F493984

General Info

Members Datasets Scaffolds Average Seq Length
1441 438 2880 306

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10001040|Ga0207706_1000104015
Length 362
Sequence MRFLVSICISHTGISRCPIGQDKNYWSYCGAKPGLVRGSTLNTPRQVHSSAIFKEDIMHPVIEVSGVRKTYGKTVAVEEASFSVNQGEIFGLIGPNGAGKTTTMECIEGIRKPDAGSIAVLGLDPFRQVYKLQDRIGVQLQQAQLQKRIKVWEAVDLWASLYGKNVIDGKRLLEQLGLTEKRGSWFMNLSGGQKQRLFIALALINDPEVVFLDELTTGLDPQARHAIWDLVRGIRERGKTVFLTTHLMEEAERLCDRVAIMEHGRIIDIDTPDGLVRRHCPERTVVLVADDPAAGEHFKAIPEAESVSCVNARFTIRGRGDDLITAVIRCLSENRIRVTDFRTILPNLEDVFLKLTGHSIRE

Samples

Sample ID Description Type Environment
1 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
133 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
134 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
207 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
212 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
213 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
214 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
215 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
216 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
217 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
224 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
225 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
234 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
235 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
252 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
253 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
254 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
255 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
256 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
257 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
258 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
272 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
281 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
284 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
287 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
290 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
291 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
292 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
293 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
294 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
299 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
303 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
304 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
314 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
320 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
332 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
354 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
389 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
390 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
391 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
392 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
395 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
396 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
397 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
398 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
399 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
400 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
401 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
402 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
403 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
404 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
405 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
406 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
407 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
408 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
409 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
410 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
413 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
414 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
417 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
418 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
419 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
420 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
421 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
422 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
423 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
424 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
425 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
426 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
427 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
428 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
429 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
430 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
431 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
434 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
435 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
436 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
437 2738543010 Bacillus sp. YR335 Isolate Unclassified
438 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.35
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 0
Rhizoplane 2.85
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207706_10001040 3300025933 Bacteria 28167
2 Ga0065712_10014421 3300005290 Bacteria 2274
3 Ga0065712_10072146 3300005290 Bacteria 4882
4 Ga0065712_10072991 3300005290 Bacteria 4543
5 Ga0065712_10075375 3300005290 Bacteria 3876
6 Ga0065715_10099686 3300005293 Bacteria 3363
7 Ga0065715_10124057 3300005293 Bacteria 2163
8 Ga0065715_10155456 3300005293 Bacteria 1682
9 Ga0065715_10156126 3300005293 Bacteria 1670
10 Ga0065715_10206215 3300005293 Bacteria 1336
11 Ga0065715_10230884 3300005293 Bacteria 1234
12 Ga0065715_10292306 3300005293 Bacteria 1060
13 Ga0065707_10093908 3300005295 Bacteria 3564
14 Ga0065707_10115964 3300005295 Bacteria 2252
15 Ga0065707_10252124 3300005295 Bacteria 1122
16 Ga0070658_10048484 3300005327 Bacteria 3440
17 Ga0070658_10183548 3300005327 Bacteria 1761
18 Ga0070683_100000006 3300005329 Bacteria 361071
19 Ga0070683_100013610 3300005329 Bacteria 7099
20 Ga0070683_100016793 3300005329 Bacteria 6457
21 Ga0070683_100044786 3300005329 Bacteria 4082
22 Ga0070683_100075972 3300005329 Bacteria 3140
23 Ga0070683_100100134 3300005329 Bacteria 2728
24 Ga0070683_100207291 3300005329 Bacteria 1862
25 Ga0070670_100004011 3300005331 Bacteria 12287
26 Ga0070670_100010057 3300005331 Bacteria 8075
27 Ga0070670_100024330 3300005331 Bacteria 5208
28 Ga0070670_100029763 3300005331 Bacteria 4703
29 Ga0070670_100068225 3300005331 Bacteria 3053
30 Ga0070670_100113896 3300005331 Bacteria 2331
31 Ga0070670_100122843 3300005331 Bacteria 2240
32 Ga0070670_100162656 3300005331 Bacteria 1935
33 Ga0070670_100162905 3300005331 Bacteria 1933
34 Ga0070670_100167968 3300005331 Bacteria 1902
35 Ga0070670_100184051 3300005331 Bacteria 1814
36 Ga0070677_10018146 3300005333 Bacteria 2531
37 Ga0070677_10027620 3300005333 Bacteria 2138
38 Ga0068869_100000218 3300005334 Bacteria 29911
39 Ga0068869_100000577 3300005334 Bacteria 20570
40 Ga0070666_10145847 3300005335 Bacteria 1650
41 Ga0070666_10354008 3300005335 Bacteria 1051
42 Ga0070680_100002912 3300005336 Bacteria 12721
43 Ga0070680_100022662 3300005336 Bacteria 5005
44 Ga0070680_100495431 3300005336 Bacteria 1045
45 Ga0070682_100001496 3300005337 Bacteria 13093
46 Ga0070682_100117615 3300005337 Bacteria 1780
47 Ga0068868_100008832 3300005338 Bacteria 7219
48 Ga0070660_100116839 3300005339 Bacteria 2127
49 Ga0070660_100481768 3300005339 Bacteria 1031
50 Ga0070689_100014965 3300005340 Bacteria 5648
51 Ga0070689_100025345 3300005340 Bacteria 4454
52 Ga0070689_100037287 3300005340 Bacteria 3717
53 Ga0070689_100040620 3300005340 Bacteria 3568
54 Ga0070689_100046098 3300005340 Bacteria 3358
55 Ga0070689_100171999 3300005340 Bacteria 1755
56 Ga0070689_100283481 3300005340 Bacteria 1375
57 Ga0070691_10000314 3300005341 Bacteria 17078
58 Ga0070687_100008412 3300005343 Bacteria 4371
59 Ga0070687_100011583 3300005343 Bacteria 3863
60 Ga0070687_100038834 3300005343 Bacteria 2388
61 Ga0070687_100071442 3300005343 Bacteria 1865
62 Ga0070687_100084157 3300005343 Bacteria 1743
63 Ga0070661_100142319 3300005344 Bacteria 1808
64 Ga0070661_100262094 3300005344 Bacteria 1336
65 Ga0070692_10151876 3300005345 Bacteria 1320
66 Ga0070692_10217802 3300005345 Bacteria 1127
67 Ga0070668_100047759 3300005347 Bacteria 3291
68 Ga0070668_100205676 3300005347 Bacteria 1617
69 Ga0070669_100000727 3300005353 Bacteria 24018
70 Ga0070669_100001162 3300005353 Bacteria 19218
71 Ga0070669_100030575 3300005353 Bacteria 3887
72 Ga0070669_100041004 3300005353 Bacteria 3366
73 Ga0070669_100059076 3300005353 Bacteria 2815
74 Ga0070669_100120478 3300005353 Bacteria 2001
75 Ga0070675_100000381 3300005354 Bacteria 30031
76 Ga0070675_100006889 3300005354 Bacteria 8726
77 Ga0070675_100007417 3300005354 Bacteria 8473
78 Ga0070675_100011685 3300005354 Bacteria 6882
79 Ga0070675_100044978 3300005354 Bacteria 3612
80 Ga0070675_100054872 3300005354 Bacteria 3279
81 Ga0070675_100108234 3300005354 Bacteria 2347
82 Ga0070675_100114836 3300005354 Bacteria 2282
83 Ga0070675_100138475 3300005354 Bacteria 2079
84 Ga0070675_100315484 3300005354 Bacteria 1380
85 Ga0070671_100051343 3300005355 Bacteria 3429
86 Ga0070671_100061907 3300005355 Bacteria 3116
87 Ga0070671_100070668 3300005355 Bacteria 2912
88 Ga0070671_100167696 3300005355 Bacteria 1857
89 Ga0070671_100326638 3300005355 Bacteria 1307
90 Ga0070674_100032698 3300005356 Bacteria 3455
91 Ga0070674_100100435 3300005356 Bacteria 2107
92 Ga0070673_100004563 3300005364 Bacteria 8776
93 Ga0070673_100034084 3300005364 Bacteria 3849
94 Ga0070673_100038123 3300005364 Bacteria 3668
95 Ga0070673_100045646 3300005364 Bacteria 3399
96 Ga0070673_100073125 3300005364 Bacteria 2759
97 Ga0070673_100098851 3300005364 Bacteria 2399
98 Ga0070673_100115216 3300005364 Bacteria 2235
99 Ga0070673_100211335 3300005364 Bacteria 1676
100 Ga0070673_100230432 3300005364 Bacteria 1607
101 Ga0070688_100093542 3300005365 Bacteria 1969
102 Ga0070688_100165880 3300005365 Bacteria 1520
103 Ga0070688_100201010 3300005365 Bacteria 1394
104 Ga0070688_100293860 3300005365 Bacteria 1172
105 Ga0070659_100009356 3300005366 Bacteria 7196
106 Ga0070667_100080425 3300005367 Bacteria 2787
107 Ga0070667_100088042 3300005367 Bacteria 2666
108 Ga0070667_100113410 3300005367 Bacteria 2352
109 Ga0070667_100287826 3300005367 Bacteria 1477
110 Ga0070667_100341854 3300005367 Bacteria 1353
111 Ga0070703_10000330 3300005406 Bacteria 21403
112 Ga0070703_10041081 3300005406 Bacteria 1441
113 Ga0070709_10001985 3300005434 Bacteria 11148
114 Ga0070709_10261763 3300005434 Bacteria 1250
115 Ga0070714_100039506 3300005435 Bacteria 3973
116 Ga0070714_100067256 3300005435 Unclassified 3089
117 Ga0070713_100000180 3300005436 Bacteria 41991
118 Ga0070713_100001143 3300005436 Bacteria 17000
119 Ga0070713_100087678 3300005436 Bacteria 2670
120 Ga0070710_10020002 3300005437 Unclassified 3468
121 Ga0070710_10021420 3300005437 Bacteria 3369
122 Ga0070710_10041425 3300005437 Bacteria 2543
123 Ga0070710_10101273 3300005437 Bacteria 1716
124 Ga0070701_10012910 3300005438 Bacteria 3784
125 Ga0070701_10101510 3300005438 Bacteria 1594
126 Ga0070711_100000441 3300005439 Bacteria 21555
127 Ga0070711_100000766 3300005439 Bacteria 16740
128 Ga0070711_100014055 3300005439 Bacteria 5037
129 Ga0070711_100356552 3300005439 Bacteria 1177
130 Ga0070705_100041701 3300005440 Bacteria 2619
131 Ga0070705_100099408 3300005440 Bacteria 1833
132 Ga0070700_100045999 3300005441 Bacteria 2694
133 Ga0070700_100111593 3300005441 Bacteria 1819
134 Ga0070694_100000615 3300005444 Bacteria 19645
135 Ga0070694_100005219 3300005444 Bacteria 7849
136 Ga0070694_100085988 3300005444 Bacteria 2197
137 Ga0070694_100248184 3300005444 Bacteria 1345
138 Ga0070708_100011899 3300005445 Bacteria 7085
139 Ga0070708_100014254 3300005445 Bacteria 6533
140 Ga0070708_100027425 3300005445 Bacteria 4887
141 Ga0070708_100029858 3300005445 Bacteria 4706
142 Ga0070708_100071722 3300005445 Bacteria 3119
143 Ga0070708_100089935 3300005445 Bacteria 2794
144 Ga0070708_100205648 3300005445 Bacteria 1844
145 Ga0070663_100018575 3300005455 Bacteria 4564
146 Ga0070663_100089958 3300005455 Bacteria 2272
147 Ga0070663_100102817 3300005455 Bacteria 2135
148 Ga0070663_100213158 3300005455 Bacteria 1513
149 Ga0070678_100022862 3300005456 Bacteria 4155
150 Ga0070678_100063645 3300005456 Bacteria 2730
151 Ga0070678_100066299 3300005456 Bacteria 2684
152 Ga0070662_100026960 3300005457 Bacteria 3984
153 Ga0070662_100043799 3300005457 Bacteria 3204
154 Ga0070662_100078547 3300005457 Bacteria 2452
155 Ga0070662_100214268 3300005457 Bacteria 1534
156 Ga0070681_10000728 3300005458 Bacteria 27200
157 Ga0070681_10020945 3300005458 Bacteria 6551
158 Ga0070681_10028064 3300005458 Bacteria 5658
159 Ga0070681_10069961 3300005458 Bacteria 3475
160 Ga0070681_10158960 3300005458 Bacteria 2184
161 Ga0068867_100007333 3300005459 Bacteria 7805
162 Ga0068867_100017285 3300005459 Bacteria 5122
163 Ga0068867_100048895 3300005459 Bacteria 3112
164 Ga0068867_100050940 3300005459 Bacteria 3053
165 Ga0068867_100053894 3300005459 Bacteria 2971
166 Ga0070685_10028111 3300005466 Bacteria 3114
167 Ga0070685_10297433 3300005466 Bacteria 1087
168 Ga0070706_100000202 3300005467 Bacteria 75165
169 Ga0070706_100007119 3300005467 Bacteria 10520
170 Ga0070706_100010158 3300005467 Bacteria 8753
171 Ga0070706_100019466 3300005467 Bacteria 6259
172 Ga0070706_100040954 3300005467 Bacteria 4277
173 Ga0070706_100041092 3300005467 Bacteria 4269
174 Ga0070707_100003644 3300005468 Bacteria 14526
175 Ga0070707_100020286 3300005468 Bacteria 6268
176 Ga0070707_100158214 3300005468 Bacteria 2207
177 Ga0070707_100161919 3300005468 Bacteria 2180
178 Ga0070707_100208418 3300005468 Bacteria 1905
179 Ga0070698_100004310 3300005471 Bacteria 15649
180 Ga0070698_100011109 3300005471 Bacteria 9568
181 Ga0070698_100027551 3300005471 Bacteria 5907
182 Ga0070698_100099361 3300005471 Bacteria 2883
183 Ga0070698_100116389 3300005471 Bacteria 2636
184 Ga0070698_100147347 3300005471 Bacteria 2302
185 Ga0070698_100204730 3300005471 Bacteria 1908
186 Ga0070698_100284782 3300005471 Bacteria 1584
187 Ga0070699_100000004 3300005518 Bacteria 404262
188 Ga0070699_100001426 3300005518 Bacteria 21971
189 Ga0070699_100010867 3300005518 Bacteria 7876
190 Ga0070699_100036883 3300005518 Bacteria 4229
191 Ga0070699_100381505 3300005518 Bacteria 1273
192 Ga0070699_100408030 3300005518 Bacteria 1229
193 Ga0070679_100011820 3300005530 Bacteria 8328
194 Ga0070679_100031359 3300005530 Bacteria 5250
195 Ga0070684_100000050 3300005535 Bacteria 78974
196 Ga0070684_100013274 3300005535 Bacteria 6638
197 Ga0070684_100016045 3300005535 Bacteria 6117
198 Ga0070684_100035511 3300005535 Bacteria 4266
199 Ga0070684_100076370 3300005535 Bacteria 2957
200 Ga0070684_100139403 3300005535 Bacteria 2192
201 Ga0070697_100001931 3300005536 Bacteria 15867
202 Ga0070697_100013572 3300005536 Bacteria 6391
203 Ga0070697_100033514 3300005536 Bacteria 4137
204 Ga0070697_100239181 3300005536 Bacteria 1550
205 Ga0070697_100470523 3300005536 Bacteria 1096
206 Ga0068853_100012199 3300005539 Bacteria 6990
207 Ga0068853_100128331 3300005539 Bacteria 2267
208 Ga0068853_100348584 3300005539 Bacteria 1377
209 Ga0070672_100009215 3300005543 Bacteria 6796
210 Ga0070672_100032476 3300005543 Bacteria 3939
211 Ga0070672_100080058 3300005543 Bacteria 2616
212 Ga0070672_100105623 3300005543 Bacteria 2290
213 Ga0070672_100224480 3300005543 Bacteria 1576
214 Ga0070672_100311020 3300005543 Bacteria 1337
215 Ga0070686_100028617 3300005544 Bacteria 3381
216 Ga0070686_100037127 3300005544 Bacteria 3020
217 Ga0070686_100050598 3300005544 Bacteria 2641
218 Ga0070686_100087721 3300005544 Bacteria 2074
219 Ga0070695_100000829 3300005545 Bacteria 16689
220 Ga0070695_100003101 3300005545 Bacteria 9676
221 Ga0070695_100014410 3300005545 Bacteria 4766
222 Ga0070695_100038480 3300005545 Bacteria 3019
223 Ga0070695_100080249 3300005545 Bacteria 2156
224 Ga0070695_100092817 3300005545 Bacteria 2019
225 Ga0070695_100204806 3300005545 Bacteria 1412
226 Ga0070695_100264604 3300005545 Bacteria 1257
227 Ga0070696_100002254 3300005546 Bacteria 12712
228 Ga0070696_100004072 3300005546 Bacteria 9752
229 Ga0070696_100011043 3300005546 Bacteria 6049
230 Ga0070696_100112484 3300005546 Bacteria 1962
231 Ga0070696_100258281 3300005546 Bacteria 1320
232 Ga0070693_100000200 3300005547 Bacteria 28231
233 Ga0070693_100002389 3300005547 Bacteria 8635
234 Ga0070693_100007875 3300005547 Bacteria 5226
235 Ga0070693_100021499 3300005547 Bacteria 3418
236 Ga0070693_100033872 3300005547 Bacteria 2822
237 Ga0070665_100006550 3300005548 Bacteria 11834
238 Ga0070665_100014573 3300005548 Bacteria 7888
239 Ga0070665_100041691 3300005548 Bacteria 4616
240 Ga0070665_100075674 3300005548 Bacteria 3373
241 Ga0070665_100077027 3300005548 Bacteria 3341
242 Ga0070665_100173103 3300005548 Bacteria 2160
243 Ga0070665_100182862 3300005548 Bacteria 2097
244 Ga0070665_100344100 3300005548 Bacteria 1496
245 Ga0070704_100001732 3300005549 Bacteria 11908
246 Ga0070704_100004385 3300005549 Bacteria 8147
247 Ga0070704_100020154 3300005549 Bacteria 4294
248 Ga0070704_100105150 3300005549 Bacteria 2137
249 Ga0070704_100161598 3300005549 Bacteria 1772
250 Ga0070704_100414908 3300005549 Bacteria 1152
251 Ga0070704_100451376 3300005549 Bacteria 1107
252 Ga0070704_100463580 3300005549 Bacteria 1093
253 Ga0068855_100012041 3300005563 Bacteria 10456
254 Ga0068855_100067900 3300005563 Bacteria 4152
255 Ga0068855_100074669 3300005563 Bacteria 3937
256 Ga0068855_100112834 3300005563 Bacteria 3119
257 Ga0068855_100434916 3300005563 Bacteria 1434
258 Ga0070664_100003381 3300005564 Bacteria 12879
259 Ga0070664_100003507 3300005564 Bacteria 12666
260 Ga0070664_100021225 3300005564 Bacteria 5350
261 Ga0070664_100021878 3300005564 Bacteria 5272
262 Ga0070664_100097400 3300005564 Bacteria 2554
263 Ga0070664_100152851 3300005564 Bacteria 2038
264 Ga0068857_100003973 3300005577 Bacteria 12452
265 Ga0068857_100007741 3300005577 Bacteria 9254
266 Ga0068857_100041896 3300005577 Bacteria 4060
267 Ga0068857_100084299 3300005577 Bacteria 2840
268 Ga0068854_100108878 3300005578 Bacteria 2087
269 Ga0068856_100011523 3300005614 Bacteria 8578
270 Ga0068856_100283926 3300005614 Bacteria 1672
271 Ga0070702_100012237 3300005615 Bacteria 4292
272 Ga0068852_100013619 3300005616 Bacteria 6227
273 Ga0068852_100251942 3300005616 Bacteria 1692
274 Ga0068852_100289462 3300005616 Bacteria 1582
275 Ga0068859_100077070 3300005617 Bacteria 3375
276 Ga0068859_100150035 3300005617 Bacteria 2407
277 Ga0068864_100151348 3300005618 Bacteria 2102
278 Ga0068864_100157187 3300005618 Bacteria 2064
279 Ga0068864_100192775 3300005618 Bacteria 1869
280 Ga0068864_100351643 3300005618 Bacteria 1390
281 Ga0068864_100566179 3300005618 Bacteria 1100
282 Ga0068866_10042715 3300005718 Bacteria 2258
283 Ga0068866_10043578 3300005718 Bacteria 2241
284 Ga0068866_10059890 3300005718 Bacteria 1972
285 Ga0068861_100008754 3300005719 Bacteria 6968
286 Ga0068861_100013064 3300005719 Bacteria 5805
287 Ga0068861_100025306 3300005719 Bacteria 4303
288 Ga0068851_10018515 3300005834 Bacteria 3355
289 Ga0068851_10031550 3300005834 Bacteria 2633
290 Ga0068851_10040395 3300005834 Bacteria 2344
291 Ga0068851_10134187 3300005834 Bacteria 1341
292 Ga0068863_100362945 3300005841 Bacteria 1412
293 Ga0068858_100003039 3300005842 Bacteria 16816
294 Ga0068858_100022792 3300005842 Bacteria 5839
295 Ga0068858_100050471 3300005842 Bacteria 3851
296 Ga0068858_100086247 3300005842 Bacteria 2920
297 Ga0068860_100038707 3300005843 Bacteria 4562
298 Ga0068860_100079179 3300005843 Bacteria 3124
299 Ga0068860_100111078 3300005843 Bacteria 2620
300 Ga0068860_100116371 3300005843 Bacteria 2558
301 Ga0068862_100013068 3300005844 Bacteria 6867
302 Ga0081538_10003367 3300005981 Bacteria 15136
303 Ga0081538_10016220 3300005981 Bacteria 5725
304 Ga0081540_1033344 3300005983 Bacteria 2798
305 Ga0070717_10000390 3300006028 Bacteria 28003
306 Ga0070717_10015105 3300006028 Bacteria 5954
307 Ga0075365_10062870 3300006038 Bacteria 2484
308 Ga0075365_10097328 3300006038 Bacteria 2012
309 Ga0075368_10029364 3300006042 Bacteria 2126
310 Ga0075363_100023814 3300006048 Bacteria 3108
311 Ga0075364_10002176 3300006051 Bacteria 10976
312 Ga0075364_10007283 3300006051 Bacteria 6564
313 Ga0075364_10091079 3300006051 Bacteria 2023
314 Ga0075364_10113223 3300006051 Bacteria 1812
315 Ga0070715_10003425 3300006163 Bacteria 5043
316 Ga0070716_100024832 3300006173 Bacteria 3192
317 Ga0070716_100255758 3300006173 Bacteria 1196
318 Ga0070712_100000424 3300006175 Bacteria 24251
319 Ga0070712_100000774 3300006175 Bacteria 18882
320 Ga0070712_100042745 3300006175 Bacteria 3117
321 Ga0070712_100195630 3300006175 Bacteria 1585
322 Ga0075362_10003871 3300006177 Bacteria 5315
323 Ga0075362_10018891 3300006177 Bacteria 2860
324 Ga0075367_10036654 3300006178 Bacteria 2845
325 Ga0075367_10083562 3300006178 Bacteria 1934
326 Ga0075367_10192750 3300006178 Bacteria 1272
327 Ga0075366_10016496 3300006195 Bacteria 4247
328 Ga0075366_10037914 3300006195 Bacteria 2847
329 Ga0075366_10038115 3300006195 Bacteria 2839
330 Ga0075366_10041787 3300006195 Bacteria 2715
331 Ga0075366_10143162 3300006195 Bacteria 1446
332 Ga0097621_100051496 3300006237 Bacteria 3351
333 Ga0097621_100082717 3300006237 Bacteria 2674
334 Ga0097621_100090730 3300006237 Bacteria 2557
335 Ga0097621_100115283 3300006237 Bacteria 2274
336 Ga0097621_100285383 3300006237 Bacteria 1454
337 Ga0097621_100323272 3300006237 Bacteria 1367
338 Ga0097621_100529668 3300006237 Bacteria 1070
339 Ga0075370_10042865 3300006353 Bacteria 2557
340 Ga0075370_10046599 3300006353 Bacteria 2453
341 Ga0068871_100024736 3300006358 Bacteria 4660
342 Ga0068871_100055534 3300006358 Bacteria 3215
343 Ga0075428_100004291 3300006844 Bacteria 15699
344 Ga0075428_100005484 3300006844 Bacteria 14102
345 Ga0075428_100012404 3300006844 Bacteria 9479
346 Ga0075428_100012869 3300006844 Bacteria 9310
347 Ga0075428_100033650 3300006844 Bacteria 5657
348 Ga0075428_100066771 3300006844 Bacteria 3938
349 Ga0075428_100263180 3300006844 Bacteria 1857
350 Ga0075428_100378823 3300006844 Bacteria 1517
351 Ga0075428_100641544 3300006844 Bacteria 1133
352 Ga0075430_100003672 3300006846 Bacteria 12881
353 Ga0075430_100003798 3300006846 Bacteria 12711
354 Ga0075430_100025288 3300006846 Bacteria 5050
355 Ga0075430_100035079 3300006846 Bacteria 4258
356 Ga0075430_100127816 3300006846 Bacteria 2118
357 Ga0075430_100259642 3300006846 Bacteria 1439
358 Ga0075430_100306835 3300006846 Bacteria 1313
359 Ga0075431_100004325 3300006847 Bacteria 13917
360 Ga0075431_100024159 3300006847 Bacteria 6223
361 Ga0075431_100024753 3300006847 Bacteria 6154
362 Ga0075431_100030652 3300006847 Bacteria 5541
363 Ga0075431_100053177 3300006847 Bacteria 4175
364 Ga0075431_100105335 3300006847 Bacteria 2910
365 Ga0075433_10000360 3300006852 Bacteria 28644
366 Ga0075433_10030890 3300006852 Bacteria 4574
367 Ga0075433_10035332 3300006852 Bacteria 4297
368 Ga0075433_10074249 3300006852 Bacteria 2992
369 Ga0075433_10093298 3300006852 Bacteria 2663
370 Ga0075433_10107478 3300006852 Bacteria 2474
371 Ga0075433_10122773 3300006852 Bacteria 2307
372 Ga0075433_10199807 3300006852 Bacteria 1777
373 Ga0075434_100001498 3300006871 Bacteria 19718
374 Ga0075434_100027710 3300006871 Bacteria 5563
375 Ga0075434_100106316 3300006871 Bacteria 2816
376 Ga0075434_100135523 3300006871 Bacteria 2481
377 Ga0075434_100145485 3300006871 Bacteria 2390
378 Ga0075434_100337988 3300006871 Bacteria 1526
379 Ga0075429_100006247 3300006880 Bacteria 10313
380 Ga0075429_100010163 3300006880 Bacteria 8148
381 Ga0075429_100048104 3300006880 Bacteria 3709
382 Ga0075429_100053555 3300006880 Bacteria 3511
383 Ga0075429_100082094 3300006880 Bacteria 2810
384 Ga0068865_100001348 3300006881 Bacteria 14299
385 Ga0068865_100009144 3300006881 Bacteria 6132
386 Ga0068865_100062956 3300006881 Bacteria 2606
387 Ga0068865_100072957 3300006881 Bacteria 2439
388 Ga0075436_100005387 3300006914 Bacteria 8807
389 Ga0075436_100006638 3300006914 Bacteria 7926
390 Ga0075436_100006643 3300006914 Bacteria 7922
391 Ga0075436_100040179 3300006914 Bacteria 3228
392 Ga0075436_100045696 3300006914 Bacteria 3021
393 Ga0075436_100124095 3300006914 Bacteria 1808
394 Ga0075436_100130323 3300006914 Bacteria 1763
395 Ga0097620_100077072 3300006931 Bacteria 3375
396 Ga0097620_100150038 3300006931 Bacteria 2407
397 Ga0097620_100585895 3300006931 Bacteria 1209
398 Ga0075435_100004674 3300007076 Bacteria 9441
399 Ga0075435_100009374 3300007076 Bacteria 7083
400 Ga0075435_100013737 3300007076 Bacteria 6033
401 Ga0075435_100047319 3300007076 Bacteria 3453
402 Ga0075435_100053607 3300007076 Bacteria 3253
403 Ga0075435_100096475 3300007076 Bacteria 2446
404 Ga0075435_100136809 3300007076 Bacteria 2053
405 Ga0075435_100185286 3300007076 Bacteria 1760
406 Ga0075435_100202536 3300007076 Bacteria 1682
407 Ga0099795_10000023 3300007788 Bacteria 52134
408 Ga0099795_10010705 3300007788 Bacteria 2712
409 Ga0105240_10006446 3300009093 Bacteria 17254
410 Ga0105240_10024898 3300009093 Bacteria 7878
411 Ga0105240_10123688 3300009093 Bacteria 3112
412 Ga0105240_10145574 3300009093 Bacteria 2827
413 Ga0105240_10246694 3300009093 Bacteria 2067
414 Ga0105240_10295827 3300009093 Bacteria 1854
415 Ga0105240_10555042 3300009093 Bacteria 1270
416 Ga0111539_10002591 3300009094 Bacteria 23946
417 Ga0111539_10002914 3300009094 Bacteria 22702
418 Ga0111539_10003491 3300009094 Bacteria 20727
419 Ga0111539_10003577 3300009094 Bacteria 20480
420 Ga0111539_10035761 3300009094 Bacteria 6012
421 Ga0111539_10041050 3300009094 Bacteria 5565
422 Ga0111539_10114724 3300009094 Bacteria 3160
423 Ga0111539_10195054 3300009094 Bacteria 2362
424 Ga0111539_10209579 3300009094 Bacteria 2271
425 Ga0111539_10223327 3300009094 Bacteria 2194
426 Ga0111539_10238357 3300009094 Bacteria 2117
427 Ga0111539_10247428 3300009094 Bacteria 2076
428 Ga0105245_10016935 3300009098 Bacteria 6363
429 Ga0105245_10059544 3300009098 Bacteria 3439
430 Ga0105245_10075935 3300009098 Bacteria 3060
431 Ga0105245_10324448 3300009098 Bacteria 1518
432 Ga0105247_10038134 3300009101 Bacteria 2932
433 Ga0105247_10189820 3300009101 Bacteria 1375
434 Ga0114129_10002266 3300009147 Bacteria 26617
435 Ga0114129_10005113 3300009147 Bacteria 18461
436 Ga0114129_10008691 3300009147 Bacteria 14476
437 Ga0114129_10008970 3300009147 Bacteria 14259
438 Ga0114129_10009206 3300009147 Bacteria 14081
439 Ga0114129_10017434 3300009147 Bacteria 10225
440 Ga0114129_10022135 3300009147 Bacteria 9021
441 Ga0114129_10024405 3300009147 Bacteria 8568
442 Ga0114129_10033843 3300009147 Bacteria 7219
443 Ga0114129_10061464 3300009147 Bacteria 5249
444 Ga0114129_10063642 3300009147 Bacteria 5150
445 Ga0114129_10089738 3300009147 Bacteria 4261
446 Ga0114129_10099293 3300009147 Bacteria 4029
447 Ga0114129_10099321 3300009147 Bacteria 4029
448 Ga0114129_10253945 3300009147 Bacteria 2359
449 Ga0114129_10317719 3300009147 Bacteria 2071
450 Ga0114129_10599126 3300009147 Bacteria 1428
451 Ga0114129_10830752 3300009147 Bacteria 1176
452 Ga0105243_10003648 3300009148 Bacteria 12387
453 Ga0105243_10205728 3300009148 Bacteria 1729
454 Ga0105241_10144245 3300009174 Bacteria 1942
455 Ga0105242_10012753 3300009176 Bacteria 6473
456 Ga0105242_10026761 3300009176 Bacteria 4573
457 Ga0105242_10045264 3300009176 Bacteria 3565
458 Ga0105242_10082056 3300009176 Bacteria 2697
459 Ga0105248_10008828 3300009177 Bacteria 11071
460 Ga0105248_10023973 3300009177 Bacteria 6783
461 Ga0105248_10048444 3300009177 Bacteria 4767
462 Ga0105248_10048781 3300009177 Bacteria 4750
463 Ga0105248_10055879 3300009177 Bacteria 4429
464 Ga0105248_10081517 3300009177 Bacteria 3637
465 Ga0105248_10103067 3300009177 Bacteria 3216
466 Ga0105248_10131427 3300009177 Bacteria 2824
467 Ga0105248_10133520 3300009177 Bacteria 2800
468 Ga0105248_10192908 3300009177 Bacteria 2295
469 Ga0105248_10231072 3300009177 Bacteria 2082
470 Ga0105248_10250813 3300009177 Bacteria 1992
471 Ga0105248_10396229 3300009177 Bacteria 1554
472 Ga0105237_10207919 3300009545 Bacteria 1957
473 Ga0105237_10211993 3300009545 Bacteria 1937
474 Ga0105238_10003340 3300009551 Bacteria 16014
475 Ga0105238_10063520 3300009551 Bacteria 3693
476 Ga0105238_10099977 3300009551 Bacteria 2883
477 Ga0105249_10000517 3300009553 Bacteria 35617
478 Ga0105249_10006590 3300009553 Bacteria 10104
479 Ga0105249_10026830 3300009553 Bacteria 5193
480 Ga0105249_10387486 3300009553 Bacteria 1425
481 Ga0105239_10199885 3300010375 Bacteria 2239
482 Ga0105239_10385325 3300010375 Bacteria 1585
483 Ga0105239_10465736 3300010375 Bacteria 1435
484 Ga0105246_10023137 3300011119 Bacteria 4018
485 Ga0105246_10108883 3300011119 Bacteria 2031
486 Ga0105246_10176615 3300011119 Bacteria 1640
487 Ga0105246_10215681 3300011119 Bacteria 1501
488 Ga0105246_10437352 3300011119 Bacteria 1096
489 Ga0157373_10114747 3300013100 Bacteria 1894
490 Ga0157370_10254091 3300013104 Bacteria 1625
491 Ga0157369_10006460 3300013105 Bacteria 13590
492 Ga0157369_10104725 3300013105 Bacteria 3012
493 Ga0157369_10256971 3300013105 Bacteria 1822
494 Ga0157374_10001514 3300013296 Bacteria 19577
495 Ga0157374_10043990 3300013296 Bacteria 4126
496 Ga0157374_10144317 3300013296 Bacteria 2312
497 Ga0157374_10231882 3300013296 Bacteria 1814
498 Ga0157374_10272023 3300013296 Bacteria 1671
499 Ga0157378_10033718 3300013297 Bacteria 4527
500 Ga0157378_10085087 3300013297 Bacteria 2864
501 Ga0157378_10105791 3300013297 Bacteria 2573
502 Ga0157378_10282175 3300013297 Bacteria 1601
503 Ga0163162_10000370 3300013306 Bacteria 40835
504 Ga0163162_10028261 3300013306 Bacteria 5548
505 Ga0163162_10086069 3300013306 Bacteria 3220
506 Ga0163162_10088425 3300013306 Bacteria 3177
507 Ga0157372_10002177 3300013307 Bacteria 21331
508 Ga0157372_10030737 3300013307 Bacteria 5876
509 Ga0157372_10030751 3300013307 Bacteria 5875
510 Ga0157372_10036897 3300013307 Bacteria 5390
511 Ga0157372_10070222 3300013307 Bacteria 3940
512 Ga0157372_10107133 3300013307 Bacteria 3197
513 Ga0157372_10122026 3300013307 Bacteria 2994
514 Ga0157372_10419456 3300013307 Bacteria 1560
515 Ga0157372_10433199 3300013307 Bacteria 1533
516 Ga0157372_10468468 3300013307 Bacteria 1468
517 Ga0157375_10052365 3300013308 Bacteria 4013
518 Ga0157375_10119915 3300013308 Bacteria 2738
519 Ga0157375_10132161 3300013308 Bacteria 2616
520 Ga0157375_10236927 3300013308 Bacteria 1984
521 Ga0157375_10247759 3300013308 Bacteria 1942
522 Ga0157375_10329808 3300013308 Bacteria 1691
523 Ga0163163_10010921 3300014325 Bacteria 8203
524 Ga0163163_10115060 3300014325 Bacteria 2721
525 Ga0163163_10118338 3300014325 Bacteria 2682
526 Ga0163163_10200709 3300014325 Bacteria 2043
527 Ga0163163_10299083 3300014325 Bacteria 1662
528 Ga0163163_10305849 3300014325 Bacteria 1642
529 Ga0163163_10543909 3300014325 Bacteria 1224
530 Ga0163163_10578207 3300014325 Bacteria 1186
531 Ga0163163_10634304 3300014325 Bacteria 1132
532 Ga0157380_10022910 3300014326 Bacteria 4709
533 Ga0157380_10060343 3300014326 Bacteria 3030
534 Ga0157380_10086528 3300014326 Bacteria 2575
535 Ga0157380_10137048 3300014326 Bacteria 2097
536 Ga0157380_10213216 3300014326 Bacteria 1722
537 Ga0157380_10300222 3300014326 Bacteria 1479
538 Ga0157380_10392081 3300014326 Bacteria 1314
539 Ga0157377_10178801 3300014745 Bacteria 1333
540 Ga0157377_10190607 3300014745 Bacteria 1295
541 Ga0157377_10222560 3300014745 Bacteria 1209
542 Ga0157379_10026737 3300014968 Bacteria 5137
543 Ga0157379_10027489 3300014968 Bacteria 5065
544 Ga0157379_10040371 3300014968 Bacteria 4165
545 Ga0157379_10053135 3300014968 Bacteria 3619
546 Ga0157379_10151788 3300014968 Bacteria 2089
547 Ga0157376_10003558 3300014969 Bacteria 10744
548 Ga0157376_10043656 3300014969 Bacteria 3680
549 Ga0157376_10079268 3300014969 Bacteria 2815
550 Ga0157376_10254669 3300014969 Bacteria 1641
551 Ga0163161_10003256 3300017792 Bacteria 11412
552 Ga0163161_10476846 3300017792 Bacteria 1012
553 Ga0224570_100995 3300022730 Bacteria 2231
554 Ga0224569_102012 3300022732 Bacteria 1675
555 Ga0228598_1001375 3300024227 Bacteria 5346
556 Ga0207697_10000143 3300025315 Bacteria 34721
557 Ga0207697_10019067 3300025315 Bacteria 2809
558 Ga0207656_10013386 3300025321 Bacteria 3135
559 Ga0207656_10014207 3300025321 Bacteria 3062
560 Ga0207653_10000071 3300025885 Bacteria 75651
561 Ga0207653_10026112 3300025885 Bacteria 1871
562 Ga0207682_10007365 3300025893 Bacteria 4390
563 Ga0207682_10015587 3300025893 Bacteria 2959
564 Ga0207682_10031726 3300025893 Bacteria 2122
565 Ga0207682_10064833 3300025893 Bacteria 1536
566 Ga0207692_10006630 3300025898 Bacteria 4706
567 Ga0207642_10067898 3300025899 Bacteria 1685
568 Ga0207710_10053314 3300025900 Bacteria 1820
569 Ga0207710_10112232 3300025900 Bacteria 1295
570 Ga0207688_10002686 3300025901 Bacteria 9626
571 Ga0207680_10124411 3300025903 Bacteria 1691
572 Ga0207680_10221208 3300025903 Bacteria 1298
573 Ga0207680_10289861 3300025903 Bacteria 1139
574 Ga0207647_10031204 3300025904 Bacteria 3430
575 Ga0207685_10018069 3300025905 Bacteria 2294
576 Ga0207699_10004012 3300025906 Bacteria 7044
577 Ga0207699_10006533 3300025906 Bacteria 5654
578 Ga0207699_10031968 3300025906 Bacteria 2961
579 Ga0207699_10092028 3300025906 Bacteria 1906
580 Ga0207699_10174747 3300025906 Bacteria 1440
581 Ga0207645_10000743 3300025907 Bacteria 27133
582 Ga0207645_10022325 3300025907 Bacteria 4119
583 Ga0207645_10037601 3300025907 Bacteria 3106
584 Ga0207645_10038845 3300025907 Bacteria 3051
585 Ga0207643_10004131 3300025908 Bacteria 7821
586 Ga0207643_10085356 3300025908 Bacteria 1833
587 Ga0207705_10068020 3300025909 Bacteria 2578
588 Ga0207705_10143069 3300025909 Bacteria 1787
589 Ga0207684_10000204 3300025910 Bacteria 91621
590 Ga0207684_10007319 3300025910 Bacteria 9959
591 Ga0207684_10008255 3300025910 Bacteria 9271
592 Ga0207684_10036722 3300025910 Bacteria 4158
593 Ga0207654_10051141 3300025911 Bacteria 2377
594 Ga0207654_10152143 3300025911 Bacteria 1486
595 Ga0207707_10004652 3300025912 Bacteria 12056
596 Ga0207707_10024623 3300025912 Bacteria 5268
597 Ga0207707_10034139 3300025912 Bacteria 4451
598 Ga0207707_10174739 3300025912 Bacteria 1876
599 Ga0207707_10233744 3300025912 Bacteria 1599
600 Ga0207695_10058666 3300025913 Bacteria 3994
601 Ga0207695_10068686 3300025913 Bacteria 3630
602 Ga0207695_10072281 3300025913 Bacteria 3520
603 Ga0207695_10142339 3300025913 Bacteria 2345
604 Ga0207671_10240292 3300025914 Bacteria 1423
605 Ga0207693_10000777 3300025915 Bacteria 28620
606 Ga0207693_10001047 3300025915 Bacteria 24726
607 Ga0207693_10002215 3300025915 Bacteria 16946
608 Ga0207693_10259159 3300025915 Bacteria 1364
609 Ga0207663_10001539 3300025916 Bacteria 10795
610 Ga0207663_10019520 3300025916 Bacteria 3821
611 Ga0207663_10033180 3300025916 Bacteria 3072
612 Ga0207663_10075561 3300025916 Bacteria 2187
613 Ga0207663_10090220 3300025916 Unclassified 2032
614 Ga0207663_10148199 3300025916 Bacteria 1643
615 Ga0207660_10000001 3300025917 Bacteria 1034169
616 Ga0207660_10073058 3300025917 Bacteria 2500
617 Ga0207660_10189635 3300025917 Bacteria 1600
618 Ga0207662_10006311 3300025918 Bacteria 6388
619 Ga0207662_10015678 3300025918 Bacteria 4266
620 Ga0207662_10053683 3300025918 Bacteria 2401
621 Ga0207662_10089006 3300025918 Bacteria 1896
622 Ga0207662_10195939 3300025918 Bacteria 1305
623 Ga0207657_10413974 3300025919 Bacteria 1060
624 Ga0207649_10015199 3300025920 Bacteria 4323
625 Ga0207649_10034085 3300025920 Unclassified 3047
626 Ga0207649_10045422 3300025920 Bacteria 2693
627 Ga0207652_10008444 3300025921 Bacteria 8287
628 Ga0207652_10011006 3300025921 Bacteria 7294
629 Ga0207646_10003702 3300025922 Bacteria 17067
630 Ga0207646_10008238 3300025922 Bacteria 10469
631 Ga0207646_10026427 3300025922 Bacteria 5296
632 Ga0207646_10029750 3300025922 Unclassified 4959
633 Ga0207646_10043474 3300025922 Bacteria 4034
634 Ga0207646_10048209 3300025922 Bacteria 3819
635 Ga0207646_10175685 3300025922 Bacteria 1934
636 Ga0207646_10383774 3300025922 Bacteria 1269
637 Ga0207681_10007137 3300025923 Bacteria 6851
638 Ga0207681_10014269 3300025923 Bacteria 4933
639 Ga0207681_10014326 3300025923 Bacteria 4925
640 Ga0207681_10025386 3300025923 Bacteria 3811
641 Ga0207681_10053026 3300025923 Bacteria 2752
642 Ga0207681_10054804 3300025923 Bacteria 2713
643 Ga0207681_10067554 3300025923 Bacteria 2479
644 Ga0207681_10112633 3300025923 Bacteria 1982
645 Ga0207681_10243272 3300025923 Bacteria 1401
646 Ga0207681_10285426 3300025923 Bacteria 1301
647 Ga0207694_10003999 3300025924 Bacteria 11616
648 Ga0207650_10048321 3300025925 Bacteria 3138
649 Ga0207650_10063070 3300025925 Bacteria 2770
650 Ga0207650_10109336 3300025925 Bacteria 2138
651 Ga0207650_10116326 3300025925 Bacteria 2076
652 Ga0207650_10134105 3300025925 Bacteria 1941
653 Ga0207659_10000630 3300025926 Bacteria 20889
654 Ga0207659_10038129 3300025926 Bacteria 3340
655 Ga0207659_10101223 3300025926 Bacteria 2172
656 Ga0207659_10164011 3300025926 Bacteria 1747
657 Ga0207659_10347581 3300025926 Bacteria 1230
658 Ga0207687_10028103 3300025927 Bacteria 3778
659 Ga0207687_10032036 3300025927 Bacteria 3557
660 Ga0207687_10043623 3300025927 Bacteria 3091
661 Ga0207687_10111343 3300025927 Bacteria 2032
662 Ga0207700_10000198 3300025928 Bacteria 35892
663 Ga0207700_10005511 3300025928 Bacteria 7590
664 Ga0207700_10008571 3300025928 Bacteria 6344
665 Ga0207700_10269145 3300025928 Bacteria 1462
666 Ga0207664_10060517 3300025929 Bacteria 3018
667 Ga0207664_10086379 3300025929 Bacteria 2563
668 Ga0207664_10455404 3300025929 Bacteria 1142
669 Ga0207644_10040792 3300025931 Bacteria 3281
670 Ga0207644_10053279 3300025931 Bacteria 2911
671 Ga0207644_10152164 3300025931 Bacteria 1791
672 Ga0207644_10334703 3300025931 Bacteria 1226
673 Ga0207690_10105343 3300025932 Bacteria 2022
674 Ga0207690_10330747 3300025932 Bacteria 1200
675 Ga0207706_10002236 3300025933 Bacteria 18885
676 Ga0207706_10002730 3300025933 Bacteria 17203
677 Ga0207706_10059957 3300025933 Unclassified 3351
678 Ga0207706_10108239 3300025933 Bacteria 2446
679 Ga0207706_10117177 3300025933 Bacteria 2342
680 Ga0207706_10194848 3300025933 Bacteria 1777
681 Ga0207706_10209096 3300025933 Bacteria 1711
682 Ga0207706_10244522 3300025933 Bacteria 1568
683 Ga0207706_10256649 3300025933 Bacteria 1526
684 Ga0207706_10530389 3300025933 Bacteria 1015
685 Ga0207686_10006648 3300025934 Bacteria 6234
686 Ga0207686_10015467 3300025934 Bacteria 4266
687 Ga0207686_10026778 3300025934 Bacteria 3368
688 Ga0207670_10016027 3300025936 Bacteria 4495
689 Ga0207670_10029275 3300025936 Bacteria 3507
690 Ga0207670_10035828 3300025936 Bacteria 3222
691 Ga0207670_10061191 3300025936 Bacteria 2568
692 Ga0207670_10148669 3300025936 Bacteria 1735
693 Ga0207669_10002051 3300025937 Bacteria 8527
694 Ga0207669_10043725 3300025937 Bacteria 2626
695 Ga0207669_10067593 3300025937 Bacteria 2228
696 Ga0207669_10093338 3300025937 Bacteria 1966
697 Ga0207669_10138684 3300025937 Bacteria 1684
698 Ga0207669_10233492 3300025937 Bacteria 1359
699 Ga0207704_10012306 3300025938 Bacteria 4246
700 Ga0207704_10045869 3300025938 Bacteria 2600
701 Ga0207704_10076603 3300025938 Bacteria 2143
702 Ga0207665_10000973 3300025939 Bacteria 19387
703 Ga0207665_10011628 3300025939 Bacteria 5783
704 Ga0207665_10011723 3300025939 Bacteria 5759
705 Ga0207665_10026562 3300025939 Bacteria 3822
706 Ga0207665_10041165 3300025939 Bacteria 3084
707 Ga0207691_10002031 3300025940 Bacteria 19804
708 Ga0207691_10003473 3300025940 Bacteria 15345
709 Ga0207691_10008843 3300025940 Bacteria 9663
710 Ga0207691_10010771 3300025940 Bacteria 8777
711 Ga0207691_10015894 3300025940 Bacteria 7151
712 Ga0207691_10015943 3300025940 Bacteria 7139
713 Ga0207691_10035125 3300025940 Bacteria 4657
714 Ga0207691_10041496 3300025940 Bacteria 4247
715 Ga0207691_10093370 3300025940 Bacteria 2695
716 Ga0207691_10227323 3300025940 Bacteria 1616
717 Ga0207711_10029360 3300025941 Bacteria 4638
718 Ga0207711_10038116 3300025941 Bacteria 4086
719 Ga0207711_10056655 3300025941 Bacteria 3368
720 Ga0207711_10100293 3300025941 Bacteria 2561
721 Ga0207711_10133263 3300025941 Bacteria 2229
722 Ga0207711_10141500 3300025941 Bacteria 2165
723 Ga0207711_10145829 3300025941 Bacteria 2133
724 Ga0207689_10000700 3300025942 Bacteria 32116
725 Ga0207689_10007432 3300025942 Bacteria 9604
726 Ga0207689_10035841 3300025942 Bacteria 4119
727 Ga0207689_10059254 3300025942 Bacteria 3149
728 Ga0207689_10119866 3300025942 Bacteria 2165
729 Ga0207689_10131527 3300025942 Bacteria 2059
730 Ga0207661_10000011 3300025944 Bacteria 361200
731 Ga0207661_10002181 3300025944 Bacteria 13503
732 Ga0207661_10023578 3300025944 Bacteria 4651
733 Ga0207661_10034991 3300025944 Bacteria 3911
734 Ga0207661_10094573 3300025944 Bacteria 2497
735 Ga0207661_10159818 3300025944 Bacteria 1954
736 Ga0207661_10234286 3300025944 Bacteria 1627
737 Ga0207661_10415186 3300025944 Bacteria 1222
738 Ga0207679_10009204 3300025945 Bacteria 6315
739 Ga0207679_10066419 3300025945 Bacteria 2703
740 Ga0207679_10097255 3300025945 Bacteria 2292
741 Ga0207679_10099555 3300025945 Bacteria 2270
742 Ga0207679_10292977 3300025945 Bacteria 1400
743 Ga0207679_10313648 3300025945 Bacteria 1356
744 Ga0207667_10044703 3300025949 Bacteria 4692
745 Ga0207667_10093213 3300025949 Bacteria 3110
746 Ga0207667_10251000 3300025949 Bacteria 1810
747 Ga0207651_10007002 3300025960 Bacteria 5972
748 Ga0207651_10009512 3300025960 Bacteria 5330
749 Ga0207651_10033799 3300025960 Bacteria 3302
750 Ga0207651_10049240 3300025960 Bacteria 2854
751 Ga0207651_10051872 3300025960 Bacteria 2794
752 Ga0207651_10066670 3300025960 Bacteria 2530
753 Ga0207651_10079632 3300025960 Bacteria 2354
754 Ga0207651_10084363 3300025960 Bacteria 2301
755 Ga0207651_10111691 3300025960 Bacteria 2053
756 Ga0207651_10137866 3300025960 Bacteria 1879
757 Ga0207712_10005715 3300025961 Bacteria 7839
758 Ga0207712_10142833 3300025961 Bacteria 1839
759 Ga0207712_10172565 3300025961 Bacteria 1692
760 Ga0207668_10048164 3300025972 Bacteria 2923
761 Ga0207668_10163645 3300025972 Bacteria 1736
762 Ga0207658_10317366 3300025986 Bacteria 1348
763 Ga0207677_10018985 3300026023 Bacteria 4141
764 Ga0207677_10063791 3300026023 Bacteria 2563
765 Ga0207677_10203712 3300026023 Bacteria 1575
766 Ga0207677_10286845 3300026023 Bacteria 1354
767 Ga0207677_10404429 3300026023 Bacteria 1158
768 Ga0207703_10035997 3300026035 Bacteria 3936
769 Ga0207703_10039860 3300026035 Bacteria 3756
770 Ga0207703_10050482 3300026035 Bacteria 3367
771 Ga0207703_10131114 3300026035 Bacteria 2165
772 Ga0207703_10141663 3300026035 Bacteria 2087
773 Ga0207703_10408894 3300026035 Bacteria 1260
774 Ga0207639_10056107 3300026041 Bacteria 3018
775 Ga0207639_10090509 3300026041 Bacteria 2447
776 Ga0207678_10022795 3300026067 Bacteria 5483
777 Ga0207678_10031382 3300026067 Bacteria 4635
778 Ga0207678_10116577 3300026067 Bacteria 2279
779 Ga0207678_10122602 3300026067 Bacteria 2218
780 Ga0207678_10185564 3300026067 Bacteria 1776
781 Ga0207708_10005458 3300026075 Bacteria 9379
782 Ga0207708_10012601 3300026075 Bacteria 6306
783 Ga0207708_10017975 3300026075 Bacteria 5319
784 Ga0207708_10313618 3300026075 Bacteria 1278
785 Ga0207702_10032863 3300026078 Bacteria 4331
786 Ga0207702_10492845 3300026078 Bacteria 1194
787 Ga0207648_10000831 3300026089 Bacteria 34764
788 Ga0207648_10013463 3300026089 Bacteria 7609
789 Ga0207648_10033080 3300026089 Bacteria 4561
790 Ga0207648_10043265 3300026089 Bacteria 3953
791 Ga0207648_10052246 3300026089 Bacteria 3573
792 Ga0207648_10143877 3300026089 Bacteria 2103
793 Ga0207648_10464751 3300026089 Bacteria 1154
794 Ga0207676_10056408 3300026095 Bacteria 3088
795 Ga0207676_10056688 3300026095 Bacteria 3082
796 Ga0207676_10072834 3300026095 Bacteria 2763
797 Ga0207676_10240853 3300026095 Bacteria 1623
798 Ga0207674_10000575 3300026116 Bacteria 48309
799 Ga0207674_10015400 3300026116 Bacteria 8400
800 Ga0207674_10018395 3300026116 Bacteria 7596
801 Ga0207674_10053138 3300026116 Bacteria 4130
802 Ga0207674_10060999 3300026116 Bacteria 3811
803 Ga0207674_10155662 3300026116 Bacteria 2241
804 Ga0207675_100001439 3300026118 Bacteria 23863
805 Ga0207675_100029121 3300026118 Bacteria 5147
806 Ga0207675_100095852 3300026118 Bacteria 2792
807 Ga0207675_100605956 3300026118 Bacteria 1098
808 Ga0207683_10029677 3300026121 Bacteria 4736
809 Ga0207683_10086901 3300026121 Bacteria 2780
810 Ga0207683_10125248 3300026121 Bacteria 2309
811 Ga0207698_10034543 3300026142 Bacteria 3687
812 Ga0207698_10039904 3300026142 Bacteria 3482
813 Ga0207698_10210221 3300026142 Bacteria 1750
814 Ga0209179_1000035 3300027512 Bacteria 31485
815 Ga0209999_1006859 3300027543 Bacteria 2048
816 Ga0209588_1045938 3300027671 Bacteria 1413
817 Ga0209971_1035165 3300027682 Bacteria 1205
818 Ga0209998_10000643 3300027717 Bacteria 9368
819 Ga0209998_10015878 3300027717 Bacteria 1581
820 Ga0209974_10015654 3300027876 Bacteria 2519
821 Ga0207428_10001569 3300027907 Bacteria 23808
822 Ga0207428_10031150 3300027907 Bacteria 4405
823 Ga0207428_10069738 3300027907 Bacteria 2764
824 Ga0207428_10139767 3300027907 Bacteria 1849
825 Ga0207428_10148331 3300027907 Bacteria 1787
826 Ga0207428_10203577 3300027907 Bacteria 1489
827 Ga0265354_1001849 3300028016 Bacteria 2843
828 Ga0265356_1000423 3300028017 Bacteria 7674
829 Ga0268266_10009803 3300028379 Bacteria 8425
830 Ga0268266_10011841 3300028379 Bacteria 7558
831 Ga0268266_10095384 3300028379 Bacteria 2613
832 Ga0268266_10119392 3300028379 Bacteria 2345
833 Ga0268266_10555682 3300028379 Bacteria 1100
834 Ga0268265_10002430 3300028380 Bacteria 14059
835 Ga0268265_10003755 3300028380 Bacteria 10793
836 Ga0268265_10072929 3300028380 Bacteria 2679
837 Ga0268265_10144087 3300028380 Bacteria 1999
838 Ga0268265_10290108 3300028380 Bacteria 1468
839 Ga0268264_10047178 3300028381 Bacteria 3581
840 Ga0268264_10259293 3300028381 Bacteria 1619
841 Ga0265337_1000341 3300028556 Bacteria 24875
842 Ga0265337_1004853 3300028556 Bacteria 5494
843 Ga0265326_10018024 3300028558 Bacteria 2033
844 Ga0265319_1004109 3300028563 Bacteria 7325
845 Ga0265319_1005238 3300028563 Bacteria 6257
846 Ga0265319_1064029 3300028563 Bacteria 1188
847 Ga0265318_10002057 3300028577 Bacteria 11050
848 Ga0265318_10015946 3300028577 Bacteria 3112
849 Ga0265318_10089329 3300028577 Bacteria 1135
850 Ga0265323_10005821 3300028653 Bacteria 5215
851 Ga0265323_10030565 3300028653 Bacteria 2005
852 Ga0265322_10007287 3300028654 Bacteria 3235
853 Ga0265322_10013995 3300028654 Bacteria 2322
854 Ga0265336_10001401 3300028666 Bacteria 11125
855 Ga0265338_10001605 3300028800 Bacteria 36301
856 Ga0265338_10001803 3300028800 Bacteria 33699
857 Ga0265338_10004319 3300028800 Bacteria 19278
858 Ga0265338_10013275 3300028800 Bacteria 9314
859 Ga0265338_10047014 3300028800 Bacteria 3947
860 Ga0265762_1002849 3300030760 Bacteria 3091
861 Ga0265765_1001162 3300030879 Bacteria 2359
862 Ga0265760_10001235 3300031090 Bacteria 7472
863 Ga0265760_10008710 3300031090 Bacteria 2899
864 Ga0265760_10025268 3300031090 Bacteria 1734
865 Ga0265330_10001378 3300031235 Bacteria 14200
866 Ga0265330_10124717 3300031235 Bacteria 1097
867 Ga0265332_10026881 3300031238 Bacteria 2522
868 Ga0265328_10017008 3300031239 Bacteria 2822
869 Ga0265320_10010173 3300031240 Bacteria 5619
870 Ga0265320_10011149 3300031240 Bacteria 5303
871 Ga0265320_10016105 3300031240 Bacteria 4200
872 Ga0265325_10001701 3300031241 Bacteria 15288
873 Ga0265325_10009862 3300031241 Bacteria 5561
874 Ga0265325_10082724 3300031241 Bacteria 1593
875 Ga0265340_10006886 3300031247 Bacteria 6214
876 Ga0265340_10093220 3300031247 Bacteria 1406
877 Ga0265339_10000011 3300031249 Bacteria 206284
878 Ga0265339_10001359 3300031249 Bacteria 18276
879 Ga0265339_10001433 3300031249 Bacteria 17692
880 Ga0265339_10015256 3300031249 Bacteria 4609
881 Ga0265331_10013068 3300031250 Bacteria 4473
882 Ga0265327_10000014 3300031251 Bacteria 506288
883 Ga0265316_10000390 3300031344 Bacteria 50094
884 Ga0265316_10000523 3300031344 Bacteria 43376
885 Ga0265316_10010760 3300031344 Bacteria 8312
886 Ga0265316_10011481 3300031344 Bacteria 7983
887 Ga0265316_10019573 3300031344 Bacteria 5783
888 Ga0265316_10033261 3300031344 Unclassified 4201
889 Ga0265316_10038328 3300031344 Bacteria 3862
890 Ga0265316_10044392 3300031344 Bacteria 3536
891 Ga0265316_10096370 3300031344 Bacteria 2252
892 Ga0265316_10238166 3300031344 Bacteria 1338
893 Ga0265316_10240099 3300031344 Bacteria 1332
894 Ga0307408_100048150 3300031548 Bacteria 3056
895 Ga0307408_100076533 3300031548 Bacteria 2490
896 Ga0307408_100151714 3300031548 Bacteria 1830
897 Ga0307408_100179890 3300031548 Bacteria 1695
898 Ga0307408_100388040 3300031548 Bacteria 1196
899 Ga0265313_10003345 3300031595 Bacteria 13107
900 Ga0265313_10021569 3300031595 Bacteria 3520
901 Ga0265313_10056632 3300031595 Bacteria 1853
902 Ga0316575_10001488 3300031665 Bacteria 7567
903 Ga0316575_10018143 3300031665 Unclassified 2679
904 Ga0316575_10027858 3300031665 Bacteria 2199
905 Ga0316579_10001127 3300031691 Bacteria 9507
906 Ga0316579_10005953 3300031691 Bacteria 4947
907 Ga0265314_10000036 3300031711 Bacteria 234928
908 Ga0265314_10002466 3300031711 Bacteria 18918
909 Ga0265314_10011383 3300031711 Bacteria 7350
910 Ga0265342_10000377 3300031712 Bacteria 49212
911 Ga0265342_10000788 3300031712 Bacteria 31973
912 Ga0265342_10014707 3300031712 Bacteria 5184
913 Ga0265342_10031155 3300031712 Bacteria 3300
914 Ga0265342_10033572 3300031712 Bacteria 3154
915 Ga0265342_10063973 3300031712 Bacteria 2160
916 Ga0265342_10072643 3300031712 Bacteria 2002
917 Ga0265342_10099334 3300031712 Bacteria 1660
918 Ga0316576_10000176 3300031727 Bacteria 26357
919 Ga0316576_10034695 3300031727 Bacteria 3597
920 Ga0316576_10063629 3300031727 Bacteria 2708
921 Ga0316576_10135066 3300031727 Bacteria 1856
922 Ga0316578_10007657 3300031728 Bacteria 5437
923 Ga0316578_10143986 3300031728 Bacteria 1435
924 Ga0316578_10147830 3300031728 Bacteria 1415
925 Ga0307405_10082905 3300031731 Bacteria 2100
926 Ga0307405_10086064 3300031731 Bacteria 2068
927 Ga0307405_10139485 3300031731 Bacteria 1688
928 Ga0316577_10005881 3300031733 Bacteria 6456
929 Ga0316577_10028765 3300031733 Bacteria 3101
930 Ga0316577_10041957 3300031733 Bacteria 2560
931 Ga0316577_10051477 3300031733 Bacteria 2297
932 Ga0307410_10030903 3300031852 Bacteria 3428
933 Ga0307410_10031559 3300031852 Bacteria 3401
934 Ga0307410_10073363 3300031852 Bacteria 2379
935 Ga0307410_10166712 3300031852 Bacteria 1656
936 Ga0307406_10000573 3300031901 Bacteria 21160
937 Ga0307406_10012696 3300031901 Bacteria 4805
938 Ga0307406_10062500 3300031901 Bacteria 2409
939 Ga0307406_10168379 3300031901 Bacteria 1583
940 Ga0307407_10045780 3300031903 Bacteria 2474
941 Ga0307407_10105340 3300031903 Bacteria 1759
942 Ga0307407_10265300 3300031903 Bacteria 1183
943 Ga0307412_10007208 3300031911 Bacteria 6311
944 Ga0307412_10219157 3300031911 Bacteria 1457
945 Ga0307409_100030777 3300031995 Bacteria 3862
946 Ga0307409_100082565 3300031995 Bacteria 2602
947 Ga0307409_100111351 3300031995 Bacteria 2296
948 Ga0307409_100256983 3300031995 Bacteria 1601
949 Ga0307409_100325905 3300031995 Bacteria 1439
950 Ga0307409_100350128 3300031995 Bacteria 1393
951 Ga0307409_100449720 3300031995 Bacteria 1243
952 Ga0307416_100000453 3300032002 Bacteria 21031
953 Ga0307416_100002533 3300032002 Bacteria 10516
954 Ga0307416_100135375 3300032002 Bacteria 2227
955 Ga0307416_100273517 3300032002 Bacteria 1660
956 Ga0307416_100561962 3300032002 Bacteria 1216
957 Ga0307414_10264643 3300032004 Bacteria 1437
958 Ga0307414_10333828 3300032004 Bacteria 1295
959 Ga0307414_10424352 3300032004 Bacteria 1160
960 Ga0307411_10017664 3300032005 Bacteria 4073
961 Ga0307411_10023552 3300032005 Bacteria 3650
962 Ga0307411_10060712 3300032005 Bacteria 2512
963 Ga0307411_10134278 3300032005 Bacteria 1814
964 Ga0307415_100029569 3300032126 Bacteria 3504
965 Ga0307415_100212840 3300032126 Bacteria 1543
966 Ga0307415_100361320 3300032126 Bacteria 1226
967 Ga0316583_10038918 3300032133 Bacteria 1684
968 Ga0316583_10054512 3300032133 Bacteria 1406
969 Ga0316585_10000518 3300032137 Bacteria 9224
970 Ga0316580_10002122 3300032139 Bacteria 5393
971 Ga0316212_1003877 3300033547 Bacteria 2169
972 Ga0373926_0018520 3300035083 Bacteria 2396
973 Ga0373926_0049806 3300035083 Bacteria 1509
974 Ga0373926_0055174 3300035083 Bacteria 1440
975 Ga0373934_0001808 3300035086 Bacteria 7854
976 Ga0373934_0015827 3300035086 Bacteria 2865
977 Ga0373934_0060064 3300035086 Bacteria 1514
978 Ga0373949_0052560 3300035090 Bacteria 1030
979 Ga0373945_0020112 3300035116 Bacteria 2282
980 Ga0373945_0020901 3300035116 Bacteria 2245
981 Ga0373953_0024910 3300035117 Bacteria 2280
982 Ga0373954_0002656 3300035118 Bacteria 7523
983 Ga0373956_0002098 3300035119 Bacteria 8262
984 Ga0373943_0001313 3300035170 Bacteria 11171
985 Ga0373943_0051694 3300035170 Bacteria 2024
986 Ga0373946_0031525 3300035171 Bacteria 2124
987 Ga0373955_0013885 3300035172 Bacteria 3908
988 Ga0373955_0087116 3300035172 Bacteria 1774
989 Ga0373955_0201676 3300035172 Bacteria 1184
990 Ga0316574_0003541 3300035398 Bacteria 8061
991 Ga0316574_0021845 3300035398 Bacteria 3803
992 Ga0316574_0182367 3300035398 Bacteria 1350
993 Ga0373935_0058605 3300035692 Bacteria 2460
994 Ga0373927_0005068 3300035695 Bacteria 9116
995 Ga0373927_0041960 3300035695 Bacteria 2967
996 Ga0373927_0060673 3300035695 Bacteria 2447
997 Ga0373927_0298266 3300035695 Bacteria 1061
998 Ga0373933_0001471 3300035724 Bacteria 13798
999 Ga0373933_0049233 3300035724 Bacteria 2512
1000 Ga0373947_0016320 3300035725 Bacteria 4268
1001 Ga0373937_0001030 3300036401 Bacteria 23591
1002 Ga0373937_0003079 3300036401 Bacteria 13946
1003 Ga0373937_0098935 3300036401 Bacteria 2706
1004 Ga0373937_0111800 3300036401 Bacteria 2541
1005 Ga0373937_0173832 3300036401 Bacteria 2021
1006 Ga0373937_0220367 3300036401 Bacteria 1786
1007 Ga0373937_0412521 3300036401 Bacteria 1281
1008 Ga0373937_0433294 3300036401 Bacteria 1248
1009 Ga0316582_0021668 3300036647 Unclassified 3802
1010 Ga0316582_0031402 3300036647 Bacteria 3246
1011 Ga0316582_0034557 3300036647 Bacteria 3114
1012 Ga0316582_0068184 3300036647 Bacteria 2296
1013 Ga0316582_0135073 3300036647 Bacteria 1659
1014 Ga0316582_0139231 3300036647 Bacteria 1635
1015 Ga0316582_0154903 3300036647 Unclassified 1550
1016 Ga0316584_0000730 3300036712 Bacteria 18269
1017 Ga0316584_0004451 3300036712 Bacteria 9272
1018 Ga0316584_0019139 3300036712 Bacteria 4946
1019 Ga0316584_0052101 3300036712 Bacteria 3061
1020 Ga0316584_0054449 3300036712 Bacteria 2994
1021 Ga0373925_0004280 3300037068 Bacteria 10817
1022 Ga0373925_0093003 3300037068 Bacteria 2307
1023 Ga0373925_0143727 3300037068 Bacteria 1869
1024 Ga0395899_0038156 3300037312 Bacteria 3599
1025 Ga0395900_0005776 3300037418 Bacteria 12929
1026 Ga0395900_0022025 3300037418 Bacteria 6517
1027 Ga0395900_0185566 3300037418 Bacteria 2111
1028 Ga0395898_0004275 3300037466 Bacteria 15666
1029 Ga0395898_0016471 3300037466 Bacteria 7562
1030 Ga0395898_0026587 3300037466 Bacteria 5820
1031 Ga0395905_0025950 3300037471 Bacteria 5524
1032 Ga0395905_0040878 3300037471 Bacteria 4350
1033 Ga0316581_0000740 3300037588 Bacteria 6720
1034 Ga0316581_0004424 3300037588 Bacteria 3586
1035 Ga0316581_0030200 3300037588 Bacteria 1630
1036 Ga0395901_0000748 3300038443 Bacteria 36691
1037 Ga0395901_0030870 3300038443 Bacteria 5522
1038 Ga0395901_0077025 3300038443 Bacteria 3480
1039 Ga0395901_0121419 3300038443 Bacteria 2746
1040 Ga0395901_0479461 3300038443 Bacteria 1269
1041 Ga0400483_005635 3300039062 Bacteria 9511
1042 Ga0400483_011190 3300039062 Bacteria 182340
1043 Ga0400483_093214 3300039062 Bacteria 200340
1044 Ga0400483_215675 3300039062 Bacteria 181282
1045 Ga0400483_219863 3300039062 Bacteria 173210
1046 Ga0400483_236928 3300039062 Bacteria 10450
1047 Ga0400489_32485 3300039093 Bacteria 1304
1048 Ga0436365_1106392 3300039437 Bacteria 5899
1049 Ga0436362_0505684 3300039453 Bacteria 1580
1050 Ga0451791_0173611 3300041451 Bacteria 1306
1051 Ga0451853_2013714 3300041512 Bacteria 1103
1052 Ga0439433_0013752 3300041999 Bacteria 1779
1053 Ga0439456_015644 3300042013 Bacteria 1586
1054 Ga0439462_0003082 3300042015 Bacteria 3963
1055 Ga0450896_000837 3300042133 Bacteria 3493
1056 Ga0450896_006316 3300042133 Bacteria 1624
1057 Ga0450908_003258 3300042184 Bacteria 3163
1058 Ga0439434_0005911 3300042435 Bacteria 3576
1059 Ga0439435_0004469 3300042436 Bacteria 3015
1060 Ga0439435_0009689 3300042436 Bacteria 2266
1061 Ga0450918_003723 3300042531 Bacteria 2821
1062 Ga0451577_0113437 3300042876 Bacteria 2426
1063 Ga0451577_0176052 3300042876 Bacteria 1928
1064 Ga0451577_0222136 3300042876 Bacteria 1707
1065 Ga0453683_0184216 3300044673 Bacteria 1324
1066 Ga0453684_0001951 3300044712 Bacteria 53210
1067 Ga0453684_0003327 3300044712 Bacteria 36507
1068 Ga0453684_0040322 3300044712 Bacteria 6343
1069 Ga0453684_0127246 3300044712 Unclassified 3064
1070 Ga0453684_0518352 3300044712 Bacteria 1317
1071 Ga0466970_0012651 3300044765 Bacteria 4317
1072 Ga0451576_0010110 3300045051 Bacteria 10865
1073 Ga0451576_0016018 3300045051 Bacteria 8283
1074 Ga0451576_0028389 3300045051 Bacteria 5994
1075 Ga0451576_0068274 3300045051 Bacteria 3699
1076 Ga0451576_0232055 3300045051 Bacteria 1927
1077 Ga0451576_0244801 3300045051 Bacteria 1873
1078 Ga0451576_0310385 3300045051 Bacteria 1650
1079 Ga0451576_0547483 3300045051 Bacteria 1216
1080 Ga0451576_0570623 3300045051 Bacteria 1189
1081 Ga0466967_0028686 3300045976 Bacteria 4650
1082 Ga0495603_0054628 3300046455 Bacteria 2367
1083 Ga0495629_0033455 3300046459 Bacteria 3636
1084 Ga0495629_0078901 3300046459 Bacteria 2298
1085 Ga0495629_0163613 3300046459 Bacteria 1545
1086 Ga0495629_0269404 3300046459 Bacteria 1170
1087 Ga0495638_0016830 3300046460 Bacteria 4889
1088 Ga0495641_0038740 3300046461 Bacteria 2226
1089 Ga0495651_0037993 3300046462 Bacteria 3749
1090 Ga0495651_0051091 3300046462 Bacteria 3188
1091 Ga0495651_0070810 3300046462 Bacteria 2653
1092 Ga0495653_0038384 3300046463 Bacteria 3760
1093 Ga0495653_0099170 3300046463 Bacteria 2114
1094 Ga0495653_0229106 3300046463 Bacteria 1245
1095 Ga0495580_0013226 3300046472 Bacteria 6309
1096 Ga0495580_0067093 3300046472 Bacteria 2511
1097 Ga0495580_0079671 3300046472 Bacteria 2284
1098 Ga0495580_0086908 3300046472 Bacteria 2178
1099 Ga0495580_0093087 3300046472 Bacteria 2098
1100 Ga0495580_0134081 3300046472 Bacteria 1717
1101 Ga0495580_0150582 3300046472 Bacteria 1612
1102 Ga0495580_0168096 3300046472 Bacteria 1517
1103 Ga0495580_0245389 3300046472 Bacteria 1227
1104 Ga0495582_0053906 3300046473 Bacteria 2218
1105 Ga0495639_0019172 3300046475 Bacteria 2984
1106 Ga0495662_0111120 3300046476 Bacteria 1343
1107 Ga0495664_0038910 3300046477 Bacteria 2809
1108 Ga0495664_0050182 3300046477 Bacteria 2477
1109 Ga0495584_0033978 3300046491 Bacteria 2580
1110 Ga0495585_0035699 3300046492 Bacteria 2808
1111 Ga0495594_0008275 3300046499 Bacteria 5355
1112 Ga0495596_0040812 3300046500 Bacteria 1831
1113 Ga0495608_0038026 3300046511 Bacteria 3235
1114 Ga0495608_0066533 3300046511 Bacteria 2359
1115 Ga0495608_0088558 3300046511 Bacteria 2004
1116 Ga0495608_0093787 3300046511 Bacteria 1939
1117 Ga0495618_0032566 3300046514 Bacteria 3264
1118 Ga0495618_0192857 3300046514 Bacteria 1291
1119 Ga0495628_0111025 3300046516 Bacteria 2109
1120 Ga0495630_0010653 3300046517 Bacteria 6636
1121 Ga0495630_0152070 3300046517 Bacteria 1761
1122 Ga0495630_0259240 3300046517 Bacteria 1328
1123 Ga0495630_0482817 3300046517 Bacteria 950
1124 Ga0495643_0003764 3300046522 Bacteria 10963
1125 Ga0495644_0000109 3300046523 Bacteria 39201
1126 Ga0495666_0152886 3300046526 Bacteria 1072
1127 Ga0495652_0041555 3300046529 Bacteria 3969
1128 Ga0495652_0062339 3300046529 Bacteria 3144
1129 Ga0495652_0151957 3300046529 Bacteria 1808
1130 Ga0495652_0166837 3300046529 Bacteria 1703
1131 Ga0495665_0030788 3300046531 Bacteria 2871
1132 Ga0495640_0037807 3300046533 Bacteria 3401
1133 Ga0495640_0055240 3300046533 Bacteria 2717
1134 Ga0495587_0025928 3300046536 Bacteria 3578
1135 Ga0495587_0029174 3300046536 Bacteria 3351
1136 Ga0495587_0078118 3300046536 Bacteria 1921
1137 Ga0495645_0003622 3300046543 Bacteria 10486
1138 Ga0495645_0016503 3300046543 Bacteria 5274
1139 Ga0495667_0039839 3300046559 Bacteria 3122
1140 Ga0495667_0046569 3300046559 Bacteria 2867
1141 Ga0495667_0278199 3300046559 Bacteria 1062
1142 Ga0495634_0150100 3300046642 Bacteria 1474
1143 Ga0495634_0182307 3300046642 Bacteria 1313
1144 Ga0495611_0152419 3300046648 Bacteria 1079
1145 Ga0495635_0049008 3300046663 Bacteria 2912
1146 Ga0495635_0081053 3300046663 Bacteria 2221
1147 Ga0495635_0096304 3300046663 Bacteria 2023
1148 Ga0495659_0083678 3300046664 Bacteria 1215
1149 Ga0495661_0059195 3300046665 Bacteria 2281
1150 Ga0495588_0070854 3300046674 Bacteria 1812
1151 Ga0495657_0036875 3300046675 Bacteria 3375
1152 Ga0495657_0122940 3300046675 Bacteria 1633
1153 Ga0495599_0038487 3300046678 Bacteria 3005
1154 Ga0495599_0067316 3300046678 Bacteria 2237
1155 Ga0495623_0029370 3300046679 Bacteria 3538
1156 Ga0495623_0193903 3300046679 Bacteria 1172
1157 Ga0495646_0065823 3300046680 Bacteria 2145
1158 Ga0495646_0078664 3300046680 Bacteria 1927
1159 Ga0495647_0019003 3300046681 Bacteria 2453
1160 Ga0495658_0021591 3300046683 Bacteria 3395
1161 Ga0495658_0033654 3300046683 Bacteria 2809
1162 Ga0495658_0042183 3300046683 Bacteria 2546
1163 Ga0495613_0009371 3300046689 Bacteria 7264
1164 Ga0495613_0076261 3300046689 Bacteria 2440
1165 Ga0495613_0106936 3300046689 Bacteria 2018
1166 Ga0495613_0130952 3300046689 Bacteria 1796
1167 Ga0495613_0195213 3300046689 Bacteria 1429
1168 Ga0495624_0214613 3300046690 Bacteria 1167
1169 Ga0495670_0038325 3300046691 Bacteria 2390
1170 Ga0495600_0019687 3300046809 Bacteria 4313
1171 Ga0495600_0052119 3300046809 Bacteria 2672
1172 Ga0495581_0028963 3300047315 Bacteria 3211
1173 Ga0495604_0000316 3300047317 Bacteria 43437
1174 Ga0495604_0060936 3300047317 Bacteria 2888
1175 Ga0495604_0076632 3300047317 Bacteria 2515
1176 Ga0495674_0054208 3300047319 Bacteria 3522
1177 Ga0495674_0063090 3300047319 Bacteria 3224
1178 Ga0495674_0075233 3300047319 Bacteria 2906
1179 Ga0495674_0119474 3300047319 Bacteria 2227
1180 Ga0495674_0131881 3300047319 Bacteria 2105
1181 Ga0495674_0159895 3300047319 Bacteria 1885
1182 Ga0495676_0022205 3300047321 Bacteria 5527
1183 Ga0495680_0028177 3300047322 Bacteria 4607
1184 Ga0495680_0070074 3300047322 Bacteria 2674
1185 Ga0495680_0084974 3300047322 Bacteria 2384
1186 Ga0495680_0216595 3300047322 Bacteria 1369
1187 Ga0495675_0194522 3300047444 Bacteria 1237
1188 Ga0495675_0212034 3300047444 Bacteria 1175
1189 Ga0495675_0268280 3300047444 Bacteria 1021
1190 Ga0495684_0006774 3300047471 Bacteria 8895
1191 Ga0495684_0066907 3300047471 Bacteria 2732
1192 Ga0495593_0133456 3300047673 Bacteria 1260
1193 Ga0495602_0010139 3300048088 Bacteria 9781
1194 Ga0495602_0068148 3300048088 Bacteria 3057
1195 Ga0495602_0174268 3300048088 Bacteria 1666
1196 Ga0495614_0024936 3300048089 Bacteria 2581
1197 Ga0496100_0038901 3300048903 Bacteria 3017
1198 Ga0496100_0094185 3300048903 Bacteria 2051
1199 Ga0496100_0264671 3300048903 Bacteria 1276
1200 Ga0496101_0001837 3300048904 Bacteria 12801
1201 Ga0496101_0112442 3300048904 Bacteria 2051
1202 Ga0496101_0148706 3300048904 Bacteria 1790
1203 Ga0496101_0220998 3300048904 Unclassified 1470
1204 Ga0496104_0003735 3300048907 Bacteria 13150
1205 Ga0496104_0006178 3300048907 Bacteria 10519
1206 Ga0496104_0024458 3300048907 Bacteria 5555
1207 Ga0496104_0031819 3300048907 Bacteria 4908
1208 Ga0496104_0170574 3300048907 Unclassified 2086
1209 Ga0496104_0196227 3300048907 Bacteria 1931
1210 Ga0496104_0238776 3300048907 Bacteria 1729
1211 Ga0496105_0017181 3300048908 Bacteria 5794
1212 Ga0496105_0025019 3300048908 Bacteria 4854
1213 Ga0496107_0013317 3300048910 Bacteria 5746
1214 Ga0496107_0098204 3300048910 Bacteria 2145
1215 Ga0496108_0005593 3300048911 Bacteria 10171
1216 Ga0496108_0061089 3300048911 Bacteria 3171
1217 Ga0496108_0289753 3300048911 Bacteria 1425
1218 Ga0496109_0001076 3300048912 Bacteria 22664
1219 Ga0496109_0229484 3300048912 Bacteria 1746
1220 Ga0496110_0124328 3300048913 Bacteria 2327
1221 Ga0496111_0008105 3300048914 Bacteria 6938
1222 Ga0496112_0134148 3300048915 Bacteria 2446
1223 Ga0496112_0200757 3300048915 Bacteria 1953
1224 Ga0496112_0249255 3300048915 Bacteria 1727
1225 Ga0496112_0366081 3300048915 Bacteria 1383
1226 Ga0496112_0521422 3300048915 Bacteria 1123
1227 Ga0496113_0069105 3300048916 Bacteria 2682
1228 Ga0496114_0004686 3300048917 Bacteria 10632
1229 Ga0496114_0056287 3300048917 Bacteria 3281
1230 Ga0496114_0147925 3300048917 Bacteria 2037
1231 Ga0496115_0021362 3300048918 Bacteria 5000
1232 Ga0496115_0055490 3300048918 Unclassified 3182
1233 Ga0496115_0060394 3300048918 Bacteria 3054
1234 Ga0496115_0113889 3300048918 Bacteria 2223
1235 Ga0496115_0243597 3300048918 Bacteria 1482
1236 Ga0496115_0319531 3300048918 Unclassified 1270
1237 Ga0496117_0011177 3300048920 Bacteria 8061
1238 Ga0496118_0024587 3300048921 Bacteria 5194
1239 Ga0496119_0054761 3300048922 Bacteria 2427
1240 Ga0496122_0040764 3300048925 Bacteria 3683
1241 Ga0496125_0000224 3300048928 Bacteria 115811
1242 Ga0501033_0064069 3300049570 Bacteria 2705
1243 Ga0501033_0140758 3300049570 Bacteria 1744
1244 Ga0501034_0010246 3300049571 Bacteria 9777
1245 Ga0501036_0006003 3300049572 Bacteria 9849
1246 Ga0501036_0013567 3300049572 Bacteria 6774
1247 Ga0501036_0033169 3300049572 Bacteria 4367
1248 Ga0501036_0049504 3300049572 Bacteria 3558
1249 Ga0501036_0560374 3300049572 Bacteria 949
1250 Ga0501037_0029707 3300049573 Bacteria 4038
1251 Ga0501037_0042486 3300049573 Bacteria 3340
1252 Ga0501037_0267746 3300049573 Bacteria 1193
1253 Ga0501038_0000991 3300049574 Bacteria 25533
1254 Ga0501038_0014073 3300049574 Bacteria 7289
1255 Ga0501038_0100348 3300049574 Bacteria 2412
1256 Ga0501038_0142246 3300049574 Bacteria 1962
1257 Ga0501038_0181138 3300049574 Bacteria 1700
1258 Ga0501039_0022956 3300049575 Bacteria 4785
1259 Ga0501039_0074496 3300049575 Bacteria 2638
1260 Ga0501039_0100284 3300049575 Bacteria 2260
1261 Ga0501040_0003519 3300049576 Bacteria 10122
1262 Ga0501040_0022672 3300049576 Bacteria 4205
1263 Ga0501040_0044915 3300049576 Bacteria 3012
1264 Ga0501041_0011281 3300049577 Bacteria 5282
1265 Ga0501041_0031028 3300049577 Bacteria 3227
1266 Ga0501041_0229535 3300049577 Bacteria 1165
1267 Ga0501042_0007078 3300049578 Bacteria 7328
1268 Ga0501042_0013134 3300049578 Bacteria 5635
1269 Ga0501042_0018519 3300049578 Bacteria 4822
1270 Ga0501042_0118670 3300049578 Bacteria 1904
1271 Ga0501042_0317061 3300049578 Bacteria 1126
1272 Ga0501043_0002624 3300049579 Bacteria 15147
1273 Ga0501043_0053833 3300049579 Bacteria 3160
1274 Ga0501046_0268932 3300049580 Bacteria 1251
1275 Ga0501047_0000829 3300049581 Bacteria 31883
1276 Ga0501047_0001599 3300049581 Bacteria 22089
1277 Ga0501048_0002638 3300049582 Bacteria 13711
1278 Ga0501048_0017707 3300049582 Bacteria 5244
1279 Ga0501048_0072503 3300049582 Bacteria 2431
1280 Ga0501048_0354549 3300049582 Bacteria 1046
1281 Ga0501067_0081014 3300049583 Bacteria 1800
1282 Ga0501068_0034772 3300049584 Bacteria 3007
1283 Ga0501068_0138533 3300049584 Bacteria 1525
1284 Ga0501069_0027812 3300049585 Bacteria 3100
1285 Ga0501071_0002438 3300049587 Bacteria 11282
1286 Ga0501071_0012615 3300049587 Bacteria 5739
1287 Ga0501071_0031098 3300049587 Bacteria 3781
1288 Ga0501071_0049679 3300049587 Bacteria 3020
1289 Ga0501071_0311503 3300049587 Bacteria 1194
1290 Ga0501072_0012918 3300049588 Bacteria 6387
1291 Ga0501072_0021227 3300049588 Bacteria 5036
1292 Ga0501072_0116443 3300049588 Bacteria 2128
1293 Ga0501072_0158252 3300049588 Bacteria 1807
1294 Ga0501073_0008694 3300049589 Bacteria 7520
1295 Ga0501073_0011036 3300049589 Bacteria 6608
1296 Ga0501074_0000170 3300049590 Bacteria 34950
1297 Ga0501074_0001420 3300049590 Bacteria 15953
1298 Ga0501074_0055665 3300049590 Bacteria 2850
1299 Ga0501074_0301794 3300049590 Bacteria 1137
1300 Ga0501075_0011221 3300049591 Bacteria 6337
1301 Ga0501075_0015397 3300049591 Bacteria 5488
1302 Ga0501075_0026355 3300049591 Bacteria 4279
1303 Ga0501075_0041003 3300049591 Bacteria 3469
1304 Ga0501075_0065619 3300049591 Bacteria 2739
1305 Ga0501076_0012000 3300049592 Bacteria 6473
1306 Ga0501076_0057668 3300049592 Bacteria 3084
1307 Ga0501076_0094097 3300049592 Bacteria 2412
1308 Ga0501076_0228471 3300049592 Bacteria 1521
1309 Ga0501224_000395 3300049664 Bacteria 5193
1310 Ga0501227_010631 3300049665 Bacteria 1996
1311 Ga0501235_000489 3300049669 Bacteria 7865
1312 Ga0501242_002627 3300049674 Bacteria 1902
1313 Ga0501249_005818 3300049679 Bacteria 2521
1314 Ga0501257_002139 3300049686 Bacteria 4131
1315 Ga0501259_002027 3300049688 Bacteria 3342
1316 Ga0501221_003696 3300049704 Bacteria 2523
1317 Ga0501225_0002679 3300049705 Bacteria 5465
1318 Ga0501245_005742 3300049708 Bacteria 1722
1319 Ga0501079_0036556 3300049741 Bacteria 3783
1320 Ga0501079_0038392 3300049741 Bacteria 3692
1321 Ga0501080_0392265 3300049742 Bacteria 1250
1322 Ga0501081_0037043 3300049743 Bacteria 3328
1323 Ga0501081_0043850 3300049743 Bacteria 3069
1324 Ga0501081_0131954 3300049743 Bacteria 1785
1325 Ga0501265_005612 3300049762 Bacteria 1449
1326 Ga0501266_002342 3300049763 Bacteria 2397
1327 Ga0501268_000019 3300049765 Bacteria 13906
1328 Ga0501035_0059868 3300049822 Bacteria 3392
1329 Ga0501035_0144838 3300049822 Bacteria 2064
1330 Ga0501044_0004134 3300049823 Bacteria 16294
1331 Ga0501044_0039975 3300049823 Bacteria 4890
1332 Ga0501045_0006600 3300049824 Bacteria 8037
1333 Ga0501045_0008757 3300049824 Bacteria 7060
1334 Ga0501045_0010135 3300049824 Bacteria 6595
1335 Ga0501045_0018522 3300049824 Bacteria 4954
1336 Ga0501045_0065336 3300049824 Bacteria 2671
1337 nmdc:mga03683_8391_c1 3300050489 Bacteria 3633
1338 nmdc:mga00v17_14306_c1 3300050491 Bacteria 4425
1339 nmdc:mga00v17_16045_c1 3300050491 Bacteria 4217
1340 nmdc:mga00v17_219341_c1 3300050491 Bacteria 1231
1341 nmdc:mga00v17_42763_c1 3300050491 Bacteria 2726
1342 nmdc:mga0k408_119362_c1 3300050493 Bacteria 1561
1343 nmdc:mga0k408_94540_c1 3300050493 Bacteria 1758
1344 nmdc:mga06z11_23354_c1 3300050494 Bacteria 2904
1345 nmdc:mga04h51_109408_c1 3300050495 Bacteria 1017
1346 nmdc:mga04h51_41603_c1 3300050495 Bacteria 1503
1347 nmdc:mga07m45_213376_c1 3300050496 Bacteria 1123
1348 nmdc:mga07m45_29874_c1 3300050496 Bacteria 3017
1349 nmdc:mga05p37_145626_c1 3300050507 Bacteria 2901
1350 nmdc:mga05p37_157704_c1 3300050507 Bacteria 2773
1351 nmdc:mga05p37_21631_c1 3300050507 Bacteria 7793
1352 nmdc:mga05p37_42487_c1 3300050507 Bacteria 5585
1353 nmdc:mga05p37_50499_c1 3300050507 Bacteria 5115
1354 nmdc:mga05p37_53519_c1 3300050507 Bacteria 4963
1355 nmdc:mga05p37_57686_c1 3300050507 Bacteria 4149
1356 nmdc:mga05p37_637_c1 3300050507 Bacteria 38821
1357 nmdc:mga05p37_691381_c1 3300050507 Bacteria 1135
1358 nmdc:mga05p37_70179_c1 3300050507 Bacteria 4310
1359 nmdc:mga05p37_83201_c1 3300050507 Bacteria 3942
1360 nmdc:mga09592_14019_c1 3300050508 Bacteria 6544
1361 nmdc:mga09592_62037_c1 3300050508 Bacteria 3162
1362 nmdc:mga09592_8480_c1 3300050508 Bacteria 8358
1363 nmdc:mga0qj67_12797_c1 3300050509 Bacteria 6328
1364 nmdc:mga0qj67_128340_c1 3300050509 Bacteria 2052
1365 nmdc:mga0qj67_195896_c1 3300050509 Bacteria 1642
1366 nmdc:mga0qj67_34526_c1 3300050509 Bacteria 3951
1367 nmdc:mga0qj67_76609_c1 3300050509 Bacteria 2675
1368 nmdc:mga0qj67_7988_c1 3300050509 Bacteria 7824
1369 nmdc:mga06r32_16603_c1 3300050510 Bacteria 6711
1370 nmdc:mga06r32_26890_c1 3300050510 Bacteria 5370
1371 nmdc:mga06r32_36418_c1 3300050510 Bacteria 4649
1372 nmdc:mga06r32_59331_c1 3300050510 Bacteria 3679
1373 nmdc:mga08y16_12492_c1 3300050511 Bacteria 6412
1374 nmdc:mga08y16_169027_c1 3300050511 Bacteria 2271
1375 nmdc:mga08y16_172800_c1 3300050511 Bacteria 2244
1376 nmdc:mga08y16_203884_c1 3300050511 Bacteria 2049
1377 nmdc:mga08y16_26376_c1 3300050511 Bacteria 6127
1378 nmdc:mga08y16_27598_c1 3300050511 Bacteria 5982
1379 nmdc:mga08y16_362934_c1 3300050511 Bacteria 1487
1380 nmdc:mga08y16_44103_c1 3300050511 Bacteria 4672
1381 nmdc:mga08y16_47457_c1 3300050511 Bacteria 4495
1382 nmdc:mga08y16_558020_c1 3300050511 Bacteria 1158
1383 nmdc:mga08y16_67155_c1 3300050511 Bacteria 3741
1384 nmdc:mga08y16_675687_c1 3300050511 Bacteria 1035
1385 nmdc:mga08y16_68368_c1 3300050511 Bacteria 3704
1386 nmdc:mga08y16_702_c1 3300050511 Bacteria 31855
1387 nmdc:mga0n895_118145_c1 3300050512 Bacteria 2671
1388 nmdc:mga0n895_148770_c1 3300050512 Bacteria 2371
1389 nmdc:mga0n895_150200_c1 3300050512 Bacteria 2360
1390 nmdc:mga0n895_15479_c1 3300050512 Bacteria 6956
1391 nmdc:mga0n895_205321_c1 3300050512 Bacteria 2001
1392 nmdc:mga0n895_229667_c1 3300050512 Bacteria 1884
1393 nmdc:mga0n895_553964_c1 3300050512 Bacteria 1155
1394 nmdc:mga0n895_88331_c1 3300050512 Bacteria 3099
1395 nmdc:mga0n895_9606_c1 3300050512 Bacteria 8475
1396 nmdc:mga0rr50_104933_c1 3300050513 Bacteria 2227
1397 nmdc:mga0rr50_190766_c1 3300050513 Bacteria 1679
1398 nmdc:mga0rr50_340689_c1 3300050513 Bacteria 1260
1399 nmdc:mga0rr50_423538_c1 3300050513 Bacteria 1126
1400 nmdc:mga0rr50_48500_c1 3300050513 Bacteria 3139
1401 nmdc:mga08x19_105455_c1 3300050514 Bacteria 1874
1402 nmdc:mga08x19_31980_c1 3300050514 Bacteria 3314
1403 nmdc:mga08x19_33934_c1 3300050514 Bacteria 3223
1404 nmdc:mga08x19_43338_c1 3300050514 Bacteria 2871
1405 nmdc:mga08x19_43721_c1 3300050514 Bacteria 2858
1406 nmdc:mga08x19_78516_c1 3300050514 Bacteria 2164
1407 nmdc:mga08x19_84089_c1 3300050514 Bacteria 2093
1408 nmdc:mga08x19_87493_c1 3300050514 Bacteria 2053
1409 nmdc:mga0a205_1106_c1 3300050515 Bacteria 22338
1410 nmdc:mga0a205_135534_c1 3300050515 Bacteria 2363
1411 nmdc:mga0a205_13906_c1 3300050515 Bacteria 7503
1412 nmdc:mga0a205_17397_c1 3300050515 Bacteria 6738
1413 nmdc:mga0a205_18643_c1 3300050515 Bacteria 6529
1414 nmdc:mga0a205_222624_c1 3300050515 Bacteria 1772
1415 nmdc:mga0a205_24671_c1 3300050515 Bacteria 5721
1416 nmdc:mga0a205_38775_c1 3300050515 Bacteria 4585
1417 nmdc:mga0a205_6498_c1 3300050515 Bacteria 10570
1418 nmdc:mga0a205_90002_c1 3300050515 Bacteria 2966
1419 Ga0495601_0003043 3300053077 Bacteria 9557
1420 Ga0495601_0018008 3300053077 Bacteria 4294
1421 Ga0495619_0030623 3300053085 Bacteria 3483
1422 Ga0495619_0058525 3300053085 Bacteria 2558
1423 Ga0495619_0211892 3300053085 Bacteria 1342
1424 Ga0495619_0302159 3300053085 Bacteria 1108
1425 Ga0500641_0002653 3300053096 Bacteria 6320
1426 Ga0500555_051991 3300053103 Bacteria 1119
1427 Ga0501084_0027681 3300054114 Bacteria 4736
1428 Ga0501084_0037765 3300054114 Bacteria 4036
1429 Ga0501084_0142649 3300054114 Bacteria 2017
1430 Ga0590071_002832 3300059421 Bacteria 4339
1431 Ga0501082_0002626 3300060353 Bacteria 15701
1432 Ga0501082_0005515 3300060353 Bacteria 10982
1433 Ga0501082_0164310 3300060353 Bacteria 1929
1434 Ga0530510_0011669 3300061734 Bacteria 6166
1435 Ga0530510_0011693 3300061734 Bacteria 6159
1436 Ga0530510_0056166 3300061734 Bacteria 2844
1437 Ga0530510_0077904 3300061734 Bacteria 2409
1438 2644505488 2643221690 Bacteria 4654705
1439 2739234869 2738543010 Bacteria 5583595
1440 2812363807 2811994880 Bacteria 4147780
1441 Ga0207706_10001040
1442 Ga0065712_10014421
1443 Ga0065712_10072146
1444 Ga0065712_10072991
1445 Ga0065712_10075375
1446 Ga0065715_10099686
1447 Ga0065715_10124057
1448 Ga0065715_10155456
1449 Ga0065715_10156126
1450 Ga0065715_10206215
1451 Ga0065715_10230884
1452 Ga0065715_10292306
1453 Ga0065707_10093908
1454 Ga0065707_10115964
1455 Ga0065707_10252124
1456 Ga0070658_10048484
1457 Ga0070658_10183548
1458 Ga0070683_100000006
1459 Ga0070683_100013610
1460 Ga0070683_100016793
1461 Ga0070683_100044786
1462 Ga0070683_100075972
1463 Ga0070683_100100134
1464 Ga0070683_100207291
1465 Ga0070670_100004011
1466 Ga0070670_100010057
1467 Ga0070670_100024330
1468 Ga0070670_100029763
1469 Ga0070670_100068225
1470 Ga0070670_100113896
1471 Ga0070670_100122843
1472 Ga0070670_100162656
1473 Ga0070670_100162905
1474 Ga0070670_100167968
1475 Ga0070670_100184051
1476 Ga0070677_10018146
1477 Ga0070677_10027620
1478 Ga0068869_100000218
1479 Ga0068869_100000577
1480 Ga0070666_10145847
1481 Ga0070666_10354008
1482 Ga0070680_100002912
1483 Ga0070680_100022662
1484 Ga0070680_100495431
1485 Ga0070682_100001496
1486 Ga0070682_100117615
1487 Ga0068868_100008832
1488 Ga0070660_100116839
1489 Ga0070660_100481768
1490 Ga0070689_100014965
1491 Ga0070689_100025345
1492 Ga0070689_100037287
1493 Ga0070689_100040620
1494 Ga0070689_100046098
1495 Ga0070689_100171999
1496 Ga0070689_100283481
1497 Ga0070691_10000314
1498 Ga0070687_100008412
1499 Ga0070687_100011583
1500 Ga0070687_100038834
1501 Ga0070687_100071442
1502 Ga0070687_100084157
1503 Ga0070661_100142319
1504 Ga0070661_100262094
1505 Ga0070692_10151876
1506 Ga0070692_10217802
1507 Ga0070668_100047759
1508 Ga0070668_100205676
1509 Ga0070669_100000727
1510 Ga0070669_100001162
1511 Ga0070669_100030575
1512 Ga0070669_100041004
1513 Ga0070669_100059076
1514 Ga0070669_100120478
1515 Ga0070675_100000381
1516 Ga0070675_100006889
1517 Ga0070675_100007417
1518 Ga0070675_100011685
1519 Ga0070675_100044978
1520 Ga0070675_100054872
1521 Ga0070675_100108234
1522 Ga0070675_100114836
1523 Ga0070675_100138475
1524 Ga0070675_100315484
1525 Ga0070671_100051343
1526 Ga0070671_100061907
1527 Ga0070671_100070668
1528 Ga0070671_100167696
1529 Ga0070671_100326638
1530 Ga0070674_100032698
1531 Ga0070674_100100435
1532 Ga0070673_100004563
1533 Ga0070673_100034084
1534 Ga0070673_100038123
1535 Ga0070673_100045646
1536 Ga0070673_100073125
1537 Ga0070673_100098851
1538 Ga0070673_100115216
1539 Ga0070673_100211335
1540 Ga0070673_100230432
1541 Ga0070688_100093542
1542 Ga0070688_100165880
1543 Ga0070688_100201010
1544 Ga0070688_100293860
1545 Ga0070659_100009356
1546 Ga0070667_100080425
1547 Ga0070667_100088042
1548 Ga0070667_100113410
1549 Ga0070667_100287826
1550 Ga0070667_100341854
1551 Ga0070703_10000330
1552 Ga0070703_10041081
1553 Ga0070709_10001985
1554 Ga0070709_10261763
1555 Ga0070714_100039506
1556 Ga0070714_100067256
1557 Ga0070713_100000180
1558 Ga0070713_100001143
1559 Ga0070713_100087678
1560 Ga0070710_10020002
1561 Ga0070710_10021420
1562 Ga0070710_10041425
1563 Ga0070710_10101273
1564 Ga0070701_10012910
1565 Ga0070701_10101510
1566 Ga0070711_100000441
1567 Ga0070711_100000766
1568 Ga0070711_100014055
1569 Ga0070711_100356552
1570 Ga0070705_100041701
1571 Ga0070705_100099408
1572 Ga0070700_100045999
1573 Ga0070700_100111593
1574 Ga0070694_100000615
1575 Ga0070694_100005219
1576 Ga0070694_100085988
1577 Ga0070694_100248184
1578 Ga0070708_100011899
1579 Ga0070708_100014254
1580 Ga0070708_100027425
1581 Ga0070708_100029858
1582 Ga0070708_100071722
1583 Ga0070708_100089935
1584 Ga0070708_100205648
1585 Ga0070663_100018575
1586 Ga0070663_100089958
1587 Ga0070663_100102817
1588 Ga0070663_100213158
1589 Ga0070678_100022862
1590 Ga0070678_100063645
1591 Ga0070678_100066299
1592 Ga0070662_100026960
1593 Ga0070662_100043799
1594 Ga0070662_100078547
1595 Ga0070662_100214268
1596 Ga0070681_10000728
1597 Ga0070681_10020945
1598 Ga0070681_10028064
1599 Ga0070681_10069961
1600 Ga0070681_10158960
1601 Ga0068867_100007333
1602 Ga0068867_100017285
1603 Ga0068867_100048895
1604 Ga0068867_100050940
1605 Ga0068867_100053894
1606 Ga0070685_10028111
1607 Ga0070685_10297433
1608 Ga0070706_100000202
1609 Ga0070706_100007119
1610 Ga0070706_100010158
1611 Ga0070706_100019466
1612 Ga0070706_100040954
1613 Ga0070706_100041092
1614 Ga0070707_100003644
1615 Ga0070707_100020286
1616 Ga0070707_100158214
1617 Ga0070707_100161919
1618 Ga0070707_100208418
1619 Ga0070698_100004310
1620 Ga0070698_100011109
1621 Ga0070698_100027551
1622 Ga0070698_100099361
1623 Ga0070698_100116389
1624 Ga0070698_100147347
1625 Ga0070698_100204730
1626 Ga0070698_100284782
1627 Ga0070699_100000004
1628 Ga0070699_100001426
1629 Ga0070699_100010867
1630 Ga0070699_100036883
1631 Ga0070699_100381505
1632 Ga0070699_100408030
1633 Ga0070679_100011820
1634 Ga0070679_100031359
1635 Ga0070684_100000050
1636 Ga0070684_100013274
1637 Ga0070684_100016045
1638 Ga0070684_100035511
1639 Ga0070684_100076370
1640 Ga0070684_100139403
1641 Ga0070697_100001931
1642 Ga0070697_100013572
1643 Ga0070697_100033514
1644 Ga0070697_100239181
1645 Ga0070697_100470523
1646 Ga0068853_100012199
1647 Ga0068853_100128331
1648 Ga0068853_100348584
1649 Ga0070672_100009215
1650 Ga0070672_100032476
1651 Ga0070672_100080058
1652 Ga0070672_100105623
1653 Ga0070672_100224480
1654 Ga0070672_100311020
1655 Ga0070686_100028617
1656 Ga0070686_100037127
1657 Ga0070686_100050598
1658 Ga0070686_100087721
1659 Ga0070695_100000829
1660 Ga0070695_100003101
1661 Ga0070695_100014410
1662 Ga0070695_100038480
1663 Ga0070695_100080249
1664 Ga0070695_100092817
1665 Ga0070695_100204806
1666 Ga0070695_100264604
1667 Ga0070696_100002254
1668 Ga0070696_100004072
1669 Ga0070696_100011043
1670 Ga0070696_100112484
1671 Ga0070696_100258281
1672 Ga0070693_100000200
1673 Ga0070693_100002389
1674 Ga0070693_100007875
1675 Ga0070693_100021499
1676 Ga0070693_100033872
1677 Ga0070665_100006550
1678 Ga0070665_100014573
1679 Ga0070665_100041691
1680 Ga0070665_100075674
1681 Ga0070665_100077027
1682 Ga0070665_100173103
1683 Ga0070665_100182862
1684 Ga0070665_100344100
1685 Ga0070704_100001732
1686 Ga0070704_100004385
1687 Ga0070704_100020154
1688 Ga0070704_100105150
1689 Ga0070704_100161598
1690 Ga0070704_100414908
1691 Ga0070704_100451376
1692 Ga0070704_100463580
1693 Ga0068855_100012041
1694 Ga0068855_100067900
1695 Ga0068855_100074669
1696 Ga0068855_100112834
1697 Ga0068855_100434916
1698 Ga0070664_100003381
1699 Ga0070664_100003507
1700 Ga0070664_100021225
1701 Ga0070664_100021878
1702 Ga0070664_100097400
1703 Ga0070664_100152851
1704 Ga0068857_100003973
1705 Ga0068857_100007741
1706 Ga0068857_100041896
1707 Ga0068857_100084299
1708 Ga0068854_100108878
1709 Ga0068856_100011523
1710 Ga0068856_100283926
1711 Ga0070702_100012237
1712 Ga0068852_100013619
1713 Ga0068852_100251942
1714 Ga0068852_100289462
1715 Ga0068859_100077070
1716 Ga0068859_100150035
1717 Ga0068864_100151348
1718 Ga0068864_100157187
1719 Ga0068864_100192775
1720 Ga0068864_100351643
1721 Ga0068864_100566179
1722 Ga0068866_10042715
1723 Ga0068866_10043578
1724 Ga0068866_10059890
1725 Ga0068861_100008754
1726 Ga0068861_100013064
1727 Ga0068861_100025306
1728 Ga0068851_10018515
1729 Ga0068851_10031550
1730 Ga0068851_10040395
1731 Ga0068851_10134187
1732 Ga0068863_100362945
1733 Ga0068858_100003039
1734 Ga0068858_100022792
1735 Ga0068858_100050471
1736 Ga0068858_100086247
1737 Ga0068860_100038707
1738 Ga0068860_100079179
1739 Ga0068860_100111078
1740 Ga0068860_100116371
1741 Ga0068862_100013068
1742 Ga0081538_10003367
1743 Ga0081538_10016220
1744 Ga0081540_1033344
1745 Ga0070717_10000390
1746 Ga0070717_10015105
1747 Ga0075365_10062870
1748 Ga0075365_10097328
1749 Ga0075368_10029364
1750 Ga0075363_100023814
1751 Ga0075364_10002176
1752 Ga0075364_10007283
1753 Ga0075364_10091079
1754 Ga0075364_10113223
1755 Ga0070715_10003425
1756 Ga0070716_100024832
1757 Ga0070716_100255758
1758 Ga0070712_100000424
1759 Ga0070712_100000774
1760 Ga0070712_100042745
1761 Ga0070712_100195630
1762 Ga0075362_10003871
1763 Ga0075362_10018891
1764 Ga0075367_10036654
1765 Ga0075367_10083562
1766 Ga0075367_10192750
1767 Ga0075366_10016496
1768 Ga0075366_10037914
1769 Ga0075366_10038115
1770 Ga0075366_10041787
1771 Ga0075366_10143162
1772 Ga0097621_100051496
1773 Ga0097621_100082717
1774 Ga0097621_100090730
1775 Ga0097621_100115283
1776 Ga0097621_100285383
1777 Ga0097621_100323272
1778 Ga0097621_100529668
1779 Ga0075370_10042865
1780 Ga0075370_10046599
1781 Ga0068871_100024736
1782 Ga0068871_100055534
1783 Ga0075428_100004291
1784 Ga0075428_100005484
1785 Ga0075428_100012404
1786 Ga0075428_100012869
1787 Ga0075428_100033650
1788 Ga0075428_100066771
1789 Ga0075428_100263180
1790 Ga0075428_100378823
1791 Ga0075428_100641544
1792 Ga0075430_100003672
1793 Ga0075430_100003798
1794 Ga0075430_100025288
1795 Ga0075430_100035079
1796 Ga0075430_100127816
1797 Ga0075430_100259642
1798 Ga0075430_100306835
1799 Ga0075431_100004325
1800 Ga0075431_100024159
1801 Ga0075431_100024753
1802 Ga0075431_100030652
1803 Ga0075431_100053177
1804 Ga0075431_100105335
1805 Ga0075433_10000360
1806 Ga0075433_10030890
1807 Ga0075433_10035332
1808 Ga0075433_10074249
1809 Ga0075433_10093298
1810 Ga0075433_10107478
1811 Ga0075433_10122773
1812 Ga0075433_10199807
1813 Ga0075434_100001498
1814 Ga0075434_100027710
1815 Ga0075434_100106316
1816 Ga0075434_100135523
1817 Ga0075434_100145485
1818 Ga0075434_100337988
1819 Ga0075429_100006247
1820 Ga0075429_100010163
1821 Ga0075429_100048104
1822 Ga0075429_100053555
1823 Ga0075429_100082094
1824 Ga0068865_100001348
1825 Ga0068865_100009144
1826 Ga0068865_100062956
1827 Ga0068865_100072957
1828 Ga0075436_100005387
1829 Ga0075436_100006638
1830 Ga0075436_100006643
1831 Ga0075436_100040179
1832 Ga0075436_100045696
1833 Ga0075436_100124095
1834 Ga0075436_100130323
1835 Ga0097620_100077072
1836 Ga0097620_100150038
1837 Ga0097620_100585895
1838 Ga0075435_100004674
1839 Ga0075435_100009374
1840 Ga0075435_100013737
1841 Ga0075435_100047319
1842 Ga0075435_100053607
1843 Ga0075435_100096475
1844 Ga0075435_100136809
1845 Ga0075435_100185286
1846 Ga0075435_100202536
1847 Ga0099795_10000023
1848 Ga0099795_10010705
1849 Ga0105240_10006446
1850 Ga0105240_10024898
1851 Ga0105240_10123688
1852 Ga0105240_10145574
1853 Ga0105240_10246694
1854 Ga0105240_10295827
1855 Ga0105240_10555042
1856 Ga0111539_10002591
1857 Ga0111539_10002914
1858 Ga0111539_10003491
1859 Ga0111539_10003577
1860 Ga0111539_10035761
1861 Ga0111539_10041050
1862 Ga0111539_10114724
1863 Ga0111539_10195054
1864 Ga0111539_10209579
1865 Ga0111539_10223327
1866 Ga0111539_10238357
1867 Ga0111539_10247428
1868 Ga0105245_10016935
1869 Ga0105245_10059544
1870 Ga0105245_10075935
1871 Ga0105245_10324448
1872 Ga0105247_10038134
1873 Ga0105247_10189820
1874 Ga0114129_10002266
1875 Ga0114129_10005113
1876 Ga0114129_10008691
1877 Ga0114129_10008970
1878 Ga0114129_10009206
1879 Ga0114129_10017434
1880 Ga0114129_10022135
1881 Ga0114129_10024405
1882 Ga0114129_10033843
1883 Ga0114129_10061464
1884 Ga0114129_10063642
1885 Ga0114129_10089738
1886 Ga0114129_10099293
1887 Ga0114129_10099321
1888 Ga0114129_10253945
1889 Ga0114129_10317719
1890 Ga0114129_10599126
1891 Ga0114129_10830752
1892 Ga0105243_10003648
1893 Ga0105243_10205728
1894 Ga0105241_10144245
1895 Ga0105242_10012753
1896 Ga0105242_10026761
1897 Ga0105242_10045264
1898 Ga0105242_10082056
1899 Ga0105248_10008828
1900 Ga0105248_10023973
1901 Ga0105248_10048444
1902 Ga0105248_10048781
1903 Ga0105248_10055879
1904 Ga0105248_10081517
1905 Ga0105248_10103067
1906 Ga0105248_10131427
1907 Ga0105248_10133520
1908 Ga0105248_10192908
1909 Ga0105248_10231072
1910 Ga0105248_10250813
1911 Ga0105248_10396229
1912 Ga0105237_10207919
1913 Ga0105237_10211993
1914 Ga0105238_10003340
1915 Ga0105238_10063520
1916 Ga0105238_10099977
1917 Ga0105249_10000517
1918 Ga0105249_10006590
1919 Ga0105249_10026830
1920 Ga0105249_10387486
1921 Ga0105239_10199885
1922 Ga0105239_10385325
1923 Ga0105239_10465736
1924 Ga0105246_10023137
1925 Ga0105246_10108883
1926 Ga0105246_10176615
1927 Ga0105246_10215681
1928 Ga0105246_10437352
1929 Ga0157373_10114747
1930 Ga0157370_10254091
1931 Ga0157369_10006460
1932 Ga0157369_10104725
1933 Ga0157369_10256971
1934 Ga0157374_10001514
1935 Ga0157374_10043990
1936 Ga0157374_10144317
1937 Ga0157374_10231882
1938 Ga0157374_10272023
1939 Ga0157378_10033718
1940 Ga0157378_10085087
1941 Ga0157378_10105791
1942 Ga0157378_10282175
1943 Ga0163162_10000370
1944 Ga0163162_10028261
1945 Ga0163162_10086069
1946 Ga0163162_10088425
1947 Ga0157372_10002177
1948 Ga0157372_10030737
1949 Ga0157372_10030751
1950 Ga0157372_10036897
1951 Ga0157372_10070222
1952 Ga0157372_10107133
1953 Ga0157372_10122026
1954 Ga0157372_10419456
1955 Ga0157372_10433199
1956 Ga0157372_10468468
1957 Ga0157375_10052365
1958 Ga0157375_10119915
1959 Ga0157375_10132161
1960 Ga0157375_10236927
1961 Ga0157375_10247759
1962 Ga0157375_10329808
1963 Ga0163163_10010921
1964 Ga0163163_10115060
1965 Ga0163163_10118338
1966 Ga0163163_10200709
1967 Ga0163163_10299083
1968 Ga0163163_10305849
1969 Ga0163163_10543909
1970 Ga0163163_10578207
1971 Ga0163163_10634304
1972 Ga0157380_10022910
1973 Ga0157380_10060343
1974 Ga0157380_10086528
1975 Ga0157380_10137048
1976 Ga0157380_10213216
1977 Ga0157380_10300222
1978 Ga0157380_10392081
1979 Ga0157377_10178801
1980 Ga0157377_10190607
1981 Ga0157377_10222560
1982 Ga0157379_10026737
1983 Ga0157379_10027489
1984 Ga0157379_10040371
1985 Ga0157379_10053135
1986 Ga0157379_10151788
1987 Ga0157376_10003558
1988 Ga0157376_10043656
1989 Ga0157376_10079268
1990 Ga0157376_10254669
1991 Ga0163161_10003256
1992 Ga0163161_10476846
1993 Ga0224570_100995
1994 Ga0224569_102012
1995 Ga0228598_1001375
1996 Ga0207697_10000143
1997 Ga0207697_10019067
1998 Ga0207656_10013386
1999 Ga0207656_10014207
2000 Ga0207653_10000071
2001 Ga0207653_10026112
2002 Ga0207682_10007365
2003 Ga0207682_10015587
2004 Ga0207682_10031726
2005 Ga0207682_10064833
2006 Ga0207692_10006630
2007 Ga0207642_10067898
2008 Ga0207710_10053314
2009 Ga0207710_10112232
2010 Ga0207688_10002686
2011 Ga0207680_10124411
2012 Ga0207680_10221208
2013 Ga0207680_10289861
2014 Ga0207647_10031204
2015 Ga0207685_10018069
2016 Ga0207699_10004012
2017 Ga0207699_10006533
2018 Ga0207699_10031968
2019 Ga0207699_10092028
2020 Ga0207699_10174747
2021 Ga0207645_10000743
2022 Ga0207645_10022325
2023 Ga0207645_10037601
2024 Ga0207645_10038845
2025 Ga0207643_10004131
2026 Ga0207643_10085356
2027 Ga0207705_10068020
2028 Ga0207705_10143069
2029 Ga0207684_10000204
2030 Ga0207684_10007319
2031 Ga0207684_10008255
2032 Ga0207684_10036722
2033 Ga0207654_10051141
2034 Ga0207654_10152143
2035 Ga0207707_10004652
2036 Ga0207707_10024623
2037 Ga0207707_10034139
2038 Ga0207707_10174739
2039 Ga0207707_10233744
2040 Ga0207695_10058666
2041 Ga0207695_10068686
2042 Ga0207695_10072281
2043 Ga0207695_10142339
2044 Ga0207671_10240292
2045 Ga0207693_10000777
2046 Ga0207693_10001047
2047 Ga0207693_10002215
2048 Ga0207693_10259159
2049 Ga0207663_10001539
2050 Ga0207663_10019520
2051 Ga0207663_10033180
2052 Ga0207663_10075561
2053 Ga0207663_10090220
2054 Ga0207663_10148199
2055 Ga0207660_10000001
2056 Ga0207660_10073058
2057 Ga0207660_10189635
2058 Ga0207662_10006311
2059 Ga0207662_10015678
2060 Ga0207662_10053683
2061 Ga0207662_10089006
2062 Ga0207662_10195939
2063 Ga0207657_10413974
2064 Ga0207649_10015199
2065 Ga0207649_10034085
2066 Ga0207649_10045422
2067 Ga0207652_10008444
2068 Ga0207652_10011006
2069 Ga0207646_10003702
2070 Ga0207646_10008238
2071 Ga0207646_10026427
2072 Ga0207646_10029750
2073 Ga0207646_10043474
2074 Ga0207646_10048209
2075 Ga0207646_10175685
2076 Ga0207646_10383774
2077 Ga0207681_10007137
2078 Ga0207681_10014269
2079 Ga0207681_10014326
2080 Ga0207681_10025386
2081 Ga0207681_10053026
2082 Ga0207681_10054804
2083 Ga0207681_10067554
2084 Ga0207681_10112633
2085 Ga0207681_10243272
2086 Ga0207681_10285426
2087 Ga0207694_10003999
2088 Ga0207650_10048321
2089 Ga0207650_10063070
2090 Ga0207650_10109336
2091 Ga0207650_10116326
2092 Ga0207650_10134105
2093 Ga0207659_10000630
2094 Ga0207659_10038129
2095 Ga0207659_10101223
2096 Ga0207659_10164011
2097 Ga0207659_10347581
2098 Ga0207687_10028103
2099 Ga0207687_10032036
2100 Ga0207687_10043623
2101 Ga0207687_10111343
2102 Ga0207700_10000198
2103 Ga0207700_10005511
2104 Ga0207700_10008571
2105 Ga0207700_10269145
2106 Ga0207664_10060517
2107 Ga0207664_10086379
2108 Ga0207664_10455404
2109 Ga0207644_10040792
2110 Ga0207644_10053279
2111 Ga0207644_10152164
2112 Ga0207644_10334703
2113 Ga0207690_10105343
2114 Ga0207690_10330747
2115 Ga0207706_10002236
2116 Ga0207706_10002730
2117 Ga0207706_10059957
2118 Ga0207706_10108239
2119 Ga0207706_10117177
2120 Ga0207706_10194848
2121 Ga0207706_10209096
2122 Ga0207706_10244522
2123 Ga0207706_10256649
2124 Ga0207706_10530389
2125 Ga0207686_10006648
2126 Ga0207686_10015467
2127 Ga0207686_10026778
2128 Ga0207670_10016027
2129 Ga0207670_10029275
2130 Ga0207670_10035828
2131 Ga0207670_10061191
2132 Ga0207670_10148669
2133 Ga0207669_10002051
2134 Ga0207669_10043725
2135 Ga0207669_10067593
2136 Ga0207669_10093338
2137 Ga0207669_10138684
2138 Ga0207669_10233492
2139 Ga0207704_10012306
2140 Ga0207704_10045869
2141 Ga0207704_10076603
2142 Ga0207665_10000973
2143 Ga0207665_10011628
2144 Ga0207665_10011723
2145 Ga0207665_10026562
2146 Ga0207665_10041165
2147 Ga0207691_10002031
2148 Ga0207691_10003473
2149 Ga0207691_10008843
2150 Ga0207691_10010771
2151 Ga0207691_10015894
2152 Ga0207691_10015943
2153 Ga0207691_10035125
2154 Ga0207691_10041496
2155 Ga0207691_10093370
2156 Ga0207691_10227323
2157 Ga0207711_10029360
2158 Ga0207711_10038116
2159 Ga0207711_10056655
2160 Ga0207711_10100293
2161 Ga0207711_10133263
2162 Ga0207711_10141500
2163 Ga0207711_10145829
2164 Ga0207689_10000700
2165 Ga0207689_10007432
2166 Ga0207689_10035841
2167 Ga0207689_10059254
2168 Ga0207689_10119866
2169 Ga0207689_10131527
2170 Ga0207661_10000011
2171 Ga0207661_10002181
2172 Ga0207661_10023578
2173 Ga0207661_10034991
2174 Ga0207661_10094573
2175 Ga0207661_10159818
2176 Ga0207661_10234286
2177 Ga0207661_10415186
2178 Ga0207679_10009204
2179 Ga0207679_10066419
2180 Ga0207679_10097255
2181 Ga0207679_10099555
2182 Ga0207679_10292977
2183 Ga0207679_10313648
2184 Ga0207667_10044703
2185 Ga0207667_10093213
2186 Ga0207667_10251000
2187 Ga0207651_10007002
2188 Ga0207651_10009512
2189 Ga0207651_10033799
2190 Ga0207651_10049240
2191 Ga0207651_10051872
2192 Ga0207651_10066670
2193 Ga0207651_10079632
2194 Ga0207651_10084363
2195 Ga0207651_10111691
2196 Ga0207651_10137866
2197 Ga0207712_10005715
2198 Ga0207712_10142833
2199 Ga0207712_10172565
2200 Ga0207668_10048164
2201 Ga0207668_10163645
2202 Ga0207658_10317366
2203 Ga0207677_10018985
2204 Ga0207677_10063791
2205 Ga0207677_10203712
2206 Ga0207677_10286845
2207 Ga0207677_10404429
2208 Ga0207703_10035997
2209 Ga0207703_10039860
2210 Ga0207703_10050482
2211 Ga0207703_10131114
2212 Ga0207703_10141663
2213 Ga0207703_10408894
2214 Ga0207639_10056107
2215 Ga0207639_10090509
2216 Ga0207678_10022795
2217 Ga0207678_10031382
2218 Ga0207678_10116577
2219 Ga0207678_10122602
2220 Ga0207678_10185564
2221 Ga0207708_10005458
2222 Ga0207708_10012601
2223 Ga0207708_10017975
2224 Ga0207708_10313618
2225 Ga0207702_10032863
2226 Ga0207702_10492845
2227 Ga0207648_10000831
2228 Ga0207648_10013463
2229 Ga0207648_10033080
2230 Ga0207648_10043265
2231 Ga0207648_10052246
2232 Ga0207648_10143877
2233 Ga0207648_10464751
2234 Ga0207676_10056408
2235 Ga0207676_10056688
2236 Ga0207676_10072834
2237 Ga0207676_10240853
2238 Ga0207674_10000575
2239 Ga0207674_10015400
2240 Ga0207674_10018395
2241 Ga0207674_10053138
2242 Ga0207674_10060999
2243 Ga0207674_10155662
2244 Ga0207675_100001439
2245 Ga0207675_100029121
2246 Ga0207675_100095852
2247 Ga0207675_100605956
2248 Ga0207683_10029677
2249 Ga0207683_10086901
2250 Ga0207683_10125248
2251 Ga0207698_10034543
2252 Ga0207698_10039904
2253 Ga0207698_10210221
2254 Ga0209179_1000035
2255 Ga0209999_1006859
2256 Ga0209588_1045938
2257 Ga0209971_1035165
2258 Ga0209998_10000643
2259 Ga0209998_10015878
2260 Ga0209974_10015654
2261 Ga0207428_10001569
2262 Ga0207428_10031150
2263 Ga0207428_10069738
2264 Ga0207428_10139767
2265 Ga0207428_10148331
2266 Ga0207428_10203577
2267 Ga0265354_1001849
2268 Ga0265356_1000423
2269 Ga0268266_10009803
2270 Ga0268266_10011841
2271 Ga0268266_10095384
2272 Ga0268266_10119392
2273 Ga0268266_10555682
2274 Ga0268265_10002430
2275 Ga0268265_10003755
2276 Ga0268265_10072929
2277 Ga0268265_10144087
2278 Ga0268265_10290108
2279 Ga0268264_10047178
2280 Ga0268264_10259293
2281 Ga0265337_1000341
2282 Ga0265337_1004853
2283 Ga0265326_10018024
2284 Ga0265319_1004109
2285 Ga0265319_1005238
2286 Ga0265319_1064029
2287 Ga0265318_10002057
2288 Ga0265318_10015946
2289 Ga0265318_10089329
2290 Ga0265323_10005821
2291 Ga0265323_10030565
2292 Ga0265322_10007287
2293 Ga0265322_10013995
2294 Ga0265336_10001401
2295 Ga0265338_10001605
2296 Ga0265338_10001803
2297 Ga0265338_10004319
2298 Ga0265338_10013275
2299 Ga0265338_10047014
2300 Ga0265762_1002849
2301 Ga0265765_1001162
2302 Ga0265760_10001235
2303 Ga0265760_10008710
2304 Ga0265760_10025268
2305 Ga0265330_10001378
2306 Ga0265330_10124717
2307 Ga0265332_10026881
2308 Ga0265328_10017008
2309 Ga0265320_10010173
2310 Ga0265320_10011149
2311 Ga0265320_10016105
2312 Ga0265325_10001701
2313 Ga0265325_10009862
2314 Ga0265325_10082724
2315 Ga0265340_10006886
2316 Ga0265340_10093220
2317 Ga0265339_10000011
2318 Ga0265339_10001359
2319 Ga0265339_10001433
2320 Ga0265339_10015256
2321 Ga0265331_10013068
2322 Ga0265327_10000014
2323 Ga0265316_10000390
2324 Ga0265316_10000523
2325 Ga0265316_10010760
2326 Ga0265316_10011481
2327 Ga0265316_10019573
2328 Ga0265316_10033261
2329 Ga0265316_10038328
2330 Ga0265316_10044392
2331 Ga0265316_10096370
2332 Ga0265316_10238166
2333 Ga0265316_10240099
2334 Ga0307408_100048150
2335 Ga0307408_100076533
2336 Ga0307408_100151714
2337 Ga0307408_100179890
2338 Ga0307408_100388040
2339 Ga0265313_10003345
2340 Ga0265313_10021569
2341 Ga0265313_10056632
2342 Ga0316575_10001488
2343 Ga0316575_10018143
2344 Ga0316575_10027858
2345 Ga0316579_10001127
2346 Ga0316579_10005953
2347 Ga0265314_10000036
2348 Ga0265314_10002466
2349 Ga0265314_10011383
2350 Ga0265342_10000377
2351 Ga0265342_10000788
2352 Ga0265342_10014707
2353 Ga0265342_10031155
2354 Ga0265342_10033572
2355 Ga0265342_10063973
2356 Ga0265342_10072643
2357 Ga0265342_10099334
2358 Ga0316576_10000176
2359 Ga0316576_10034695
2360 Ga0316576_10063629
2361 Ga0316576_10135066
2362 Ga0316578_10007657
2363 Ga0316578_10143986
2364 Ga0316578_10147830
2365 Ga0307405_10082905
2366 Ga0307405_10086064
2367 Ga0307405_10139485
2368 Ga0316577_10005881
2369 Ga0316577_10028765
2370 Ga0316577_10041957
2371 Ga0316577_10051477
2372 Ga0307410_10030903
2373 Ga0307410_10031559
2374 Ga0307410_10073363
2375 Ga0307410_10166712
2376 Ga0307406_10000573
2377 Ga0307406_10012696
2378 Ga0307406_10062500
2379 Ga0307406_10168379
2380 Ga0307407_10045780
2381 Ga0307407_10105340
2382 Ga0307407_10265300
2383 Ga0307412_10007208
2384 Ga0307412_10219157
2385 Ga0307409_100030777
2386 Ga0307409_100082565
2387 Ga0307409_100111351
2388 Ga0307409_100256983
2389 Ga0307409_100325905
2390 Ga0307409_100350128
2391 Ga0307409_100449720
2392 Ga0307416_100000453
2393 Ga0307416_100002533
2394 Ga0307416_100135375
2395 Ga0307416_100273517
2396 Ga0307416_100561962
2397 Ga0307414_10264643
2398 Ga0307414_10333828
2399 Ga0307414_10424352
2400 Ga0307411_10017664
2401 Ga0307411_10023552
2402 Ga0307411_10060712
2403 Ga0307411_10134278
2404 Ga0307415_100029569
2405 Ga0307415_100212840
2406 Ga0307415_100361320
2407 Ga0316583_10038918
2408 Ga0316583_10054512
2409 Ga0316585_10000518
2410 Ga0316580_10002122
2411 Ga0316212_1003877
2412 Ga0373926_0018520
2413 Ga0373926_0049806
2414 Ga0373926_0055174
2415 Ga0373934_0001808
2416 Ga0373934_0015827
2417 Ga0373934_0060064
2418 Ga0373949_0052560
2419 Ga0373945_0020112
2420 Ga0373945_0020901
2421 Ga0373953_0024910
2422 Ga0373954_0002656
2423 Ga0373956_0002098
2424 Ga0373943_0001313
2425 Ga0373943_0051694
2426 Ga0373946_0031525
2427 Ga0373955_0013885
2428 Ga0373955_0087116
2429 Ga0373955_0201676
2430 Ga0316574_0003541
2431 Ga0316574_0021845
2432 Ga0316574_0182367
2433 Ga0373935_0058605
2434 Ga0373927_0005068
2435 Ga0373927_0041960
2436 Ga0373927_0060673
2437 Ga0373927_0298266
2438 Ga0373933_0001471
2439 Ga0373933_0049233
2440 Ga0373947_0016320
2441 Ga0373937_0001030
2442 Ga0373937_0003079
2443 Ga0373937_0098935
2444 Ga0373937_0111800
2445 Ga0373937_0173832
2446 Ga0373937_0220367
2447 Ga0373937_0412521
2448 Ga0373937_0433294
2449 Ga0316582_0021668
2450 Ga0316582_0031402
2451 Ga0316582_0034557
2452 Ga0316582_0068184
2453 Ga0316582_0135073
2454 Ga0316582_0139231
2455 Ga0316582_0154903
2456 Ga0316584_0000730
2457 Ga0316584_0004451
2458 Ga0316584_0019139
2459 Ga0316584_0052101
2460 Ga0316584_0054449
2461 Ga0373925_0004280
2462 Ga0373925_0093003
2463 Ga0373925_0143727
2464 Ga0395899_0038156
2465 Ga0395900_0005776
2466 Ga0395900_0022025
2467 Ga0395900_0185566
2468 Ga0395898_0004275
2469 Ga0395898_0016471
2470 Ga0395898_0026587
2471 Ga0395905_0025950
2472 Ga0395905_0040878
2473 Ga0316581_0000740
2474 Ga0316581_0004424
2475 Ga0316581_0030200
2476 Ga0395901_0000748
2477 Ga0395901_0030870
2478 Ga0395901_0077025
2479 Ga0395901_0121419
2480 Ga0395901_0479461
2481 Ga0400483_005635
2482 Ga0400483_011190
2483 Ga0400483_093214
2484 Ga0400483_215675
2485 Ga0400483_219863
2486 Ga0400483_236928
2487 Ga0400489_32485
2488 Ga0436365_1106392
2489 Ga0436362_0505684
2490 Ga0451791_0173611
2491 Ga0451853_2013714
2492 Ga0439433_0013752
2493 Ga0439456_015644
2494 Ga0439462_0003082
2495 Ga0450896_000837
2496 Ga0450896_006316
2497 Ga0450908_003258
2498 Ga0439434_0005911
2499 Ga0439435_0004469
2500 Ga0439435_0009689
2501 Ga0450918_003723
2502 Ga0451577_0113437
2503 Ga0451577_0176052
2504 Ga0451577_0222136
2505 Ga0453683_0184216
2506 Ga0453684_0001951
2507 Ga0453684_0003327
2508 Ga0453684_0040322
2509 Ga0453684_0127246
2510 Ga0453684_0518352
2511 Ga0466970_0012651
2512 Ga0451576_0010110
2513 Ga0451576_0016018
2514 Ga0451576_0028389
2515 Ga0451576_0068274
2516 Ga0451576_0232055
2517 Ga0451576_0244801
2518 Ga0451576_0310385
2519 Ga0451576_0547483
2520 Ga0451576_0570623
2521 Ga0466967_0028686
2522 Ga0495603_0054628
2523 Ga0495629_0033455
2524 Ga0495629_0078901
2525 Ga0495629_0163613
2526 Ga0495629_0269404
2527 Ga0495638_0016830
2528 Ga0495641_0038740
2529 Ga0495651_0037993
2530 Ga0495651_0051091
2531 Ga0495651_0070810
2532 Ga0495653_0038384
2533 Ga0495653_0099170
2534 Ga0495653_0229106
2535 Ga0495580_0013226
2536 Ga0495580_0067093
2537 Ga0495580_0079671
2538 Ga0495580_0086908
2539 Ga0495580_0093087
2540 Ga0495580_0134081
2541 Ga0495580_0150582
2542 Ga0495580_0168096
2543 Ga0495580_0245389
2544 Ga0495582_0053906
2545 Ga0495639_0019172
2546 Ga0495662_0111120
2547 Ga0495664_0038910
2548 Ga0495664_0050182
2549 Ga0495584_0033978
2550 Ga0495585_0035699
2551 Ga0495594_0008275
2552 Ga0495596_0040812
2553 Ga0495608_0038026
2554 Ga0495608_0066533
2555 Ga0495608_0088558
2556 Ga0495608_0093787
2557 Ga0495618_0032566
2558 Ga0495618_0192857
2559 Ga0495628_0111025
2560 Ga0495630_0010653
2561 Ga0495630_0152070
2562 Ga0495630_0259240
2563 Ga0495630_0482817
2564 Ga0495643_0003764
2565 Ga0495644_0000109
2566 Ga0495666_0152886
2567 Ga0495652_0041555
2568 Ga0495652_0062339
2569 Ga0495652_0151957
2570 Ga0495652_0166837
2571 Ga0495665_0030788
2572 Ga0495640_0037807
2573 Ga0495640_0055240
2574 Ga0495587_0025928
2575 Ga0495587_0029174
2576 Ga0495587_0078118
2577 Ga0495645_0003622
2578 Ga0495645_0016503
2579 Ga0495667_0039839
2580 Ga0495667_0046569
2581 Ga0495667_0278199
2582 Ga0495634_0150100
2583 Ga0495634_0182307
2584 Ga0495611_0152419
2585 Ga0495635_0049008
2586 Ga0495635_0081053
2587 Ga0495635_0096304
2588 Ga0495659_0083678
2589 Ga0495661_0059195
2590 Ga0495588_0070854
2591 Ga0495657_0036875
2592 Ga0495657_0122940
2593 Ga0495599_0038487
2594 Ga0495599_0067316
2595 Ga0495623_0029370
2596 Ga0495623_0193903
2597 Ga0495646_0065823
2598 Ga0495646_0078664
2599 Ga0495647_0019003
2600 Ga0495658_0021591
2601 Ga0495658_0033654
2602 Ga0495658_0042183
2603 Ga0495613_0009371
2604 Ga0495613_0076261
2605 Ga0495613_0106936
2606 Ga0495613_0130952
2607 Ga0495613_0195213
2608 Ga0495624_0214613
2609 Ga0495670_0038325
2610 Ga0495600_0019687
2611 Ga0495600_0052119
2612 Ga0495581_0028963
2613 Ga0495604_0000316
2614 Ga0495604_0060936
2615 Ga0495604_0076632
2616 Ga0495674_0054208
2617 Ga0495674_0063090
2618 Ga0495674_0075233
2619 Ga0495674_0119474
2620 Ga0495674_0131881
2621 Ga0495674_0159895
2622 Ga0495676_0022205
2623 Ga0495680_0028177
2624 Ga0495680_0070074
2625 Ga0495680_0084974
2626 Ga0495680_0216595
2627 Ga0495675_0194522
2628 Ga0495675_0212034
2629 Ga0495675_0268280
2630 Ga0495684_0006774
2631 Ga0495684_0066907
2632 Ga0495593_0133456
2633 Ga0495602_0010139
2634 Ga0495602_0068148
2635 Ga0495602_0174268
2636 Ga0495614_0024936
2637 Ga0496100_0038901
2638 Ga0496100_0094185
2639 Ga0496100_0264671
2640 Ga0496101_0001837
2641 Ga0496101_0112442
2642 Ga0496101_0148706
2643 Ga0496101_0220998
2644 Ga0496104_0003735
2645 Ga0496104_0006178
2646 Ga0496104_0024458
2647 Ga0496104_0031819
2648 Ga0496104_0170574
2649 Ga0496104_0196227
2650 Ga0496104_0238776
2651 Ga0496105_0017181
2652 Ga0496105_0025019
2653 Ga0496107_0013317
2654 Ga0496107_0098204
2655 Ga0496108_0005593
2656 Ga0496108_0061089
2657 Ga0496108_0289753
2658 Ga0496109_0001076
2659 Ga0496109_0229484
2660 Ga0496110_0124328
2661 Ga0496111_0008105
2662 Ga0496112_0134148
2663 Ga0496112_0200757
2664 Ga0496112_0249255
2665 Ga0496112_0366081
2666 Ga0496112_0521422
2667 Ga0496113_0069105
2668 Ga0496114_0004686
2669 Ga0496114_0056287
2670 Ga0496114_0147925
2671 Ga0496115_0021362
2672 Ga0496115_0055490
2673 Ga0496115_0060394
2674 Ga0496115_0113889
2675 Ga0496115_0243597
2676 Ga0496115_0319531
2677 Ga0496117_0011177
2678 Ga0496118_0024587
2679 Ga0496119_0054761
2680 Ga0496122_0040764
2681 Ga0496125_0000224
2682 Ga0501033_0064069
2683 Ga0501033_0140758
2684 Ga0501034_0010246
2685 Ga0501036_0006003
2686 Ga0501036_0013567
2687 Ga0501036_0033169
2688 Ga0501036_0049504
2689 Ga0501036_0560374
2690 Ga0501037_0029707
2691 Ga0501037_0042486
2692 Ga0501037_0267746
2693 Ga0501038_0000991
2694 Ga0501038_0014073
2695 Ga0501038_0100348
2696 Ga0501038_0142246
2697 Ga0501038_0181138
2698 Ga0501039_0022956
2699 Ga0501039_0074496
2700 Ga0501039_0100284
2701 Ga0501040_0003519
2702 Ga0501040_0022672
2703 Ga0501040_0044915
2704 Ga0501041_0011281
2705 Ga0501041_0031028
2706 Ga0501041_0229535
2707 Ga0501042_0007078
2708 Ga0501042_0013134
2709 Ga0501042_0018519
2710 Ga0501042_0118670
2711 Ga0501042_0317061
2712 Ga0501043_0002624
2713 Ga0501043_0053833
2714 Ga0501046_0268932
2715 Ga0501047_0000829
2716 Ga0501047_0001599
2717 Ga0501048_0002638
2718 Ga0501048_0017707
2719 Ga0501048_0072503
2720 Ga0501048_0354549
2721 Ga0501067_0081014
2722 Ga0501068_0034772
2723 Ga0501068_0138533
2724 Ga0501069_0027812
2725 Ga0501071_0002438
2726 Ga0501071_0012615
2727 Ga0501071_0031098
2728 Ga0501071_0049679
2729 Ga0501071_0311503
2730 Ga0501072_0012918
2731 Ga0501072_0021227
2732 Ga0501072_0116443
2733 Ga0501072_0158252
2734 Ga0501073_0008694
2735 Ga0501073_0011036
2736 Ga0501074_0000170
2737 Ga0501074_0001420
2738 Ga0501074_0055665
2739 Ga0501074_0301794
2740 Ga0501075_0011221
2741 Ga0501075_0015397
2742 Ga0501075_0026355
2743 Ga0501075_0041003
2744 Ga0501075_0065619
2745 Ga0501076_0012000
2746 Ga0501076_0057668
2747 Ga0501076_0094097
2748 Ga0501076_0228471
2749 Ga0501224_000395
2750 Ga0501227_010631
2751 Ga0501235_000489
2752 Ga0501242_002627
2753 Ga0501249_005818
2754 Ga0501257_002139
2755 Ga0501259_002027
2756 Ga0501221_003696
2757 Ga0501225_0002679
2758 Ga0501245_005742
2759 Ga0501079_0036556
2760 Ga0501079_0038392
2761 Ga0501080_0392265
2762 Ga0501081_0037043
2763 Ga0501081_0043850
2764 Ga0501081_0131954
2765 Ga0501265_005612
2766 Ga0501266_002342
2767 Ga0501268_000019
2768 Ga0501035_0059868
2769 Ga0501035_0144838
2770 Ga0501044_0004134
2771 Ga0501044_0039975
2772 Ga0501045_0006600
2773 Ga0501045_0008757
2774 Ga0501045_0010135
2775 Ga0501045_0018522
2776 Ga0501045_0065336
2777 nmdc:mga03683_8391_c1
2778 nmdc:mga00v17_14306_c1
2779 nmdc:mga00v17_16045_c1
2780 nmdc:mga00v17_219341_c1
2781 nmdc:mga00v17_42763_c1
2782 nmdc:mga0k408_119362_c1
2783 nmdc:mga0k408_94540_c1
2784 nmdc:mga06z11_23354_c1
2785 nmdc:mga04h51_109408_c1
2786 nmdc:mga04h51_41603_c1
2787 nmdc:mga07m45_213376_c1
2788 nmdc:mga07m45_29874_c1
2789 nmdc:mga05p37_145626_c1
2790 nmdc:mga05p37_157704_c1
2791 nmdc:mga05p37_21631_c1
2792 nmdc:mga05p37_42487_c1
2793 nmdc:mga05p37_50499_c1
2794 nmdc:mga05p37_53519_c1
2795 nmdc:mga05p37_57686_c1
2796 nmdc:mga05p37_637_c1
2797 nmdc:mga05p37_691381_c1
2798 nmdc:mga05p37_70179_c1
2799 nmdc:mga05p37_83201_c1
2800 nmdc:mga09592_14019_c1
2801 nmdc:mga09592_62037_c1
2802 nmdc:mga09592_8480_c1
2803 nmdc:mga0qj67_12797_c1
2804 nmdc:mga0qj67_128340_c1
2805 nmdc:mga0qj67_195896_c1
2806 nmdc:mga0qj67_34526_c1
2807 nmdc:mga0qj67_76609_c1
2808 nmdc:mga0qj67_7988_c1
2809 nmdc:mga06r32_16603_c1
2810 nmdc:mga06r32_26890_c1
2811 nmdc:mga06r32_36418_c1
2812 nmdc:mga06r32_59331_c1
2813 nmdc:mga08y16_12492_c1
2814 nmdc:mga08y16_169027_c1
2815 nmdc:mga08y16_172800_c1
2816 nmdc:mga08y16_203884_c1
2817 nmdc:mga08y16_26376_c1
2818 nmdc:mga08y16_27598_c1
2819 nmdc:mga08y16_362934_c1
2820 nmdc:mga08y16_44103_c1
2821 nmdc:mga08y16_47457_c1
2822 nmdc:mga08y16_558020_c1
2823 nmdc:mga08y16_67155_c1
2824 nmdc:mga08y16_675687_c1
2825 nmdc:mga08y16_68368_c1
2826 nmdc:mga08y16_702_c1
2827 nmdc:mga0n895_118145_c1
2828 nmdc:mga0n895_148770_c1
2829 nmdc:mga0n895_150200_c1
2830 nmdc:mga0n895_15479_c1
2831 nmdc:mga0n895_205321_c1
2832 nmdc:mga0n895_229667_c1
2833 nmdc:mga0n895_553964_c1
2834 nmdc:mga0n895_88331_c1
2835 nmdc:mga0n895_9606_c1
2836 nmdc:mga0rr50_104933_c1
2837 nmdc:mga0rr50_190766_c1
2838 nmdc:mga0rr50_340689_c1
2839 nmdc:mga0rr50_423538_c1
2840 nmdc:mga0rr50_48500_c1
2841 nmdc:mga08x19_105455_c1
2842 nmdc:mga08x19_31980_c1
2843 nmdc:mga08x19_33934_c1
2844 nmdc:mga08x19_43338_c1
2845 nmdc:mga08x19_43721_c1
2846 nmdc:mga08x19_78516_c1
2847 nmdc:mga08x19_84089_c1
2848 nmdc:mga08x19_87493_c1
2849 nmdc:mga0a205_1106_c1
2850 nmdc:mga0a205_135534_c1
2851 nmdc:mga0a205_13906_c1
2852 nmdc:mga0a205_17397_c1
2853 nmdc:mga0a205_18643_c1
2854 nmdc:mga0a205_222624_c1
2855 nmdc:mga0a205_24671_c1
2856 nmdc:mga0a205_38775_c1
2857 nmdc:mga0a205_6498_c1
2858 nmdc:mga0a205_90002_c1
2859 Ga0495601_0003043
2860 Ga0495601_0018008
2861 Ga0495619_0030623
2862 Ga0495619_0058525
2863 Ga0495619_0211892
2864 Ga0495619_0302159
2865 Ga0500641_0002653
2866 Ga0500555_051991
2867 Ga0501084_0027681
2868 Ga0501084_0037765
2869 Ga0501084_0142649
2870 Ga0590071_002832
2871 Ga0501082_0002626
2872 Ga0501082_0005515
2873 Ga0501082_0164310
2874 Ga0530510_0011669
2875 Ga0530510_0011693
2876 Ga0530510_0056166
2877 Ga0530510_0077904
2878 2644505488
2879 2739234869
2880 2812363807

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

77

217

0.94

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

186

251

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9073 5 221
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9066 3 224
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9052 1 222
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9025 1 221
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.902 2 224
ID Description Score Start End Superfamily
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9549 1 221 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9492 3 222 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9449 4 223 3.40.50.300
af_P9WQL7_7_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9435 3 221 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9428 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7T7XM26-F1-model_v4 ABC transporter ATP-binding protein 0.9715 3 222 GO:0005524
GO:0016887
AF-A0A1V5WLN9-F1-model_v4 Putative ABC transporter ATP-binding protein YbhF 0.9634 3 222 GO:0005524
GO:0016887
AF-A0A7V5DKD2-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9499 6 214 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A7X8XW61-F1-model_v4 ABC transporter ATP-binding protein 0.9487 1 224 GO:0005524
GO:0005886
GO:0016887
AF-A0A520NVZ7-F1-model_v4 ABC transporter ATP-binding protein 0.9467 1 221 GO:0005524
GO:0016887

Map