F493984
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1441 | 438 | 2880 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300025933|Ga0207706_10001040|Ga0207706_1000104015 |
| Length | 362 |
| Sequence | MRFLVSICISHTGISRCPIGQDKNYWSYCGAKPGLVRGSTLNTPRQVHSSAIFKEDIMHPVIEVSGVRKTYGKTVAVEEASFSVNQGEIFGLIGPNGAGKTTTMECIEGIRKPDAGSIAVLGLDPFRQVYKLQDRIGVQLQQAQLQKRIKVWEAVDLWASLYGKNVIDGKRLLEQLGLTEKRGSWFMNLSGGQKQRLFIALALINDPEVVFLDELTTGLDPQARHAIWDLVRGIRERGKTVFLTTHLMEEAERLCDRVAIMEHGRIIDIDTPDGLVRRHCPERTVVLVADDPAAGEHFKAIPEAESVSCVNARFTIRGRGDDLITAVIRCLSENRIRVTDFRTILPNLEDVFLKLTGHSIRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 133 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 134 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 207 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 227 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 229 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 235 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 239 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 252 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 253 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 254 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 255 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 256 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 272 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 281 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 282 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 283 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 284 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 287 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 288 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 289 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 290 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 291 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 292 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 293 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 294 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 295 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 359 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 363 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 364 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 365 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 366 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 367 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 368 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 369 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 396 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 397 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 398 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 399 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 400 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 401 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 402 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 403 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 404 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 408 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 409 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 410 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 414 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 415 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 416 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 417 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 418 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 419 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 432 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 434 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 436 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 437 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 438 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.35 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.36 |
| Nodule | 0 |
| Rhizoplane | 2.85 |
| Rhizosphere | 93.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207706_10001040 | 3300025933 | Bacteria | 28167 |
| 2 | Ga0065712_10014421 | 3300005290 | Bacteria | 2274 |
| 3 | Ga0065712_10072146 | 3300005290 | Bacteria | 4882 |
| 4 | Ga0065712_10072991 | 3300005290 | Bacteria | 4543 |
| 5 | Ga0065712_10075375 | 3300005290 | Bacteria | 3876 |
| 6 | Ga0065715_10099686 | 3300005293 | Bacteria | 3363 |
| 7 | Ga0065715_10124057 | 3300005293 | Bacteria | 2163 |
| 8 | Ga0065715_10155456 | 3300005293 | Bacteria | 1682 |
| 9 | Ga0065715_10156126 | 3300005293 | Bacteria | 1670 |
| 10 | Ga0065715_10206215 | 3300005293 | Bacteria | 1336 |
| 11 | Ga0065715_10230884 | 3300005293 | Bacteria | 1234 |
| 12 | Ga0065715_10292306 | 3300005293 | Bacteria | 1060 |
| 13 | Ga0065707_10093908 | 3300005295 | Bacteria | 3564 |
| 14 | Ga0065707_10115964 | 3300005295 | Bacteria | 2252 |
| 15 | Ga0065707_10252124 | 3300005295 | Bacteria | 1122 |
| 16 | Ga0070658_10048484 | 3300005327 | Bacteria | 3440 |
| 17 | Ga0070658_10183548 | 3300005327 | Bacteria | 1761 |
| 18 | Ga0070683_100000006 | 3300005329 | Bacteria | 361071 |
| 19 | Ga0070683_100013610 | 3300005329 | Bacteria | 7099 |
| 20 | Ga0070683_100016793 | 3300005329 | Bacteria | 6457 |
| 21 | Ga0070683_100044786 | 3300005329 | Bacteria | 4082 |
| 22 | Ga0070683_100075972 | 3300005329 | Bacteria | 3140 |
| 23 | Ga0070683_100100134 | 3300005329 | Bacteria | 2728 |
| 24 | Ga0070683_100207291 | 3300005329 | Bacteria | 1862 |
| 25 | Ga0070670_100004011 | 3300005331 | Bacteria | 12287 |
| 26 | Ga0070670_100010057 | 3300005331 | Bacteria | 8075 |
| 27 | Ga0070670_100024330 | 3300005331 | Bacteria | 5208 |
| 28 | Ga0070670_100029763 | 3300005331 | Bacteria | 4703 |
| 29 | Ga0070670_100068225 | 3300005331 | Bacteria | 3053 |
| 30 | Ga0070670_100113896 | 3300005331 | Bacteria | 2331 |
| 31 | Ga0070670_100122843 | 3300005331 | Bacteria | 2240 |
| 32 | Ga0070670_100162656 | 3300005331 | Bacteria | 1935 |
| 33 | Ga0070670_100162905 | 3300005331 | Bacteria | 1933 |
| 34 | Ga0070670_100167968 | 3300005331 | Bacteria | 1902 |
| 35 | Ga0070670_100184051 | 3300005331 | Bacteria | 1814 |
| 36 | Ga0070677_10018146 | 3300005333 | Bacteria | 2531 |
| 37 | Ga0070677_10027620 | 3300005333 | Bacteria | 2138 |
| 38 | Ga0068869_100000218 | 3300005334 | Bacteria | 29911 |
| 39 | Ga0068869_100000577 | 3300005334 | Bacteria | 20570 |
| 40 | Ga0070666_10145847 | 3300005335 | Bacteria | 1650 |
| 41 | Ga0070666_10354008 | 3300005335 | Bacteria | 1051 |
| 42 | Ga0070680_100002912 | 3300005336 | Bacteria | 12721 |
| 43 | Ga0070680_100022662 | 3300005336 | Bacteria | 5005 |
| 44 | Ga0070680_100495431 | 3300005336 | Bacteria | 1045 |
| 45 | Ga0070682_100001496 | 3300005337 | Bacteria | 13093 |
| 46 | Ga0070682_100117615 | 3300005337 | Bacteria | 1780 |
| 47 | Ga0068868_100008832 | 3300005338 | Bacteria | 7219 |
| 48 | Ga0070660_100116839 | 3300005339 | Bacteria | 2127 |
| 49 | Ga0070660_100481768 | 3300005339 | Bacteria | 1031 |
| 50 | Ga0070689_100014965 | 3300005340 | Bacteria | 5648 |
| 51 | Ga0070689_100025345 | 3300005340 | Bacteria | 4454 |
| 52 | Ga0070689_100037287 | 3300005340 | Bacteria | 3717 |
| 53 | Ga0070689_100040620 | 3300005340 | Bacteria | 3568 |
| 54 | Ga0070689_100046098 | 3300005340 | Bacteria | 3358 |
| 55 | Ga0070689_100171999 | 3300005340 | Bacteria | 1755 |
| 56 | Ga0070689_100283481 | 3300005340 | Bacteria | 1375 |
| 57 | Ga0070691_10000314 | 3300005341 | Bacteria | 17078 |
| 58 | Ga0070687_100008412 | 3300005343 | Bacteria | 4371 |
| 59 | Ga0070687_100011583 | 3300005343 | Bacteria | 3863 |
| 60 | Ga0070687_100038834 | 3300005343 | Bacteria | 2388 |
| 61 | Ga0070687_100071442 | 3300005343 | Bacteria | 1865 |
| 62 | Ga0070687_100084157 | 3300005343 | Bacteria | 1743 |
| 63 | Ga0070661_100142319 | 3300005344 | Bacteria | 1808 |
| 64 | Ga0070661_100262094 | 3300005344 | Bacteria | 1336 |
| 65 | Ga0070692_10151876 | 3300005345 | Bacteria | 1320 |
| 66 | Ga0070692_10217802 | 3300005345 | Bacteria | 1127 |
| 67 | Ga0070668_100047759 | 3300005347 | Bacteria | 3291 |
| 68 | Ga0070668_100205676 | 3300005347 | Bacteria | 1617 |
| 69 | Ga0070669_100000727 | 3300005353 | Bacteria | 24018 |
| 70 | Ga0070669_100001162 | 3300005353 | Bacteria | 19218 |
| 71 | Ga0070669_100030575 | 3300005353 | Bacteria | 3887 |
| 72 | Ga0070669_100041004 | 3300005353 | Bacteria | 3366 |
| 73 | Ga0070669_100059076 | 3300005353 | Bacteria | 2815 |
| 74 | Ga0070669_100120478 | 3300005353 | Bacteria | 2001 |
| 75 | Ga0070675_100000381 | 3300005354 | Bacteria | 30031 |
| 76 | Ga0070675_100006889 | 3300005354 | Bacteria | 8726 |
| 77 | Ga0070675_100007417 | 3300005354 | Bacteria | 8473 |
| 78 | Ga0070675_100011685 | 3300005354 | Bacteria | 6882 |
| 79 | Ga0070675_100044978 | 3300005354 | Bacteria | 3612 |
| 80 | Ga0070675_100054872 | 3300005354 | Bacteria | 3279 |
| 81 | Ga0070675_100108234 | 3300005354 | Bacteria | 2347 |
| 82 | Ga0070675_100114836 | 3300005354 | Bacteria | 2282 |
| 83 | Ga0070675_100138475 | 3300005354 | Bacteria | 2079 |
| 84 | Ga0070675_100315484 | 3300005354 | Bacteria | 1380 |
| 85 | Ga0070671_100051343 | 3300005355 | Bacteria | 3429 |
| 86 | Ga0070671_100061907 | 3300005355 | Bacteria | 3116 |
| 87 | Ga0070671_100070668 | 3300005355 | Bacteria | 2912 |
| 88 | Ga0070671_100167696 | 3300005355 | Bacteria | 1857 |
| 89 | Ga0070671_100326638 | 3300005355 | Bacteria | 1307 |
| 90 | Ga0070674_100032698 | 3300005356 | Bacteria | 3455 |
| 91 | Ga0070674_100100435 | 3300005356 | Bacteria | 2107 |
| 92 | Ga0070673_100004563 | 3300005364 | Bacteria | 8776 |
| 93 | Ga0070673_100034084 | 3300005364 | Bacteria | 3849 |
| 94 | Ga0070673_100038123 | 3300005364 | Bacteria | 3668 |
| 95 | Ga0070673_100045646 | 3300005364 | Bacteria | 3399 |
| 96 | Ga0070673_100073125 | 3300005364 | Bacteria | 2759 |
| 97 | Ga0070673_100098851 | 3300005364 | Bacteria | 2399 |
| 98 | Ga0070673_100115216 | 3300005364 | Bacteria | 2235 |
| 99 | Ga0070673_100211335 | 3300005364 | Bacteria | 1676 |
| 100 | Ga0070673_100230432 | 3300005364 | Bacteria | 1607 |
| 101 | Ga0070688_100093542 | 3300005365 | Bacteria | 1969 |
| 102 | Ga0070688_100165880 | 3300005365 | Bacteria | 1520 |
| 103 | Ga0070688_100201010 | 3300005365 | Bacteria | 1394 |
| 104 | Ga0070688_100293860 | 3300005365 | Bacteria | 1172 |
| 105 | Ga0070659_100009356 | 3300005366 | Bacteria | 7196 |
| 106 | Ga0070667_100080425 | 3300005367 | Bacteria | 2787 |
| 107 | Ga0070667_100088042 | 3300005367 | Bacteria | 2666 |
| 108 | Ga0070667_100113410 | 3300005367 | Bacteria | 2352 |
| 109 | Ga0070667_100287826 | 3300005367 | Bacteria | 1477 |
| 110 | Ga0070667_100341854 | 3300005367 | Bacteria | 1353 |
| 111 | Ga0070703_10000330 | 3300005406 | Bacteria | 21403 |
| 112 | Ga0070703_10041081 | 3300005406 | Bacteria | 1441 |
| 113 | Ga0070709_10001985 | 3300005434 | Bacteria | 11148 |
| 114 | Ga0070709_10261763 | 3300005434 | Bacteria | 1250 |
| 115 | Ga0070714_100039506 | 3300005435 | Bacteria | 3973 |
| 116 | Ga0070714_100067256 | 3300005435 | Unclassified | 3089 |
| 117 | Ga0070713_100000180 | 3300005436 | Bacteria | 41991 |
| 118 | Ga0070713_100001143 | 3300005436 | Bacteria | 17000 |
| 119 | Ga0070713_100087678 | 3300005436 | Bacteria | 2670 |
| 120 | Ga0070710_10020002 | 3300005437 | Unclassified | 3468 |
| 121 | Ga0070710_10021420 | 3300005437 | Bacteria | 3369 |
| 122 | Ga0070710_10041425 | 3300005437 | Bacteria | 2543 |
| 123 | Ga0070710_10101273 | 3300005437 | Bacteria | 1716 |
| 124 | Ga0070701_10012910 | 3300005438 | Bacteria | 3784 |
| 125 | Ga0070701_10101510 | 3300005438 | Bacteria | 1594 |
| 126 | Ga0070711_100000441 | 3300005439 | Bacteria | 21555 |
| 127 | Ga0070711_100000766 | 3300005439 | Bacteria | 16740 |
| 128 | Ga0070711_100014055 | 3300005439 | Bacteria | 5037 |
| 129 | Ga0070711_100356552 | 3300005439 | Bacteria | 1177 |
| 130 | Ga0070705_100041701 | 3300005440 | Bacteria | 2619 |
| 131 | Ga0070705_100099408 | 3300005440 | Bacteria | 1833 |
| 132 | Ga0070700_100045999 | 3300005441 | Bacteria | 2694 |
| 133 | Ga0070700_100111593 | 3300005441 | Bacteria | 1819 |
| 134 | Ga0070694_100000615 | 3300005444 | Bacteria | 19645 |
| 135 | Ga0070694_100005219 | 3300005444 | Bacteria | 7849 |
| 136 | Ga0070694_100085988 | 3300005444 | Bacteria | 2197 |
| 137 | Ga0070694_100248184 | 3300005444 | Bacteria | 1345 |
| 138 | Ga0070708_100011899 | 3300005445 | Bacteria | 7085 |
| 139 | Ga0070708_100014254 | 3300005445 | Bacteria | 6533 |
| 140 | Ga0070708_100027425 | 3300005445 | Bacteria | 4887 |
| 141 | Ga0070708_100029858 | 3300005445 | Bacteria | 4706 |
| 142 | Ga0070708_100071722 | 3300005445 | Bacteria | 3119 |
| 143 | Ga0070708_100089935 | 3300005445 | Bacteria | 2794 |
| 144 | Ga0070708_100205648 | 3300005445 | Bacteria | 1844 |
| 145 | Ga0070663_100018575 | 3300005455 | Bacteria | 4564 |
| 146 | Ga0070663_100089958 | 3300005455 | Bacteria | 2272 |
| 147 | Ga0070663_100102817 | 3300005455 | Bacteria | 2135 |
| 148 | Ga0070663_100213158 | 3300005455 | Bacteria | 1513 |
| 149 | Ga0070678_100022862 | 3300005456 | Bacteria | 4155 |
| 150 | Ga0070678_100063645 | 3300005456 | Bacteria | 2730 |
| 151 | Ga0070678_100066299 | 3300005456 | Bacteria | 2684 |
| 152 | Ga0070662_100026960 | 3300005457 | Bacteria | 3984 |
| 153 | Ga0070662_100043799 | 3300005457 | Bacteria | 3204 |
| 154 | Ga0070662_100078547 | 3300005457 | Bacteria | 2452 |
| 155 | Ga0070662_100214268 | 3300005457 | Bacteria | 1534 |
| 156 | Ga0070681_10000728 | 3300005458 | Bacteria | 27200 |
| 157 | Ga0070681_10020945 | 3300005458 | Bacteria | 6551 |
| 158 | Ga0070681_10028064 | 3300005458 | Bacteria | 5658 |
| 159 | Ga0070681_10069961 | 3300005458 | Bacteria | 3475 |
| 160 | Ga0070681_10158960 | 3300005458 | Bacteria | 2184 |
| 161 | Ga0068867_100007333 | 3300005459 | Bacteria | 7805 |
| 162 | Ga0068867_100017285 | 3300005459 | Bacteria | 5122 |
| 163 | Ga0068867_100048895 | 3300005459 | Bacteria | 3112 |
| 164 | Ga0068867_100050940 | 3300005459 | Bacteria | 3053 |
| 165 | Ga0068867_100053894 | 3300005459 | Bacteria | 2971 |
| 166 | Ga0070685_10028111 | 3300005466 | Bacteria | 3114 |
| 167 | Ga0070685_10297433 | 3300005466 | Bacteria | 1087 |
| 168 | Ga0070706_100000202 | 3300005467 | Bacteria | 75165 |
| 169 | Ga0070706_100007119 | 3300005467 | Bacteria | 10520 |
| 170 | Ga0070706_100010158 | 3300005467 | Bacteria | 8753 |
| 171 | Ga0070706_100019466 | 3300005467 | Bacteria | 6259 |
| 172 | Ga0070706_100040954 | 3300005467 | Bacteria | 4277 |
| 173 | Ga0070706_100041092 | 3300005467 | Bacteria | 4269 |
| 174 | Ga0070707_100003644 | 3300005468 | Bacteria | 14526 |
| 175 | Ga0070707_100020286 | 3300005468 | Bacteria | 6268 |
| 176 | Ga0070707_100158214 | 3300005468 | Bacteria | 2207 |
| 177 | Ga0070707_100161919 | 3300005468 | Bacteria | 2180 |
| 178 | Ga0070707_100208418 | 3300005468 | Bacteria | 1905 |
| 179 | Ga0070698_100004310 | 3300005471 | Bacteria | 15649 |
| 180 | Ga0070698_100011109 | 3300005471 | Bacteria | 9568 |
| 181 | Ga0070698_100027551 | 3300005471 | Bacteria | 5907 |
| 182 | Ga0070698_100099361 | 3300005471 | Bacteria | 2883 |
| 183 | Ga0070698_100116389 | 3300005471 | Bacteria | 2636 |
| 184 | Ga0070698_100147347 | 3300005471 | Bacteria | 2302 |
| 185 | Ga0070698_100204730 | 3300005471 | Bacteria | 1908 |
| 186 | Ga0070698_100284782 | 3300005471 | Bacteria | 1584 |
| 187 | Ga0070699_100000004 | 3300005518 | Bacteria | 404262 |
| 188 | Ga0070699_100001426 | 3300005518 | Bacteria | 21971 |
| 189 | Ga0070699_100010867 | 3300005518 | Bacteria | 7876 |
| 190 | Ga0070699_100036883 | 3300005518 | Bacteria | 4229 |
| 191 | Ga0070699_100381505 | 3300005518 | Bacteria | 1273 |
| 192 | Ga0070699_100408030 | 3300005518 | Bacteria | 1229 |
| 193 | Ga0070679_100011820 | 3300005530 | Bacteria | 8328 |
| 194 | Ga0070679_100031359 | 3300005530 | Bacteria | 5250 |
| 195 | Ga0070684_100000050 | 3300005535 | Bacteria | 78974 |
| 196 | Ga0070684_100013274 | 3300005535 | Bacteria | 6638 |
| 197 | Ga0070684_100016045 | 3300005535 | Bacteria | 6117 |
| 198 | Ga0070684_100035511 | 3300005535 | Bacteria | 4266 |
| 199 | Ga0070684_100076370 | 3300005535 | Bacteria | 2957 |
| 200 | Ga0070684_100139403 | 3300005535 | Bacteria | 2192 |
| 201 | Ga0070697_100001931 | 3300005536 | Bacteria | 15867 |
| 202 | Ga0070697_100013572 | 3300005536 | Bacteria | 6391 |
| 203 | Ga0070697_100033514 | 3300005536 | Bacteria | 4137 |
| 204 | Ga0070697_100239181 | 3300005536 | Bacteria | 1550 |
| 205 | Ga0070697_100470523 | 3300005536 | Bacteria | 1096 |
| 206 | Ga0068853_100012199 | 3300005539 | Bacteria | 6990 |
| 207 | Ga0068853_100128331 | 3300005539 | Bacteria | 2267 |
| 208 | Ga0068853_100348584 | 3300005539 | Bacteria | 1377 |
| 209 | Ga0070672_100009215 | 3300005543 | Bacteria | 6796 |
| 210 | Ga0070672_100032476 | 3300005543 | Bacteria | 3939 |
| 211 | Ga0070672_100080058 | 3300005543 | Bacteria | 2616 |
| 212 | Ga0070672_100105623 | 3300005543 | Bacteria | 2290 |
| 213 | Ga0070672_100224480 | 3300005543 | Bacteria | 1576 |
| 214 | Ga0070672_100311020 | 3300005543 | Bacteria | 1337 |
| 215 | Ga0070686_100028617 | 3300005544 | Bacteria | 3381 |
| 216 | Ga0070686_100037127 | 3300005544 | Bacteria | 3020 |
| 217 | Ga0070686_100050598 | 3300005544 | Bacteria | 2641 |
| 218 | Ga0070686_100087721 | 3300005544 | Bacteria | 2074 |
| 219 | Ga0070695_100000829 | 3300005545 | Bacteria | 16689 |
| 220 | Ga0070695_100003101 | 3300005545 | Bacteria | 9676 |
| 221 | Ga0070695_100014410 | 3300005545 | Bacteria | 4766 |
| 222 | Ga0070695_100038480 | 3300005545 | Bacteria | 3019 |
| 223 | Ga0070695_100080249 | 3300005545 | Bacteria | 2156 |
| 224 | Ga0070695_100092817 | 3300005545 | Bacteria | 2019 |
| 225 | Ga0070695_100204806 | 3300005545 | Bacteria | 1412 |
| 226 | Ga0070695_100264604 | 3300005545 | Bacteria | 1257 |
| 227 | Ga0070696_100002254 | 3300005546 | Bacteria | 12712 |
| 228 | Ga0070696_100004072 | 3300005546 | Bacteria | 9752 |
| 229 | Ga0070696_100011043 | 3300005546 | Bacteria | 6049 |
| 230 | Ga0070696_100112484 | 3300005546 | Bacteria | 1962 |
| 231 | Ga0070696_100258281 | 3300005546 | Bacteria | 1320 |
| 232 | Ga0070693_100000200 | 3300005547 | Bacteria | 28231 |
| 233 | Ga0070693_100002389 | 3300005547 | Bacteria | 8635 |
| 234 | Ga0070693_100007875 | 3300005547 | Bacteria | 5226 |
| 235 | Ga0070693_100021499 | 3300005547 | Bacteria | 3418 |
| 236 | Ga0070693_100033872 | 3300005547 | Bacteria | 2822 |
| 237 | Ga0070665_100006550 | 3300005548 | Bacteria | 11834 |
| 238 | Ga0070665_100014573 | 3300005548 | Bacteria | 7888 |
| 239 | Ga0070665_100041691 | 3300005548 | Bacteria | 4616 |
| 240 | Ga0070665_100075674 | 3300005548 | Bacteria | 3373 |
| 241 | Ga0070665_100077027 | 3300005548 | Bacteria | 3341 |
| 242 | Ga0070665_100173103 | 3300005548 | Bacteria | 2160 |
| 243 | Ga0070665_100182862 | 3300005548 | Bacteria | 2097 |
| 244 | Ga0070665_100344100 | 3300005548 | Bacteria | 1496 |
| 245 | Ga0070704_100001732 | 3300005549 | Bacteria | 11908 |
| 246 | Ga0070704_100004385 | 3300005549 | Bacteria | 8147 |
| 247 | Ga0070704_100020154 | 3300005549 | Bacteria | 4294 |
| 248 | Ga0070704_100105150 | 3300005549 | Bacteria | 2137 |
| 249 | Ga0070704_100161598 | 3300005549 | Bacteria | 1772 |
| 250 | Ga0070704_100414908 | 3300005549 | Bacteria | 1152 |
| 251 | Ga0070704_100451376 | 3300005549 | Bacteria | 1107 |
| 252 | Ga0070704_100463580 | 3300005549 | Bacteria | 1093 |
| 253 | Ga0068855_100012041 | 3300005563 | Bacteria | 10456 |
| 254 | Ga0068855_100067900 | 3300005563 | Bacteria | 4152 |
| 255 | Ga0068855_100074669 | 3300005563 | Bacteria | 3937 |
| 256 | Ga0068855_100112834 | 3300005563 | Bacteria | 3119 |
| 257 | Ga0068855_100434916 | 3300005563 | Bacteria | 1434 |
| 258 | Ga0070664_100003381 | 3300005564 | Bacteria | 12879 |
| 259 | Ga0070664_100003507 | 3300005564 | Bacteria | 12666 |
| 260 | Ga0070664_100021225 | 3300005564 | Bacteria | 5350 |
| 261 | Ga0070664_100021878 | 3300005564 | Bacteria | 5272 |
| 262 | Ga0070664_100097400 | 3300005564 | Bacteria | 2554 |
| 263 | Ga0070664_100152851 | 3300005564 | Bacteria | 2038 |
| 264 | Ga0068857_100003973 | 3300005577 | Bacteria | 12452 |
| 265 | Ga0068857_100007741 | 3300005577 | Bacteria | 9254 |
| 266 | Ga0068857_100041896 | 3300005577 | Bacteria | 4060 |
| 267 | Ga0068857_100084299 | 3300005577 | Bacteria | 2840 |
| 268 | Ga0068854_100108878 | 3300005578 | Bacteria | 2087 |
| 269 | Ga0068856_100011523 | 3300005614 | Bacteria | 8578 |
| 270 | Ga0068856_100283926 | 3300005614 | Bacteria | 1672 |
| 271 | Ga0070702_100012237 | 3300005615 | Bacteria | 4292 |
| 272 | Ga0068852_100013619 | 3300005616 | Bacteria | 6227 |
| 273 | Ga0068852_100251942 | 3300005616 | Bacteria | 1692 |
| 274 | Ga0068852_100289462 | 3300005616 | Bacteria | 1582 |
| 275 | Ga0068859_100077070 | 3300005617 | Bacteria | 3375 |
| 276 | Ga0068859_100150035 | 3300005617 | Bacteria | 2407 |
| 277 | Ga0068864_100151348 | 3300005618 | Bacteria | 2102 |
| 278 | Ga0068864_100157187 | 3300005618 | Bacteria | 2064 |
| 279 | Ga0068864_100192775 | 3300005618 | Bacteria | 1869 |
| 280 | Ga0068864_100351643 | 3300005618 | Bacteria | 1390 |
| 281 | Ga0068864_100566179 | 3300005618 | Bacteria | 1100 |
| 282 | Ga0068866_10042715 | 3300005718 | Bacteria | 2258 |
| 283 | Ga0068866_10043578 | 3300005718 | Bacteria | 2241 |
| 284 | Ga0068866_10059890 | 3300005718 | Bacteria | 1972 |
| 285 | Ga0068861_100008754 | 3300005719 | Bacteria | 6968 |
| 286 | Ga0068861_100013064 | 3300005719 | Bacteria | 5805 |
| 287 | Ga0068861_100025306 | 3300005719 | Bacteria | 4303 |
| 288 | Ga0068851_10018515 | 3300005834 | Bacteria | 3355 |
| 289 | Ga0068851_10031550 | 3300005834 | Bacteria | 2633 |
| 290 | Ga0068851_10040395 | 3300005834 | Bacteria | 2344 |
| 291 | Ga0068851_10134187 | 3300005834 | Bacteria | 1341 |
| 292 | Ga0068863_100362945 | 3300005841 | Bacteria | 1412 |
| 293 | Ga0068858_100003039 | 3300005842 | Bacteria | 16816 |
| 294 | Ga0068858_100022792 | 3300005842 | Bacteria | 5839 |
| 295 | Ga0068858_100050471 | 3300005842 | Bacteria | 3851 |
| 296 | Ga0068858_100086247 | 3300005842 | Bacteria | 2920 |
| 297 | Ga0068860_100038707 | 3300005843 | Bacteria | 4562 |
| 298 | Ga0068860_100079179 | 3300005843 | Bacteria | 3124 |
| 299 | Ga0068860_100111078 | 3300005843 | Bacteria | 2620 |
| 300 | Ga0068860_100116371 | 3300005843 | Bacteria | 2558 |
| 301 | Ga0068862_100013068 | 3300005844 | Bacteria | 6867 |
| 302 | Ga0081538_10003367 | 3300005981 | Bacteria | 15136 |
| 303 | Ga0081538_10016220 | 3300005981 | Bacteria | 5725 |
| 304 | Ga0081540_1033344 | 3300005983 | Bacteria | 2798 |
| 305 | Ga0070717_10000390 | 3300006028 | Bacteria | 28003 |
| 306 | Ga0070717_10015105 | 3300006028 | Bacteria | 5954 |
| 307 | Ga0075365_10062870 | 3300006038 | Bacteria | 2484 |
| 308 | Ga0075365_10097328 | 3300006038 | Bacteria | 2012 |
| 309 | Ga0075368_10029364 | 3300006042 | Bacteria | 2126 |
| 310 | Ga0075363_100023814 | 3300006048 | Bacteria | 3108 |
| 311 | Ga0075364_10002176 | 3300006051 | Bacteria | 10976 |
| 312 | Ga0075364_10007283 | 3300006051 | Bacteria | 6564 |
| 313 | Ga0075364_10091079 | 3300006051 | Bacteria | 2023 |
| 314 | Ga0075364_10113223 | 3300006051 | Bacteria | 1812 |
| 315 | Ga0070715_10003425 | 3300006163 | Bacteria | 5043 |
| 316 | Ga0070716_100024832 | 3300006173 | Bacteria | 3192 |
| 317 | Ga0070716_100255758 | 3300006173 | Bacteria | 1196 |
| 318 | Ga0070712_100000424 | 3300006175 | Bacteria | 24251 |
| 319 | Ga0070712_100000774 | 3300006175 | Bacteria | 18882 |
| 320 | Ga0070712_100042745 | 3300006175 | Bacteria | 3117 |
| 321 | Ga0070712_100195630 | 3300006175 | Bacteria | 1585 |
| 322 | Ga0075362_10003871 | 3300006177 | Bacteria | 5315 |
| 323 | Ga0075362_10018891 | 3300006177 | Bacteria | 2860 |
| 324 | Ga0075367_10036654 | 3300006178 | Bacteria | 2845 |
| 325 | Ga0075367_10083562 | 3300006178 | Bacteria | 1934 |
| 326 | Ga0075367_10192750 | 3300006178 | Bacteria | 1272 |
| 327 | Ga0075366_10016496 | 3300006195 | Bacteria | 4247 |
| 328 | Ga0075366_10037914 | 3300006195 | Bacteria | 2847 |
| 329 | Ga0075366_10038115 | 3300006195 | Bacteria | 2839 |
| 330 | Ga0075366_10041787 | 3300006195 | Bacteria | 2715 |
| 331 | Ga0075366_10143162 | 3300006195 | Bacteria | 1446 |
| 332 | Ga0097621_100051496 | 3300006237 | Bacteria | 3351 |
| 333 | Ga0097621_100082717 | 3300006237 | Bacteria | 2674 |
| 334 | Ga0097621_100090730 | 3300006237 | Bacteria | 2557 |
| 335 | Ga0097621_100115283 | 3300006237 | Bacteria | 2274 |
| 336 | Ga0097621_100285383 | 3300006237 | Bacteria | 1454 |
| 337 | Ga0097621_100323272 | 3300006237 | Bacteria | 1367 |
| 338 | Ga0097621_100529668 | 3300006237 | Bacteria | 1070 |
| 339 | Ga0075370_10042865 | 3300006353 | Bacteria | 2557 |
| 340 | Ga0075370_10046599 | 3300006353 | Bacteria | 2453 |
| 341 | Ga0068871_100024736 | 3300006358 | Bacteria | 4660 |
| 342 | Ga0068871_100055534 | 3300006358 | Bacteria | 3215 |
| 343 | Ga0075428_100004291 | 3300006844 | Bacteria | 15699 |
| 344 | Ga0075428_100005484 | 3300006844 | Bacteria | 14102 |
| 345 | Ga0075428_100012404 | 3300006844 | Bacteria | 9479 |
| 346 | Ga0075428_100012869 | 3300006844 | Bacteria | 9310 |
| 347 | Ga0075428_100033650 | 3300006844 | Bacteria | 5657 |
| 348 | Ga0075428_100066771 | 3300006844 | Bacteria | 3938 |
| 349 | Ga0075428_100263180 | 3300006844 | Bacteria | 1857 |
| 350 | Ga0075428_100378823 | 3300006844 | Bacteria | 1517 |
| 351 | Ga0075428_100641544 | 3300006844 | Bacteria | 1133 |
| 352 | Ga0075430_100003672 | 3300006846 | Bacteria | 12881 |
| 353 | Ga0075430_100003798 | 3300006846 | Bacteria | 12711 |
| 354 | Ga0075430_100025288 | 3300006846 | Bacteria | 5050 |
| 355 | Ga0075430_100035079 | 3300006846 | Bacteria | 4258 |
| 356 | Ga0075430_100127816 | 3300006846 | Bacteria | 2118 |
| 357 | Ga0075430_100259642 | 3300006846 | Bacteria | 1439 |
| 358 | Ga0075430_100306835 | 3300006846 | Bacteria | 1313 |
| 359 | Ga0075431_100004325 | 3300006847 | Bacteria | 13917 |
| 360 | Ga0075431_100024159 | 3300006847 | Bacteria | 6223 |
| 361 | Ga0075431_100024753 | 3300006847 | Bacteria | 6154 |
| 362 | Ga0075431_100030652 | 3300006847 | Bacteria | 5541 |
| 363 | Ga0075431_100053177 | 3300006847 | Bacteria | 4175 |
| 364 | Ga0075431_100105335 | 3300006847 | Bacteria | 2910 |
| 365 | Ga0075433_10000360 | 3300006852 | Bacteria | 28644 |
| 366 | Ga0075433_10030890 | 3300006852 | Bacteria | 4574 |
| 367 | Ga0075433_10035332 | 3300006852 | Bacteria | 4297 |
| 368 | Ga0075433_10074249 | 3300006852 | Bacteria | 2992 |
| 369 | Ga0075433_10093298 | 3300006852 | Bacteria | 2663 |
| 370 | Ga0075433_10107478 | 3300006852 | Bacteria | 2474 |
| 371 | Ga0075433_10122773 | 3300006852 | Bacteria | 2307 |
| 372 | Ga0075433_10199807 | 3300006852 | Bacteria | 1777 |
| 373 | Ga0075434_100001498 | 3300006871 | Bacteria | 19718 |
| 374 | Ga0075434_100027710 | 3300006871 | Bacteria | 5563 |
| 375 | Ga0075434_100106316 | 3300006871 | Bacteria | 2816 |
| 376 | Ga0075434_100135523 | 3300006871 | Bacteria | 2481 |
| 377 | Ga0075434_100145485 | 3300006871 | Bacteria | 2390 |
| 378 | Ga0075434_100337988 | 3300006871 | Bacteria | 1526 |
| 379 | Ga0075429_100006247 | 3300006880 | Bacteria | 10313 |
| 380 | Ga0075429_100010163 | 3300006880 | Bacteria | 8148 |
| 381 | Ga0075429_100048104 | 3300006880 | Bacteria | 3709 |
| 382 | Ga0075429_100053555 | 3300006880 | Bacteria | 3511 |
| 383 | Ga0075429_100082094 | 3300006880 | Bacteria | 2810 |
| 384 | Ga0068865_100001348 | 3300006881 | Bacteria | 14299 |
| 385 | Ga0068865_100009144 | 3300006881 | Bacteria | 6132 |
| 386 | Ga0068865_100062956 | 3300006881 | Bacteria | 2606 |
| 387 | Ga0068865_100072957 | 3300006881 | Bacteria | 2439 |
| 388 | Ga0075436_100005387 | 3300006914 | Bacteria | 8807 |
| 389 | Ga0075436_100006638 | 3300006914 | Bacteria | 7926 |
| 390 | Ga0075436_100006643 | 3300006914 | Bacteria | 7922 |
| 391 | Ga0075436_100040179 | 3300006914 | Bacteria | 3228 |
| 392 | Ga0075436_100045696 | 3300006914 | Bacteria | 3021 |
| 393 | Ga0075436_100124095 | 3300006914 | Bacteria | 1808 |
| 394 | Ga0075436_100130323 | 3300006914 | Bacteria | 1763 |
| 395 | Ga0097620_100077072 | 3300006931 | Bacteria | 3375 |
| 396 | Ga0097620_100150038 | 3300006931 | Bacteria | 2407 |
| 397 | Ga0097620_100585895 | 3300006931 | Bacteria | 1209 |
| 398 | Ga0075435_100004674 | 3300007076 | Bacteria | 9441 |
| 399 | Ga0075435_100009374 | 3300007076 | Bacteria | 7083 |
| 400 | Ga0075435_100013737 | 3300007076 | Bacteria | 6033 |
| 401 | Ga0075435_100047319 | 3300007076 | Bacteria | 3453 |
| 402 | Ga0075435_100053607 | 3300007076 | Bacteria | 3253 |
| 403 | Ga0075435_100096475 | 3300007076 | Bacteria | 2446 |
| 404 | Ga0075435_100136809 | 3300007076 | Bacteria | 2053 |
| 405 | Ga0075435_100185286 | 3300007076 | Bacteria | 1760 |
| 406 | Ga0075435_100202536 | 3300007076 | Bacteria | 1682 |
| 407 | Ga0099795_10000023 | 3300007788 | Bacteria | 52134 |
| 408 | Ga0099795_10010705 | 3300007788 | Bacteria | 2712 |
| 409 | Ga0105240_10006446 | 3300009093 | Bacteria | 17254 |
| 410 | Ga0105240_10024898 | 3300009093 | Bacteria | 7878 |
| 411 | Ga0105240_10123688 | 3300009093 | Bacteria | 3112 |
| 412 | Ga0105240_10145574 | 3300009093 | Bacteria | 2827 |
| 413 | Ga0105240_10246694 | 3300009093 | Bacteria | 2067 |
| 414 | Ga0105240_10295827 | 3300009093 | Bacteria | 1854 |
| 415 | Ga0105240_10555042 | 3300009093 | Bacteria | 1270 |
| 416 | Ga0111539_10002591 | 3300009094 | Bacteria | 23946 |
| 417 | Ga0111539_10002914 | 3300009094 | Bacteria | 22702 |
| 418 | Ga0111539_10003491 | 3300009094 | Bacteria | 20727 |
| 419 | Ga0111539_10003577 | 3300009094 | Bacteria | 20480 |
| 420 | Ga0111539_10035761 | 3300009094 | Bacteria | 6012 |
| 421 | Ga0111539_10041050 | 3300009094 | Bacteria | 5565 |
| 422 | Ga0111539_10114724 | 3300009094 | Bacteria | 3160 |
| 423 | Ga0111539_10195054 | 3300009094 | Bacteria | 2362 |
| 424 | Ga0111539_10209579 | 3300009094 | Bacteria | 2271 |
| 425 | Ga0111539_10223327 | 3300009094 | Bacteria | 2194 |
| 426 | Ga0111539_10238357 | 3300009094 | Bacteria | 2117 |
| 427 | Ga0111539_10247428 | 3300009094 | Bacteria | 2076 |
| 428 | Ga0105245_10016935 | 3300009098 | Bacteria | 6363 |
| 429 | Ga0105245_10059544 | 3300009098 | Bacteria | 3439 |
| 430 | Ga0105245_10075935 | 3300009098 | Bacteria | 3060 |
| 431 | Ga0105245_10324448 | 3300009098 | Bacteria | 1518 |
| 432 | Ga0105247_10038134 | 3300009101 | Bacteria | 2932 |
| 433 | Ga0105247_10189820 | 3300009101 | Bacteria | 1375 |
| 434 | Ga0114129_10002266 | 3300009147 | Bacteria | 26617 |
| 435 | Ga0114129_10005113 | 3300009147 | Bacteria | 18461 |
| 436 | Ga0114129_10008691 | 3300009147 | Bacteria | 14476 |
| 437 | Ga0114129_10008970 | 3300009147 | Bacteria | 14259 |
| 438 | Ga0114129_10009206 | 3300009147 | Bacteria | 14081 |
| 439 | Ga0114129_10017434 | 3300009147 | Bacteria | 10225 |
| 440 | Ga0114129_10022135 | 3300009147 | Bacteria | 9021 |
| 441 | Ga0114129_10024405 | 3300009147 | Bacteria | 8568 |
| 442 | Ga0114129_10033843 | 3300009147 | Bacteria | 7219 |
| 443 | Ga0114129_10061464 | 3300009147 | Bacteria | 5249 |
| 444 | Ga0114129_10063642 | 3300009147 | Bacteria | 5150 |
| 445 | Ga0114129_10089738 | 3300009147 | Bacteria | 4261 |
| 446 | Ga0114129_10099293 | 3300009147 | Bacteria | 4029 |
| 447 | Ga0114129_10099321 | 3300009147 | Bacteria | 4029 |
| 448 | Ga0114129_10253945 | 3300009147 | Bacteria | 2359 |
| 449 | Ga0114129_10317719 | 3300009147 | Bacteria | 2071 |
| 450 | Ga0114129_10599126 | 3300009147 | Bacteria | 1428 |
| 451 | Ga0114129_10830752 | 3300009147 | Bacteria | 1176 |
| 452 | Ga0105243_10003648 | 3300009148 | Bacteria | 12387 |
| 453 | Ga0105243_10205728 | 3300009148 | Bacteria | 1729 |
| 454 | Ga0105241_10144245 | 3300009174 | Bacteria | 1942 |
| 455 | Ga0105242_10012753 | 3300009176 | Bacteria | 6473 |
| 456 | Ga0105242_10026761 | 3300009176 | Bacteria | 4573 |
| 457 | Ga0105242_10045264 | 3300009176 | Bacteria | 3565 |
| 458 | Ga0105242_10082056 | 3300009176 | Bacteria | 2697 |
| 459 | Ga0105248_10008828 | 3300009177 | Bacteria | 11071 |
| 460 | Ga0105248_10023973 | 3300009177 | Bacteria | 6783 |
| 461 | Ga0105248_10048444 | 3300009177 | Bacteria | 4767 |
| 462 | Ga0105248_10048781 | 3300009177 | Bacteria | 4750 |
| 463 | Ga0105248_10055879 | 3300009177 | Bacteria | 4429 |
| 464 | Ga0105248_10081517 | 3300009177 | Bacteria | 3637 |
| 465 | Ga0105248_10103067 | 3300009177 | Bacteria | 3216 |
| 466 | Ga0105248_10131427 | 3300009177 | Bacteria | 2824 |
| 467 | Ga0105248_10133520 | 3300009177 | Bacteria | 2800 |
| 468 | Ga0105248_10192908 | 3300009177 | Bacteria | 2295 |
| 469 | Ga0105248_10231072 | 3300009177 | Bacteria | 2082 |
| 470 | Ga0105248_10250813 | 3300009177 | Bacteria | 1992 |
| 471 | Ga0105248_10396229 | 3300009177 | Bacteria | 1554 |
| 472 | Ga0105237_10207919 | 3300009545 | Bacteria | 1957 |
| 473 | Ga0105237_10211993 | 3300009545 | Bacteria | 1937 |
| 474 | Ga0105238_10003340 | 3300009551 | Bacteria | 16014 |
| 475 | Ga0105238_10063520 | 3300009551 | Bacteria | 3693 |
| 476 | Ga0105238_10099977 | 3300009551 | Bacteria | 2883 |
| 477 | Ga0105249_10000517 | 3300009553 | Bacteria | 35617 |
| 478 | Ga0105249_10006590 | 3300009553 | Bacteria | 10104 |
| 479 | Ga0105249_10026830 | 3300009553 | Bacteria | 5193 |
| 480 | Ga0105249_10387486 | 3300009553 | Bacteria | 1425 |
| 481 | Ga0105239_10199885 | 3300010375 | Bacteria | 2239 |
| 482 | Ga0105239_10385325 | 3300010375 | Bacteria | 1585 |
| 483 | Ga0105239_10465736 | 3300010375 | Bacteria | 1435 |
| 484 | Ga0105246_10023137 | 3300011119 | Bacteria | 4018 |
| 485 | Ga0105246_10108883 | 3300011119 | Bacteria | 2031 |
| 486 | Ga0105246_10176615 | 3300011119 | Bacteria | 1640 |
| 487 | Ga0105246_10215681 | 3300011119 | Bacteria | 1501 |
| 488 | Ga0105246_10437352 | 3300011119 | Bacteria | 1096 |
| 489 | Ga0157373_10114747 | 3300013100 | Bacteria | 1894 |
| 490 | Ga0157370_10254091 | 3300013104 | Bacteria | 1625 |
| 491 | Ga0157369_10006460 | 3300013105 | Bacteria | 13590 |
| 492 | Ga0157369_10104725 | 3300013105 | Bacteria | 3012 |
| 493 | Ga0157369_10256971 | 3300013105 | Bacteria | 1822 |
| 494 | Ga0157374_10001514 | 3300013296 | Bacteria | 19577 |
| 495 | Ga0157374_10043990 | 3300013296 | Bacteria | 4126 |
| 496 | Ga0157374_10144317 | 3300013296 | Bacteria | 2312 |
| 497 | Ga0157374_10231882 | 3300013296 | Bacteria | 1814 |
| 498 | Ga0157374_10272023 | 3300013296 | Bacteria | 1671 |
| 499 | Ga0157378_10033718 | 3300013297 | Bacteria | 4527 |
| 500 | Ga0157378_10085087 | 3300013297 | Bacteria | 2864 |
| 501 | Ga0157378_10105791 | 3300013297 | Bacteria | 2573 |
| 502 | Ga0157378_10282175 | 3300013297 | Bacteria | 1601 |
| 503 | Ga0163162_10000370 | 3300013306 | Bacteria | 40835 |
| 504 | Ga0163162_10028261 | 3300013306 | Bacteria | 5548 |
| 505 | Ga0163162_10086069 | 3300013306 | Bacteria | 3220 |
| 506 | Ga0163162_10088425 | 3300013306 | Bacteria | 3177 |
| 507 | Ga0157372_10002177 | 3300013307 | Bacteria | 21331 |
| 508 | Ga0157372_10030737 | 3300013307 | Bacteria | 5876 |
| 509 | Ga0157372_10030751 | 3300013307 | Bacteria | 5875 |
| 510 | Ga0157372_10036897 | 3300013307 | Bacteria | 5390 |
| 511 | Ga0157372_10070222 | 3300013307 | Bacteria | 3940 |
| 512 | Ga0157372_10107133 | 3300013307 | Bacteria | 3197 |
| 513 | Ga0157372_10122026 | 3300013307 | Bacteria | 2994 |
| 514 | Ga0157372_10419456 | 3300013307 | Bacteria | 1560 |
| 515 | Ga0157372_10433199 | 3300013307 | Bacteria | 1533 |
| 516 | Ga0157372_10468468 | 3300013307 | Bacteria | 1468 |
| 517 | Ga0157375_10052365 | 3300013308 | Bacteria | 4013 |
| 518 | Ga0157375_10119915 | 3300013308 | Bacteria | 2738 |
| 519 | Ga0157375_10132161 | 3300013308 | Bacteria | 2616 |
| 520 | Ga0157375_10236927 | 3300013308 | Bacteria | 1984 |
| 521 | Ga0157375_10247759 | 3300013308 | Bacteria | 1942 |
| 522 | Ga0157375_10329808 | 3300013308 | Bacteria | 1691 |
| 523 | Ga0163163_10010921 | 3300014325 | Bacteria | 8203 |
| 524 | Ga0163163_10115060 | 3300014325 | Bacteria | 2721 |
| 525 | Ga0163163_10118338 | 3300014325 | Bacteria | 2682 |
| 526 | Ga0163163_10200709 | 3300014325 | Bacteria | 2043 |
| 527 | Ga0163163_10299083 | 3300014325 | Bacteria | 1662 |
| 528 | Ga0163163_10305849 | 3300014325 | Bacteria | 1642 |
| 529 | Ga0163163_10543909 | 3300014325 | Bacteria | 1224 |
| 530 | Ga0163163_10578207 | 3300014325 | Bacteria | 1186 |
| 531 | Ga0163163_10634304 | 3300014325 | Bacteria | 1132 |
| 532 | Ga0157380_10022910 | 3300014326 | Bacteria | 4709 |
| 533 | Ga0157380_10060343 | 3300014326 | Bacteria | 3030 |
| 534 | Ga0157380_10086528 | 3300014326 | Bacteria | 2575 |
| 535 | Ga0157380_10137048 | 3300014326 | Bacteria | 2097 |
| 536 | Ga0157380_10213216 | 3300014326 | Bacteria | 1722 |
| 537 | Ga0157380_10300222 | 3300014326 | Bacteria | 1479 |
| 538 | Ga0157380_10392081 | 3300014326 | Bacteria | 1314 |
| 539 | Ga0157377_10178801 | 3300014745 | Bacteria | 1333 |
| 540 | Ga0157377_10190607 | 3300014745 | Bacteria | 1295 |
| 541 | Ga0157377_10222560 | 3300014745 | Bacteria | 1209 |
| 542 | Ga0157379_10026737 | 3300014968 | Bacteria | 5137 |
| 543 | Ga0157379_10027489 | 3300014968 | Bacteria | 5065 |
| 544 | Ga0157379_10040371 | 3300014968 | Bacteria | 4165 |
| 545 | Ga0157379_10053135 | 3300014968 | Bacteria | 3619 |
| 546 | Ga0157379_10151788 | 3300014968 | Bacteria | 2089 |
| 547 | Ga0157376_10003558 | 3300014969 | Bacteria | 10744 |
| 548 | Ga0157376_10043656 | 3300014969 | Bacteria | 3680 |
| 549 | Ga0157376_10079268 | 3300014969 | Bacteria | 2815 |
| 550 | Ga0157376_10254669 | 3300014969 | Bacteria | 1641 |
| 551 | Ga0163161_10003256 | 3300017792 | Bacteria | 11412 |
| 552 | Ga0163161_10476846 | 3300017792 | Bacteria | 1012 |
| 553 | Ga0224570_100995 | 3300022730 | Bacteria | 2231 |
| 554 | Ga0224569_102012 | 3300022732 | Bacteria | 1675 |
| 555 | Ga0228598_1001375 | 3300024227 | Bacteria | 5346 |
| 556 | Ga0207697_10000143 | 3300025315 | Bacteria | 34721 |
| 557 | Ga0207697_10019067 | 3300025315 | Bacteria | 2809 |
| 558 | Ga0207656_10013386 | 3300025321 | Bacteria | 3135 |
| 559 | Ga0207656_10014207 | 3300025321 | Bacteria | 3062 |
| 560 | Ga0207653_10000071 | 3300025885 | Bacteria | 75651 |
| 561 | Ga0207653_10026112 | 3300025885 | Bacteria | 1871 |
| 562 | Ga0207682_10007365 | 3300025893 | Bacteria | 4390 |
| 563 | Ga0207682_10015587 | 3300025893 | Bacteria | 2959 |
| 564 | Ga0207682_10031726 | 3300025893 | Bacteria | 2122 |
| 565 | Ga0207682_10064833 | 3300025893 | Bacteria | 1536 |
| 566 | Ga0207692_10006630 | 3300025898 | Bacteria | 4706 |
| 567 | Ga0207642_10067898 | 3300025899 | Bacteria | 1685 |
| 568 | Ga0207710_10053314 | 3300025900 | Bacteria | 1820 |
| 569 | Ga0207710_10112232 | 3300025900 | Bacteria | 1295 |
| 570 | Ga0207688_10002686 | 3300025901 | Bacteria | 9626 |
| 571 | Ga0207680_10124411 | 3300025903 | Bacteria | 1691 |
| 572 | Ga0207680_10221208 | 3300025903 | Bacteria | 1298 |
| 573 | Ga0207680_10289861 | 3300025903 | Bacteria | 1139 |
| 574 | Ga0207647_10031204 | 3300025904 | Bacteria | 3430 |
| 575 | Ga0207685_10018069 | 3300025905 | Bacteria | 2294 |
| 576 | Ga0207699_10004012 | 3300025906 | Bacteria | 7044 |
| 577 | Ga0207699_10006533 | 3300025906 | Bacteria | 5654 |
| 578 | Ga0207699_10031968 | 3300025906 | Bacteria | 2961 |
| 579 | Ga0207699_10092028 | 3300025906 | Bacteria | 1906 |
| 580 | Ga0207699_10174747 | 3300025906 | Bacteria | 1440 |
| 581 | Ga0207645_10000743 | 3300025907 | Bacteria | 27133 |
| 582 | Ga0207645_10022325 | 3300025907 | Bacteria | 4119 |
| 583 | Ga0207645_10037601 | 3300025907 | Bacteria | 3106 |
| 584 | Ga0207645_10038845 | 3300025907 | Bacteria | 3051 |
| 585 | Ga0207643_10004131 | 3300025908 | Bacteria | 7821 |
| 586 | Ga0207643_10085356 | 3300025908 | Bacteria | 1833 |
| 587 | Ga0207705_10068020 | 3300025909 | Bacteria | 2578 |
| 588 | Ga0207705_10143069 | 3300025909 | Bacteria | 1787 |
| 589 | Ga0207684_10000204 | 3300025910 | Bacteria | 91621 |
| 590 | Ga0207684_10007319 | 3300025910 | Bacteria | 9959 |
| 591 | Ga0207684_10008255 | 3300025910 | Bacteria | 9271 |
| 592 | Ga0207684_10036722 | 3300025910 | Bacteria | 4158 |
| 593 | Ga0207654_10051141 | 3300025911 | Bacteria | 2377 |
| 594 | Ga0207654_10152143 | 3300025911 | Bacteria | 1486 |
| 595 | Ga0207707_10004652 | 3300025912 | Bacteria | 12056 |
| 596 | Ga0207707_10024623 | 3300025912 | Bacteria | 5268 |
| 597 | Ga0207707_10034139 | 3300025912 | Bacteria | 4451 |
| 598 | Ga0207707_10174739 | 3300025912 | Bacteria | 1876 |
| 599 | Ga0207707_10233744 | 3300025912 | Bacteria | 1599 |
| 600 | Ga0207695_10058666 | 3300025913 | Bacteria | 3994 |
| 601 | Ga0207695_10068686 | 3300025913 | Bacteria | 3630 |
| 602 | Ga0207695_10072281 | 3300025913 | Bacteria | 3520 |
| 603 | Ga0207695_10142339 | 3300025913 | Bacteria | 2345 |
| 604 | Ga0207671_10240292 | 3300025914 | Bacteria | 1423 |
| 605 | Ga0207693_10000777 | 3300025915 | Bacteria | 28620 |
| 606 | Ga0207693_10001047 | 3300025915 | Bacteria | 24726 |
| 607 | Ga0207693_10002215 | 3300025915 | Bacteria | 16946 |
| 608 | Ga0207693_10259159 | 3300025915 | Bacteria | 1364 |
| 609 | Ga0207663_10001539 | 3300025916 | Bacteria | 10795 |
| 610 | Ga0207663_10019520 | 3300025916 | Bacteria | 3821 |
| 611 | Ga0207663_10033180 | 3300025916 | Bacteria | 3072 |
| 612 | Ga0207663_10075561 | 3300025916 | Bacteria | 2187 |
| 613 | Ga0207663_10090220 | 3300025916 | Unclassified | 2032 |
| 614 | Ga0207663_10148199 | 3300025916 | Bacteria | 1643 |
| 615 | Ga0207660_10000001 | 3300025917 | Bacteria | 1034169 |
| 616 | Ga0207660_10073058 | 3300025917 | Bacteria | 2500 |
| 617 | Ga0207660_10189635 | 3300025917 | Bacteria | 1600 |
| 618 | Ga0207662_10006311 | 3300025918 | Bacteria | 6388 |
| 619 | Ga0207662_10015678 | 3300025918 | Bacteria | 4266 |
| 620 | Ga0207662_10053683 | 3300025918 | Bacteria | 2401 |
| 621 | Ga0207662_10089006 | 3300025918 | Bacteria | 1896 |
| 622 | Ga0207662_10195939 | 3300025918 | Bacteria | 1305 |
| 623 | Ga0207657_10413974 | 3300025919 | Bacteria | 1060 |
| 624 | Ga0207649_10015199 | 3300025920 | Bacteria | 4323 |
| 625 | Ga0207649_10034085 | 3300025920 | Unclassified | 3047 |
| 626 | Ga0207649_10045422 | 3300025920 | Bacteria | 2693 |
| 627 | Ga0207652_10008444 | 3300025921 | Bacteria | 8287 |
| 628 | Ga0207652_10011006 | 3300025921 | Bacteria | 7294 |
| 629 | Ga0207646_10003702 | 3300025922 | Bacteria | 17067 |
| 630 | Ga0207646_10008238 | 3300025922 | Bacteria | 10469 |
| 631 | Ga0207646_10026427 | 3300025922 | Bacteria | 5296 |
| 632 | Ga0207646_10029750 | 3300025922 | Unclassified | 4959 |
| 633 | Ga0207646_10043474 | 3300025922 | Bacteria | 4034 |
| 634 | Ga0207646_10048209 | 3300025922 | Bacteria | 3819 |
| 635 | Ga0207646_10175685 | 3300025922 | Bacteria | 1934 |
| 636 | Ga0207646_10383774 | 3300025922 | Bacteria | 1269 |
| 637 | Ga0207681_10007137 | 3300025923 | Bacteria | 6851 |
| 638 | Ga0207681_10014269 | 3300025923 | Bacteria | 4933 |
| 639 | Ga0207681_10014326 | 3300025923 | Bacteria | 4925 |
| 640 | Ga0207681_10025386 | 3300025923 | Bacteria | 3811 |
| 641 | Ga0207681_10053026 | 3300025923 | Bacteria | 2752 |
| 642 | Ga0207681_10054804 | 3300025923 | Bacteria | 2713 |
| 643 | Ga0207681_10067554 | 3300025923 | Bacteria | 2479 |
| 644 | Ga0207681_10112633 | 3300025923 | Bacteria | 1982 |
| 645 | Ga0207681_10243272 | 3300025923 | Bacteria | 1401 |
| 646 | Ga0207681_10285426 | 3300025923 | Bacteria | 1301 |
| 647 | Ga0207694_10003999 | 3300025924 | Bacteria | 11616 |
| 648 | Ga0207650_10048321 | 3300025925 | Bacteria | 3138 |
| 649 | Ga0207650_10063070 | 3300025925 | Bacteria | 2770 |
| 650 | Ga0207650_10109336 | 3300025925 | Bacteria | 2138 |
| 651 | Ga0207650_10116326 | 3300025925 | Bacteria | 2076 |
| 652 | Ga0207650_10134105 | 3300025925 | Bacteria | 1941 |
| 653 | Ga0207659_10000630 | 3300025926 | Bacteria | 20889 |
| 654 | Ga0207659_10038129 | 3300025926 | Bacteria | 3340 |
| 655 | Ga0207659_10101223 | 3300025926 | Bacteria | 2172 |
| 656 | Ga0207659_10164011 | 3300025926 | Bacteria | 1747 |
| 657 | Ga0207659_10347581 | 3300025926 | Bacteria | 1230 |
| 658 | Ga0207687_10028103 | 3300025927 | Bacteria | 3778 |
| 659 | Ga0207687_10032036 | 3300025927 | Bacteria | 3557 |
| 660 | Ga0207687_10043623 | 3300025927 | Bacteria | 3091 |
| 661 | Ga0207687_10111343 | 3300025927 | Bacteria | 2032 |
| 662 | Ga0207700_10000198 | 3300025928 | Bacteria | 35892 |
| 663 | Ga0207700_10005511 | 3300025928 | Bacteria | 7590 |
| 664 | Ga0207700_10008571 | 3300025928 | Bacteria | 6344 |
| 665 | Ga0207700_10269145 | 3300025928 | Bacteria | 1462 |
| 666 | Ga0207664_10060517 | 3300025929 | Bacteria | 3018 |
| 667 | Ga0207664_10086379 | 3300025929 | Bacteria | 2563 |
| 668 | Ga0207664_10455404 | 3300025929 | Bacteria | 1142 |
| 669 | Ga0207644_10040792 | 3300025931 | Bacteria | 3281 |
| 670 | Ga0207644_10053279 | 3300025931 | Bacteria | 2911 |
| 671 | Ga0207644_10152164 | 3300025931 | Bacteria | 1791 |
| 672 | Ga0207644_10334703 | 3300025931 | Bacteria | 1226 |
| 673 | Ga0207690_10105343 | 3300025932 | Bacteria | 2022 |
| 674 | Ga0207690_10330747 | 3300025932 | Bacteria | 1200 |
| 675 | Ga0207706_10002236 | 3300025933 | Bacteria | 18885 |
| 676 | Ga0207706_10002730 | 3300025933 | Bacteria | 17203 |
| 677 | Ga0207706_10059957 | 3300025933 | Unclassified | 3351 |
| 678 | Ga0207706_10108239 | 3300025933 | Bacteria | 2446 |
| 679 | Ga0207706_10117177 | 3300025933 | Bacteria | 2342 |
| 680 | Ga0207706_10194848 | 3300025933 | Bacteria | 1777 |
| 681 | Ga0207706_10209096 | 3300025933 | Bacteria | 1711 |
| 682 | Ga0207706_10244522 | 3300025933 | Bacteria | 1568 |
| 683 | Ga0207706_10256649 | 3300025933 | Bacteria | 1526 |
| 684 | Ga0207706_10530389 | 3300025933 | Bacteria | 1015 |
| 685 | Ga0207686_10006648 | 3300025934 | Bacteria | 6234 |
| 686 | Ga0207686_10015467 | 3300025934 | Bacteria | 4266 |
| 687 | Ga0207686_10026778 | 3300025934 | Bacteria | 3368 |
| 688 | Ga0207670_10016027 | 3300025936 | Bacteria | 4495 |
| 689 | Ga0207670_10029275 | 3300025936 | Bacteria | 3507 |
| 690 | Ga0207670_10035828 | 3300025936 | Bacteria | 3222 |
| 691 | Ga0207670_10061191 | 3300025936 | Bacteria | 2568 |
| 692 | Ga0207670_10148669 | 3300025936 | Bacteria | 1735 |
| 693 | Ga0207669_10002051 | 3300025937 | Bacteria | 8527 |
| 694 | Ga0207669_10043725 | 3300025937 | Bacteria | 2626 |
| 695 | Ga0207669_10067593 | 3300025937 | Bacteria | 2228 |
| 696 | Ga0207669_10093338 | 3300025937 | Bacteria | 1966 |
| 697 | Ga0207669_10138684 | 3300025937 | Bacteria | 1684 |
| 698 | Ga0207669_10233492 | 3300025937 | Bacteria | 1359 |
| 699 | Ga0207704_10012306 | 3300025938 | Bacteria | 4246 |
| 700 | Ga0207704_10045869 | 3300025938 | Bacteria | 2600 |
| 701 | Ga0207704_10076603 | 3300025938 | Bacteria | 2143 |
| 702 | Ga0207665_10000973 | 3300025939 | Bacteria | 19387 |
| 703 | Ga0207665_10011628 | 3300025939 | Bacteria | 5783 |
| 704 | Ga0207665_10011723 | 3300025939 | Bacteria | 5759 |
| 705 | Ga0207665_10026562 | 3300025939 | Bacteria | 3822 |
| 706 | Ga0207665_10041165 | 3300025939 | Bacteria | 3084 |
| 707 | Ga0207691_10002031 | 3300025940 | Bacteria | 19804 |
| 708 | Ga0207691_10003473 | 3300025940 | Bacteria | 15345 |
| 709 | Ga0207691_10008843 | 3300025940 | Bacteria | 9663 |
| 710 | Ga0207691_10010771 | 3300025940 | Bacteria | 8777 |
| 711 | Ga0207691_10015894 | 3300025940 | Bacteria | 7151 |
| 712 | Ga0207691_10015943 | 3300025940 | Bacteria | 7139 |
| 713 | Ga0207691_10035125 | 3300025940 | Bacteria | 4657 |
| 714 | Ga0207691_10041496 | 3300025940 | Bacteria | 4247 |
| 715 | Ga0207691_10093370 | 3300025940 | Bacteria | 2695 |
| 716 | Ga0207691_10227323 | 3300025940 | Bacteria | 1616 |
| 717 | Ga0207711_10029360 | 3300025941 | Bacteria | 4638 |
| 718 | Ga0207711_10038116 | 3300025941 | Bacteria | 4086 |
| 719 | Ga0207711_10056655 | 3300025941 | Bacteria | 3368 |
| 720 | Ga0207711_10100293 | 3300025941 | Bacteria | 2561 |
| 721 | Ga0207711_10133263 | 3300025941 | Bacteria | 2229 |
| 722 | Ga0207711_10141500 | 3300025941 | Bacteria | 2165 |
| 723 | Ga0207711_10145829 | 3300025941 | Bacteria | 2133 |
| 724 | Ga0207689_10000700 | 3300025942 | Bacteria | 32116 |
| 725 | Ga0207689_10007432 | 3300025942 | Bacteria | 9604 |
| 726 | Ga0207689_10035841 | 3300025942 | Bacteria | 4119 |
| 727 | Ga0207689_10059254 | 3300025942 | Bacteria | 3149 |
| 728 | Ga0207689_10119866 | 3300025942 | Bacteria | 2165 |
| 729 | Ga0207689_10131527 | 3300025942 | Bacteria | 2059 |
| 730 | Ga0207661_10000011 | 3300025944 | Bacteria | 361200 |
| 731 | Ga0207661_10002181 | 3300025944 | Bacteria | 13503 |
| 732 | Ga0207661_10023578 | 3300025944 | Bacteria | 4651 |
| 733 | Ga0207661_10034991 | 3300025944 | Bacteria | 3911 |
| 734 | Ga0207661_10094573 | 3300025944 | Bacteria | 2497 |
| 735 | Ga0207661_10159818 | 3300025944 | Bacteria | 1954 |
| 736 | Ga0207661_10234286 | 3300025944 | Bacteria | 1627 |
| 737 | Ga0207661_10415186 | 3300025944 | Bacteria | 1222 |
| 738 | Ga0207679_10009204 | 3300025945 | Bacteria | 6315 |
| 739 | Ga0207679_10066419 | 3300025945 | Bacteria | 2703 |
| 740 | Ga0207679_10097255 | 3300025945 | Bacteria | 2292 |
| 741 | Ga0207679_10099555 | 3300025945 | Bacteria | 2270 |
| 742 | Ga0207679_10292977 | 3300025945 | Bacteria | 1400 |
| 743 | Ga0207679_10313648 | 3300025945 | Bacteria | 1356 |
| 744 | Ga0207667_10044703 | 3300025949 | Bacteria | 4692 |
| 745 | Ga0207667_10093213 | 3300025949 | Bacteria | 3110 |
| 746 | Ga0207667_10251000 | 3300025949 | Bacteria | 1810 |
| 747 | Ga0207651_10007002 | 3300025960 | Bacteria | 5972 |
| 748 | Ga0207651_10009512 | 3300025960 | Bacteria | 5330 |
| 749 | Ga0207651_10033799 | 3300025960 | Bacteria | 3302 |
| 750 | Ga0207651_10049240 | 3300025960 | Bacteria | 2854 |
| 751 | Ga0207651_10051872 | 3300025960 | Bacteria | 2794 |
| 752 | Ga0207651_10066670 | 3300025960 | Bacteria | 2530 |
| 753 | Ga0207651_10079632 | 3300025960 | Bacteria | 2354 |
| 754 | Ga0207651_10084363 | 3300025960 | Bacteria | 2301 |
| 755 | Ga0207651_10111691 | 3300025960 | Bacteria | 2053 |
| 756 | Ga0207651_10137866 | 3300025960 | Bacteria | 1879 |
| 757 | Ga0207712_10005715 | 3300025961 | Bacteria | 7839 |
| 758 | Ga0207712_10142833 | 3300025961 | Bacteria | 1839 |
| 759 | Ga0207712_10172565 | 3300025961 | Bacteria | 1692 |
| 760 | Ga0207668_10048164 | 3300025972 | Bacteria | 2923 |
| 761 | Ga0207668_10163645 | 3300025972 | Bacteria | 1736 |
| 762 | Ga0207658_10317366 | 3300025986 | Bacteria | 1348 |
| 763 | Ga0207677_10018985 | 3300026023 | Bacteria | 4141 |
| 764 | Ga0207677_10063791 | 3300026023 | Bacteria | 2563 |
| 765 | Ga0207677_10203712 | 3300026023 | Bacteria | 1575 |
| 766 | Ga0207677_10286845 | 3300026023 | Bacteria | 1354 |
| 767 | Ga0207677_10404429 | 3300026023 | Bacteria | 1158 |
| 768 | Ga0207703_10035997 | 3300026035 | Bacteria | 3936 |
| 769 | Ga0207703_10039860 | 3300026035 | Bacteria | 3756 |
| 770 | Ga0207703_10050482 | 3300026035 | Bacteria | 3367 |
| 771 | Ga0207703_10131114 | 3300026035 | Bacteria | 2165 |
| 772 | Ga0207703_10141663 | 3300026035 | Bacteria | 2087 |
| 773 | Ga0207703_10408894 | 3300026035 | Bacteria | 1260 |
| 774 | Ga0207639_10056107 | 3300026041 | Bacteria | 3018 |
| 775 | Ga0207639_10090509 | 3300026041 | Bacteria | 2447 |
| 776 | Ga0207678_10022795 | 3300026067 | Bacteria | 5483 |
| 777 | Ga0207678_10031382 | 3300026067 | Bacteria | 4635 |
| 778 | Ga0207678_10116577 | 3300026067 | Bacteria | 2279 |
| 779 | Ga0207678_10122602 | 3300026067 | Bacteria | 2218 |
| 780 | Ga0207678_10185564 | 3300026067 | Bacteria | 1776 |
| 781 | Ga0207708_10005458 | 3300026075 | Bacteria | 9379 |
| 782 | Ga0207708_10012601 | 3300026075 | Bacteria | 6306 |
| 783 | Ga0207708_10017975 | 3300026075 | Bacteria | 5319 |
| 784 | Ga0207708_10313618 | 3300026075 | Bacteria | 1278 |
| 785 | Ga0207702_10032863 | 3300026078 | Bacteria | 4331 |
| 786 | Ga0207702_10492845 | 3300026078 | Bacteria | 1194 |
| 787 | Ga0207648_10000831 | 3300026089 | Bacteria | 34764 |
| 788 | Ga0207648_10013463 | 3300026089 | Bacteria | 7609 |
| 789 | Ga0207648_10033080 | 3300026089 | Bacteria | 4561 |
| 790 | Ga0207648_10043265 | 3300026089 | Bacteria | 3953 |
| 791 | Ga0207648_10052246 | 3300026089 | Bacteria | 3573 |
| 792 | Ga0207648_10143877 | 3300026089 | Bacteria | 2103 |
| 793 | Ga0207648_10464751 | 3300026089 | Bacteria | 1154 |
| 794 | Ga0207676_10056408 | 3300026095 | Bacteria | 3088 |
| 795 | Ga0207676_10056688 | 3300026095 | Bacteria | 3082 |
| 796 | Ga0207676_10072834 | 3300026095 | Bacteria | 2763 |
| 797 | Ga0207676_10240853 | 3300026095 | Bacteria | 1623 |
| 798 | Ga0207674_10000575 | 3300026116 | Bacteria | 48309 |
| 799 | Ga0207674_10015400 | 3300026116 | Bacteria | 8400 |
| 800 | Ga0207674_10018395 | 3300026116 | Bacteria | 7596 |
| 801 | Ga0207674_10053138 | 3300026116 | Bacteria | 4130 |
| 802 | Ga0207674_10060999 | 3300026116 | Bacteria | 3811 |
| 803 | Ga0207674_10155662 | 3300026116 | Bacteria | 2241 |
| 804 | Ga0207675_100001439 | 3300026118 | Bacteria | 23863 |
| 805 | Ga0207675_100029121 | 3300026118 | Bacteria | 5147 |
| 806 | Ga0207675_100095852 | 3300026118 | Bacteria | 2792 |
| 807 | Ga0207675_100605956 | 3300026118 | Bacteria | 1098 |
| 808 | Ga0207683_10029677 | 3300026121 | Bacteria | 4736 |
| 809 | Ga0207683_10086901 | 3300026121 | Bacteria | 2780 |
| 810 | Ga0207683_10125248 | 3300026121 | Bacteria | 2309 |
| 811 | Ga0207698_10034543 | 3300026142 | Bacteria | 3687 |
| 812 | Ga0207698_10039904 | 3300026142 | Bacteria | 3482 |
| 813 | Ga0207698_10210221 | 3300026142 | Bacteria | 1750 |
| 814 | Ga0209179_1000035 | 3300027512 | Bacteria | 31485 |
| 815 | Ga0209999_1006859 | 3300027543 | Bacteria | 2048 |
| 816 | Ga0209588_1045938 | 3300027671 | Bacteria | 1413 |
| 817 | Ga0209971_1035165 | 3300027682 | Bacteria | 1205 |
| 818 | Ga0209998_10000643 | 3300027717 | Bacteria | 9368 |
| 819 | Ga0209998_10015878 | 3300027717 | Bacteria | 1581 |
| 820 | Ga0209974_10015654 | 3300027876 | Bacteria | 2519 |
| 821 | Ga0207428_10001569 | 3300027907 | Bacteria | 23808 |
| 822 | Ga0207428_10031150 | 3300027907 | Bacteria | 4405 |
| 823 | Ga0207428_10069738 | 3300027907 | Bacteria | 2764 |
| 824 | Ga0207428_10139767 | 3300027907 | Bacteria | 1849 |
| 825 | Ga0207428_10148331 | 3300027907 | Bacteria | 1787 |
| 826 | Ga0207428_10203577 | 3300027907 | Bacteria | 1489 |
| 827 | Ga0265354_1001849 | 3300028016 | Bacteria | 2843 |
| 828 | Ga0265356_1000423 | 3300028017 | Bacteria | 7674 |
| 829 | Ga0268266_10009803 | 3300028379 | Bacteria | 8425 |
| 830 | Ga0268266_10011841 | 3300028379 | Bacteria | 7558 |
| 831 | Ga0268266_10095384 | 3300028379 | Bacteria | 2613 |
| 832 | Ga0268266_10119392 | 3300028379 | Bacteria | 2345 |
| 833 | Ga0268266_10555682 | 3300028379 | Bacteria | 1100 |
| 834 | Ga0268265_10002430 | 3300028380 | Bacteria | 14059 |
| 835 | Ga0268265_10003755 | 3300028380 | Bacteria | 10793 |
| 836 | Ga0268265_10072929 | 3300028380 | Bacteria | 2679 |
| 837 | Ga0268265_10144087 | 3300028380 | Bacteria | 1999 |
| 838 | Ga0268265_10290108 | 3300028380 | Bacteria | 1468 |
| 839 | Ga0268264_10047178 | 3300028381 | Bacteria | 3581 |
| 840 | Ga0268264_10259293 | 3300028381 | Bacteria | 1619 |
| 841 | Ga0265337_1000341 | 3300028556 | Bacteria | 24875 |
| 842 | Ga0265337_1004853 | 3300028556 | Bacteria | 5494 |
| 843 | Ga0265326_10018024 | 3300028558 | Bacteria | 2033 |
| 844 | Ga0265319_1004109 | 3300028563 | Bacteria | 7325 |
| 845 | Ga0265319_1005238 | 3300028563 | Bacteria | 6257 |
| 846 | Ga0265319_1064029 | 3300028563 | Bacteria | 1188 |
| 847 | Ga0265318_10002057 | 3300028577 | Bacteria | 11050 |
| 848 | Ga0265318_10015946 | 3300028577 | Bacteria | 3112 |
| 849 | Ga0265318_10089329 | 3300028577 | Bacteria | 1135 |
| 850 | Ga0265323_10005821 | 3300028653 | Bacteria | 5215 |
| 851 | Ga0265323_10030565 | 3300028653 | Bacteria | 2005 |
| 852 | Ga0265322_10007287 | 3300028654 | Bacteria | 3235 |
| 853 | Ga0265322_10013995 | 3300028654 | Bacteria | 2322 |
| 854 | Ga0265336_10001401 | 3300028666 | Bacteria | 11125 |
| 855 | Ga0265338_10001605 | 3300028800 | Bacteria | 36301 |
| 856 | Ga0265338_10001803 | 3300028800 | Bacteria | 33699 |
| 857 | Ga0265338_10004319 | 3300028800 | Bacteria | 19278 |
| 858 | Ga0265338_10013275 | 3300028800 | Bacteria | 9314 |
| 859 | Ga0265338_10047014 | 3300028800 | Bacteria | 3947 |
| 860 | Ga0265762_1002849 | 3300030760 | Bacteria | 3091 |
| 861 | Ga0265765_1001162 | 3300030879 | Bacteria | 2359 |
| 862 | Ga0265760_10001235 | 3300031090 | Bacteria | 7472 |
| 863 | Ga0265760_10008710 | 3300031090 | Bacteria | 2899 |
| 864 | Ga0265760_10025268 | 3300031090 | Bacteria | 1734 |
| 865 | Ga0265330_10001378 | 3300031235 | Bacteria | 14200 |
| 866 | Ga0265330_10124717 | 3300031235 | Bacteria | 1097 |
| 867 | Ga0265332_10026881 | 3300031238 | Bacteria | 2522 |
| 868 | Ga0265328_10017008 | 3300031239 | Bacteria | 2822 |
| 869 | Ga0265320_10010173 | 3300031240 | Bacteria | 5619 |
| 870 | Ga0265320_10011149 | 3300031240 | Bacteria | 5303 |
| 871 | Ga0265320_10016105 | 3300031240 | Bacteria | 4200 |
| 872 | Ga0265325_10001701 | 3300031241 | Bacteria | 15288 |
| 873 | Ga0265325_10009862 | 3300031241 | Bacteria | 5561 |
| 874 | Ga0265325_10082724 | 3300031241 | Bacteria | 1593 |
| 875 | Ga0265340_10006886 | 3300031247 | Bacteria | 6214 |
| 876 | Ga0265340_10093220 | 3300031247 | Bacteria | 1406 |
| 877 | Ga0265339_10000011 | 3300031249 | Bacteria | 206284 |
| 878 | Ga0265339_10001359 | 3300031249 | Bacteria | 18276 |
| 879 | Ga0265339_10001433 | 3300031249 | Bacteria | 17692 |
| 880 | Ga0265339_10015256 | 3300031249 | Bacteria | 4609 |
| 881 | Ga0265331_10013068 | 3300031250 | Bacteria | 4473 |
| 882 | Ga0265327_10000014 | 3300031251 | Bacteria | 506288 |
| 883 | Ga0265316_10000390 | 3300031344 | Bacteria | 50094 |
| 884 | Ga0265316_10000523 | 3300031344 | Bacteria | 43376 |
| 885 | Ga0265316_10010760 | 3300031344 | Bacteria | 8312 |
| 886 | Ga0265316_10011481 | 3300031344 | Bacteria | 7983 |
| 887 | Ga0265316_10019573 | 3300031344 | Bacteria | 5783 |
| 888 | Ga0265316_10033261 | 3300031344 | Unclassified | 4201 |
| 889 | Ga0265316_10038328 | 3300031344 | Bacteria | 3862 |
| 890 | Ga0265316_10044392 | 3300031344 | Bacteria | 3536 |
| 891 | Ga0265316_10096370 | 3300031344 | Bacteria | 2252 |
| 892 | Ga0265316_10238166 | 3300031344 | Bacteria | 1338 |
| 893 | Ga0265316_10240099 | 3300031344 | Bacteria | 1332 |
| 894 | Ga0307408_100048150 | 3300031548 | Bacteria | 3056 |
| 895 | Ga0307408_100076533 | 3300031548 | Bacteria | 2490 |
| 896 | Ga0307408_100151714 | 3300031548 | Bacteria | 1830 |
| 897 | Ga0307408_100179890 | 3300031548 | Bacteria | 1695 |
| 898 | Ga0307408_100388040 | 3300031548 | Bacteria | 1196 |
| 899 | Ga0265313_10003345 | 3300031595 | Bacteria | 13107 |
| 900 | Ga0265313_10021569 | 3300031595 | Bacteria | 3520 |
| 901 | Ga0265313_10056632 | 3300031595 | Bacteria | 1853 |
| 902 | Ga0316575_10001488 | 3300031665 | Bacteria | 7567 |
| 903 | Ga0316575_10018143 | 3300031665 | Unclassified | 2679 |
| 904 | Ga0316575_10027858 | 3300031665 | Bacteria | 2199 |
| 905 | Ga0316579_10001127 | 3300031691 | Bacteria | 9507 |
| 906 | Ga0316579_10005953 | 3300031691 | Bacteria | 4947 |
| 907 | Ga0265314_10000036 | 3300031711 | Bacteria | 234928 |
| 908 | Ga0265314_10002466 | 3300031711 | Bacteria | 18918 |
| 909 | Ga0265314_10011383 | 3300031711 | Bacteria | 7350 |
| 910 | Ga0265342_10000377 | 3300031712 | Bacteria | 49212 |
| 911 | Ga0265342_10000788 | 3300031712 | Bacteria | 31973 |
| 912 | Ga0265342_10014707 | 3300031712 | Bacteria | 5184 |
| 913 | Ga0265342_10031155 | 3300031712 | Bacteria | 3300 |
| 914 | Ga0265342_10033572 | 3300031712 | Bacteria | 3154 |
| 915 | Ga0265342_10063973 | 3300031712 | Bacteria | 2160 |
| 916 | Ga0265342_10072643 | 3300031712 | Bacteria | 2002 |
| 917 | Ga0265342_10099334 | 3300031712 | Bacteria | 1660 |
| 918 | Ga0316576_10000176 | 3300031727 | Bacteria | 26357 |
| 919 | Ga0316576_10034695 | 3300031727 | Bacteria | 3597 |
| 920 | Ga0316576_10063629 | 3300031727 | Bacteria | 2708 |
| 921 | Ga0316576_10135066 | 3300031727 | Bacteria | 1856 |
| 922 | Ga0316578_10007657 | 3300031728 | Bacteria | 5437 |
| 923 | Ga0316578_10143986 | 3300031728 | Bacteria | 1435 |
| 924 | Ga0316578_10147830 | 3300031728 | Bacteria | 1415 |
| 925 | Ga0307405_10082905 | 3300031731 | Bacteria | 2100 |
| 926 | Ga0307405_10086064 | 3300031731 | Bacteria | 2068 |
| 927 | Ga0307405_10139485 | 3300031731 | Bacteria | 1688 |
| 928 | Ga0316577_10005881 | 3300031733 | Bacteria | 6456 |
| 929 | Ga0316577_10028765 | 3300031733 | Bacteria | 3101 |
| 930 | Ga0316577_10041957 | 3300031733 | Bacteria | 2560 |
| 931 | Ga0316577_10051477 | 3300031733 | Bacteria | 2297 |
| 932 | Ga0307410_10030903 | 3300031852 | Bacteria | 3428 |
| 933 | Ga0307410_10031559 | 3300031852 | Bacteria | 3401 |
| 934 | Ga0307410_10073363 | 3300031852 | Bacteria | 2379 |
| 935 | Ga0307410_10166712 | 3300031852 | Bacteria | 1656 |
| 936 | Ga0307406_10000573 | 3300031901 | Bacteria | 21160 |
| 937 | Ga0307406_10012696 | 3300031901 | Bacteria | 4805 |
| 938 | Ga0307406_10062500 | 3300031901 | Bacteria | 2409 |
| 939 | Ga0307406_10168379 | 3300031901 | Bacteria | 1583 |
| 940 | Ga0307407_10045780 | 3300031903 | Bacteria | 2474 |
| 941 | Ga0307407_10105340 | 3300031903 | Bacteria | 1759 |
| 942 | Ga0307407_10265300 | 3300031903 | Bacteria | 1183 |
| 943 | Ga0307412_10007208 | 3300031911 | Bacteria | 6311 |
| 944 | Ga0307412_10219157 | 3300031911 | Bacteria | 1457 |
| 945 | Ga0307409_100030777 | 3300031995 | Bacteria | 3862 |
| 946 | Ga0307409_100082565 | 3300031995 | Bacteria | 2602 |
| 947 | Ga0307409_100111351 | 3300031995 | Bacteria | 2296 |
| 948 | Ga0307409_100256983 | 3300031995 | Bacteria | 1601 |
| 949 | Ga0307409_100325905 | 3300031995 | Bacteria | 1439 |
| 950 | Ga0307409_100350128 | 3300031995 | Bacteria | 1393 |
| 951 | Ga0307409_100449720 | 3300031995 | Bacteria | 1243 |
| 952 | Ga0307416_100000453 | 3300032002 | Bacteria | 21031 |
| 953 | Ga0307416_100002533 | 3300032002 | Bacteria | 10516 |
| 954 | Ga0307416_100135375 | 3300032002 | Bacteria | 2227 |
| 955 | Ga0307416_100273517 | 3300032002 | Bacteria | 1660 |
| 956 | Ga0307416_100561962 | 3300032002 | Bacteria | 1216 |
| 957 | Ga0307414_10264643 | 3300032004 | Bacteria | 1437 |
| 958 | Ga0307414_10333828 | 3300032004 | Bacteria | 1295 |
| 959 | Ga0307414_10424352 | 3300032004 | Bacteria | 1160 |
| 960 | Ga0307411_10017664 | 3300032005 | Bacteria | 4073 |
| 961 | Ga0307411_10023552 | 3300032005 | Bacteria | 3650 |
| 962 | Ga0307411_10060712 | 3300032005 | Bacteria | 2512 |
| 963 | Ga0307411_10134278 | 3300032005 | Bacteria | 1814 |
| 964 | Ga0307415_100029569 | 3300032126 | Bacteria | 3504 |
| 965 | Ga0307415_100212840 | 3300032126 | Bacteria | 1543 |
| 966 | Ga0307415_100361320 | 3300032126 | Bacteria | 1226 |
| 967 | Ga0316583_10038918 | 3300032133 | Bacteria | 1684 |
| 968 | Ga0316583_10054512 | 3300032133 | Bacteria | 1406 |
| 969 | Ga0316585_10000518 | 3300032137 | Bacteria | 9224 |
| 970 | Ga0316580_10002122 | 3300032139 | Bacteria | 5393 |
| 971 | Ga0316212_1003877 | 3300033547 | Bacteria | 2169 |
| 972 | Ga0373926_0018520 | 3300035083 | Bacteria | 2396 |
| 973 | Ga0373926_0049806 | 3300035083 | Bacteria | 1509 |
| 974 | Ga0373926_0055174 | 3300035083 | Bacteria | 1440 |
| 975 | Ga0373934_0001808 | 3300035086 | Bacteria | 7854 |
| 976 | Ga0373934_0015827 | 3300035086 | Bacteria | 2865 |
| 977 | Ga0373934_0060064 | 3300035086 | Bacteria | 1514 |
| 978 | Ga0373949_0052560 | 3300035090 | Bacteria | 1030 |
| 979 | Ga0373945_0020112 | 3300035116 | Bacteria | 2282 |
| 980 | Ga0373945_0020901 | 3300035116 | Bacteria | 2245 |
| 981 | Ga0373953_0024910 | 3300035117 | Bacteria | 2280 |
| 982 | Ga0373954_0002656 | 3300035118 | Bacteria | 7523 |
| 983 | Ga0373956_0002098 | 3300035119 | Bacteria | 8262 |
| 984 | Ga0373943_0001313 | 3300035170 | Bacteria | 11171 |
| 985 | Ga0373943_0051694 | 3300035170 | Bacteria | 2024 |
| 986 | Ga0373946_0031525 | 3300035171 | Bacteria | 2124 |
| 987 | Ga0373955_0013885 | 3300035172 | Bacteria | 3908 |
| 988 | Ga0373955_0087116 | 3300035172 | Bacteria | 1774 |
| 989 | Ga0373955_0201676 | 3300035172 | Bacteria | 1184 |
| 990 | Ga0316574_0003541 | 3300035398 | Bacteria | 8061 |
| 991 | Ga0316574_0021845 | 3300035398 | Bacteria | 3803 |
| 992 | Ga0316574_0182367 | 3300035398 | Bacteria | 1350 |
| 993 | Ga0373935_0058605 | 3300035692 | Bacteria | 2460 |
| 994 | Ga0373927_0005068 | 3300035695 | Bacteria | 9116 |
| 995 | Ga0373927_0041960 | 3300035695 | Bacteria | 2967 |
| 996 | Ga0373927_0060673 | 3300035695 | Bacteria | 2447 |
| 997 | Ga0373927_0298266 | 3300035695 | Bacteria | 1061 |
| 998 | Ga0373933_0001471 | 3300035724 | Bacteria | 13798 |
| 999 | Ga0373933_0049233 | 3300035724 | Bacteria | 2512 |
| 1000 | Ga0373947_0016320 | 3300035725 | Bacteria | 4268 |
| 1001 | Ga0373937_0001030 | 3300036401 | Bacteria | 23591 |
| 1002 | Ga0373937_0003079 | 3300036401 | Bacteria | 13946 |
| 1003 | Ga0373937_0098935 | 3300036401 | Bacteria | 2706 |
| 1004 | Ga0373937_0111800 | 3300036401 | Bacteria | 2541 |
| 1005 | Ga0373937_0173832 | 3300036401 | Bacteria | 2021 |
| 1006 | Ga0373937_0220367 | 3300036401 | Bacteria | 1786 |
| 1007 | Ga0373937_0412521 | 3300036401 | Bacteria | 1281 |
| 1008 | Ga0373937_0433294 | 3300036401 | Bacteria | 1248 |
| 1009 | Ga0316582_0021668 | 3300036647 | Unclassified | 3802 |
| 1010 | Ga0316582_0031402 | 3300036647 | Bacteria | 3246 |
| 1011 | Ga0316582_0034557 | 3300036647 | Bacteria | 3114 |
| 1012 | Ga0316582_0068184 | 3300036647 | Bacteria | 2296 |
| 1013 | Ga0316582_0135073 | 3300036647 | Bacteria | 1659 |
| 1014 | Ga0316582_0139231 | 3300036647 | Bacteria | 1635 |
| 1015 | Ga0316582_0154903 | 3300036647 | Unclassified | 1550 |
| 1016 | Ga0316584_0000730 | 3300036712 | Bacteria | 18269 |
| 1017 | Ga0316584_0004451 | 3300036712 | Bacteria | 9272 |
| 1018 | Ga0316584_0019139 | 3300036712 | Bacteria | 4946 |
| 1019 | Ga0316584_0052101 | 3300036712 | Bacteria | 3061 |
| 1020 | Ga0316584_0054449 | 3300036712 | Bacteria | 2994 |
| 1021 | Ga0373925_0004280 | 3300037068 | Bacteria | 10817 |
| 1022 | Ga0373925_0093003 | 3300037068 | Bacteria | 2307 |
| 1023 | Ga0373925_0143727 | 3300037068 | Bacteria | 1869 |
| 1024 | Ga0395899_0038156 | 3300037312 | Bacteria | 3599 |
| 1025 | Ga0395900_0005776 | 3300037418 | Bacteria | 12929 |
| 1026 | Ga0395900_0022025 | 3300037418 | Bacteria | 6517 |
| 1027 | Ga0395900_0185566 | 3300037418 | Bacteria | 2111 |
| 1028 | Ga0395898_0004275 | 3300037466 | Bacteria | 15666 |
| 1029 | Ga0395898_0016471 | 3300037466 | Bacteria | 7562 |
| 1030 | Ga0395898_0026587 | 3300037466 | Bacteria | 5820 |
| 1031 | Ga0395905_0025950 | 3300037471 | Bacteria | 5524 |
| 1032 | Ga0395905_0040878 | 3300037471 | Bacteria | 4350 |
| 1033 | Ga0316581_0000740 | 3300037588 | Bacteria | 6720 |
| 1034 | Ga0316581_0004424 | 3300037588 | Bacteria | 3586 |
| 1035 | Ga0316581_0030200 | 3300037588 | Bacteria | 1630 |
| 1036 | Ga0395901_0000748 | 3300038443 | Bacteria | 36691 |
| 1037 | Ga0395901_0030870 | 3300038443 | Bacteria | 5522 |
| 1038 | Ga0395901_0077025 | 3300038443 | Bacteria | 3480 |
| 1039 | Ga0395901_0121419 | 3300038443 | Bacteria | 2746 |
| 1040 | Ga0395901_0479461 | 3300038443 | Bacteria | 1269 |
| 1041 | Ga0400483_005635 | 3300039062 | Bacteria | 9511 |
| 1042 | Ga0400483_011190 | 3300039062 | Bacteria | 182340 |
| 1043 | Ga0400483_093214 | 3300039062 | Bacteria | 200340 |
| 1044 | Ga0400483_215675 | 3300039062 | Bacteria | 181282 |
| 1045 | Ga0400483_219863 | 3300039062 | Bacteria | 173210 |
| 1046 | Ga0400483_236928 | 3300039062 | Bacteria | 10450 |
| 1047 | Ga0400489_32485 | 3300039093 | Bacteria | 1304 |
| 1048 | Ga0436365_1106392 | 3300039437 | Bacteria | 5899 |
| 1049 | Ga0436362_0505684 | 3300039453 | Bacteria | 1580 |
| 1050 | Ga0451791_0173611 | 3300041451 | Bacteria | 1306 |
| 1051 | Ga0451853_2013714 | 3300041512 | Bacteria | 1103 |
| 1052 | Ga0439433_0013752 | 3300041999 | Bacteria | 1779 |
| 1053 | Ga0439456_015644 | 3300042013 | Bacteria | 1586 |
| 1054 | Ga0439462_0003082 | 3300042015 | Bacteria | 3963 |
| 1055 | Ga0450896_000837 | 3300042133 | Bacteria | 3493 |
| 1056 | Ga0450896_006316 | 3300042133 | Bacteria | 1624 |
| 1057 | Ga0450908_003258 | 3300042184 | Bacteria | 3163 |
| 1058 | Ga0439434_0005911 | 3300042435 | Bacteria | 3576 |
| 1059 | Ga0439435_0004469 | 3300042436 | Bacteria | 3015 |
| 1060 | Ga0439435_0009689 | 3300042436 | Bacteria | 2266 |
| 1061 | Ga0450918_003723 | 3300042531 | Bacteria | 2821 |
| 1062 | Ga0451577_0113437 | 3300042876 | Bacteria | 2426 |
| 1063 | Ga0451577_0176052 | 3300042876 | Bacteria | 1928 |
| 1064 | Ga0451577_0222136 | 3300042876 | Bacteria | 1707 |
| 1065 | Ga0453683_0184216 | 3300044673 | Bacteria | 1324 |
| 1066 | Ga0453684_0001951 | 3300044712 | Bacteria | 53210 |
| 1067 | Ga0453684_0003327 | 3300044712 | Bacteria | 36507 |
| 1068 | Ga0453684_0040322 | 3300044712 | Bacteria | 6343 |
| 1069 | Ga0453684_0127246 | 3300044712 | Unclassified | 3064 |
| 1070 | Ga0453684_0518352 | 3300044712 | Bacteria | 1317 |
| 1071 | Ga0466970_0012651 | 3300044765 | Bacteria | 4317 |
| 1072 | Ga0451576_0010110 | 3300045051 | Bacteria | 10865 |
| 1073 | Ga0451576_0016018 | 3300045051 | Bacteria | 8283 |
| 1074 | Ga0451576_0028389 | 3300045051 | Bacteria | 5994 |
| 1075 | Ga0451576_0068274 | 3300045051 | Bacteria | 3699 |
| 1076 | Ga0451576_0232055 | 3300045051 | Bacteria | 1927 |
| 1077 | Ga0451576_0244801 | 3300045051 | Bacteria | 1873 |
| 1078 | Ga0451576_0310385 | 3300045051 | Bacteria | 1650 |
| 1079 | Ga0451576_0547483 | 3300045051 | Bacteria | 1216 |
| 1080 | Ga0451576_0570623 | 3300045051 | Bacteria | 1189 |
| 1081 | Ga0466967_0028686 | 3300045976 | Bacteria | 4650 |
| 1082 | Ga0495603_0054628 | 3300046455 | Bacteria | 2367 |
| 1083 | Ga0495629_0033455 | 3300046459 | Bacteria | 3636 |
| 1084 | Ga0495629_0078901 | 3300046459 | Bacteria | 2298 |
| 1085 | Ga0495629_0163613 | 3300046459 | Bacteria | 1545 |
| 1086 | Ga0495629_0269404 | 3300046459 | Bacteria | 1170 |
| 1087 | Ga0495638_0016830 | 3300046460 | Bacteria | 4889 |
| 1088 | Ga0495641_0038740 | 3300046461 | Bacteria | 2226 |
| 1089 | Ga0495651_0037993 | 3300046462 | Bacteria | 3749 |
| 1090 | Ga0495651_0051091 | 3300046462 | Bacteria | 3188 |
| 1091 | Ga0495651_0070810 | 3300046462 | Bacteria | 2653 |
| 1092 | Ga0495653_0038384 | 3300046463 | Bacteria | 3760 |
| 1093 | Ga0495653_0099170 | 3300046463 | Bacteria | 2114 |
| 1094 | Ga0495653_0229106 | 3300046463 | Bacteria | 1245 |
| 1095 | Ga0495580_0013226 | 3300046472 | Bacteria | 6309 |
| 1096 | Ga0495580_0067093 | 3300046472 | Bacteria | 2511 |
| 1097 | Ga0495580_0079671 | 3300046472 | Bacteria | 2284 |
| 1098 | Ga0495580_0086908 | 3300046472 | Bacteria | 2178 |
| 1099 | Ga0495580_0093087 | 3300046472 | Bacteria | 2098 |
| 1100 | Ga0495580_0134081 | 3300046472 | Bacteria | 1717 |
| 1101 | Ga0495580_0150582 | 3300046472 | Bacteria | 1612 |
| 1102 | Ga0495580_0168096 | 3300046472 | Bacteria | 1517 |
| 1103 | Ga0495580_0245389 | 3300046472 | Bacteria | 1227 |
| 1104 | Ga0495582_0053906 | 3300046473 | Bacteria | 2218 |
| 1105 | Ga0495639_0019172 | 3300046475 | Bacteria | 2984 |
| 1106 | Ga0495662_0111120 | 3300046476 | Bacteria | 1343 |
| 1107 | Ga0495664_0038910 | 3300046477 | Bacteria | 2809 |
| 1108 | Ga0495664_0050182 | 3300046477 | Bacteria | 2477 |
| 1109 | Ga0495584_0033978 | 3300046491 | Bacteria | 2580 |
| 1110 | Ga0495585_0035699 | 3300046492 | Bacteria | 2808 |
| 1111 | Ga0495594_0008275 | 3300046499 | Bacteria | 5355 |
| 1112 | Ga0495596_0040812 | 3300046500 | Bacteria | 1831 |
| 1113 | Ga0495608_0038026 | 3300046511 | Bacteria | 3235 |
| 1114 | Ga0495608_0066533 | 3300046511 | Bacteria | 2359 |
| 1115 | Ga0495608_0088558 | 3300046511 | Bacteria | 2004 |
| 1116 | Ga0495608_0093787 | 3300046511 | Bacteria | 1939 |
| 1117 | Ga0495618_0032566 | 3300046514 | Bacteria | 3264 |
| 1118 | Ga0495618_0192857 | 3300046514 | Bacteria | 1291 |
| 1119 | Ga0495628_0111025 | 3300046516 | Bacteria | 2109 |
| 1120 | Ga0495630_0010653 | 3300046517 | Bacteria | 6636 |
| 1121 | Ga0495630_0152070 | 3300046517 | Bacteria | 1761 |
| 1122 | Ga0495630_0259240 | 3300046517 | Bacteria | 1328 |
| 1123 | Ga0495630_0482817 | 3300046517 | Bacteria | 950 |
| 1124 | Ga0495643_0003764 | 3300046522 | Bacteria | 10963 |
| 1125 | Ga0495644_0000109 | 3300046523 | Bacteria | 39201 |
| 1126 | Ga0495666_0152886 | 3300046526 | Bacteria | 1072 |
| 1127 | Ga0495652_0041555 | 3300046529 | Bacteria | 3969 |
| 1128 | Ga0495652_0062339 | 3300046529 | Bacteria | 3144 |
| 1129 | Ga0495652_0151957 | 3300046529 | Bacteria | 1808 |
| 1130 | Ga0495652_0166837 | 3300046529 | Bacteria | 1703 |
| 1131 | Ga0495665_0030788 | 3300046531 | Bacteria | 2871 |
| 1132 | Ga0495640_0037807 | 3300046533 | Bacteria | 3401 |
| 1133 | Ga0495640_0055240 | 3300046533 | Bacteria | 2717 |
| 1134 | Ga0495587_0025928 | 3300046536 | Bacteria | 3578 |
| 1135 | Ga0495587_0029174 | 3300046536 | Bacteria | 3351 |
| 1136 | Ga0495587_0078118 | 3300046536 | Bacteria | 1921 |
| 1137 | Ga0495645_0003622 | 3300046543 | Bacteria | 10486 |
| 1138 | Ga0495645_0016503 | 3300046543 | Bacteria | 5274 |
| 1139 | Ga0495667_0039839 | 3300046559 | Bacteria | 3122 |
| 1140 | Ga0495667_0046569 | 3300046559 | Bacteria | 2867 |
| 1141 | Ga0495667_0278199 | 3300046559 | Bacteria | 1062 |
| 1142 | Ga0495634_0150100 | 3300046642 | Bacteria | 1474 |
| 1143 | Ga0495634_0182307 | 3300046642 | Bacteria | 1313 |
| 1144 | Ga0495611_0152419 | 3300046648 | Bacteria | 1079 |
| 1145 | Ga0495635_0049008 | 3300046663 | Bacteria | 2912 |
| 1146 | Ga0495635_0081053 | 3300046663 | Bacteria | 2221 |
| 1147 | Ga0495635_0096304 | 3300046663 | Bacteria | 2023 |
| 1148 | Ga0495659_0083678 | 3300046664 | Bacteria | 1215 |
| 1149 | Ga0495661_0059195 | 3300046665 | Bacteria | 2281 |
| 1150 | Ga0495588_0070854 | 3300046674 | Bacteria | 1812 |
| 1151 | Ga0495657_0036875 | 3300046675 | Bacteria | 3375 |
| 1152 | Ga0495657_0122940 | 3300046675 | Bacteria | 1633 |
| 1153 | Ga0495599_0038487 | 3300046678 | Bacteria | 3005 |
| 1154 | Ga0495599_0067316 | 3300046678 | Bacteria | 2237 |
| 1155 | Ga0495623_0029370 | 3300046679 | Bacteria | 3538 |
| 1156 | Ga0495623_0193903 | 3300046679 | Bacteria | 1172 |
| 1157 | Ga0495646_0065823 | 3300046680 | Bacteria | 2145 |
| 1158 | Ga0495646_0078664 | 3300046680 | Bacteria | 1927 |
| 1159 | Ga0495647_0019003 | 3300046681 | Bacteria | 2453 |
| 1160 | Ga0495658_0021591 | 3300046683 | Bacteria | 3395 |
| 1161 | Ga0495658_0033654 | 3300046683 | Bacteria | 2809 |
| 1162 | Ga0495658_0042183 | 3300046683 | Bacteria | 2546 |
| 1163 | Ga0495613_0009371 | 3300046689 | Bacteria | 7264 |
| 1164 | Ga0495613_0076261 | 3300046689 | Bacteria | 2440 |
| 1165 | Ga0495613_0106936 | 3300046689 | Bacteria | 2018 |
| 1166 | Ga0495613_0130952 | 3300046689 | Bacteria | 1796 |
| 1167 | Ga0495613_0195213 | 3300046689 | Bacteria | 1429 |
| 1168 | Ga0495624_0214613 | 3300046690 | Bacteria | 1167 |
| 1169 | Ga0495670_0038325 | 3300046691 | Bacteria | 2390 |
| 1170 | Ga0495600_0019687 | 3300046809 | Bacteria | 4313 |
| 1171 | Ga0495600_0052119 | 3300046809 | Bacteria | 2672 |
| 1172 | Ga0495581_0028963 | 3300047315 | Bacteria | 3211 |
| 1173 | Ga0495604_0000316 | 3300047317 | Bacteria | 43437 |
| 1174 | Ga0495604_0060936 | 3300047317 | Bacteria | 2888 |
| 1175 | Ga0495604_0076632 | 3300047317 | Bacteria | 2515 |
| 1176 | Ga0495674_0054208 | 3300047319 | Bacteria | 3522 |
| 1177 | Ga0495674_0063090 | 3300047319 | Bacteria | 3224 |
| 1178 | Ga0495674_0075233 | 3300047319 | Bacteria | 2906 |
| 1179 | Ga0495674_0119474 | 3300047319 | Bacteria | 2227 |
| 1180 | Ga0495674_0131881 | 3300047319 | Bacteria | 2105 |
| 1181 | Ga0495674_0159895 | 3300047319 | Bacteria | 1885 |
| 1182 | Ga0495676_0022205 | 3300047321 | Bacteria | 5527 |
| 1183 | Ga0495680_0028177 | 3300047322 | Bacteria | 4607 |
| 1184 | Ga0495680_0070074 | 3300047322 | Bacteria | 2674 |
| 1185 | Ga0495680_0084974 | 3300047322 | Bacteria | 2384 |
| 1186 | Ga0495680_0216595 | 3300047322 | Bacteria | 1369 |
| 1187 | Ga0495675_0194522 | 3300047444 | Bacteria | 1237 |
| 1188 | Ga0495675_0212034 | 3300047444 | Bacteria | 1175 |
| 1189 | Ga0495675_0268280 | 3300047444 | Bacteria | 1021 |
| 1190 | Ga0495684_0006774 | 3300047471 | Bacteria | 8895 |
| 1191 | Ga0495684_0066907 | 3300047471 | Bacteria | 2732 |
| 1192 | Ga0495593_0133456 | 3300047673 | Bacteria | 1260 |
| 1193 | Ga0495602_0010139 | 3300048088 | Bacteria | 9781 |
| 1194 | Ga0495602_0068148 | 3300048088 | Bacteria | 3057 |
| 1195 | Ga0495602_0174268 | 3300048088 | Bacteria | 1666 |
| 1196 | Ga0495614_0024936 | 3300048089 | Bacteria | 2581 |
| 1197 | Ga0496100_0038901 | 3300048903 | Bacteria | 3017 |
| 1198 | Ga0496100_0094185 | 3300048903 | Bacteria | 2051 |
| 1199 | Ga0496100_0264671 | 3300048903 | Bacteria | 1276 |
| 1200 | Ga0496101_0001837 | 3300048904 | Bacteria | 12801 |
| 1201 | Ga0496101_0112442 | 3300048904 | Bacteria | 2051 |
| 1202 | Ga0496101_0148706 | 3300048904 | Bacteria | 1790 |
| 1203 | Ga0496101_0220998 | 3300048904 | Unclassified | 1470 |
| 1204 | Ga0496104_0003735 | 3300048907 | Bacteria | 13150 |
| 1205 | Ga0496104_0006178 | 3300048907 | Bacteria | 10519 |
| 1206 | Ga0496104_0024458 | 3300048907 | Bacteria | 5555 |
| 1207 | Ga0496104_0031819 | 3300048907 | Bacteria | 4908 |
| 1208 | Ga0496104_0170574 | 3300048907 | Unclassified | 2086 |
| 1209 | Ga0496104_0196227 | 3300048907 | Bacteria | 1931 |
| 1210 | Ga0496104_0238776 | 3300048907 | Bacteria | 1729 |
| 1211 | Ga0496105_0017181 | 3300048908 | Bacteria | 5794 |
| 1212 | Ga0496105_0025019 | 3300048908 | Bacteria | 4854 |
| 1213 | Ga0496107_0013317 | 3300048910 | Bacteria | 5746 |
| 1214 | Ga0496107_0098204 | 3300048910 | Bacteria | 2145 |
| 1215 | Ga0496108_0005593 | 3300048911 | Bacteria | 10171 |
| 1216 | Ga0496108_0061089 | 3300048911 | Bacteria | 3171 |
| 1217 | Ga0496108_0289753 | 3300048911 | Bacteria | 1425 |
| 1218 | Ga0496109_0001076 | 3300048912 | Bacteria | 22664 |
| 1219 | Ga0496109_0229484 | 3300048912 | Bacteria | 1746 |
| 1220 | Ga0496110_0124328 | 3300048913 | Bacteria | 2327 |
| 1221 | Ga0496111_0008105 | 3300048914 | Bacteria | 6938 |
| 1222 | Ga0496112_0134148 | 3300048915 | Bacteria | 2446 |
| 1223 | Ga0496112_0200757 | 3300048915 | Bacteria | 1953 |
| 1224 | Ga0496112_0249255 | 3300048915 | Bacteria | 1727 |
| 1225 | Ga0496112_0366081 | 3300048915 | Bacteria | 1383 |
| 1226 | Ga0496112_0521422 | 3300048915 | Bacteria | 1123 |
| 1227 | Ga0496113_0069105 | 3300048916 | Bacteria | 2682 |
| 1228 | Ga0496114_0004686 | 3300048917 | Bacteria | 10632 |
| 1229 | Ga0496114_0056287 | 3300048917 | Bacteria | 3281 |
| 1230 | Ga0496114_0147925 | 3300048917 | Bacteria | 2037 |
| 1231 | Ga0496115_0021362 | 3300048918 | Bacteria | 5000 |
| 1232 | Ga0496115_0055490 | 3300048918 | Unclassified | 3182 |
| 1233 | Ga0496115_0060394 | 3300048918 | Bacteria | 3054 |
| 1234 | Ga0496115_0113889 | 3300048918 | Bacteria | 2223 |
| 1235 | Ga0496115_0243597 | 3300048918 | Bacteria | 1482 |
| 1236 | Ga0496115_0319531 | 3300048918 | Unclassified | 1270 |
| 1237 | Ga0496117_0011177 | 3300048920 | Bacteria | 8061 |
| 1238 | Ga0496118_0024587 | 3300048921 | Bacteria | 5194 |
| 1239 | Ga0496119_0054761 | 3300048922 | Bacteria | 2427 |
| 1240 | Ga0496122_0040764 | 3300048925 | Bacteria | 3683 |
| 1241 | Ga0496125_0000224 | 3300048928 | Bacteria | 115811 |
| 1242 | Ga0501033_0064069 | 3300049570 | Bacteria | 2705 |
| 1243 | Ga0501033_0140758 | 3300049570 | Bacteria | 1744 |
| 1244 | Ga0501034_0010246 | 3300049571 | Bacteria | 9777 |
| 1245 | Ga0501036_0006003 | 3300049572 | Bacteria | 9849 |
| 1246 | Ga0501036_0013567 | 3300049572 | Bacteria | 6774 |
| 1247 | Ga0501036_0033169 | 3300049572 | Bacteria | 4367 |
| 1248 | Ga0501036_0049504 | 3300049572 | Bacteria | 3558 |
| 1249 | Ga0501036_0560374 | 3300049572 | Bacteria | 949 |
| 1250 | Ga0501037_0029707 | 3300049573 | Bacteria | 4038 |
| 1251 | Ga0501037_0042486 | 3300049573 | Bacteria | 3340 |
| 1252 | Ga0501037_0267746 | 3300049573 | Bacteria | 1193 |
| 1253 | Ga0501038_0000991 | 3300049574 | Bacteria | 25533 |
| 1254 | Ga0501038_0014073 | 3300049574 | Bacteria | 7289 |
| 1255 | Ga0501038_0100348 | 3300049574 | Bacteria | 2412 |
| 1256 | Ga0501038_0142246 | 3300049574 | Bacteria | 1962 |
| 1257 | Ga0501038_0181138 | 3300049574 | Bacteria | 1700 |
| 1258 | Ga0501039_0022956 | 3300049575 | Bacteria | 4785 |
| 1259 | Ga0501039_0074496 | 3300049575 | Bacteria | 2638 |
| 1260 | Ga0501039_0100284 | 3300049575 | Bacteria | 2260 |
| 1261 | Ga0501040_0003519 | 3300049576 | Bacteria | 10122 |
| 1262 | Ga0501040_0022672 | 3300049576 | Bacteria | 4205 |
| 1263 | Ga0501040_0044915 | 3300049576 | Bacteria | 3012 |
| 1264 | Ga0501041_0011281 | 3300049577 | Bacteria | 5282 |
| 1265 | Ga0501041_0031028 | 3300049577 | Bacteria | 3227 |
| 1266 | Ga0501041_0229535 | 3300049577 | Bacteria | 1165 |
| 1267 | Ga0501042_0007078 | 3300049578 | Bacteria | 7328 |
| 1268 | Ga0501042_0013134 | 3300049578 | Bacteria | 5635 |
| 1269 | Ga0501042_0018519 | 3300049578 | Bacteria | 4822 |
| 1270 | Ga0501042_0118670 | 3300049578 | Bacteria | 1904 |
| 1271 | Ga0501042_0317061 | 3300049578 | Bacteria | 1126 |
| 1272 | Ga0501043_0002624 | 3300049579 | Bacteria | 15147 |
| 1273 | Ga0501043_0053833 | 3300049579 | Bacteria | 3160 |
| 1274 | Ga0501046_0268932 | 3300049580 | Bacteria | 1251 |
| 1275 | Ga0501047_0000829 | 3300049581 | Bacteria | 31883 |
| 1276 | Ga0501047_0001599 | 3300049581 | Bacteria | 22089 |
| 1277 | Ga0501048_0002638 | 3300049582 | Bacteria | 13711 |
| 1278 | Ga0501048_0017707 | 3300049582 | Bacteria | 5244 |
| 1279 | Ga0501048_0072503 | 3300049582 | Bacteria | 2431 |
| 1280 | Ga0501048_0354549 | 3300049582 | Bacteria | 1046 |
| 1281 | Ga0501067_0081014 | 3300049583 | Bacteria | 1800 |
| 1282 | Ga0501068_0034772 | 3300049584 | Bacteria | 3007 |
| 1283 | Ga0501068_0138533 | 3300049584 | Bacteria | 1525 |
| 1284 | Ga0501069_0027812 | 3300049585 | Bacteria | 3100 |
| 1285 | Ga0501071_0002438 | 3300049587 | Bacteria | 11282 |
| 1286 | Ga0501071_0012615 | 3300049587 | Bacteria | 5739 |
| 1287 | Ga0501071_0031098 | 3300049587 | Bacteria | 3781 |
| 1288 | Ga0501071_0049679 | 3300049587 | Bacteria | 3020 |
| 1289 | Ga0501071_0311503 | 3300049587 | Bacteria | 1194 |
| 1290 | Ga0501072_0012918 | 3300049588 | Bacteria | 6387 |
| 1291 | Ga0501072_0021227 | 3300049588 | Bacteria | 5036 |
| 1292 | Ga0501072_0116443 | 3300049588 | Bacteria | 2128 |
| 1293 | Ga0501072_0158252 | 3300049588 | Bacteria | 1807 |
| 1294 | Ga0501073_0008694 | 3300049589 | Bacteria | 7520 |
| 1295 | Ga0501073_0011036 | 3300049589 | Bacteria | 6608 |
| 1296 | Ga0501074_0000170 | 3300049590 | Bacteria | 34950 |
| 1297 | Ga0501074_0001420 | 3300049590 | Bacteria | 15953 |
| 1298 | Ga0501074_0055665 | 3300049590 | Bacteria | 2850 |
| 1299 | Ga0501074_0301794 | 3300049590 | Bacteria | 1137 |
| 1300 | Ga0501075_0011221 | 3300049591 | Bacteria | 6337 |
| 1301 | Ga0501075_0015397 | 3300049591 | Bacteria | 5488 |
| 1302 | Ga0501075_0026355 | 3300049591 | Bacteria | 4279 |
| 1303 | Ga0501075_0041003 | 3300049591 | Bacteria | 3469 |
| 1304 | Ga0501075_0065619 | 3300049591 | Bacteria | 2739 |
| 1305 | Ga0501076_0012000 | 3300049592 | Bacteria | 6473 |
| 1306 | Ga0501076_0057668 | 3300049592 | Bacteria | 3084 |
| 1307 | Ga0501076_0094097 | 3300049592 | Bacteria | 2412 |
| 1308 | Ga0501076_0228471 | 3300049592 | Bacteria | 1521 |
| 1309 | Ga0501224_000395 | 3300049664 | Bacteria | 5193 |
| 1310 | Ga0501227_010631 | 3300049665 | Bacteria | 1996 |
| 1311 | Ga0501235_000489 | 3300049669 | Bacteria | 7865 |
| 1312 | Ga0501242_002627 | 3300049674 | Bacteria | 1902 |
| 1313 | Ga0501249_005818 | 3300049679 | Bacteria | 2521 |
| 1314 | Ga0501257_002139 | 3300049686 | Bacteria | 4131 |
| 1315 | Ga0501259_002027 | 3300049688 | Bacteria | 3342 |
| 1316 | Ga0501221_003696 | 3300049704 | Bacteria | 2523 |
| 1317 | Ga0501225_0002679 | 3300049705 | Bacteria | 5465 |
| 1318 | Ga0501245_005742 | 3300049708 | Bacteria | 1722 |
| 1319 | Ga0501079_0036556 | 3300049741 | Bacteria | 3783 |
| 1320 | Ga0501079_0038392 | 3300049741 | Bacteria | 3692 |
| 1321 | Ga0501080_0392265 | 3300049742 | Bacteria | 1250 |
| 1322 | Ga0501081_0037043 | 3300049743 | Bacteria | 3328 |
| 1323 | Ga0501081_0043850 | 3300049743 | Bacteria | 3069 |
| 1324 | Ga0501081_0131954 | 3300049743 | Bacteria | 1785 |
| 1325 | Ga0501265_005612 | 3300049762 | Bacteria | 1449 |
| 1326 | Ga0501266_002342 | 3300049763 | Bacteria | 2397 |
| 1327 | Ga0501268_000019 | 3300049765 | Bacteria | 13906 |
| 1328 | Ga0501035_0059868 | 3300049822 | Bacteria | 3392 |
| 1329 | Ga0501035_0144838 | 3300049822 | Bacteria | 2064 |
| 1330 | Ga0501044_0004134 | 3300049823 | Bacteria | 16294 |
| 1331 | Ga0501044_0039975 | 3300049823 | Bacteria | 4890 |
| 1332 | Ga0501045_0006600 | 3300049824 | Bacteria | 8037 |
| 1333 | Ga0501045_0008757 | 3300049824 | Bacteria | 7060 |
| 1334 | Ga0501045_0010135 | 3300049824 | Bacteria | 6595 |
| 1335 | Ga0501045_0018522 | 3300049824 | Bacteria | 4954 |
| 1336 | Ga0501045_0065336 | 3300049824 | Bacteria | 2671 |
| 1337 | nmdc:mga03683_8391_c1 | 3300050489 | Bacteria | 3633 |
| 1338 | nmdc:mga00v17_14306_c1 | 3300050491 | Bacteria | 4425 |
| 1339 | nmdc:mga00v17_16045_c1 | 3300050491 | Bacteria | 4217 |
| 1340 | nmdc:mga00v17_219341_c1 | 3300050491 | Bacteria | 1231 |
| 1341 | nmdc:mga00v17_42763_c1 | 3300050491 | Bacteria | 2726 |
| 1342 | nmdc:mga0k408_119362_c1 | 3300050493 | Bacteria | 1561 |
| 1343 | nmdc:mga0k408_94540_c1 | 3300050493 | Bacteria | 1758 |
| 1344 | nmdc:mga06z11_23354_c1 | 3300050494 | Bacteria | 2904 |
| 1345 | nmdc:mga04h51_109408_c1 | 3300050495 | Bacteria | 1017 |
| 1346 | nmdc:mga04h51_41603_c1 | 3300050495 | Bacteria | 1503 |
| 1347 | nmdc:mga07m45_213376_c1 | 3300050496 | Bacteria | 1123 |
| 1348 | nmdc:mga07m45_29874_c1 | 3300050496 | Bacteria | 3017 |
| 1349 | nmdc:mga05p37_145626_c1 | 3300050507 | Bacteria | 2901 |
| 1350 | nmdc:mga05p37_157704_c1 | 3300050507 | Bacteria | 2773 |
| 1351 | nmdc:mga05p37_21631_c1 | 3300050507 | Bacteria | 7793 |
| 1352 | nmdc:mga05p37_42487_c1 | 3300050507 | Bacteria | 5585 |
| 1353 | nmdc:mga05p37_50499_c1 | 3300050507 | Bacteria | 5115 |
| 1354 | nmdc:mga05p37_53519_c1 | 3300050507 | Bacteria | 4963 |
| 1355 | nmdc:mga05p37_57686_c1 | 3300050507 | Bacteria | 4149 |
| 1356 | nmdc:mga05p37_637_c1 | 3300050507 | Bacteria | 38821 |
| 1357 | nmdc:mga05p37_691381_c1 | 3300050507 | Bacteria | 1135 |
| 1358 | nmdc:mga05p37_70179_c1 | 3300050507 | Bacteria | 4310 |
| 1359 | nmdc:mga05p37_83201_c1 | 3300050507 | Bacteria | 3942 |
| 1360 | nmdc:mga09592_14019_c1 | 3300050508 | Bacteria | 6544 |
| 1361 | nmdc:mga09592_62037_c1 | 3300050508 | Bacteria | 3162 |
| 1362 | nmdc:mga09592_8480_c1 | 3300050508 | Bacteria | 8358 |
| 1363 | nmdc:mga0qj67_12797_c1 | 3300050509 | Bacteria | 6328 |
| 1364 | nmdc:mga0qj67_128340_c1 | 3300050509 | Bacteria | 2052 |
| 1365 | nmdc:mga0qj67_195896_c1 | 3300050509 | Bacteria | 1642 |
| 1366 | nmdc:mga0qj67_34526_c1 | 3300050509 | Bacteria | 3951 |
| 1367 | nmdc:mga0qj67_76609_c1 | 3300050509 | Bacteria | 2675 |
| 1368 | nmdc:mga0qj67_7988_c1 | 3300050509 | Bacteria | 7824 |
| 1369 | nmdc:mga06r32_16603_c1 | 3300050510 | Bacteria | 6711 |
| 1370 | nmdc:mga06r32_26890_c1 | 3300050510 | Bacteria | 5370 |
| 1371 | nmdc:mga06r32_36418_c1 | 3300050510 | Bacteria | 4649 |
| 1372 | nmdc:mga06r32_59331_c1 | 3300050510 | Bacteria | 3679 |
| 1373 | nmdc:mga08y16_12492_c1 | 3300050511 | Bacteria | 6412 |
| 1374 | nmdc:mga08y16_169027_c1 | 3300050511 | Bacteria | 2271 |
| 1375 | nmdc:mga08y16_172800_c1 | 3300050511 | Bacteria | 2244 |
| 1376 | nmdc:mga08y16_203884_c1 | 3300050511 | Bacteria | 2049 |
| 1377 | nmdc:mga08y16_26376_c1 | 3300050511 | Bacteria | 6127 |
| 1378 | nmdc:mga08y16_27598_c1 | 3300050511 | Bacteria | 5982 |
| 1379 | nmdc:mga08y16_362934_c1 | 3300050511 | Bacteria | 1487 |
| 1380 | nmdc:mga08y16_44103_c1 | 3300050511 | Bacteria | 4672 |
| 1381 | nmdc:mga08y16_47457_c1 | 3300050511 | Bacteria | 4495 |
| 1382 | nmdc:mga08y16_558020_c1 | 3300050511 | Bacteria | 1158 |
| 1383 | nmdc:mga08y16_67155_c1 | 3300050511 | Bacteria | 3741 |
| 1384 | nmdc:mga08y16_675687_c1 | 3300050511 | Bacteria | 1035 |
| 1385 | nmdc:mga08y16_68368_c1 | 3300050511 | Bacteria | 3704 |
| 1386 | nmdc:mga08y16_702_c1 | 3300050511 | Bacteria | 31855 |
| 1387 | nmdc:mga0n895_118145_c1 | 3300050512 | Bacteria | 2671 |
| 1388 | nmdc:mga0n895_148770_c1 | 3300050512 | Bacteria | 2371 |
| 1389 | nmdc:mga0n895_150200_c1 | 3300050512 | Bacteria | 2360 |
| 1390 | nmdc:mga0n895_15479_c1 | 3300050512 | Bacteria | 6956 |
| 1391 | nmdc:mga0n895_205321_c1 | 3300050512 | Bacteria | 2001 |
| 1392 | nmdc:mga0n895_229667_c1 | 3300050512 | Bacteria | 1884 |
| 1393 | nmdc:mga0n895_553964_c1 | 3300050512 | Bacteria | 1155 |
| 1394 | nmdc:mga0n895_88331_c1 | 3300050512 | Bacteria | 3099 |
| 1395 | nmdc:mga0n895_9606_c1 | 3300050512 | Bacteria | 8475 |
| 1396 | nmdc:mga0rr50_104933_c1 | 3300050513 | Bacteria | 2227 |
| 1397 | nmdc:mga0rr50_190766_c1 | 3300050513 | Bacteria | 1679 |
| 1398 | nmdc:mga0rr50_340689_c1 | 3300050513 | Bacteria | 1260 |
| 1399 | nmdc:mga0rr50_423538_c1 | 3300050513 | Bacteria | 1126 |
| 1400 | nmdc:mga0rr50_48500_c1 | 3300050513 | Bacteria | 3139 |
| 1401 | nmdc:mga08x19_105455_c1 | 3300050514 | Bacteria | 1874 |
| 1402 | nmdc:mga08x19_31980_c1 | 3300050514 | Bacteria | 3314 |
| 1403 | nmdc:mga08x19_33934_c1 | 3300050514 | Bacteria | 3223 |
| 1404 | nmdc:mga08x19_43338_c1 | 3300050514 | Bacteria | 2871 |
| 1405 | nmdc:mga08x19_43721_c1 | 3300050514 | Bacteria | 2858 |
| 1406 | nmdc:mga08x19_78516_c1 | 3300050514 | Bacteria | 2164 |
| 1407 | nmdc:mga08x19_84089_c1 | 3300050514 | Bacteria | 2093 |
| 1408 | nmdc:mga08x19_87493_c1 | 3300050514 | Bacteria | 2053 |
| 1409 | nmdc:mga0a205_1106_c1 | 3300050515 | Bacteria | 22338 |
| 1410 | nmdc:mga0a205_135534_c1 | 3300050515 | Bacteria | 2363 |
| 1411 | nmdc:mga0a205_13906_c1 | 3300050515 | Bacteria | 7503 |
| 1412 | nmdc:mga0a205_17397_c1 | 3300050515 | Bacteria | 6738 |
| 1413 | nmdc:mga0a205_18643_c1 | 3300050515 | Bacteria | 6529 |
| 1414 | nmdc:mga0a205_222624_c1 | 3300050515 | Bacteria | 1772 |
| 1415 | nmdc:mga0a205_24671_c1 | 3300050515 | Bacteria | 5721 |
| 1416 | nmdc:mga0a205_38775_c1 | 3300050515 | Bacteria | 4585 |
| 1417 | nmdc:mga0a205_6498_c1 | 3300050515 | Bacteria | 10570 |
| 1418 | nmdc:mga0a205_90002_c1 | 3300050515 | Bacteria | 2966 |
| 1419 | Ga0495601_0003043 | 3300053077 | Bacteria | 9557 |
| 1420 | Ga0495601_0018008 | 3300053077 | Bacteria | 4294 |
| 1421 | Ga0495619_0030623 | 3300053085 | Bacteria | 3483 |
| 1422 | Ga0495619_0058525 | 3300053085 | Bacteria | 2558 |
| 1423 | Ga0495619_0211892 | 3300053085 | Bacteria | 1342 |
| 1424 | Ga0495619_0302159 | 3300053085 | Bacteria | 1108 |
| 1425 | Ga0500641_0002653 | 3300053096 | Bacteria | 6320 |
| 1426 | Ga0500555_051991 | 3300053103 | Bacteria | 1119 |
| 1427 | Ga0501084_0027681 | 3300054114 | Bacteria | 4736 |
| 1428 | Ga0501084_0037765 | 3300054114 | Bacteria | 4036 |
| 1429 | Ga0501084_0142649 | 3300054114 | Bacteria | 2017 |
| 1430 | Ga0590071_002832 | 3300059421 | Bacteria | 4339 |
| 1431 | Ga0501082_0002626 | 3300060353 | Bacteria | 15701 |
| 1432 | Ga0501082_0005515 | 3300060353 | Bacteria | 10982 |
| 1433 | Ga0501082_0164310 | 3300060353 | Bacteria | 1929 |
| 1434 | Ga0530510_0011669 | 3300061734 | Bacteria | 6166 |
| 1435 | Ga0530510_0011693 | 3300061734 | Bacteria | 6159 |
| 1436 | Ga0530510_0056166 | 3300061734 | Bacteria | 2844 |
| 1437 | Ga0530510_0077904 | 3300061734 | Bacteria | 2409 |
| 1438 | 2644505488 | 2643221690 | Bacteria | 4654705 |
| 1439 | 2739234869 | 2738543010 | Bacteria | 5583595 |
| 1440 | 2812363807 | 2811994880 | Bacteria | 4147780 |
| 1441 | Ga0207706_10001040 | |||
| 1442 | Ga0065712_10014421 | |||
| 1443 | Ga0065712_10072146 | |||
| 1444 | Ga0065712_10072991 | |||
| 1445 | Ga0065712_10075375 | |||
| 1446 | Ga0065715_10099686 | |||
| 1447 | Ga0065715_10124057 | |||
| 1448 | Ga0065715_10155456 | |||
| 1449 | Ga0065715_10156126 | |||
| 1450 | Ga0065715_10206215 | |||
| 1451 | Ga0065715_10230884 | |||
| 1452 | Ga0065715_10292306 | |||
| 1453 | Ga0065707_10093908 | |||
| 1454 | Ga0065707_10115964 | |||
| 1455 | Ga0065707_10252124 | |||
| 1456 | Ga0070658_10048484 | |||
| 1457 | Ga0070658_10183548 | |||
| 1458 | Ga0070683_100000006 | |||
| 1459 | Ga0070683_100013610 | |||
| 1460 | Ga0070683_100016793 | |||
| 1461 | Ga0070683_100044786 | |||
| 1462 | Ga0070683_100075972 | |||
| 1463 | Ga0070683_100100134 | |||
| 1464 | Ga0070683_100207291 | |||
| 1465 | Ga0070670_100004011 | |||
| 1466 | Ga0070670_100010057 | |||
| 1467 | Ga0070670_100024330 | |||
| 1468 | Ga0070670_100029763 | |||
| 1469 | Ga0070670_100068225 | |||
| 1470 | Ga0070670_100113896 | |||
| 1471 | Ga0070670_100122843 | |||
| 1472 | Ga0070670_100162656 | |||
| 1473 | Ga0070670_100162905 | |||
| 1474 | Ga0070670_100167968 | |||
| 1475 | Ga0070670_100184051 | |||
| 1476 | Ga0070677_10018146 | |||
| 1477 | Ga0070677_10027620 | |||
| 1478 | Ga0068869_100000218 | |||
| 1479 | Ga0068869_100000577 | |||
| 1480 | Ga0070666_10145847 | |||
| 1481 | Ga0070666_10354008 | |||
| 1482 | Ga0070680_100002912 | |||
| 1483 | Ga0070680_100022662 | |||
| 1484 | Ga0070680_100495431 | |||
| 1485 | Ga0070682_100001496 | |||
| 1486 | Ga0070682_100117615 | |||
| 1487 | Ga0068868_100008832 | |||
| 1488 | Ga0070660_100116839 | |||
| 1489 | Ga0070660_100481768 | |||
| 1490 | Ga0070689_100014965 | |||
| 1491 | Ga0070689_100025345 | |||
| 1492 | Ga0070689_100037287 | |||
| 1493 | Ga0070689_100040620 | |||
| 1494 | Ga0070689_100046098 | |||
| 1495 | Ga0070689_100171999 | |||
| 1496 | Ga0070689_100283481 | |||
| 1497 | Ga0070691_10000314 | |||
| 1498 | Ga0070687_100008412 | |||
| 1499 | Ga0070687_100011583 | |||
| 1500 | Ga0070687_100038834 | |||
| 1501 | Ga0070687_100071442 | |||
| 1502 | Ga0070687_100084157 | |||
| 1503 | Ga0070661_100142319 | |||
| 1504 | Ga0070661_100262094 | |||
| 1505 | Ga0070692_10151876 | |||
| 1506 | Ga0070692_10217802 | |||
| 1507 | Ga0070668_100047759 | |||
| 1508 | Ga0070668_100205676 | |||
| 1509 | Ga0070669_100000727 | |||
| 1510 | Ga0070669_100001162 | |||
| 1511 | Ga0070669_100030575 | |||
| 1512 | Ga0070669_100041004 | |||
| 1513 | Ga0070669_100059076 | |||
| 1514 | Ga0070669_100120478 | |||
| 1515 | Ga0070675_100000381 | |||
| 1516 | Ga0070675_100006889 | |||
| 1517 | Ga0070675_100007417 | |||
| 1518 | Ga0070675_100011685 | |||
| 1519 | Ga0070675_100044978 | |||
| 1520 | Ga0070675_100054872 | |||
| 1521 | Ga0070675_100108234 | |||
| 1522 | Ga0070675_100114836 | |||
| 1523 | Ga0070675_100138475 | |||
| 1524 | Ga0070675_100315484 | |||
| 1525 | Ga0070671_100051343 | |||
| 1526 | Ga0070671_100061907 | |||
| 1527 | Ga0070671_100070668 | |||
| 1528 | Ga0070671_100167696 | |||
| 1529 | Ga0070671_100326638 | |||
| 1530 | Ga0070674_100032698 | |||
| 1531 | Ga0070674_100100435 | |||
| 1532 | Ga0070673_100004563 | |||
| 1533 | Ga0070673_100034084 | |||
| 1534 | Ga0070673_100038123 | |||
| 1535 | Ga0070673_100045646 | |||
| 1536 | Ga0070673_100073125 | |||
| 1537 | Ga0070673_100098851 | |||
| 1538 | Ga0070673_100115216 | |||
| 1539 | Ga0070673_100211335 | |||
| 1540 | Ga0070673_100230432 | |||
| 1541 | Ga0070688_100093542 | |||
| 1542 | Ga0070688_100165880 | |||
| 1543 | Ga0070688_100201010 | |||
| 1544 | Ga0070688_100293860 | |||
| 1545 | Ga0070659_100009356 | |||
| 1546 | Ga0070667_100080425 | |||
| 1547 | Ga0070667_100088042 | |||
| 1548 | Ga0070667_100113410 | |||
| 1549 | Ga0070667_100287826 | |||
| 1550 | Ga0070667_100341854 | |||
| 1551 | Ga0070703_10000330 | |||
| 1552 | Ga0070703_10041081 | |||
| 1553 | Ga0070709_10001985 | |||
| 1554 | Ga0070709_10261763 | |||
| 1555 | Ga0070714_100039506 | |||
| 1556 | Ga0070714_100067256 | |||
| 1557 | Ga0070713_100000180 | |||
| 1558 | Ga0070713_100001143 | |||
| 1559 | Ga0070713_100087678 | |||
| 1560 | Ga0070710_10020002 | |||
| 1561 | Ga0070710_10021420 | |||
| 1562 | Ga0070710_10041425 | |||
| 1563 | Ga0070710_10101273 | |||
| 1564 | Ga0070701_10012910 | |||
| 1565 | Ga0070701_10101510 | |||
| 1566 | Ga0070711_100000441 | |||
| 1567 | Ga0070711_100000766 | |||
| 1568 | Ga0070711_100014055 | |||
| 1569 | Ga0070711_100356552 | |||
| 1570 | Ga0070705_100041701 | |||
| 1571 | Ga0070705_100099408 | |||
| 1572 | Ga0070700_100045999 | |||
| 1573 | Ga0070700_100111593 | |||
| 1574 | Ga0070694_100000615 | |||
| 1575 | Ga0070694_100005219 | |||
| 1576 | Ga0070694_100085988 | |||
| 1577 | Ga0070694_100248184 | |||
| 1578 | Ga0070708_100011899 | |||
| 1579 | Ga0070708_100014254 | |||
| 1580 | Ga0070708_100027425 | |||
| 1581 | Ga0070708_100029858 | |||
| 1582 | Ga0070708_100071722 | |||
| 1583 | Ga0070708_100089935 | |||
| 1584 | Ga0070708_100205648 | |||
| 1585 | Ga0070663_100018575 | |||
| 1586 | Ga0070663_100089958 | |||
| 1587 | Ga0070663_100102817 | |||
| 1588 | Ga0070663_100213158 | |||
| 1589 | Ga0070678_100022862 | |||
| 1590 | Ga0070678_100063645 | |||
| 1591 | Ga0070678_100066299 | |||
| 1592 | Ga0070662_100026960 | |||
| 1593 | Ga0070662_100043799 | |||
| 1594 | Ga0070662_100078547 | |||
| 1595 | Ga0070662_100214268 | |||
| 1596 | Ga0070681_10000728 | |||
| 1597 | Ga0070681_10020945 | |||
| 1598 | Ga0070681_10028064 | |||
| 1599 | Ga0070681_10069961 | |||
| 1600 | Ga0070681_10158960 | |||
| 1601 | Ga0068867_100007333 | |||
| 1602 | Ga0068867_100017285 | |||
| 1603 | Ga0068867_100048895 | |||
| 1604 | Ga0068867_100050940 | |||
| 1605 | Ga0068867_100053894 | |||
| 1606 | Ga0070685_10028111 | |||
| 1607 | Ga0070685_10297433 | |||
| 1608 | Ga0070706_100000202 | |||
| 1609 | Ga0070706_100007119 | |||
| 1610 | Ga0070706_100010158 | |||
| 1611 | Ga0070706_100019466 | |||
| 1612 | Ga0070706_100040954 | |||
| 1613 | Ga0070706_100041092 | |||
| 1614 | Ga0070707_100003644 | |||
| 1615 | Ga0070707_100020286 | |||
| 1616 | Ga0070707_100158214 | |||
| 1617 | Ga0070707_100161919 | |||
| 1618 | Ga0070707_100208418 | |||
| 1619 | Ga0070698_100004310 | |||
| 1620 | Ga0070698_100011109 | |||
| 1621 | Ga0070698_100027551 | |||
| 1622 | Ga0070698_100099361 | |||
| 1623 | Ga0070698_100116389 | |||
| 1624 | Ga0070698_100147347 | |||
| 1625 | Ga0070698_100204730 | |||
| 1626 | Ga0070698_100284782 | |||
| 1627 | Ga0070699_100000004 | |||
| 1628 | Ga0070699_100001426 | |||
| 1629 | Ga0070699_100010867 | |||
| 1630 | Ga0070699_100036883 | |||
| 1631 | Ga0070699_100381505 | |||
| 1632 | Ga0070699_100408030 | |||
| 1633 | Ga0070679_100011820 | |||
| 1634 | Ga0070679_100031359 | |||
| 1635 | Ga0070684_100000050 | |||
| 1636 | Ga0070684_100013274 | |||
| 1637 | Ga0070684_100016045 | |||
| 1638 | Ga0070684_100035511 | |||
| 1639 | Ga0070684_100076370 | |||
| 1640 | Ga0070684_100139403 | |||
| 1641 | Ga0070697_100001931 | |||
| 1642 | Ga0070697_100013572 | |||
| 1643 | Ga0070697_100033514 | |||
| 1644 | Ga0070697_100239181 | |||
| 1645 | Ga0070697_100470523 | |||
| 1646 | Ga0068853_100012199 | |||
| 1647 | Ga0068853_100128331 | |||
| 1648 | Ga0068853_100348584 | |||
| 1649 | Ga0070672_100009215 | |||
| 1650 | Ga0070672_100032476 | |||
| 1651 | Ga0070672_100080058 | |||
| 1652 | Ga0070672_100105623 | |||
| 1653 | Ga0070672_100224480 | |||
| 1654 | Ga0070672_100311020 | |||
| 1655 | Ga0070686_100028617 | |||
| 1656 | Ga0070686_100037127 | |||
| 1657 | Ga0070686_100050598 | |||
| 1658 | Ga0070686_100087721 | |||
| 1659 | Ga0070695_100000829 | |||
| 1660 | Ga0070695_100003101 | |||
| 1661 | Ga0070695_100014410 | |||
| 1662 | Ga0070695_100038480 | |||
| 1663 | Ga0070695_100080249 | |||
| 1664 | Ga0070695_100092817 | |||
| 1665 | Ga0070695_100204806 | |||
| 1666 | Ga0070695_100264604 | |||
| 1667 | Ga0070696_100002254 | |||
| 1668 | Ga0070696_100004072 | |||
| 1669 | Ga0070696_100011043 | |||
| 1670 | Ga0070696_100112484 | |||
| 1671 | Ga0070696_100258281 | |||
| 1672 | Ga0070693_100000200 | |||
| 1673 | Ga0070693_100002389 | |||
| 1674 | Ga0070693_100007875 | |||
| 1675 | Ga0070693_100021499 | |||
| 1676 | Ga0070693_100033872 | |||
| 1677 | Ga0070665_100006550 | |||
| 1678 | Ga0070665_100014573 | |||
| 1679 | Ga0070665_100041691 | |||
| 1680 | Ga0070665_100075674 | |||
| 1681 | Ga0070665_100077027 | |||
| 1682 | Ga0070665_100173103 | |||
| 1683 | Ga0070665_100182862 | |||
| 1684 | Ga0070665_100344100 | |||
| 1685 | Ga0070704_100001732 | |||
| 1686 | Ga0070704_100004385 | |||
| 1687 | Ga0070704_100020154 | |||
| 1688 | Ga0070704_100105150 | |||
| 1689 | Ga0070704_100161598 | |||
| 1690 | Ga0070704_100414908 | |||
| 1691 | Ga0070704_100451376 | |||
| 1692 | Ga0070704_100463580 | |||
| 1693 | Ga0068855_100012041 | |||
| 1694 | Ga0068855_100067900 | |||
| 1695 | Ga0068855_100074669 | |||
| 1696 | Ga0068855_100112834 | |||
| 1697 | Ga0068855_100434916 | |||
| 1698 | Ga0070664_100003381 | |||
| 1699 | Ga0070664_100003507 | |||
| 1700 | Ga0070664_100021225 | |||
| 1701 | Ga0070664_100021878 | |||
| 1702 | Ga0070664_100097400 | |||
| 1703 | Ga0070664_100152851 | |||
| 1704 | Ga0068857_100003973 | |||
| 1705 | Ga0068857_100007741 | |||
| 1706 | Ga0068857_100041896 | |||
| 1707 | Ga0068857_100084299 | |||
| 1708 | Ga0068854_100108878 | |||
| 1709 | Ga0068856_100011523 | |||
| 1710 | Ga0068856_100283926 | |||
| 1711 | Ga0070702_100012237 | |||
| 1712 | Ga0068852_100013619 | |||
| 1713 | Ga0068852_100251942 | |||
| 1714 | Ga0068852_100289462 | |||
| 1715 | Ga0068859_100077070 | |||
| 1716 | Ga0068859_100150035 | |||
| 1717 | Ga0068864_100151348 | |||
| 1718 | Ga0068864_100157187 | |||
| 1719 | Ga0068864_100192775 | |||
| 1720 | Ga0068864_100351643 | |||
| 1721 | Ga0068864_100566179 | |||
| 1722 | Ga0068866_10042715 | |||
| 1723 | Ga0068866_10043578 | |||
| 1724 | Ga0068866_10059890 | |||
| 1725 | Ga0068861_100008754 | |||
| 1726 | Ga0068861_100013064 | |||
| 1727 | Ga0068861_100025306 | |||
| 1728 | Ga0068851_10018515 | |||
| 1729 | Ga0068851_10031550 | |||
| 1730 | Ga0068851_10040395 | |||
| 1731 | Ga0068851_10134187 | |||
| 1732 | Ga0068863_100362945 | |||
| 1733 | Ga0068858_100003039 | |||
| 1734 | Ga0068858_100022792 | |||
| 1735 | Ga0068858_100050471 | |||
| 1736 | Ga0068858_100086247 | |||
| 1737 | Ga0068860_100038707 | |||
| 1738 | Ga0068860_100079179 | |||
| 1739 | Ga0068860_100111078 | |||
| 1740 | Ga0068860_100116371 | |||
| 1741 | Ga0068862_100013068 | |||
| 1742 | Ga0081538_10003367 | |||
| 1743 | Ga0081538_10016220 | |||
| 1744 | Ga0081540_1033344 | |||
| 1745 | Ga0070717_10000390 | |||
| 1746 | Ga0070717_10015105 | |||
| 1747 | Ga0075365_10062870 | |||
| 1748 | Ga0075365_10097328 | |||
| 1749 | Ga0075368_10029364 | |||
| 1750 | Ga0075363_100023814 | |||
| 1751 | Ga0075364_10002176 | |||
| 1752 | Ga0075364_10007283 | |||
| 1753 | Ga0075364_10091079 | |||
| 1754 | Ga0075364_10113223 | |||
| 1755 | Ga0070715_10003425 | |||
| 1756 | Ga0070716_100024832 | |||
| 1757 | Ga0070716_100255758 | |||
| 1758 | Ga0070712_100000424 | |||
| 1759 | Ga0070712_100000774 | |||
| 1760 | Ga0070712_100042745 | |||
| 1761 | Ga0070712_100195630 | |||
| 1762 | Ga0075362_10003871 | |||
| 1763 | Ga0075362_10018891 | |||
| 1764 | Ga0075367_10036654 | |||
| 1765 | Ga0075367_10083562 | |||
| 1766 | Ga0075367_10192750 | |||
| 1767 | Ga0075366_10016496 | |||
| 1768 | Ga0075366_10037914 | |||
| 1769 | Ga0075366_10038115 | |||
| 1770 | Ga0075366_10041787 | |||
| 1771 | Ga0075366_10143162 | |||
| 1772 | Ga0097621_100051496 | |||
| 1773 | Ga0097621_100082717 | |||
| 1774 | Ga0097621_100090730 | |||
| 1775 | Ga0097621_100115283 | |||
| 1776 | Ga0097621_100285383 | |||
| 1777 | Ga0097621_100323272 | |||
| 1778 | Ga0097621_100529668 | |||
| 1779 | Ga0075370_10042865 | |||
| 1780 | Ga0075370_10046599 | |||
| 1781 | Ga0068871_100024736 | |||
| 1782 | Ga0068871_100055534 | |||
| 1783 | Ga0075428_100004291 | |||
| 1784 | Ga0075428_100005484 | |||
| 1785 | Ga0075428_100012404 | |||
| 1786 | Ga0075428_100012869 | |||
| 1787 | Ga0075428_100033650 | |||
| 1788 | Ga0075428_100066771 | |||
| 1789 | Ga0075428_100263180 | |||
| 1790 | Ga0075428_100378823 | |||
| 1791 | Ga0075428_100641544 | |||
| 1792 | Ga0075430_100003672 | |||
| 1793 | Ga0075430_100003798 | |||
| 1794 | Ga0075430_100025288 | |||
| 1795 | Ga0075430_100035079 | |||
| 1796 | Ga0075430_100127816 | |||
| 1797 | Ga0075430_100259642 | |||
| 1798 | Ga0075430_100306835 | |||
| 1799 | Ga0075431_100004325 | |||
| 1800 | Ga0075431_100024159 | |||
| 1801 | Ga0075431_100024753 | |||
| 1802 | Ga0075431_100030652 | |||
| 1803 | Ga0075431_100053177 | |||
| 1804 | Ga0075431_100105335 | |||
| 1805 | Ga0075433_10000360 | |||
| 1806 | Ga0075433_10030890 | |||
| 1807 | Ga0075433_10035332 | |||
| 1808 | Ga0075433_10074249 | |||
| 1809 | Ga0075433_10093298 | |||
| 1810 | Ga0075433_10107478 | |||
| 1811 | Ga0075433_10122773 | |||
| 1812 | Ga0075433_10199807 | |||
| 1813 | Ga0075434_100001498 | |||
| 1814 | Ga0075434_100027710 | |||
| 1815 | Ga0075434_100106316 | |||
| 1816 | Ga0075434_100135523 | |||
| 1817 | Ga0075434_100145485 | |||
| 1818 | Ga0075434_100337988 | |||
| 1819 | Ga0075429_100006247 | |||
| 1820 | Ga0075429_100010163 | |||
| 1821 | Ga0075429_100048104 | |||
| 1822 | Ga0075429_100053555 | |||
| 1823 | Ga0075429_100082094 | |||
| 1824 | Ga0068865_100001348 | |||
| 1825 | Ga0068865_100009144 | |||
| 1826 | Ga0068865_100062956 | |||
| 1827 | Ga0068865_100072957 | |||
| 1828 | Ga0075436_100005387 | |||
| 1829 | Ga0075436_100006638 | |||
| 1830 | Ga0075436_100006643 | |||
| 1831 | Ga0075436_100040179 | |||
| 1832 | Ga0075436_100045696 | |||
| 1833 | Ga0075436_100124095 | |||
| 1834 | Ga0075436_100130323 | |||
| 1835 | Ga0097620_100077072 | |||
| 1836 | Ga0097620_100150038 | |||
| 1837 | Ga0097620_100585895 | |||
| 1838 | Ga0075435_100004674 | |||
| 1839 | Ga0075435_100009374 | |||
| 1840 | Ga0075435_100013737 | |||
| 1841 | Ga0075435_100047319 | |||
| 1842 | Ga0075435_100053607 | |||
| 1843 | Ga0075435_100096475 | |||
| 1844 | Ga0075435_100136809 | |||
| 1845 | Ga0075435_100185286 | |||
| 1846 | Ga0075435_100202536 | |||
| 1847 | Ga0099795_10000023 | |||
| 1848 | Ga0099795_10010705 | |||
| 1849 | Ga0105240_10006446 | |||
| 1850 | Ga0105240_10024898 | |||
| 1851 | Ga0105240_10123688 | |||
| 1852 | Ga0105240_10145574 | |||
| 1853 | Ga0105240_10246694 | |||
| 1854 | Ga0105240_10295827 | |||
| 1855 | Ga0105240_10555042 | |||
| 1856 | Ga0111539_10002591 | |||
| 1857 | Ga0111539_10002914 | |||
| 1858 | Ga0111539_10003491 | |||
| 1859 | Ga0111539_10003577 | |||
| 1860 | Ga0111539_10035761 | |||
| 1861 | Ga0111539_10041050 | |||
| 1862 | Ga0111539_10114724 | |||
| 1863 | Ga0111539_10195054 | |||
| 1864 | Ga0111539_10209579 | |||
| 1865 | Ga0111539_10223327 | |||
| 1866 | Ga0111539_10238357 | |||
| 1867 | Ga0111539_10247428 | |||
| 1868 | Ga0105245_10016935 | |||
| 1869 | Ga0105245_10059544 | |||
| 1870 | Ga0105245_10075935 | |||
| 1871 | Ga0105245_10324448 | |||
| 1872 | Ga0105247_10038134 | |||
| 1873 | Ga0105247_10189820 | |||
| 1874 | Ga0114129_10002266 | |||
| 1875 | Ga0114129_10005113 | |||
| 1876 | Ga0114129_10008691 | |||
| 1877 | Ga0114129_10008970 | |||
| 1878 | Ga0114129_10009206 | |||
| 1879 | Ga0114129_10017434 | |||
| 1880 | Ga0114129_10022135 | |||
| 1881 | Ga0114129_10024405 | |||
| 1882 | Ga0114129_10033843 | |||
| 1883 | Ga0114129_10061464 | |||
| 1884 | Ga0114129_10063642 | |||
| 1885 | Ga0114129_10089738 | |||
| 1886 | Ga0114129_10099293 | |||
| 1887 | Ga0114129_10099321 | |||
| 1888 | Ga0114129_10253945 | |||
| 1889 | Ga0114129_10317719 | |||
| 1890 | Ga0114129_10599126 | |||
| 1891 | Ga0114129_10830752 | |||
| 1892 | Ga0105243_10003648 | |||
| 1893 | Ga0105243_10205728 | |||
| 1894 | Ga0105241_10144245 | |||
| 1895 | Ga0105242_10012753 | |||
| 1896 | Ga0105242_10026761 | |||
| 1897 | Ga0105242_10045264 | |||
| 1898 | Ga0105242_10082056 | |||
| 1899 | Ga0105248_10008828 | |||
| 1900 | Ga0105248_10023973 | |||
| 1901 | Ga0105248_10048444 | |||
| 1902 | Ga0105248_10048781 | |||
| 1903 | Ga0105248_10055879 | |||
| 1904 | Ga0105248_10081517 | |||
| 1905 | Ga0105248_10103067 | |||
| 1906 | Ga0105248_10131427 | |||
| 1907 | Ga0105248_10133520 | |||
| 1908 | Ga0105248_10192908 | |||
| 1909 | Ga0105248_10231072 | |||
| 1910 | Ga0105248_10250813 | |||
| 1911 | Ga0105248_10396229 | |||
| 1912 | Ga0105237_10207919 | |||
| 1913 | Ga0105237_10211993 | |||
| 1914 | Ga0105238_10003340 | |||
| 1915 | Ga0105238_10063520 | |||
| 1916 | Ga0105238_10099977 | |||
| 1917 | Ga0105249_10000517 | |||
| 1918 | Ga0105249_10006590 | |||
| 1919 | Ga0105249_10026830 | |||
| 1920 | Ga0105249_10387486 | |||
| 1921 | Ga0105239_10199885 | |||
| 1922 | Ga0105239_10385325 | |||
| 1923 | Ga0105239_10465736 | |||
| 1924 | Ga0105246_10023137 | |||
| 1925 | Ga0105246_10108883 | |||
| 1926 | Ga0105246_10176615 | |||
| 1927 | Ga0105246_10215681 | |||
| 1928 | Ga0105246_10437352 | |||
| 1929 | Ga0157373_10114747 | |||
| 1930 | Ga0157370_10254091 | |||
| 1931 | Ga0157369_10006460 | |||
| 1932 | Ga0157369_10104725 | |||
| 1933 | Ga0157369_10256971 | |||
| 1934 | Ga0157374_10001514 | |||
| 1935 | Ga0157374_10043990 | |||
| 1936 | Ga0157374_10144317 | |||
| 1937 | Ga0157374_10231882 | |||
| 1938 | Ga0157374_10272023 | |||
| 1939 | Ga0157378_10033718 | |||
| 1940 | Ga0157378_10085087 | |||
| 1941 | Ga0157378_10105791 | |||
| 1942 | Ga0157378_10282175 | |||
| 1943 | Ga0163162_10000370 | |||
| 1944 | Ga0163162_10028261 | |||
| 1945 | Ga0163162_10086069 | |||
| 1946 | Ga0163162_10088425 | |||
| 1947 | Ga0157372_10002177 | |||
| 1948 | Ga0157372_10030737 | |||
| 1949 | Ga0157372_10030751 | |||
| 1950 | Ga0157372_10036897 | |||
| 1951 | Ga0157372_10070222 | |||
| 1952 | Ga0157372_10107133 | |||
| 1953 | Ga0157372_10122026 | |||
| 1954 | Ga0157372_10419456 | |||
| 1955 | Ga0157372_10433199 | |||
| 1956 | Ga0157372_10468468 | |||
| 1957 | Ga0157375_10052365 | |||
| 1958 | Ga0157375_10119915 | |||
| 1959 | Ga0157375_10132161 | |||
| 1960 | Ga0157375_10236927 | |||
| 1961 | Ga0157375_10247759 | |||
| 1962 | Ga0157375_10329808 | |||
| 1963 | Ga0163163_10010921 | |||
| 1964 | Ga0163163_10115060 | |||
| 1965 | Ga0163163_10118338 | |||
| 1966 | Ga0163163_10200709 | |||
| 1967 | Ga0163163_10299083 | |||
| 1968 | Ga0163163_10305849 | |||
| 1969 | Ga0163163_10543909 | |||
| 1970 | Ga0163163_10578207 | |||
| 1971 | Ga0163163_10634304 | |||
| 1972 | Ga0157380_10022910 | |||
| 1973 | Ga0157380_10060343 | |||
| 1974 | Ga0157380_10086528 | |||
| 1975 | Ga0157380_10137048 | |||
| 1976 | Ga0157380_10213216 | |||
| 1977 | Ga0157380_10300222 | |||
| 1978 | Ga0157380_10392081 | |||
| 1979 | Ga0157377_10178801 | |||
| 1980 | Ga0157377_10190607 | |||
| 1981 | Ga0157377_10222560 | |||
| 1982 | Ga0157379_10026737 | |||
| 1983 | Ga0157379_10027489 | |||
| 1984 | Ga0157379_10040371 | |||
| 1985 | Ga0157379_10053135 | |||
| 1986 | Ga0157379_10151788 | |||
| 1987 | Ga0157376_10003558 | |||
| 1988 | Ga0157376_10043656 | |||
| 1989 | Ga0157376_10079268 | |||
| 1990 | Ga0157376_10254669 | |||
| 1991 | Ga0163161_10003256 | |||
| 1992 | Ga0163161_10476846 | |||
| 1993 | Ga0224570_100995 | |||
| 1994 | Ga0224569_102012 | |||
| 1995 | Ga0228598_1001375 | |||
| 1996 | Ga0207697_10000143 | |||
| 1997 | Ga0207697_10019067 | |||
| 1998 | Ga0207656_10013386 | |||
| 1999 | Ga0207656_10014207 | |||
| 2000 | Ga0207653_10000071 | |||
| 2001 | Ga0207653_10026112 | |||
| 2002 | Ga0207682_10007365 | |||
| 2003 | Ga0207682_10015587 | |||
| 2004 | Ga0207682_10031726 | |||
| 2005 | Ga0207682_10064833 | |||
| 2006 | Ga0207692_10006630 | |||
| 2007 | Ga0207642_10067898 | |||
| 2008 | Ga0207710_10053314 | |||
| 2009 | Ga0207710_10112232 | |||
| 2010 | Ga0207688_10002686 | |||
| 2011 | Ga0207680_10124411 | |||
| 2012 | Ga0207680_10221208 | |||
| 2013 | Ga0207680_10289861 | |||
| 2014 | Ga0207647_10031204 | |||
| 2015 | Ga0207685_10018069 | |||
| 2016 | Ga0207699_10004012 | |||
| 2017 | Ga0207699_10006533 | |||
| 2018 | Ga0207699_10031968 | |||
| 2019 | Ga0207699_10092028 | |||
| 2020 | Ga0207699_10174747 | |||
| 2021 | Ga0207645_10000743 | |||
| 2022 | Ga0207645_10022325 | |||
| 2023 | Ga0207645_10037601 | |||
| 2024 | Ga0207645_10038845 | |||
| 2025 | Ga0207643_10004131 | |||
| 2026 | Ga0207643_10085356 | |||
| 2027 | Ga0207705_10068020 | |||
| 2028 | Ga0207705_10143069 | |||
| 2029 | Ga0207684_10000204 | |||
| 2030 | Ga0207684_10007319 | |||
| 2031 | Ga0207684_10008255 | |||
| 2032 | Ga0207684_10036722 | |||
| 2033 | Ga0207654_10051141 | |||
| 2034 | Ga0207654_10152143 | |||
| 2035 | Ga0207707_10004652 | |||
| 2036 | Ga0207707_10024623 | |||
| 2037 | Ga0207707_10034139 | |||
| 2038 | Ga0207707_10174739 | |||
| 2039 | Ga0207707_10233744 | |||
| 2040 | Ga0207695_10058666 | |||
| 2041 | Ga0207695_10068686 | |||
| 2042 | Ga0207695_10072281 | |||
| 2043 | Ga0207695_10142339 | |||
| 2044 | Ga0207671_10240292 | |||
| 2045 | Ga0207693_10000777 | |||
| 2046 | Ga0207693_10001047 | |||
| 2047 | Ga0207693_10002215 | |||
| 2048 | Ga0207693_10259159 | |||
| 2049 | Ga0207663_10001539 | |||
| 2050 | Ga0207663_10019520 | |||
| 2051 | Ga0207663_10033180 | |||
| 2052 | Ga0207663_10075561 | |||
| 2053 | Ga0207663_10090220 | |||
| 2054 | Ga0207663_10148199 | |||
| 2055 | Ga0207660_10000001 | |||
| 2056 | Ga0207660_10073058 | |||
| 2057 | Ga0207660_10189635 | |||
| 2058 | Ga0207662_10006311 | |||
| 2059 | Ga0207662_10015678 | |||
| 2060 | Ga0207662_10053683 | |||
| 2061 | Ga0207662_10089006 | |||
| 2062 | Ga0207662_10195939 | |||
| 2063 | Ga0207657_10413974 | |||
| 2064 | Ga0207649_10015199 | |||
| 2065 | Ga0207649_10034085 | |||
| 2066 | Ga0207649_10045422 | |||
| 2067 | Ga0207652_10008444 | |||
| 2068 | Ga0207652_10011006 | |||
| 2069 | Ga0207646_10003702 | |||
| 2070 | Ga0207646_10008238 | |||
| 2071 | Ga0207646_10026427 | |||
| 2072 | Ga0207646_10029750 | |||
| 2073 | Ga0207646_10043474 | |||
| 2074 | Ga0207646_10048209 | |||
| 2075 | Ga0207646_10175685 | |||
| 2076 | Ga0207646_10383774 | |||
| 2077 | Ga0207681_10007137 | |||
| 2078 | Ga0207681_10014269 | |||
| 2079 | Ga0207681_10014326 | |||
| 2080 | Ga0207681_10025386 | |||
| 2081 | Ga0207681_10053026 | |||
| 2082 | Ga0207681_10054804 | |||
| 2083 | Ga0207681_10067554 | |||
| 2084 | Ga0207681_10112633 | |||
| 2085 | Ga0207681_10243272 | |||
| 2086 | Ga0207681_10285426 | |||
| 2087 | Ga0207694_10003999 | |||
| 2088 | Ga0207650_10048321 | |||
| 2089 | Ga0207650_10063070 | |||
| 2090 | Ga0207650_10109336 | |||
| 2091 | Ga0207650_10116326 | |||
| 2092 | Ga0207650_10134105 | |||
| 2093 | Ga0207659_10000630 | |||
| 2094 | Ga0207659_10038129 | |||
| 2095 | Ga0207659_10101223 | |||
| 2096 | Ga0207659_10164011 | |||
| 2097 | Ga0207659_10347581 | |||
| 2098 | Ga0207687_10028103 | |||
| 2099 | Ga0207687_10032036 | |||
| 2100 | Ga0207687_10043623 | |||
| 2101 | Ga0207687_10111343 | |||
| 2102 | Ga0207700_10000198 | |||
| 2103 | Ga0207700_10005511 | |||
| 2104 | Ga0207700_10008571 | |||
| 2105 | Ga0207700_10269145 | |||
| 2106 | Ga0207664_10060517 | |||
| 2107 | Ga0207664_10086379 | |||
| 2108 | Ga0207664_10455404 | |||
| 2109 | Ga0207644_10040792 | |||
| 2110 | Ga0207644_10053279 | |||
| 2111 | Ga0207644_10152164 | |||
| 2112 | Ga0207644_10334703 | |||
| 2113 | Ga0207690_10105343 | |||
| 2114 | Ga0207690_10330747 | |||
| 2115 | Ga0207706_10002236 | |||
| 2116 | Ga0207706_10002730 | |||
| 2117 | Ga0207706_10059957 | |||
| 2118 | Ga0207706_10108239 | |||
| 2119 | Ga0207706_10117177 | |||
| 2120 | Ga0207706_10194848 | |||
| 2121 | Ga0207706_10209096 | |||
| 2122 | Ga0207706_10244522 | |||
| 2123 | Ga0207706_10256649 | |||
| 2124 | Ga0207706_10530389 | |||
| 2125 | Ga0207686_10006648 | |||
| 2126 | Ga0207686_10015467 | |||
| 2127 | Ga0207686_10026778 | |||
| 2128 | Ga0207670_10016027 | |||
| 2129 | Ga0207670_10029275 | |||
| 2130 | Ga0207670_10035828 | |||
| 2131 | Ga0207670_10061191 | |||
| 2132 | Ga0207670_10148669 | |||
| 2133 | Ga0207669_10002051 | |||
| 2134 | Ga0207669_10043725 | |||
| 2135 | Ga0207669_10067593 | |||
| 2136 | Ga0207669_10093338 | |||
| 2137 | Ga0207669_10138684 | |||
| 2138 | Ga0207669_10233492 | |||
| 2139 | Ga0207704_10012306 | |||
| 2140 | Ga0207704_10045869 | |||
| 2141 | Ga0207704_10076603 | |||
| 2142 | Ga0207665_10000973 | |||
| 2143 | Ga0207665_10011628 | |||
| 2144 | Ga0207665_10011723 | |||
| 2145 | Ga0207665_10026562 | |||
| 2146 | Ga0207665_10041165 | |||
| 2147 | Ga0207691_10002031 | |||
| 2148 | Ga0207691_10003473 | |||
| 2149 | Ga0207691_10008843 | |||
| 2150 | Ga0207691_10010771 | |||
| 2151 | Ga0207691_10015894 | |||
| 2152 | Ga0207691_10015943 | |||
| 2153 | Ga0207691_10035125 | |||
| 2154 | Ga0207691_10041496 | |||
| 2155 | Ga0207691_10093370 | |||
| 2156 | Ga0207691_10227323 | |||
| 2157 | Ga0207711_10029360 | |||
| 2158 | Ga0207711_10038116 | |||
| 2159 | Ga0207711_10056655 | |||
| 2160 | Ga0207711_10100293 | |||
| 2161 | Ga0207711_10133263 | |||
| 2162 | Ga0207711_10141500 | |||
| 2163 | Ga0207711_10145829 | |||
| 2164 | Ga0207689_10000700 | |||
| 2165 | Ga0207689_10007432 | |||
| 2166 | Ga0207689_10035841 | |||
| 2167 | Ga0207689_10059254 | |||
| 2168 | Ga0207689_10119866 | |||
| 2169 | Ga0207689_10131527 | |||
| 2170 | Ga0207661_10000011 | |||
| 2171 | Ga0207661_10002181 | |||
| 2172 | Ga0207661_10023578 | |||
| 2173 | Ga0207661_10034991 | |||
| 2174 | Ga0207661_10094573 | |||
| 2175 | Ga0207661_10159818 | |||
| 2176 | Ga0207661_10234286 | |||
| 2177 | Ga0207661_10415186 | |||
| 2178 | Ga0207679_10009204 | |||
| 2179 | Ga0207679_10066419 | |||
| 2180 | Ga0207679_10097255 | |||
| 2181 | Ga0207679_10099555 | |||
| 2182 | Ga0207679_10292977 | |||
| 2183 | Ga0207679_10313648 | |||
| 2184 | Ga0207667_10044703 | |||
| 2185 | Ga0207667_10093213 | |||
| 2186 | Ga0207667_10251000 | |||
| 2187 | Ga0207651_10007002 | |||
| 2188 | Ga0207651_10009512 | |||
| 2189 | Ga0207651_10033799 | |||
| 2190 | Ga0207651_10049240 | |||
| 2191 | Ga0207651_10051872 | |||
| 2192 | Ga0207651_10066670 | |||
| 2193 | Ga0207651_10079632 | |||
| 2194 | Ga0207651_10084363 | |||
| 2195 | Ga0207651_10111691 | |||
| 2196 | Ga0207651_10137866 | |||
| 2197 | Ga0207712_10005715 | |||
| 2198 | Ga0207712_10142833 | |||
| 2199 | Ga0207712_10172565 | |||
| 2200 | Ga0207668_10048164 | |||
| 2201 | Ga0207668_10163645 | |||
| 2202 | Ga0207658_10317366 | |||
| 2203 | Ga0207677_10018985 | |||
| 2204 | Ga0207677_10063791 | |||
| 2205 | Ga0207677_10203712 | |||
| 2206 | Ga0207677_10286845 | |||
| 2207 | Ga0207677_10404429 | |||
| 2208 | Ga0207703_10035997 | |||
| 2209 | Ga0207703_10039860 | |||
| 2210 | Ga0207703_10050482 | |||
| 2211 | Ga0207703_10131114 | |||
| 2212 | Ga0207703_10141663 | |||
| 2213 | Ga0207703_10408894 | |||
| 2214 | Ga0207639_10056107 | |||
| 2215 | Ga0207639_10090509 | |||
| 2216 | Ga0207678_10022795 | |||
| 2217 | Ga0207678_10031382 | |||
| 2218 | Ga0207678_10116577 | |||
| 2219 | Ga0207678_10122602 | |||
| 2220 | Ga0207678_10185564 | |||
| 2221 | Ga0207708_10005458 | |||
| 2222 | Ga0207708_10012601 | |||
| 2223 | Ga0207708_10017975 | |||
| 2224 | Ga0207708_10313618 | |||
| 2225 | Ga0207702_10032863 | |||
| 2226 | Ga0207702_10492845 | |||
| 2227 | Ga0207648_10000831 | |||
| 2228 | Ga0207648_10013463 | |||
| 2229 | Ga0207648_10033080 | |||
| 2230 | Ga0207648_10043265 | |||
| 2231 | Ga0207648_10052246 | |||
| 2232 | Ga0207648_10143877 | |||
| 2233 | Ga0207648_10464751 | |||
| 2234 | Ga0207676_10056408 | |||
| 2235 | Ga0207676_10056688 | |||
| 2236 | Ga0207676_10072834 | |||
| 2237 | Ga0207676_10240853 | |||
| 2238 | Ga0207674_10000575 | |||
| 2239 | Ga0207674_10015400 | |||
| 2240 | Ga0207674_10018395 | |||
| 2241 | Ga0207674_10053138 | |||
| 2242 | Ga0207674_10060999 | |||
| 2243 | Ga0207674_10155662 | |||
| 2244 | Ga0207675_100001439 | |||
| 2245 | Ga0207675_100029121 | |||
| 2246 | Ga0207675_100095852 | |||
| 2247 | Ga0207675_100605956 | |||
| 2248 | Ga0207683_10029677 | |||
| 2249 | Ga0207683_10086901 | |||
| 2250 | Ga0207683_10125248 | |||
| 2251 | Ga0207698_10034543 | |||
| 2252 | Ga0207698_10039904 | |||
| 2253 | Ga0207698_10210221 | |||
| 2254 | Ga0209179_1000035 | |||
| 2255 | Ga0209999_1006859 | |||
| 2256 | Ga0209588_1045938 | |||
| 2257 | Ga0209971_1035165 | |||
| 2258 | Ga0209998_10000643 | |||
| 2259 | Ga0209998_10015878 | |||
| 2260 | Ga0209974_10015654 | |||
| 2261 | Ga0207428_10001569 | |||
| 2262 | Ga0207428_10031150 | |||
| 2263 | Ga0207428_10069738 | |||
| 2264 | Ga0207428_10139767 | |||
| 2265 | Ga0207428_10148331 | |||
| 2266 | Ga0207428_10203577 | |||
| 2267 | Ga0265354_1001849 | |||
| 2268 | Ga0265356_1000423 | |||
| 2269 | Ga0268266_10009803 | |||
| 2270 | Ga0268266_10011841 | |||
| 2271 | Ga0268266_10095384 | |||
| 2272 | Ga0268266_10119392 | |||
| 2273 | Ga0268266_10555682 | |||
| 2274 | Ga0268265_10002430 | |||
| 2275 | Ga0268265_10003755 | |||
| 2276 | Ga0268265_10072929 | |||
| 2277 | Ga0268265_10144087 | |||
| 2278 | Ga0268265_10290108 | |||
| 2279 | Ga0268264_10047178 | |||
| 2280 | Ga0268264_10259293 | |||
| 2281 | Ga0265337_1000341 | |||
| 2282 | Ga0265337_1004853 | |||
| 2283 | Ga0265326_10018024 | |||
| 2284 | Ga0265319_1004109 | |||
| 2285 | Ga0265319_1005238 | |||
| 2286 | Ga0265319_1064029 | |||
| 2287 | Ga0265318_10002057 | |||
| 2288 | Ga0265318_10015946 | |||
| 2289 | Ga0265318_10089329 | |||
| 2290 | Ga0265323_10005821 | |||
| 2291 | Ga0265323_10030565 | |||
| 2292 | Ga0265322_10007287 | |||
| 2293 | Ga0265322_10013995 | |||
| 2294 | Ga0265336_10001401 | |||
| 2295 | Ga0265338_10001605 | |||
| 2296 | Ga0265338_10001803 | |||
| 2297 | Ga0265338_10004319 | |||
| 2298 | Ga0265338_10013275 | |||
| 2299 | Ga0265338_10047014 | |||
| 2300 | Ga0265762_1002849 | |||
| 2301 | Ga0265765_1001162 | |||
| 2302 | Ga0265760_10001235 | |||
| 2303 | Ga0265760_10008710 | |||
| 2304 | Ga0265760_10025268 | |||
| 2305 | Ga0265330_10001378 | |||
| 2306 | Ga0265330_10124717 | |||
| 2307 | Ga0265332_10026881 | |||
| 2308 | Ga0265328_10017008 | |||
| 2309 | Ga0265320_10010173 | |||
| 2310 | Ga0265320_10011149 | |||
| 2311 | Ga0265320_10016105 | |||
| 2312 | Ga0265325_10001701 | |||
| 2313 | Ga0265325_10009862 | |||
| 2314 | Ga0265325_10082724 | |||
| 2315 | Ga0265340_10006886 | |||
| 2316 | Ga0265340_10093220 | |||
| 2317 | Ga0265339_10000011 | |||
| 2318 | Ga0265339_10001359 | |||
| 2319 | Ga0265339_10001433 | |||
| 2320 | Ga0265339_10015256 | |||
| 2321 | Ga0265331_10013068 | |||
| 2322 | Ga0265327_10000014 | |||
| 2323 | Ga0265316_10000390 | |||
| 2324 | Ga0265316_10000523 | |||
| 2325 | Ga0265316_10010760 | |||
| 2326 | Ga0265316_10011481 | |||
| 2327 | Ga0265316_10019573 | |||
| 2328 | Ga0265316_10033261 | |||
| 2329 | Ga0265316_10038328 | |||
| 2330 | Ga0265316_10044392 | |||
| 2331 | Ga0265316_10096370 | |||
| 2332 | Ga0265316_10238166 | |||
| 2333 | Ga0265316_10240099 | |||
| 2334 | Ga0307408_100048150 | |||
| 2335 | Ga0307408_100076533 | |||
| 2336 | Ga0307408_100151714 | |||
| 2337 | Ga0307408_100179890 | |||
| 2338 | Ga0307408_100388040 | |||
| 2339 | Ga0265313_10003345 | |||
| 2340 | Ga0265313_10021569 | |||
| 2341 | Ga0265313_10056632 | |||
| 2342 | Ga0316575_10001488 | |||
| 2343 | Ga0316575_10018143 | |||
| 2344 | Ga0316575_10027858 | |||
| 2345 | Ga0316579_10001127 | |||
| 2346 | Ga0316579_10005953 | |||
| 2347 | Ga0265314_10000036 | |||
| 2348 | Ga0265314_10002466 | |||
| 2349 | Ga0265314_10011383 | |||
| 2350 | Ga0265342_10000377 | |||
| 2351 | Ga0265342_10000788 | |||
| 2352 | Ga0265342_10014707 | |||
| 2353 | Ga0265342_10031155 | |||
| 2354 | Ga0265342_10033572 | |||
| 2355 | Ga0265342_10063973 | |||
| 2356 | Ga0265342_10072643 | |||
| 2357 | Ga0265342_10099334 | |||
| 2358 | Ga0316576_10000176 | |||
| 2359 | Ga0316576_10034695 | |||
| 2360 | Ga0316576_10063629 | |||
| 2361 | Ga0316576_10135066 | |||
| 2362 | Ga0316578_10007657 | |||
| 2363 | Ga0316578_10143986 | |||
| 2364 | Ga0316578_10147830 | |||
| 2365 | Ga0307405_10082905 | |||
| 2366 | Ga0307405_10086064 | |||
| 2367 | Ga0307405_10139485 | |||
| 2368 | Ga0316577_10005881 | |||
| 2369 | Ga0316577_10028765 | |||
| 2370 | Ga0316577_10041957 | |||
| 2371 | Ga0316577_10051477 | |||
| 2372 | Ga0307410_10030903 | |||
| 2373 | Ga0307410_10031559 | |||
| 2374 | Ga0307410_10073363 | |||
| 2375 | Ga0307410_10166712 | |||
| 2376 | Ga0307406_10000573 | |||
| 2377 | Ga0307406_10012696 | |||
| 2378 | Ga0307406_10062500 | |||
| 2379 | Ga0307406_10168379 | |||
| 2380 | Ga0307407_10045780 | |||
| 2381 | Ga0307407_10105340 | |||
| 2382 | Ga0307407_10265300 | |||
| 2383 | Ga0307412_10007208 | |||
| 2384 | Ga0307412_10219157 | |||
| 2385 | Ga0307409_100030777 | |||
| 2386 | Ga0307409_100082565 | |||
| 2387 | Ga0307409_100111351 | |||
| 2388 | Ga0307409_100256983 | |||
| 2389 | Ga0307409_100325905 | |||
| 2390 | Ga0307409_100350128 | |||
| 2391 | Ga0307409_100449720 | |||
| 2392 | Ga0307416_100000453 | |||
| 2393 | Ga0307416_100002533 | |||
| 2394 | Ga0307416_100135375 | |||
| 2395 | Ga0307416_100273517 | |||
| 2396 | Ga0307416_100561962 | |||
| 2397 | Ga0307414_10264643 | |||
| 2398 | Ga0307414_10333828 | |||
| 2399 | Ga0307414_10424352 | |||
| 2400 | Ga0307411_10017664 | |||
| 2401 | Ga0307411_10023552 | |||
| 2402 | Ga0307411_10060712 | |||
| 2403 | Ga0307411_10134278 | |||
| 2404 | Ga0307415_100029569 | |||
| 2405 | Ga0307415_100212840 | |||
| 2406 | Ga0307415_100361320 | |||
| 2407 | Ga0316583_10038918 | |||
| 2408 | Ga0316583_10054512 | |||
| 2409 | Ga0316585_10000518 | |||
| 2410 | Ga0316580_10002122 | |||
| 2411 | Ga0316212_1003877 | |||
| 2412 | Ga0373926_0018520 | |||
| 2413 | Ga0373926_0049806 | |||
| 2414 | Ga0373926_0055174 | |||
| 2415 | Ga0373934_0001808 | |||
| 2416 | Ga0373934_0015827 | |||
| 2417 | Ga0373934_0060064 | |||
| 2418 | Ga0373949_0052560 | |||
| 2419 | Ga0373945_0020112 | |||
| 2420 | Ga0373945_0020901 | |||
| 2421 | Ga0373953_0024910 | |||
| 2422 | Ga0373954_0002656 | |||
| 2423 | Ga0373956_0002098 | |||
| 2424 | Ga0373943_0001313 | |||
| 2425 | Ga0373943_0051694 | |||
| 2426 | Ga0373946_0031525 | |||
| 2427 | Ga0373955_0013885 | |||
| 2428 | Ga0373955_0087116 | |||
| 2429 | Ga0373955_0201676 | |||
| 2430 | Ga0316574_0003541 | |||
| 2431 | Ga0316574_0021845 | |||
| 2432 | Ga0316574_0182367 | |||
| 2433 | Ga0373935_0058605 | |||
| 2434 | Ga0373927_0005068 | |||
| 2435 | Ga0373927_0041960 | |||
| 2436 | Ga0373927_0060673 | |||
| 2437 | Ga0373927_0298266 | |||
| 2438 | Ga0373933_0001471 | |||
| 2439 | Ga0373933_0049233 | |||
| 2440 | Ga0373947_0016320 | |||
| 2441 | Ga0373937_0001030 | |||
| 2442 | Ga0373937_0003079 | |||
| 2443 | Ga0373937_0098935 | |||
| 2444 | Ga0373937_0111800 | |||
| 2445 | Ga0373937_0173832 | |||
| 2446 | Ga0373937_0220367 | |||
| 2447 | Ga0373937_0412521 | |||
| 2448 | Ga0373937_0433294 | |||
| 2449 | Ga0316582_0021668 | |||
| 2450 | Ga0316582_0031402 | |||
| 2451 | Ga0316582_0034557 | |||
| 2452 | Ga0316582_0068184 | |||
| 2453 | Ga0316582_0135073 | |||
| 2454 | Ga0316582_0139231 | |||
| 2455 | Ga0316582_0154903 | |||
| 2456 | Ga0316584_0000730 | |||
| 2457 | Ga0316584_0004451 | |||
| 2458 | Ga0316584_0019139 | |||
| 2459 | Ga0316584_0052101 | |||
| 2460 | Ga0316584_0054449 | |||
| 2461 | Ga0373925_0004280 | |||
| 2462 | Ga0373925_0093003 | |||
| 2463 | Ga0373925_0143727 | |||
| 2464 | Ga0395899_0038156 | |||
| 2465 | Ga0395900_0005776 | |||
| 2466 | Ga0395900_0022025 | |||
| 2467 | Ga0395900_0185566 | |||
| 2468 | Ga0395898_0004275 | |||
| 2469 | Ga0395898_0016471 | |||
| 2470 | Ga0395898_0026587 | |||
| 2471 | Ga0395905_0025950 | |||
| 2472 | Ga0395905_0040878 | |||
| 2473 | Ga0316581_0000740 | |||
| 2474 | Ga0316581_0004424 | |||
| 2475 | Ga0316581_0030200 | |||
| 2476 | Ga0395901_0000748 | |||
| 2477 | Ga0395901_0030870 | |||
| 2478 | Ga0395901_0077025 | |||
| 2479 | Ga0395901_0121419 | |||
| 2480 | Ga0395901_0479461 | |||
| 2481 | Ga0400483_005635 | |||
| 2482 | Ga0400483_011190 | |||
| 2483 | Ga0400483_093214 | |||
| 2484 | Ga0400483_215675 | |||
| 2485 | Ga0400483_219863 | |||
| 2486 | Ga0400483_236928 | |||
| 2487 | Ga0400489_32485 | |||
| 2488 | Ga0436365_1106392 | |||
| 2489 | Ga0436362_0505684 | |||
| 2490 | Ga0451791_0173611 | |||
| 2491 | Ga0451853_2013714 | |||
| 2492 | Ga0439433_0013752 | |||
| 2493 | Ga0439456_015644 | |||
| 2494 | Ga0439462_0003082 | |||
| 2495 | Ga0450896_000837 | |||
| 2496 | Ga0450896_006316 | |||
| 2497 | Ga0450908_003258 | |||
| 2498 | Ga0439434_0005911 | |||
| 2499 | Ga0439435_0004469 | |||
| 2500 | Ga0439435_0009689 | |||
| 2501 | Ga0450918_003723 | |||
| 2502 | Ga0451577_0113437 | |||
| 2503 | Ga0451577_0176052 | |||
| 2504 | Ga0451577_0222136 | |||
| 2505 | Ga0453683_0184216 | |||
| 2506 | Ga0453684_0001951 | |||
| 2507 | Ga0453684_0003327 | |||
| 2508 | Ga0453684_0040322 | |||
| 2509 | Ga0453684_0127246 | |||
| 2510 | Ga0453684_0518352 | |||
| 2511 | Ga0466970_0012651 | |||
| 2512 | Ga0451576_0010110 | |||
| 2513 | Ga0451576_0016018 | |||
| 2514 | Ga0451576_0028389 | |||
| 2515 | Ga0451576_0068274 | |||
| 2516 | Ga0451576_0232055 | |||
| 2517 | Ga0451576_0244801 | |||
| 2518 | Ga0451576_0310385 | |||
| 2519 | Ga0451576_0547483 | |||
| 2520 | Ga0451576_0570623 | |||
| 2521 | Ga0466967_0028686 | |||
| 2522 | Ga0495603_0054628 | |||
| 2523 | Ga0495629_0033455 | |||
| 2524 | Ga0495629_0078901 | |||
| 2525 | Ga0495629_0163613 | |||
| 2526 | Ga0495629_0269404 | |||
| 2527 | Ga0495638_0016830 | |||
| 2528 | Ga0495641_0038740 | |||
| 2529 | Ga0495651_0037993 | |||
| 2530 | Ga0495651_0051091 | |||
| 2531 | Ga0495651_0070810 | |||
| 2532 | Ga0495653_0038384 | |||
| 2533 | Ga0495653_0099170 | |||
| 2534 | Ga0495653_0229106 | |||
| 2535 | Ga0495580_0013226 | |||
| 2536 | Ga0495580_0067093 | |||
| 2537 | Ga0495580_0079671 | |||
| 2538 | Ga0495580_0086908 | |||
| 2539 | Ga0495580_0093087 | |||
| 2540 | Ga0495580_0134081 | |||
| 2541 | Ga0495580_0150582 | |||
| 2542 | Ga0495580_0168096 | |||
| 2543 | Ga0495580_0245389 | |||
| 2544 | Ga0495582_0053906 | |||
| 2545 | Ga0495639_0019172 | |||
| 2546 | Ga0495662_0111120 | |||
| 2547 | Ga0495664_0038910 | |||
| 2548 | Ga0495664_0050182 | |||
| 2549 | Ga0495584_0033978 | |||
| 2550 | Ga0495585_0035699 | |||
| 2551 | Ga0495594_0008275 | |||
| 2552 | Ga0495596_0040812 | |||
| 2553 | Ga0495608_0038026 | |||
| 2554 | Ga0495608_0066533 | |||
| 2555 | Ga0495608_0088558 | |||
| 2556 | Ga0495608_0093787 | |||
| 2557 | Ga0495618_0032566 | |||
| 2558 | Ga0495618_0192857 | |||
| 2559 | Ga0495628_0111025 | |||
| 2560 | Ga0495630_0010653 | |||
| 2561 | Ga0495630_0152070 | |||
| 2562 | Ga0495630_0259240 | |||
| 2563 | Ga0495630_0482817 | |||
| 2564 | Ga0495643_0003764 | |||
| 2565 | Ga0495644_0000109 | |||
| 2566 | Ga0495666_0152886 | |||
| 2567 | Ga0495652_0041555 | |||
| 2568 | Ga0495652_0062339 | |||
| 2569 | Ga0495652_0151957 | |||
| 2570 | Ga0495652_0166837 | |||
| 2571 | Ga0495665_0030788 | |||
| 2572 | Ga0495640_0037807 | |||
| 2573 | Ga0495640_0055240 | |||
| 2574 | Ga0495587_0025928 | |||
| 2575 | Ga0495587_0029174 | |||
| 2576 | Ga0495587_0078118 | |||
| 2577 | Ga0495645_0003622 | |||
| 2578 | Ga0495645_0016503 | |||
| 2579 | Ga0495667_0039839 | |||
| 2580 | Ga0495667_0046569 | |||
| 2581 | Ga0495667_0278199 | |||
| 2582 | Ga0495634_0150100 | |||
| 2583 | Ga0495634_0182307 | |||
| 2584 | Ga0495611_0152419 | |||
| 2585 | Ga0495635_0049008 | |||
| 2586 | Ga0495635_0081053 | |||
| 2587 | Ga0495635_0096304 | |||
| 2588 | Ga0495659_0083678 | |||
| 2589 | Ga0495661_0059195 | |||
| 2590 | Ga0495588_0070854 | |||
| 2591 | Ga0495657_0036875 | |||
| 2592 | Ga0495657_0122940 | |||
| 2593 | Ga0495599_0038487 | |||
| 2594 | Ga0495599_0067316 | |||
| 2595 | Ga0495623_0029370 | |||
| 2596 | Ga0495623_0193903 | |||
| 2597 | Ga0495646_0065823 | |||
| 2598 | Ga0495646_0078664 | |||
| 2599 | Ga0495647_0019003 | |||
| 2600 | Ga0495658_0021591 | |||
| 2601 | Ga0495658_0033654 | |||
| 2602 | Ga0495658_0042183 | |||
| 2603 | Ga0495613_0009371 | |||
| 2604 | Ga0495613_0076261 | |||
| 2605 | Ga0495613_0106936 | |||
| 2606 | Ga0495613_0130952 | |||
| 2607 | Ga0495613_0195213 | |||
| 2608 | Ga0495624_0214613 | |||
| 2609 | Ga0495670_0038325 | |||
| 2610 | Ga0495600_0019687 | |||
| 2611 | Ga0495600_0052119 | |||
| 2612 | Ga0495581_0028963 | |||
| 2613 | Ga0495604_0000316 | |||
| 2614 | Ga0495604_0060936 | |||
| 2615 | Ga0495604_0076632 | |||
| 2616 | Ga0495674_0054208 | |||
| 2617 | Ga0495674_0063090 | |||
| 2618 | Ga0495674_0075233 | |||
| 2619 | Ga0495674_0119474 | |||
| 2620 | Ga0495674_0131881 | |||
| 2621 | Ga0495674_0159895 | |||
| 2622 | Ga0495676_0022205 | |||
| 2623 | Ga0495680_0028177 | |||
| 2624 | Ga0495680_0070074 | |||
| 2625 | Ga0495680_0084974 | |||
| 2626 | Ga0495680_0216595 | |||
| 2627 | Ga0495675_0194522 | |||
| 2628 | Ga0495675_0212034 | |||
| 2629 | Ga0495675_0268280 | |||
| 2630 | Ga0495684_0006774 | |||
| 2631 | Ga0495684_0066907 | |||
| 2632 | Ga0495593_0133456 | |||
| 2633 | Ga0495602_0010139 | |||
| 2634 | Ga0495602_0068148 | |||
| 2635 | Ga0495602_0174268 | |||
| 2636 | Ga0495614_0024936 | |||
| 2637 | Ga0496100_0038901 | |||
| 2638 | Ga0496100_0094185 | |||
| 2639 | Ga0496100_0264671 | |||
| 2640 | Ga0496101_0001837 | |||
| 2641 | Ga0496101_0112442 | |||
| 2642 | Ga0496101_0148706 | |||
| 2643 | Ga0496101_0220998 | |||
| 2644 | Ga0496104_0003735 | |||
| 2645 | Ga0496104_0006178 | |||
| 2646 | Ga0496104_0024458 | |||
| 2647 | Ga0496104_0031819 | |||
| 2648 | Ga0496104_0170574 | |||
| 2649 | Ga0496104_0196227 | |||
| 2650 | Ga0496104_0238776 | |||
| 2651 | Ga0496105_0017181 | |||
| 2652 | Ga0496105_0025019 | |||
| 2653 | Ga0496107_0013317 | |||
| 2654 | Ga0496107_0098204 | |||
| 2655 | Ga0496108_0005593 | |||
| 2656 | Ga0496108_0061089 | |||
| 2657 | Ga0496108_0289753 | |||
| 2658 | Ga0496109_0001076 | |||
| 2659 | Ga0496109_0229484 | |||
| 2660 | Ga0496110_0124328 | |||
| 2661 | Ga0496111_0008105 | |||
| 2662 | Ga0496112_0134148 | |||
| 2663 | Ga0496112_0200757 | |||
| 2664 | Ga0496112_0249255 | |||
| 2665 | Ga0496112_0366081 | |||
| 2666 | Ga0496112_0521422 | |||
| 2667 | Ga0496113_0069105 | |||
| 2668 | Ga0496114_0004686 | |||
| 2669 | Ga0496114_0056287 | |||
| 2670 | Ga0496114_0147925 | |||
| 2671 | Ga0496115_0021362 | |||
| 2672 | Ga0496115_0055490 | |||
| 2673 | Ga0496115_0060394 | |||
| 2674 | Ga0496115_0113889 | |||
| 2675 | Ga0496115_0243597 | |||
| 2676 | Ga0496115_0319531 | |||
| 2677 | Ga0496117_0011177 | |||
| 2678 | Ga0496118_0024587 | |||
| 2679 | Ga0496119_0054761 | |||
| 2680 | Ga0496122_0040764 | |||
| 2681 | Ga0496125_0000224 | |||
| 2682 | Ga0501033_0064069 | |||
| 2683 | Ga0501033_0140758 | |||
| 2684 | Ga0501034_0010246 | |||
| 2685 | Ga0501036_0006003 | |||
| 2686 | Ga0501036_0013567 | |||
| 2687 | Ga0501036_0033169 | |||
| 2688 | Ga0501036_0049504 | |||
| 2689 | Ga0501036_0560374 | |||
| 2690 | Ga0501037_0029707 | |||
| 2691 | Ga0501037_0042486 | |||
| 2692 | Ga0501037_0267746 | |||
| 2693 | Ga0501038_0000991 | |||
| 2694 | Ga0501038_0014073 | |||
| 2695 | Ga0501038_0100348 | |||
| 2696 | Ga0501038_0142246 | |||
| 2697 | Ga0501038_0181138 | |||
| 2698 | Ga0501039_0022956 | |||
| 2699 | Ga0501039_0074496 | |||
| 2700 | Ga0501039_0100284 | |||
| 2701 | Ga0501040_0003519 | |||
| 2702 | Ga0501040_0022672 | |||
| 2703 | Ga0501040_0044915 | |||
| 2704 | Ga0501041_0011281 | |||
| 2705 | Ga0501041_0031028 | |||
| 2706 | Ga0501041_0229535 | |||
| 2707 | Ga0501042_0007078 | |||
| 2708 | Ga0501042_0013134 | |||
| 2709 | Ga0501042_0018519 | |||
| 2710 | Ga0501042_0118670 | |||
| 2711 | Ga0501042_0317061 | |||
| 2712 | Ga0501043_0002624 | |||
| 2713 | Ga0501043_0053833 | |||
| 2714 | Ga0501046_0268932 | |||
| 2715 | Ga0501047_0000829 | |||
| 2716 | Ga0501047_0001599 | |||
| 2717 | Ga0501048_0002638 | |||
| 2718 | Ga0501048_0017707 | |||
| 2719 | Ga0501048_0072503 | |||
| 2720 | Ga0501048_0354549 | |||
| 2721 | Ga0501067_0081014 | |||
| 2722 | Ga0501068_0034772 | |||
| 2723 | Ga0501068_0138533 | |||
| 2724 | Ga0501069_0027812 | |||
| 2725 | Ga0501071_0002438 | |||
| 2726 | Ga0501071_0012615 | |||
| 2727 | Ga0501071_0031098 | |||
| 2728 | Ga0501071_0049679 | |||
| 2729 | Ga0501071_0311503 | |||
| 2730 | Ga0501072_0012918 | |||
| 2731 | Ga0501072_0021227 | |||
| 2732 | Ga0501072_0116443 | |||
| 2733 | Ga0501072_0158252 | |||
| 2734 | Ga0501073_0008694 | |||
| 2735 | Ga0501073_0011036 | |||
| 2736 | Ga0501074_0000170 | |||
| 2737 | Ga0501074_0001420 | |||
| 2738 | Ga0501074_0055665 | |||
| 2739 | Ga0501074_0301794 | |||
| 2740 | Ga0501075_0011221 | |||
| 2741 | Ga0501075_0015397 | |||
| 2742 | Ga0501075_0026355 | |||
| 2743 | Ga0501075_0041003 | |||
| 2744 | Ga0501075_0065619 | |||
| 2745 | Ga0501076_0012000 | |||
| 2746 | Ga0501076_0057668 | |||
| 2747 | Ga0501076_0094097 | |||
| 2748 | Ga0501076_0228471 | |||
| 2749 | Ga0501224_000395 | |||
| 2750 | Ga0501227_010631 | |||
| 2751 | Ga0501235_000489 | |||
| 2752 | Ga0501242_002627 | |||
| 2753 | Ga0501249_005818 | |||
| 2754 | Ga0501257_002139 | |||
| 2755 | Ga0501259_002027 | |||
| 2756 | Ga0501221_003696 | |||
| 2757 | Ga0501225_0002679 | |||
| 2758 | Ga0501245_005742 | |||
| 2759 | Ga0501079_0036556 | |||
| 2760 | Ga0501079_0038392 | |||
| 2761 | Ga0501080_0392265 | |||
| 2762 | Ga0501081_0037043 | |||
| 2763 | Ga0501081_0043850 | |||
| 2764 | Ga0501081_0131954 | |||
| 2765 | Ga0501265_005612 | |||
| 2766 | Ga0501266_002342 | |||
| 2767 | Ga0501268_000019 | |||
| 2768 | Ga0501035_0059868 | |||
| 2769 | Ga0501035_0144838 | |||
| 2770 | Ga0501044_0004134 | |||
| 2771 | Ga0501044_0039975 | |||
| 2772 | Ga0501045_0006600 | |||
| 2773 | Ga0501045_0008757 | |||
| 2774 | Ga0501045_0010135 | |||
| 2775 | Ga0501045_0018522 | |||
| 2776 | Ga0501045_0065336 | |||
| 2777 | nmdc:mga03683_8391_c1 | |||
| 2778 | nmdc:mga00v17_14306_c1 | |||
| 2779 | nmdc:mga00v17_16045_c1 | |||
| 2780 | nmdc:mga00v17_219341_c1 | |||
| 2781 | nmdc:mga00v17_42763_c1 | |||
| 2782 | nmdc:mga0k408_119362_c1 | |||
| 2783 | nmdc:mga0k408_94540_c1 | |||
| 2784 | nmdc:mga06z11_23354_c1 | |||
| 2785 | nmdc:mga04h51_109408_c1 | |||
| 2786 | nmdc:mga04h51_41603_c1 | |||
| 2787 | nmdc:mga07m45_213376_c1 | |||
| 2788 | nmdc:mga07m45_29874_c1 | |||
| 2789 | nmdc:mga05p37_145626_c1 | |||
| 2790 | nmdc:mga05p37_157704_c1 | |||
| 2791 | nmdc:mga05p37_21631_c1 | |||
| 2792 | nmdc:mga05p37_42487_c1 | |||
| 2793 | nmdc:mga05p37_50499_c1 | |||
| 2794 | nmdc:mga05p37_53519_c1 | |||
| 2795 | nmdc:mga05p37_57686_c1 | |||
| 2796 | nmdc:mga05p37_637_c1 | |||
| 2797 | nmdc:mga05p37_691381_c1 | |||
| 2798 | nmdc:mga05p37_70179_c1 | |||
| 2799 | nmdc:mga05p37_83201_c1 | |||
| 2800 | nmdc:mga09592_14019_c1 | |||
| 2801 | nmdc:mga09592_62037_c1 | |||
| 2802 | nmdc:mga09592_8480_c1 | |||
| 2803 | nmdc:mga0qj67_12797_c1 | |||
| 2804 | nmdc:mga0qj67_128340_c1 | |||
| 2805 | nmdc:mga0qj67_195896_c1 | |||
| 2806 | nmdc:mga0qj67_34526_c1 | |||
| 2807 | nmdc:mga0qj67_76609_c1 | |||
| 2808 | nmdc:mga0qj67_7988_c1 | |||
| 2809 | nmdc:mga06r32_16603_c1 | |||
| 2810 | nmdc:mga06r32_26890_c1 | |||
| 2811 | nmdc:mga06r32_36418_c1 | |||
| 2812 | nmdc:mga06r32_59331_c1 | |||
| 2813 | nmdc:mga08y16_12492_c1 | |||
| 2814 | nmdc:mga08y16_169027_c1 | |||
| 2815 | nmdc:mga08y16_172800_c1 | |||
| 2816 | nmdc:mga08y16_203884_c1 | |||
| 2817 | nmdc:mga08y16_26376_c1 | |||
| 2818 | nmdc:mga08y16_27598_c1 | |||
| 2819 | nmdc:mga08y16_362934_c1 | |||
| 2820 | nmdc:mga08y16_44103_c1 | |||
| 2821 | nmdc:mga08y16_47457_c1 | |||
| 2822 | nmdc:mga08y16_558020_c1 | |||
| 2823 | nmdc:mga08y16_67155_c1 | |||
| 2824 | nmdc:mga08y16_675687_c1 | |||
| 2825 | nmdc:mga08y16_68368_c1 | |||
| 2826 | nmdc:mga08y16_702_c1 | |||
| 2827 | nmdc:mga0n895_118145_c1 | |||
| 2828 | nmdc:mga0n895_148770_c1 | |||
| 2829 | nmdc:mga0n895_150200_c1 | |||
| 2830 | nmdc:mga0n895_15479_c1 | |||
| 2831 | nmdc:mga0n895_205321_c1 | |||
| 2832 | nmdc:mga0n895_229667_c1 | |||
| 2833 | nmdc:mga0n895_553964_c1 | |||
| 2834 | nmdc:mga0n895_88331_c1 | |||
| 2835 | nmdc:mga0n895_9606_c1 | |||
| 2836 | nmdc:mga0rr50_104933_c1 | |||
| 2837 | nmdc:mga0rr50_190766_c1 | |||
| 2838 | nmdc:mga0rr50_340689_c1 | |||
| 2839 | nmdc:mga0rr50_423538_c1 | |||
| 2840 | nmdc:mga0rr50_48500_c1 | |||
| 2841 | nmdc:mga08x19_105455_c1 | |||
| 2842 | nmdc:mga08x19_31980_c1 | |||
| 2843 | nmdc:mga08x19_33934_c1 | |||
| 2844 | nmdc:mga08x19_43338_c1 | |||
| 2845 | nmdc:mga08x19_43721_c1 | |||
| 2846 | nmdc:mga08x19_78516_c1 | |||
| 2847 | nmdc:mga08x19_84089_c1 | |||
| 2848 | nmdc:mga08x19_87493_c1 | |||
| 2849 | nmdc:mga0a205_1106_c1 | |||
| 2850 | nmdc:mga0a205_135534_c1 | |||
| 2851 | nmdc:mga0a205_13906_c1 | |||
| 2852 | nmdc:mga0a205_17397_c1 | |||
| 2853 | nmdc:mga0a205_18643_c1 | |||
| 2854 | nmdc:mga0a205_222624_c1 | |||
| 2855 | nmdc:mga0a205_24671_c1 | |||
| 2856 | nmdc:mga0a205_38775_c1 | |||
| 2857 | nmdc:mga0a205_6498_c1 | |||
| 2858 | nmdc:mga0a205_90002_c1 | |||
| 2859 | Ga0495601_0003043 | |||
| 2860 | Ga0495601_0018008 | |||
| 2861 | Ga0495619_0030623 | |||
| 2862 | Ga0495619_0058525 | |||
| 2863 | Ga0495619_0211892 | |||
| 2864 | Ga0495619_0302159 | |||
| 2865 | Ga0500641_0002653 | |||
| 2866 | Ga0500555_051991 | |||
| 2867 | Ga0501084_0027681 | |||
| 2868 | Ga0501084_0037765 | |||
| 2869 | Ga0501084_0142649 | |||
| 2870 | Ga0590071_002832 | |||
| 2871 | Ga0501082_0002626 | |||
| 2872 | Ga0501082_0005515 | |||
| 2873 | Ga0501082_0164310 | |||
| 2874 | Ga0530510_0011669 | |||
| 2875 | Ga0530510_0011693 | |||
| 2876 | Ga0530510_0056166 | |||
| 2877 | Ga0530510_0077904 | |||
| 2878 | 2644505488 | |||
| 2879 | 2739234869 | |||
| 2880 | 2812363807 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9073 | 5 | 221 |
| 7cha-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with amppnp | 0.9066 | 3 | 224 |
| 5x41-assembly1.cif.gz_B | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9052 | 1 | 222 |
| 5x41-assembly2.cif.gz_D | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9025 | 1 | 221 |
| 7d06-assembly1.cif.gz_B | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.902 | 2 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53149_2_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9549 | 1 | 221 | 3.40.50.300 |
| af_A4HRM7_2286_2560_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9492 | 3 | 222 | 3.40.50.300 |
| af_A4I2P8_1496_1744_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9449 | 4 | 223 | 3.40.50.300 |
| af_P9WQL7_7_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9435 | 3 | 221 | 3.40.50.300 |
| af_Q9VDR4_479_718_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9428 | 2 | 219 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T7XM26-F1-model_v4 | ABC transporter ATP-binding protein | 0.9715 | 3 | 222 |
GO:0005524
GO:0016887 |
| AF-A0A1V5WLN9-F1-model_v4 | Putative ABC transporter ATP-binding protein YbhF | 0.9634 | 3 | 222 |
GO:0005524
GO:0016887 |
| AF-A0A7V5DKD2-F1-model_v4 | Heme ABC exporter ATP-binding protein CcmA | 0.9499 | 6 | 214 |
GO:0005524
GO:0016887 GO:0017004 GO:0022857 |
| AF-A0A7X8XW61-F1-model_v4 | ABC transporter ATP-binding protein | 0.9487 | 1 | 224 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A520NVZ7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9467 | 1 | 221 |
GO:0005524
GO:0016887 |