652_10113322 | |||
| 1918 | Ga0207652_10163555 | |||
| 1919 | Ga0207652_10202579 | |||
| 1920 | Ga0207652_10215686 | |||
| 1921 | Ga0207652_10257614 | |||
| 1922 | Ga0207652_10348509 | |||
| 1923 | Ga0207652_10615620 | |||
| 1924 | Ga0207652_10657695 | |||
| 1925 | Ga0207681_10555456 | |||
| 1926 | Ga0207681_10657884 | |||
| 1927 | Ga0207694_10000131 | |||
| 1928 | Ga0207694_10017080 | |||
| 1929 | Ga0207694_10052393 | |||
| 1930 | Ga0207694_10098451 | |||
| 1931 | Ga0207694_10400964 | |||
| 1932 | Ga0207694_10924153 | |||
| 1933 | Ga0207694_11158871 | |||
| 1934 | Ga0207694_11307657 | |||
| 1935 | Ga0207650_10667973 | |||
| 1936 | Ga0207650_10980541 | |||
| 1937 | Ga0207659_10058734 | |||
| 1938 | Ga0207659_11457497 | |||
| 1939 | Ga0207687_10051484 | |||
| 1940 | Ga0207687_10066068 | |||
| 1941 | Ga0207687_10316214 | |||
| 1942 | Ga0207687_10372198 | |||
| 1943 | Ga0207687_11031157 | |||
| 1944 | Ga0207687_11059995 | |||
| 1945 | Ga0207700_10121454 | |||
| 1946 | Ga0207700_10139885 | |||
| 1947 | Ga0207700_10169673 | |||
| 1948 | Ga0207700_10318937 | |||
| 1949 | Ga0207700_10384962 | |||
| 1950 | Ga0207700_11412255 | |||
| 1951 | Ga0207664_10013204 | |||
| 1952 | Ga0207664_10188517 | |||
| 1953 | Ga0207664_10349754 | |||
| 1954 | Ga0207664_11023849 | |||
| 1955 | Ga0207664_11406503 | |||
| 1956 | Ga0207644_10607524 | |||
| 1957 | Ga0207644_11395869 | |||
| 1958 | Ga0207644_11445561 | |||
| 1959 | Ga0207690_10378930 | |||
| 1960 | Ga0207690_10816458 | |||
| 1961 | Ga0207690_11699793 | |||
| 1962 | Ga0207706_10238535 | |||
| 1963 | Ga0207706_10376236 | |||
| 1964 | Ga0207686_10306875 | |||
| 1965 | Ga0207686_10567364 | |||
| 1966 | Ga0207686_11181630 | |||
| 1967 | Ga0207686_11268417 | |||
| 1968 | Ga0207686_11308336 | |||
| 1969 | Ga0207709_10378051 | |||
| 1970 | Ga0207709_10679275 | |||
| 1971 | Ga0207709_11705995 | |||
| 1972 | Ga0207670_10483325 | |||
| 1973 | Ga0207670_10876273 | |||
| 1974 | Ga0207669_10590397 | |||
| 1975 | Ga0207704_10381179 | |||
| 1976 | Ga0207704_11097340 | |||
| 1977 | Ga0207665_10093767 | |||
| 1978 | Ga0207665_10156686 | |||
| 1979 | Ga0207665_10538390 | |||
| 1980 | Ga0207665_11120148 | |||
| 1981 | Ga0207691_10109959 | |||
| 1982 | Ga0207691_10338956 | |||
| 1983 | Ga0207691_10378322 | |||
| 1984 | Ga0207711_10566014 | |||
| 1985 | Ga0207711_10646607 | |||
| 1986 | Ga0207711_11580752 | |||
| 1987 | Ga0207689_10283116 | |||
| 1988 | Ga0207689_10356813 | |||
| 1989 | Ga0207689_11097820 | |||
| 1990 | Ga0207661_10134171 | |||
| 1991 | Ga0207661_10312338 | |||
| 1992 | Ga0207661_10507115 | |||
| 1993 | Ga0207661_11023139 | |||
| 1994 | Ga0207661_11445891 | |||
| 1995 | Ga0207679_10134482 | |||
| 1996 | Ga0207679_10580051 | |||
| 1997 | Ga0207679_10603655 | |||
| 1998 | Ga0207679_11118091 | |||
| 1999 | Ga0207679_11335824 | |||
| 2000 | Ga0207679_11601543 | |||
| 2001 | Ga0207667_10003395 | |||
| 2002 | Ga0207667_10028084 | |||
| 2003 | Ga0207667_10037024 | |||
| 2004 | Ga0207667_10093645 | |||
| 2005 | Ga0207667_10106551 | |||
| 2006 | Ga0207667_10187762 | |||
| 2007 | Ga0207667_10209148 | |||
| 2008 | Ga0207667_10254703 | |||
| 2009 | Ga0207667_10996978 | |||
| 2010 | Ga0207667_11731198 | |||
| 2011 | Ga0207667_11750772 | |||
| 2012 | Ga0207651_10197922 | |||
| 2013 | Ga0207651_11003188 | |||
| 2014 | Ga0207651_11075585 | |||
| 2015 | Ga0207651_11854572 | |||
| 2016 | Ga0207712_10143112 | |||
| 2017 | Ga0207712_11538804 | |||
| 2018 | Ga0207712_11794073 | |||
| 2019 | Ga0207668_10021038 | |||
| 2020 | Ga0207668_10285380 | |||
| 2021 | Ga0207668_10558029 | |||
| 2022 | Ga0207668_11653573 | |||
| 2023 | Ga0207640_10493870 | |||
| 2024 | Ga0207640_11870078 | |||
| 2025 | Ga0207658_10261485 | |||
| 2026 | Ga0207658_11995076 | |||
| 2027 | Ga0207677_10072204 | |||
| 2028 | Ga0207677_10117535 | |||
| 2029 | Ga0207677_10240025 | |||
| 2030 | Ga0207703_10078418 | |||
| 2031 | Ga0207703_10265177 | |||
| 2032 | Ga0207703_10668424 | |||
| 2033 | Ga0207703_11213045 | |||
| 2034 | Ga0207639_10144693 | |||
| 2035 | Ga0207639_10225659 | |||
| 2036 | Ga0207639_10248114 | |||
| 2037 | Ga0207639_10359443 | |||
| 2038 | Ga0207639_10560095 | |||
| 2039 | Ga0207639_10701292 | |||
| 2040 | Ga0207639_10932998 | |||
| 2041 | Ga0207639_11133279 | |||
| 2042 | Ga0207639_11156561 | |||
| 2043 | Ga0207639_11635626 | |||
| 2044 | Ga0207678_10072593 | |||
| 2045 | Ga0207678_10297766 | |||
| 2046 | Ga0207678_10367948 | |||
| 2047 | Ga0207678_10375438 | |||
| 2048 | Ga0207678_10834336 | |||
| 2049 | Ga0207678_11434023 | |||
| 2050 | Ga0207678_11890598 | |||
| 2051 | Ga0207678_11995560 | |||
| 2052 | Ga0207708_11378489 | |||
| 2053 | Ga0207702_10000005 | |||
| 2054 | Ga0207702_10064501 | |||
| 2055 | Ga0207702_10139358 | |||
| 2056 | Ga0207702_10186112 | |||
| 2057 | Ga0207702_10195381 | |||
| 2058 | Ga0207702_10204982 | |||
| 2059 | Ga0207702_10401780 | |||
| 2060 | Ga0207702_10533570 | |||
| 2061 | Ga0207641_10250063 | |||
| 2062 | Ga0207641_10443238 | |||
| 2063 | Ga0207641_11165306 | |||
| 2064 | Ga0207641_11697790 | |||
| 2065 | Ga0207648_10048974 | |||
| 2066 | Ga0207648_10106063 | |||
| 2067 | Ga0207648_10128591 | |||
| 2068 | Ga0207676_10039245 | |||
| 2069 | Ga0207676_10864448 | |||
| 2070 | Ga0207674_10006041 | |||
| 2071 | Ga0207674_10402890 | |||
| 2072 | Ga0207674_10775997 | |||
| 2073 | Ga0207674_10901603 | |||
| 2074 | Ga0207674_11007966 | |||
| 2075 | Ga0207674_11605451 | |||
| 2076 | Ga0207675_100353332 | |||
| 2077 | Ga0207675_101597889 | |||
| 2078 | Ga0207683_10049694 | |||
| 2079 | Ga0207683_10309642 | |||
| 2080 | Ga0207683_10428023 | |||
| 2081 | Ga0207683_10496604 | |||
| 2082 | Ga0207683_10680796 | |||
| 2083 | Ga0207683_12066700 | |||
| 2084 | Ga0207683_12173990 | |||
| 2085 | Ga0207698_10068911 | |||
| 2086 | Ga0207698_10118539 | |||
| 2087 | Ga0207698_10335700 | |||
| 2088 | Ga0207698_10504843 | |||
| 2089 | Ga0207698_10782700 | |||
| 2090 | Ga0207698_10891043 | |||
| 2091 | Ga0207698_11827730 | |||
| 2092 | Ga0207698_12575972 | |||
| 2093 | Ga0209589_1000018 | |||
| 2094 | Ga0209489_100026 | |||
| 2095 | Ga0209700_100035 | |||
| 2096 | Ga0209179_1003566 | |||
| 2097 | Ga0209983_1061965 | |||
| 2098 | Ga0209971_1132274 | |||
| 2099 | Ga0209813_10389203 | |||
| 2100 | Ga0209974_10005374 | |||
| 2101 | Ga0207428_10164099 | |||
| 2102 | Ga0207428_10498267 | |||
| 2103 | Ga0207428_11285237 | |||
| 2104 | Ga0268266_10041491 | |||
| 2105 | Ga0268266_10055561 | |||
| 2106 | Ga0268266_10099751 | |||
| 2107 | Ga0268266_10125162 | |||
| 2108 | Ga0268266_10249765 | |||
| 2109 | Ga0268265_10908779 | |||
| 2110 | Ga0268265_11363369 | |||
| 2111 | Ga0268265_11403393 | |||
| 2112 | Ga0268264_10185255 | |||
| 2113 | Ga0268264_10208676 | |||
| 2114 | Ga0268264_10354350 | |||
| 2115 | Ga0268264_11372735 | |||
| 2116 | Ga0268264_11810928 | |||
| 2117 | Ga0265337_1004966 | |||
| 2118 | Ga0265326_10002505 | |||
| 2119 | Ga0265319_1024209 | |||
| 2120 | Ga0265334_10009869 | |||
| 2121 | Ga0265334_10031806 | |||
| 2122 | Ga0265318_10032974 | |||
| 2123 | Ga0265323_10000768 | |||
| 2124 | Ga0265322_10063957 | |||
| 2125 | Ga0265336_10000106 | |||
| 2126 | Ga0307517_10000049 | |||
| 2127 | Ga0307517_10278634 | |||
| 2128 | Ga0307515_10016148 | |||
| 2129 | Ga0265338_10000065 | |||
| 2130 | Ga0265338_10077416 | |||
| 2131 | Ga0265338_10398738 | |||
| 2132 | Ga0307511_10333882 | |||
| 2133 | Ga0265330_10018889 | |||
| 2134 | Ga0265330_10019298 | |||
| 2135 | Ga0265330_10030431 | |||
| 2136 | Ga0265330_10055416 | |||
| 2137 | Ga0265330_10267661 | |||
| 2138 | Ga0265330_10290213 | |||
| 2139 | Ga0265332_10337870 | |||
| 2140 | Ga0265328_10194554 | |||
| 2141 | Ga0265328_10227067 | |||
| 2142 | Ga0265325_10034658 | |||
| 2143 | Ga0265325_10038631 | |||
| 2144 | Ga0265325_10069404 | |||
| 2145 | Ga0265325_10108010 | |||
| 2146 | Ga0265325_10231225 | |||
| 2147 | Ga0265325_10368395 | |||
| 2148 | Ga0265325_10373578 | |||
| 2149 | Ga0265340_10005873 | |||
| 2150 | Ga0265340_10070286 | |||
| 2151 | Ga0265340_10330983 | |||
| 2152 | Ga0265340_10438184 | |||
| 2153 | Ga0265339_10053590 | |||
| 2154 | Ga0265339_10064485 | |||
| 2155 | Ga0265339_10081687 | |||
| 2156 | Ga0265339_10158596 | |||
| 2157 | Ga0265331_10011078 | |||
| 2158 | Ga0265331_10475833 | |||
| 2159 | Ga0265316_10429511 | |||
| 2160 | Ga0265316_10603379 | |||
| 2161 | Ga0265316_11210069 | |||
| 2162 | Ga0307513_10458312 | |||
| 2163 | Ga0307509_10731822 | |||
| 2164 | Ga0307408_101286607 | |||
| 2165 | Ga0307408_101323912 | |||
| 2166 | Ga0307408_102305909 | |||
| 2167 | Ga0265313_10035653 | |||
| 2168 | Ga0265313_10204953 | |||
| 2169 | Ga0307508_10212244 | |||
| 2170 | Ga0316575_10133268 | |||
| 2171 | Ga0265314_10000279 | |||
| 2172 | Ga0265314_10005600 | |||
| 2173 | Ga0265314_10038487 | |||
| 2174 | Ga0265314_10239446 | |||
| 2175 | Ga0265342_10001581 | |||
| 2176 | Ga0265342_10013091 | |||
| 2177 | Ga0265342_10151435 | |||
| 2178 | Ga0265342_10476347 | |||
| 2179 | Ga0307516_10051007 | |||
| 2180 | Ga0307516_10538117 | |||
| 2181 | Ga0307405_10202195 | |||
| 2182 | Ga0307406_10155118 | |||
| 2183 | Ga0307409_100525607 | |||
| 2184 | Ga0307416_100462769 | |||
| 2185 | Ga0307416_100609237 | |||
| 2186 | Ga0307411_12195026 | |||
| 2187 | Ga0307415_100533689 | |||
| 2188 | Ga0307415_100911381 | |||
| 2189 | Ga0316583_10175831 | |||
| 2190 | Ga0307510_10337755 | |||
| 2191 | Ga0315911_1000011 | |||
| 2192 | Ga0373930_0040959 | |||
| 2193 | Ga0373959_0110686 | |||
| 2194 | Ga0373934_0240648 | |||
| 2195 | Ga0373940_0350042 | |||
| 2196 | Ga0373923_0417610 | |||
| 2197 | Ga0373932_0404685 | |||
| 2198 | Ga0373936_0279229 | |||
| 2199 | Ga0373936_0631592 | |||
| 2200 | Ga0373939_0003718 | |||
| 2201 | Ga0373939_0055838 | |||
| 2202 | Ga0373941_0531161 | |||
| 2203 | Ga0373945_0105923 | |||
| 2204 | Ga0373953_0124631 | |||
| 2205 | Ga0373954_0011204 | |||
| 2206 | Ga0373954_0130675 | |||
| 2207 | Ga0373954_0180290 | |||
| 2208 | Ga0373956_0409857 | |||
| 2209 | Ga0373956_0596608 | |||
| 2210 | Ga0373957_0016906 | |||
| 2211 | Ga0373957_0092473 | |||
| 2212 | Ga0373957_0132514 | |||
| 2213 | Ga0373960_0360705 | |||
| 2214 | Ga0373943_0033778 | |||
| 2215 | Ga0373943_0545490 | |||
| 2216 | Ga0373943_0893079 | |||
| 2217 | Ga0373946_0269737 | |||
| 2218 | Ga0373946_0379081 | |||
| 2219 | Ga0373955_0001156 | |||
| 2220 | Ga0373942_0167962 | |||
| 2221 | Ga0373961_0014310 | |||
| 2222 | Ga0373961_0192126 | |||
| 2223 | Ga0373962_0329989 | |||
| 2224 | Ga0373924_0337576 | |||
| 2225 | Ga0373924_0399201 | |||
| 2226 | Ga0373931_0036913 | |||
| 2227 | Ga0373931_0038552 | |||
| 2228 | Ga0373931_0313222 | |||
| 2229 | Ga0373931_1247317 | |||
| 2230 | Ga0373935_0116430 | |||
| 2231 | Ga0373935_0294845 | |||
| 2232 | Ga0373935_0380273 | |||
| 2233 | Ga0373927_0030250 | |||
| 2234 | Ga0373927_0835362 | |||
| 2235 | Ga0373933_0004332 | |||
| 2236 | Ga0373933_0381208 | |||
| 2237 | Ga0373947_0083958 | |||
| 2238 | Ga0373947_0294252 | |||
| 2239 | Ga0373947_0363296 | |||
| 2240 | Ga0373947_0623017 | |||
| 2241 | Ga0373947_0640206 | |||
| 2242 | Ga0373947_0658093 | |||
| 2243 | Ga0373937_0002645 | |||
| 2244 | Ga0373937_0009243 | |||
| 2245 | Ga0373937_0081830 | |||
| 2246 | Ga0373937_0195039 | |||
| 2247 | Ga0373925_0071117 | |||
| 2248 | Ga0373925_0173466 | |||
| 2249 | Ga0373925_0209046 | |||
| 2250 | Ga0373925_0269099 | |||
| 2251 | Ga0373925_0393766 | |||
| 2252 | Ga0373925_1524620 | |||
| 2253 | Ga0395899_0016160 | |||
| 2254 | Ga0395899_0672063 | |||
| 2255 | Ga0395900_0011017 | |||
| 2256 | Ga0395900_0035233 | |||
| 2257 | Ga0395900_0167515 | |||
| 2258 | Ga0395898_0065883 | |||
| 2259 | Ga0395898_0630433 | |||
| 2260 | Ga0395905_0366851 | |||
| 2261 | Ga0436364_0073049 | |||
| 2262 | Ga0436364_0292514 | |||
| 2263 | Ga0436364_0328516 | |||
| 2264 | Ga0436364_1059106 | |||
| 2265 | Ga0395901_0069511 | |||
| 2266 | Ga0395901_0968506 | |||
| 2267 | Ga0395901_1275916 | |||
| 2268 | Ga0395901_1561870 | |||
| 2269 | Ga0436365_0100274 | |||
| 2270 | Ga0436365_0240210 | |||
| 2271 | Ga0436365_0319787 | |||
| 2272 | Ga0436365_0769093 | |||
| 2273 | Ga0436365_1322638 | |||
| 2274 | Ga0436365_1378525 | |||
| 2275 | Ga0436365_1580673 | |||
| 2276 | Ga0436365_1749134 | |||
| 2277 | Ga0436365_1884131 | |||
| 2278 | Ga0436360_0102150 | |||
| 2279 | Ga0436360_1140528 | |||
| 2280 | Ga0436361_0236411 | |||
| 2281 | Ga0436361_0777969 | |||
| 2282 | Ga0436363_0425847 | |||
| 2283 | Ga0436363_0762675 | |||
| 2284 | Ga0436363_0928586 | |||
| 2285 | Ga0436362_0248055 | |||
| 2286 | Ga0436362_0344107 | |||
| 2287 | Ga0436362_1029622 | |||
| 2288 | Ga0439465_0188535 | |||
| 2289 | Ga0451791_0376676 | |||
| 2290 | Ga0451798_0632243 | |||
| 2291 | Ga0451804_0738228 | |||
| 2292 | Ga0451807_0427715 | |||
| 2293 | Ga0451833_0003391 | |||
| 2294 | Ga0451833_1307367 | |||
| 2295 | Ga0451839_1205220 | |||
| 2296 | Ga0439448_0111400 | |||
| 2297 | Ga0439459_0048924 | |||
| 2298 | Ga0439459_0096259 | |||
| 2299 | Ga0466961_0613003 | |||
| 2300 | Ga0466963_0053946 | |||
| 2301 | Ga0466963_0403348 | |||
| 2302 | Ga0466963_1317424 | |||
| 2303 | Ga0466964_0195905 | |||
| 2304 | Ga0466964_0290216 | |||
| 2305 | Ga0466957_0664820 | |||
| 2306 | Ga0466957_0842140 | |||
| 2307 | Ga0466967_0050075 | |||
| 2308 | Ga0466967_0176195 | |||
| 2309 | Ga0466967_0228217 | |||
| 2310 | Ga0466967_0469931 | |||
| 2311 | Ga0466967_0534720 | |||
| 2312 | Ga0466967_0689569 | |||
| 2313 | Ga0495592_0153061 | |||
| 2314 | Ga0495592_0216009 | |||
| 2315 | Ga0495592_0513563 | |||
| 2316 | Ga0495592_0580358 | |||
| 2317 | Ga0495592_0713168 | |||
| 2318 | Ga0495603_0138183 | |||
| 2319 | Ga0495603_0179594 | |||
| 2320 | Ga0495603_0644533 | |||
| 2321 | Ga0495590_0258848 | |||
| 2322 | Ga0495629_0587474 | |||
| 2323 | Ga0495629_1107088 | |||
| 2324 | Ga0495638_0183183 | |||
| 2325 | Ga0495638_0241576 | |||
| 2326 | Ga0495651_0222603 | |||
| 2327 | Ga0495651_0371690 | |||
| 2328 | Ga0495651_0493885 | |||
| 2329 | Ga0495651_0666716 | |||
| 2330 | Ga0495653_0083390 | |||
| 2331 | Ga0495653_0391244 | |||
| 2332 | Ga0495580_0344039 | |||
| 2333 | Ga0495580_0427950 | |||
| 2334 | Ga0495582_0087759 | |||
| 2335 | Ga0495639_0075941 | |||
| 2336 | Ga0495662_0070764 | |||
| 2337 | Ga0495662_0543184 | |||
| 2338 | Ga0495664_0155701 | |||
| 2339 | Ga0495664_0163895 | |||
| 2340 | Ga0495664_0451667 | |||
| 2341 | Ga0495584_0049523 | |||
| 2342 | Ga0495585_0027259 | |||
| 2343 | Ga0495585_0069838 | |||
| 2344 | Ga0495585_0241639 | |||
| 2345 | Ga0495594_0210874 | |||
| 2346 | Ga0495607_0089064 | |||
| 2347 | Ga0495583_0232497 | |||
| 2348 | Ga0495608_0376056 | |||
| 2349 | Ga0495608_0472963 | |||
| 2350 | Ga0495608_0671573 | |||
| 2351 | Ga0495610_0140653 | |||
| 2352 | Ga0495610_0392143 | |||
| 2353 | Ga0495616_0275474 | |||
| 2354 | Ga0495616_0469300 | |||
| 2355 | Ga0495618_0143385 | |||
| 2356 | Ga0495618_0175314 | |||
| 2357 | Ga0495628_0186603 | |||
| 2358 | Ga0495628_0719569 | |||
| 2359 | Ga0495630_0048011 | |||
| 2360 | Ga0495630_0133090 | |||
| 2361 | Ga0495630_0299001 | |||
| 2362 | Ga0495630_0335599 | |||
| 2363 | Ga0495630_0652592 | |||
| 2364 | Ga0495630_1271631 | |||
| 2365 | Ga0495631_0189854 | |||
| 2366 | Ga0495632_0304676 | |||
| 2367 | Ga0495643_0265263 | |||
| 2368 | Ga0495643_0289963 | |||
| 2369 | Ga0495644_0133874 | |||
| 2370 | Ga0495663_0068414 | |||
| 2371 | Ga0495663_0159269 | |||
| 2372 | Ga0495642_0299187 | |||
| 2373 | Ga0495642_0454582 | |||
| 2374 | Ga0495652_0045076 | |||
| 2375 | Ga0495652_0189843 | |||
| 2376 | Ga0495665_0245770 | |||
| 2377 | Ga0495640_0780270 | |||
| 2378 | Ga0495586_0790312 | |||
| 2379 | Ga0495598_0010889 | |||
| 2380 | Ga0495609_0227648 | |||
| 2381 | Ga0495609_0282149 | |||
| 2382 | Ga0495609_0285029 | |||
| 2383 | Ga0495621_0029547 | |||
| 2384 | Ga0495645_0141873 | |||
| 2385 | Ga0495645_0285748 | |||
| 2386 | Ga0495633_0061493 | |||
| 2387 | Ga0495633_0203873 | |||
| 2388 | Ga0495667_0099573 | |||
| 2389 | Ga0495667_0220702 | |||
| 2390 | Ga0495656_0021230 | |||
| 2391 | Ga0495656_0053723 | |||
| 2392 | Ga0495634_0075249 | |||
| 2393 | Ga0495634_0518249 | |||
| 2394 | Ga0495634_0820268 | |||
| 2395 | Ga0495611_0351367 | |||
| 2396 | Ga0495625_0515479 | |||
| 2397 | Ga0495635_0225530 | |||
| 2398 | Ga0495635_0433090 | |||
| 2399 | Ga0495659_0007740 | |||
| 2400 | Ga0495659_0020845 | |||
| 2401 | Ga0495659_0076988 | |||
| 2402 | Ga0495588_0004075 | |||
| 2403 | Ga0495588_0145430 | |||
| 2404 | Ga0495657_0330645 | |||
| 2405 | Ga0495623_0170314 | |||
| 2406 | Ga0495623_0412606 | |||
| 2407 | Ga0495623_0539276 | |||
| 2408 | Ga0495646_0556401 | |||
| 2409 | Ga0495646_0596124 | |||
| 2410 | Ga0495647_0369891 | |||
| 2411 | Ga0495658_0050898 | |||
| 2412 | Ga0495658_0151800 | |||
| 2413 | Ga0495669_0272223 | |||
| 2414 | Ga0495669_0653146 | |||
| 2415 | Ga0495613_0425698 | |||
| 2416 | Ga0495613_1069084 | |||
| 2417 | Ga0495624_0228367 | |||
| 2418 | Ga0495624_0283586 | |||
| 2419 | Ga0495670_0061360 | |||
| 2420 | Ga0495670_0347768 | |||
| 2421 | Ga0495670_0705509 | |||
| 2422 | Ga0495589_0320157 | |||
| 2423 | Ga0495600_0026554 | |||
| 2424 | Ga0495600_0036563 | |||
| 2425 | Ga0495600_0131182 | |||
| 2426 | Ga0495600_0489647 | |||
| 2427 | Ga0495581_0166707 | |||
| 2428 | Ga0495581_0451895 | |||
| 2429 | Ga0495604_0044602 | |||
| 2430 | Ga0495604_0404266 | |||
| 2431 | Ga0495636_0662386 | |||
| 2432 | Ga0495674_0069187 | |||
| 2433 | Ga0495674_0074745 | |||
| 2434 | Ga0495672_0411430 | |||
| 2435 | Ga0495672_0558339 | |||
| 2436 | Ga0495676_0108457 | |||
| 2437 | Ga0495676_0467814 | |||
| 2438 | Ga0495680_0055741 | |||
| 2439 | Ga0495680_0266840 | |||
| 2440 | Ga0495680_1085824 | |||
| 2441 | Ga0495683_0237225 | |||
| 2442 | Ga0495675_0654886 | |||
| 2443 | Ga0495677_0134655 | |||
| 2444 | Ga0495685_041479 | |||
| 2445 | Ga0495673_0019962 | |||
| 2446 | Ga0495673_0362873 | |||
| 2447 | Ga0495684_0460164 | |||
| 2448 | Ga0495686_0061480 | |||
| 2449 | Ga0495686_0200816 | |||
| 2450 | Ga0495593_0108357 | |||
| 2451 | Ga0495593_0275611 | |||
| 2452 | Ga0495602_0130662 | |||
| 2453 | Ga0495602_0519251 | |||
| 2454 | Ga0495615_0060334 | |||
| 2455 | Ga0495615_0134522 | |||
| 2456 | Ga0496100_0190606 | |||
| 2457 | Ga0496100_0352606 | |||
| 2458 | Ga0496100_0549709 | |||
| 2459 | Ga0496100_1373750 | |||
| 2460 | Ga0496100_1565766 | |||
| 2461 | Ga0496101_0036355 | |||
| 2462 | Ga0496101_0081293 | |||
| 2463 | Ga0496102_0002717 | |||
| 2464 | Ga0496102_0160243 | |||
| 2465 | Ga0496102_0335270 | |||
| 2466 | Ga0496102_0617869 | |||
| 2467 | Ga0496102_0618200 | |||
| 2468 | Ga0496103_0056811 | |||
| 2469 | Ga0496103_0071931 | |||
| 2470 | Ga0496104_0002941 | |||
| 2471 | Ga0496104_0029175 | |||
| 2472 | Ga0496104_0075863 | |||
| 2473 | Ga0496104_0454515 | |||
| 2474 | Ga0496104_0459207 | |||
| 2475 | Ga0496104_0942522 | |||
| 2476 | Ga0496105_0005733 | |||
| 2477 | Ga0496105_0017928 | |||
| 2478 | Ga0496105_0074254 | |||
| 2479 | Ga0496105_0294135 | |||
| 2480 | Ga0496105_0313483 | |||
| 2481 | Ga0496106_0014967 | |||
| 2482 | Ga0496106_0016026 | |||
| 2483 | Ga0496106_0084769 | |||
| 2484 | Ga0496106_0297696 | |||
| 2485 | Ga0496106_0383888 | |||
| 2486 | Ga0496107_0001922 | |||
| 2487 | Ga0496107_0348539 | |||
| 2488 | Ga0496107_0455858 | |||
| 2489 | Ga0496108_0030372 | |||
| 2490 | Ga0496108_0056465 | |||
| 2491 | Ga0496108_0620605 | |||
| 2492 | Ga0496108_0771812 | |||
| 2493 | Ga0496108_0932025 | |||
| 2494 | Ga0496108_1541789 | |||
| 2495 | Ga0496109_0009086 | |||
| 2496 | Ga0496109_0090304 | |||
| 2497 | Ga0496109_0123380 | |||
| 2498 | Ga0496109_0341369 | |||
| 2499 | Ga0496109_0486359 | |||
| 2500 | Ga0496109_1823163 | |||
| 2501 | Ga0496110_0038281 | |||
| 2502 | Ga0496110_0113484 | |||
| 2503 | Ga0496110_0200625 | |||
| 2504 | Ga0496110_0238575 | |||
| 2505 | Ga0496110_0813146 | |||
| 2506 | Ga0496110_1078655 | |||
| 2507 | Ga0496111_0097742 | |||
| 2508 | Ga0496111_0177095 | |||
| 2509 | Ga0496111_0199569 | |||
| 2510 | Ga0496112_0002573 | |||
| 2511 | Ga0496112_0007029 | |||
| 2512 | Ga0496112_0125937 | |||
| 2513 | Ga0496112_0261604 | |||
| 2514 | Ga0496112_0449154 | |||
| 2515 | Ga0496112_0527468 | |||
| 2516 | Ga0496112_1017784 | |||
| 2517 | Ga0496112_1375693 | |||
| 2518 | Ga0496113_0013099 | |||
| 2519 | Ga0496113_0031098 | |||
| 2520 | Ga0496113_0382057 | |||
| 2521 | Ga0496114_0002764 | |||
| 2522 | Ga0496114_0014426 | |||
| 2523 | Ga0496114_0393571 | |||
| 2524 | Ga0496114_0810483 | |||
| 2525 | Ga0496115_0002584 | |||
| 2526 | Ga0496115_0179761 | |||
| 2527 | Ga0496115_0207303 | |||
| 2528 | Ga0496115_0789722 | |||
| 2529 | Ga0496116_0412377 | |||
| 2530 | Ga0496117_0014771 | |||
| 2531 | Ga0496117_0553394 | |||
| 2532 | Ga0496118_0280439 | |||
| 2533 | Ga0496122_0058323 | |||
| 2534 | Ga0496122_0067307 | |||
| 2535 | Ga0496122_0284740 | |||
| 2536 | Ga0496123_0051308 | |||
| 2537 | Ga0496123_0499237 | |||
| 2538 | Ga0496124_0043751 | |||
| 2539 | Ga0496124_0129566 | |||
| 2540 | Ga0496124_0537831 | |||
| 2541 | Ga0496125_0157834 | |||
| 2542 | Ga0496125_0420089 | |||
| 2543 | Ga0496126_0033861 | |||
| 2544 | Ga0496126_0054724 | |||
| 2545 | Ga0496126_0082115 | |||
| 2546 | Ga0496126_0118549 | |||
| 2547 | Ga0496126_0180895 | |||
| 2548 | Ga0496126_0426376 | |||
| 2549 | Ga0501031_0007305 | |||
| 2550 | Ga0501031_0026899 | |||
| 2551 | Ga0501031_0032706 | |||
| 2552 | Ga0501031_0303793 | |||
| 2553 | Ga0501031_0407277 | |||
| 2554 | Ga0501032_0003464 | |||
| 2555 | Ga0501032_0027450 | |||
| 2556 | Ga0501032_0041713 | |||
| 2557 | Ga0501032_0160672 | |||
| 2558 | Ga0501032_0165828 | |||
| 2559 | Ga0501032_0343154 | |||
| 2560 | Ga0501033_0000523 | |||
| 2561 | Ga0501033_0025990 | |||
| 2562 | Ga0501033_0031583 | |||
| 2563 | Ga0501033_0582565 | |||
| 2564 | Ga0501033_0951721 | |||
| 2565 | Ga0501033_1182470 | |||
| 2566 | Ga0501034_0000244 | |||
| 2567 | Ga0501034_0001899 | |||
| 2568 | Ga0501034_0025626 | |||
| 2569 | Ga0501034_0043426 | |||
| 2570 | Ga0501034_0052541 | |||
| 2571 | Ga0501034_0064860 | |||
| 2572 | Ga0501034_0085570 | |||
| 2573 | Ga0501034_0091553 | |||
| 2574 | Ga0501034_0102308 | |||
| 2575 | Ga0501034_0173224 | |||
| 2576 | Ga0501034_0366143 | |||
| 2577 | Ga0501034_0371724 | |||
| 2578 | Ga0501034_0426375 | |||
| 2579 | Ga0501034_0833469 | |||
| 2580 | Ga0501034_1295284 | |||
| 2581 | Ga0501034_1631875 | |||
| 2582 | Ga0501036_0001110 | |||
| 2583 | Ga0501036_0033599 | |||
| 2584 | Ga0501036_0051128 | |||
| 2585 | Ga0501036_0055614 | |||
| 2586 | Ga0501036_0063933 | |||
| 2587 | Ga0501036_0154923 | |||
| 2588 | Ga0501036_0424537 | |||
| 2589 | Ga0501036_1282126 | |||
| 2590 | Ga0501037_0015888 | |||
| 2591 | Ga0501037_0016521 | |||
| 2592 | Ga0501037_0022009 | |||
| 2593 | Ga0501037_0023191 | |||
| 2594 | Ga0501037_0035338 | |||
| 2595 | Ga0501037_0262861 | |||
| 2596 | Ga0501037_1076075 | |||
| 2597 | Ga0501038_0008819 | |||
| 2598 | Ga0501038_0022305 | |||
| 2599 | Ga0501038_0044703 | |||
| 2600 | Ga0501038_0054012 | |||
| 2601 | Ga0501038_0471250 | |||
| 2602 | Ga0501038_0612683 | |||
| 2603 | Ga0501039_0021072 | |||
| 2604 | Ga0501039_0031296 | |||
| 2605 | Ga0501039_0068215 | |||
| 2606 | Ga0501039_0185825 | |||
| 2607 | Ga0501039_0186238 | |||
| 2608 | Ga0501039_0333318 | |||
| 2609 | Ga0501041_0395008 | |||
| 2610 | Ga0501042_0202945 | |||
| 2611 | Ga0501042_0488139 | |||
| 2612 | Ga0501043_0000380 | |||
| 2613 | Ga0501043_0006697 | |||
| 2614 | Ga0501043_0019608 | |||
| 2615 | Ga0501043_0026393 | |||
| 2616 | Ga0501043_0055833 | |||
| 2617 | Ga0501043_0275968 | |||
| 2618 | Ga0501043_0745086 | |||
| 2619 | Ga0501046_0007508 | |||
| 2620 | Ga0501046_0009446 | |||
| 2621 | Ga0501046_0036728 | |||
| 2622 | Ga0501046_0146595 | |||
| 2623 | Ga0501047_0000521 | |||
| 2624 | Ga0501047_0005189 | |||
| 2625 | Ga0501047_0030190 | |||
| 2626 | Ga0501047_0068797 | |||
| 2627 | Ga0501047_0098722 | |||
| 2628 | Ga0501047_0130130 | |||
| 2629 | Ga0501047_0243872 | |||
| 2630 | Ga0501047_0325419 | |||
| 2631 | Ga0501047_0616871 | |||
| 2632 | Ga0501047_0926115 | |||
| 2633 | Ga0501048_0000424 | |||
| 2634 | Ga0501048_0004846 | |||
| 2635 | Ga0501048_0294372 | |||
| 2636 | Ga0501048_0597826 | |||
| 2637 | Ga0501067_0194643 | |||
| 2638 | Ga0501067_0195512 | |||
| 2639 | Ga0501067_0256582 | |||
| 2640 | Ga0501067_0281019 | |||
| 2641 | Ga0501067_0635334 | |||
| 2642 | Ga0501067_0643769 | |||
| 2643 | Ga0501068_0003418 | |||
| 2644 | Ga0501068_0262260 | |||
| 2645 | Ga0501069_0012683 | |||
| 2646 | Ga0501069_0016017 | |||
| 2647 | Ga0501069_0018041 | |||
| 2648 | Ga0501069_0019206 | |||
| 2649 | Ga0501069_0177979 | |||
| 2650 | Ga0501069_0205130 | |||
| 2651 | Ga0501069_0213732 | |||
| 2652 | Ga0501069_0444635 | |||
| 2653 | Ga0501070_0007500 | |||
| 2654 | Ga0501070_0011437 | |||
| 2655 | Ga0501070_0016197 | |||
| 2656 | Ga0501070_0024817 | |||
| 2657 | Ga0501070_0036225 | |||
| 2658 | Ga0501070_0195976 | |||
| 2659 | Ga0501070_0350821 | |||
| 2660 | Ga0501070_0422475 | |||
| 2661 | Ga0501070_0444694 | |||
| 2662 | Ga0501070_0483043 | |||
| 2663 | Ga0501070_0665296 | |||
| 2664 | Ga0501070_0787463 | |||
| 2665 | Ga0501071_0006065 | |||
| 2666 | Ga0501071_0201317 | |||
| 2667 | Ga0501071_0574898 | |||
| 2668 | Ga0501071_0881555 | |||
| 2669 | Ga0501071_1282452 | |||
| 2670 | Ga0501071_1456162 | |||
| 2671 | Ga0501072_0102571 | |||
| 2672 | Ga0501072_0134575 | |||
| 2673 | Ga0501072_0342943 | |||
| 2674 | Ga0501073_0003978 | |||
| 2675 | Ga0501073_0040392 | |||
| 2676 | Ga0501073_0168203 | |||
| 2677 | Ga0501073_0288425 | |||
| 2678 | Ga0501073_0485297 | |||
| 2679 | Ga0501073_0509793 | |||
| 2680 | Ga0501073_0699090 | |||
| 2681 | Ga0501073_0900771 | |||
| 2682 | Ga0501073_1217048 | |||
| 2683 | Ga0501074_0036354 | |||
| 2684 | Ga0501074_0046359 | |||
| 2685 | Ga0501074_0192385 | |||
| 2686 | Ga0501074_0327635 | |||
| 2687 | Ga0501074_0540447 | |||
| 2688 | Ga0501074_0586624 | |||
| 2689 | Ga0501074_0978368 | |||
| 2690 | Ga0501074_1051128 | |||
| 2691 | Ga0501074_1296034 | |||
| 2692 | Ga0501075_1018460 | |||
| 2693 | Ga0501075_1202174 | |||
| 2694 | Ga0501076_0453461 | |||
| 2695 | Ga0501077_0669814 | |||
| 2696 | Ga0501257_194851 | |||
| 2697 | Ga0501079_0471977 | |||
| 2698 | Ga0501080_0000112 | |||
| 2699 | Ga0501080_0007633 | |||
| 2700 | Ga0501080_0030524 | |||
| 2701 | Ga0501080_0057546 | |||
| 2702 | Ga0501080_0082182 | |||
| 2703 | Ga0501080_0339542 | |||
| 2704 | Ga0501080_0420435 | |||
| 2705 | Ga0501080_0665352 | |||
| 2706 | Ga0501080_0705034 | |||
| 2707 | Ga0501080_0717799 | |||
| 2708 | Ga0501081_0097284 | |||
| 2709 | Ga0501081_0276849 | |||
| 2710 | Ga0501081_0458287 | |||
| 2711 | Ga0501081_1016023 | |||
| 2712 | Ga0501083_0006103 | |||
| 2713 | Ga0501083_0011763 | |||
| 2714 | Ga0501083_0024733 | |||
| 2715 | Ga0501083_0339484 | |||
| 2716 | Ga0501083_0416082 | |||
| 2717 | Ga0501083_0464387 | |||
| 2718 | Ga0501083_0474824 | |||
| 2719 | Ga0501083_0604406 | |||
| 2720 | Ga0501083_0816798 | |||
| 2721 | Ga0501035_0015935 | |||
| 2722 | Ga0501035_0018834 | |||
| 2723 | Ga0501035_0133597 | |||
| 2724 | Ga0501035_0150556 | |||
| 2725 | Ga0501035_0296812 | |||
| 2726 | Ga0501044_0004299 | |||
| 2727 | Ga0501044_0024093 | |||
| 2728 | Ga0501044_0065711 | |||
| 2729 | Ga0501044_0085913 | |||
| 2730 | Ga0501044_0102116 | |||
| 2731 | Ga0501044_0134956 | |||
| 2732 | Ga0501044_0167788 | |||
| 2733 | Ga0501044_0325949 | |||
| 2734 | Ga0501044_0520922 | |||
| 2735 | Ga0501044_0558284 | |||
| 2736 | Ga0501044_0642508 | |||
| 2737 | Ga0501044_1129306 | |||
| 2738 | Ga0501044_1425840 | |||
| 2739 | Ga0501045_0034195 | |||
| 2740 | Ga0501045_0605438 | |||
| 2741 | Ga0501045_0644780 | |||
| 2742 | nmdc:mga03683_55294_c1 | |||
| 2743 | nmdc:mga03683_56534_c2 | |||
| 2744 | nmdc:mga03n38_276591_c1 | |||
| 2745 | nmdc:mga03n38_907620_c1 | |||
| 2746 | nmdc:mga00v17_120777_c1 | |||
| 2747 | nmdc:mga00v17_353319_c1 | |||
| 2748 | nmdc:mga0yw44_1003219_c1 | |||
| 2749 | nmdc:mga0yw44_1025129_c1 | |||
| 2750 | nmdc:mga0yw44_186918_c1 | |||
| 2751 | nmdc:mga0yw44_28483_c1 | |||
| 2752 | nmdc:mga0yw44_31676_c1 | |||
| 2753 | nmdc:mga0yw44_32289_c1 | |||
| 2754 | nmdc:mga0k408_26017_c1 | |||
| 2755 | nmdc:mga0k408_300135_c1 | |||
| 2756 | nmdc:mga06z11_38399_c1 | |||
| 2757 | nmdc:mga06z11_474709_c1 | |||
| 2758 | nmdc:mga04h51_84942_c1 | |||
| 2759 | nmdc:mga07m45_311878_c1 | |||
| 2760 | nmdc:mga05p37_1107618_c1 | |||
| 2761 | nmdc:mga05p37_1602956_c1 | |||
| 2762 | nmdc:mga05p37_32622_c1 | |||
| 2763 | nmdc:mga05p37_690326_c1 | |||
| 2764 | nmdc:mga09592_1630694_c1 | |||
| 2765 | nmdc:mga09592_271584_c1 | |||
| 2766 | nmdc:mga09592_346412_c1 | |||
| 2767 | nmdc:mga0qj67_1478629_c1 | |||
| 2768 | nmdc:mga0qj67_30661_c1 | |||
| 2769 | nmdc:mga0qj67_54997_c1 | |||
| 2770 | nmdc:mga0qj67_64_c1 | |||
| 2771 | nmdc:mga06r32_1128416_c1 | |||
| 2772 | nmdc:mga06r32_1518803_c1 | |||
| 2773 | nmdc:mga06r32_219896_c1 | |||
| 2774 | nmdc:mga06r32_668407_c1 | |||
| 2775 | nmdc:mga08y16_184437_c1 | |||
| 2776 | nmdc:mga08y16_2109952_c1 | |||
| 2777 | nmdc:mga08y16_273732_c1 | |||
| 2778 | nmdc:mga08y16_298073_c1 | |||
| 2779 | nmdc:mga0n895_374112_c1 | |||
| 2780 | nmdc:mga0n895_42898_c1 | |||
| 2781 | nmdc:mga0n895_6291_c1 | |||
| 2782 | nmdc:mga0n895_64463_c1 | |||
| 2783 | nmdc:mga0n895_714984_c1 | |||
| 2784 | nmdc:mga0rr50_327667_c1 | |||
| 2785 | nmdc:mga0rr50_353313_c1 | |||
| 2786 | nmdc:mga0rr50_434605_c1 | |||
| 2787 | nmdc:mga08x19_4095_c1 | |||
| 2788 | nmdc:mga0a205_19348_c2 | |||
| 2789 | nmdc:mga0a205_211695_c1 | |||
| 2790 | nmdc:mga0a205_523146_c1 | |||
| 2791 | nmdc:mga0sz30_162599_c1 | |||
| 2792 | nmdc:mga0sz30_369702_c1 | |||
| 2793 | nmdc:mga0sz30_87805_c1 | |||
| 2794 | Ga0495601_0001005 | |||
| 2795 | Ga0495601_0001502 | |||
| 2796 | Ga0495601_0276964 | |||
| 2797 | Ga0495601_0891888 | |||
| 2798 | Ga0495601_0988601 | |||
| 2799 | Ga0495612_0078690 | |||
| 2800 | Ga0495612_0157233 | |||
| 2801 | Ga0495612_0268218 | |||
| 2802 | Ga0495612_0417392 | |||
| 2803 | Ga0500635_0095768 | |||
| 2804 | Ga0495655_0036965 | |||
| 2805 | Ga0495655_0236188 | |||
| 2806 | Ga0495595_0000987 | |||
| 2807 | Ga0495595_0054776 | |||
| 2808 | Ga0495619_0000161 | |||
| 2809 | Ga0495619_0006746 | |||
| 2810 | Ga0495619_0642297 | |||
| 2811 | Ga0500643_001129 | |||
| 2812 | Ga0500643_086825 | |||
| 2813 | Ga0500643_150371 | |||
| 2814 | Ga0500644_0002768 | |||
| 2815 | Ga0500583_0558446 | |||
| 2816 | Ga0500651_0006160 | |||
| 2817 | Ga0500651_0083955 | |||
| 2818 | Ga0500651_0582998 | |||
| 2819 | Ga0500566_0163606 | |||
| 2820 | Ga0500566_0211256 | |||
| 2821 | Ga0500640_031993 | |||
| 2822 | Ga0500641_0159594 | |||
| 2823 | Ga0500641_0370541 | |||
| 2824 | Ga0500572_002430 | |||
| 2825 | Ga0500592_076881 | |||
| 2826 | Ga0500594_0068367 | |||
| 2827 | Ga0500595_000056 | |||
| 2828 | Ga0500595_009755 | |||
| 2829 | Ga0500595_074125 | |||
| 2830 | Ga0500595_121715 | |||
| 2831 | Ga0500607_051599 | |||
| 2832 | Ga0500608_106842 | |||
| 2833 | Ga0500608_176252 | |||
| 2834 | Ga0500608_291454 | |||
| 2835 | Ga0500614_009286 | |||
| 2836 | Ga0500621_193686 | |||
| 2837 | Ga0500642_0135948 | |||
| 2838 | Ga0500642_0201847 | |||
| 2839 | Ga0500652_000030 | |||
| 2840 | Ga0500652_120098 | |||
| 2841 | Ga0500655_029480 | |||
| 2842 | Ga0500658_0130580 | |||
| 2843 | Ga0500658_0408077 | |||
| 2844 | Ga0500559_0042567 | |||
| 2845 | Ga0500559_0154758 | |||
| 2846 | Ga0500561_0089912 | |||
| 2847 | Ga0500561_0180128 | |||
| 2848 | Ga0500564_161358 | |||
| 2849 | Ga0500568_0025558 | |||
| 2850 | Ga0500568_0243133 | |||
| 2851 | Ga0500577_0050367 | |||
| 2852 | Ga0500588_0247853 | |||
| 2853 | Ga0500590_213529 | |||
| 2854 | Ga0500616_0000006 | |||
| 2855 | Ga0500616_0090724 | |||
| 2856 | Ga0500620_020681 | |||
| 2857 | Ga0500627_0319172 | |||
| 2858 | Ga0500627_0427818 | |||
| 2859 | Ga0500627_0488193 | |||
| 2860 | Ga0500633_0140075 | |||
| 2861 | Ga0500634_0133905 | |||
| 2862 | Ga0500638_176301 | |||
| 2863 | Ga0500636_0011608 | |||
| 2864 | Ga0500636_0028470 | |||
| 2865 | Ga0500636_0045018 | |||
| 2866 | Ga0500637_0275733 | |||
| 2867 | Ga0500576_112303 | |||
| 2868 | Ga0500645_000532 | |||
| 2869 | Ga0500645_108749 | |||
| 2870 | Ga0501084_0122229 | |||
| 2871 | Ga0501084_0151938 | |||
| 2872 | Ga0501084_0281502 | |||
| 2873 | Ga0501084_1738663 | |||
| 2874 | Ga0587084_041071 | |||
| 2875 | Ga0587077_173207 | |||
| 2876 | Ga0587083_0114664 | |||
| 2877 | Ga0587090_161839 | |||
| 2878 | Ga0587098_102561 | |||
| 2879 | Ga0587111_0023142 | |||
| 2880 | Ga0501082_0016603 | |||
| 2881 | Ga0501082_0060204 | |||
| 2882 | Ga0501082_0206503 | |||
| 2883 | Ga0501082_0249729 | |||
| 2884 | Ga0501082_0687711 | |||
| 2885 | Ga0501082_0726373 | |||
| 2886 | Ga0530510_0250961 | |||
| 2887 | Ga0530510_0488110 | |||
| 2888 | Ga0530510_1187921 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dez-assembly1.cif.gz_A | structure of msdpo4 | 0.7329 | 17 | 76 |
| 7pmn-assembly1.cif.gz_Q | s. cerevisiae replisome-scf(dia2) complex bound to double-stranded dna (conformation ii) | 0.7231 | 19 | 78 |
| 5iud-assembly1.cif.gz_A | human dna polymerase alpha in binary complex with a dna:dna template-primer | 0.7182 | 19 | 80 |
| 5iud-assembly3.cif.gz_G | human dna polymerase alpha in binary complex with a dna:dna template-primer | 0.7174 | 19 | 80 |
| 6lpq-assembly1.cif.gz_A | crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) | 0.6911 | 2 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q07864_1537_1925_3.90.1600.10 | Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain | 0.7309 | 17 | 80 | 3.90.1600.10 |
| af_O62218_1468_1869_3.90.1600.10 | Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain | 0.7293 | 23 | 80 | 3.90.1600.10 |
| af_A0A1D6LBV0_420_523_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.7284 | 17 | 69 | 3.90.1150.10 |
| af_Q54RD4_1526_1955_3.90.1600.10 | Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain | 0.7256 | 19 | 80 | 3.90.1600.10 |
| af_A0A0P0VJF3_230_422_3.90.1600.10 | Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain | 0.7162 | 19 | 80 | 3.90.1600.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R7PEZ4-F1-model_v4 | DNA polymerase V subunit UmuC | 0.8024 | 18 | 76 |
GO:0003684
GO:0003887 GO:0005829 GO:0009432 GO:0016020 GO:0042276 |
| AF-A0A6N9Q4N7-F1-model_v4 | Response regulator transcription factor | 0.7754 | 2 | 76 |
GO:0000160
GO:0003700 GO:0043565 |
| AF-A0A7X0H7J2-F1-model_v4 | Lipopolysaccharide/colanic/teichoic acid biosynthesis glycosyltransferase | 0.7708 | 2 | 79 |
GO:0016020
GO:0016780 |
| AF-A0A117KNB8-F1-model_v4 | Diguanylate cyclase | 0.7624 | 2 | 76 |
|
| AF-A0A7C5CNU6-F1-model_v4 | Diguanylate cyclase | 0.7611 | 2 | 76 |
|