F493865
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1425 | 462 | 1413 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10149801|Ga0111539_101498012 |
| Length | 86 |
| Sequence | MTYTVQIKVMPLKELLDPQGKAVMGGLQNLGLSGVEDVRVGKNITLQLNASSPEQAKQLAEEASKKLLANPVMEYFEVLCETPNSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 5 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 6 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 7 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 8 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 9 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 10 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 11 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 12 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 13 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 14 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 21 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 22 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 23 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 239 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 240 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 241 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 244 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 247 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 248 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 249 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 256 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 257 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 271 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 272 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 273 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 282 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 283 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 284 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 285 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 286 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 287 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 288 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 289 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 290 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 291 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 292 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 293 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 294 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 295 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 296 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 297 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 298 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 299 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 300 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 301 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 302 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 303 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 307 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 308 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 314 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 315 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 377 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 378 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 379 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 380 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 381 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 382 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 383 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 384 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 389 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 390 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 391 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 392 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 393 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 394 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 395 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 396 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 397 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 398 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 399 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 400 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 401 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 402 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 406 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 407 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 408 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 409 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 410 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 411 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049849 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought | Metagenome | Rhizosphere |
| 414 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 415 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 416 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 425 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 426 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 427 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 429 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 430 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 431 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 432 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 433 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 434 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 435 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 436 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 437 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 438 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 439 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 440 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 441 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 443 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 444 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 445 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 446 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 447 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 448 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 450 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 452 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 453 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 454 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 455 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 457 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 458 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 459 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 460 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 461 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 462 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.09 |
| Metatranscriptomes | 0 |
| Isolates | 0.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.65 |
| Nodule | 0 |
| Rhizoplane | 1.96 |
| Rhizosphere | 86.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_3991831 | 2162886011 | Unclassified | 1031 |
| 2 | CNXas_1008144 | 3300000545 | Bacteria | 738 |
| 3 | JGI24740J21852_10004408 | 3300001979 | Bacteria | 6048 |
| 4 | JGI24739J22299_10000154 | 3300001989 | Bacteria | 22212 |
| 5 | JGI24739J22299_10088741 | 3300001989 | Bacteria | 943 |
| 6 | JGI24739J22299_10163145 | 3300001989 | Bacteria | 657 |
| 7 | JGI24737J22298_10124825 | 3300001990 | Bacteria | 760 |
| 8 | JGI24033J26618_1015030 | 3300002155 | Unclassified | 952 |
| 9 | JGI24751J29686_10022844 | 3300002459 | Unclassified | 1296 |
| 10 | JGI25154J39366_1000004 | 3300002738 | Bacteria | 346460 |
| 11 | JGI25158J39367_1012243 | 3300002739 | Bacteria | 1133 |
| 12 | JGI25158J39367_1020046 | 3300002739 | Bacteria | 819 |
| 13 | JGI25157J39369_1006614 | 3300002741 | Bacteria | 1744 |
| 14 | JGI25159J45721_1011021 | 3300002987 | Bacteria | 2249 |
| 15 | JGI25153J46596_10000224 | 3300003215 | Bacteria | 48671 |
| 16 | JGI25153J46596_10084177 | 3300003215 | Bacteria | 785 |
| 17 | JGI25153J46596_10125283 | 3300003215 | Bacteria | 574 |
| 18 | rootH1_10028725 | 3300003316 | Bacteria | 5378 |
| 19 | rootH1_10105550 | 3300003316 | Bacteria | 4751 |
| 20 | rootH2_10004858 | 3300003320 | Bacteria | 14814 |
| 21 | rootH2_10052963 | 3300003320 | Bacteria | 13053 |
| 22 | rootH2_10092470 | 3300003320 | Bacteria | 1865 |
| 23 | rootH2_10168387 | 3300003320 | Bacteria | 1111 |
| 24 | rootH2_10246825 | 3300003320 | Viruses | 1738 |
| 25 | rootL2_10108849 | 3300003322 | Bacteria | 4894 |
| 26 | rootL2_10160668 | 3300003322 | Bacteria | 3909 |
| 27 | rootL2_10303123 | 3300003322 | Bacteria | 1215 |
| 28 | rootH1_10006382 | 3300003323 | Bacteria | 6024 |
| 29 | rootH1_10071977 | 3300003323 | Bacteria | 1755 |
| 30 | rootH1_10087949 | 3300003316 | Bacteria | 1209 |
| 31 | rootH1_10087949 | 3300003323 | Bacteria | 1955 |
| 32 | JGI25160J50197_1007253 | 3300003354 | Bacteria | 4359 |
| 33 | JGI25160J50197_1010399 | 3300003354 | Bacteria | 3369 |
| 34 | JGI25160J50197_1025424 | 3300003354 | Bacteria | 1657 |
| 35 | Ga0055535_1007135 | 3300003761 | Bacteria | 2166 |
| 36 | Ga0055542_1006677 | 3300003762 | Bacteria | 2437 |
| 37 | Ga0055528_1000355 | 3300003790 | Bacteria | 37201 |
| 38 | Ga0055530_10000425 | 3300003791 | Bacteria | 37501 |
| 39 | Ga0055531_10000411 | 3300003794 | Bacteria | 41180 |
| 40 | Ga0055531_10037717 | 3300003794 | Bacteria | 1464 |
| 41 | Ga0065165_1000148 | 3300005262 | Bacteria | 122640 |
| 42 | Ga0065165_1014842 | 3300005262 | Bacteria | 3003 |
| 43 | Ga0065165_1030372 | 3300005262 | Bacteria | 1720 |
| 44 | Ga0065714_10171921 | 3300005288 | Unclassified | 1000 |
| 45 | Ga0065704_10375778 | 3300005289 | Bacteria | 779 |
| 46 | Ga0065704_10388791 | 3300005289 | Bacteria | 765 |
| 47 | Ga0065704_10843439 | 3300005289 | Unclassified | 511 |
| 48 | Ga0065712_10001417 | 3300005290 | Bacteria | 6359 |
| 49 | Ga0065712_10010245 | 3300005290 | Bacteria | 2748 |
| 50 | Ga0065712_10149212 | 3300005290 | Bacteria | 1375 |
| 51 | Ga0065712_10165992 | 3300005290 | Bacteria | 1273 |
| 52 | Ga0065712_10228029 | 3300005290 | Unclassified | 1020 |
| 53 | Ga0065712_10332757 | 3300005290 | Unclassified | 811 |
| 54 | Ga0065712_10696653 | 3300005290 | Bacteria | 548 |
| 55 | Ga0065712_10719023 | 3300005290 | Bacteria | 539 |
| 56 | Ga0065715_10075105 | 3300005293 | Bacteria | 661 |
| 57 | Ga0065715_10236672 | 3300005293 | Unclassified | 1214 |
| 58 | Ga0065707_10229826 | 3300005295 | Bacteria | 1193 |
| 59 | Ga0065707_10425758 | 3300005295 | Unclassified | 825 |
| 60 | Ga0070658_10016557 | 3300005327 | Bacteria | 5899 |
| 61 | Ga0070658_10029504 | 3300005327 | Unclassified | 4407 |
| 62 | Ga0070658_10166171 | 3300005327 | Bacteria | 1852 |
| 63 | Ga0070658_11009185 | 3300005327 | Bacteria | 724 |
| 64 | Ga0070676_10004512 | 3300005328 | Bacteria | 7327 |
| 65 | Ga0070676_10027716 | 3300005328 | Bacteria | 3214 |
| 66 | Ga0070676_10158946 | 3300005328 | Bacteria | 1453 |
| 67 | Ga0070683_100000615 | 3300005329 | Bacteria | 25605 |
| 68 | Ga0070683_100002428 | 3300005329 | Bacteria | 14813 |
| 69 | Ga0070683_100008631 | 3300005329 | Bacteria | 8659 |
| 70 | Ga0070683_100048187 | 3300005329 | Bacteria | 3939 |
| 71 | Ga0070683_100055456 | 3300005329 | Unclassified | 3678 |
| 72 | Ga0070690_100022674 | 3300005330 | Bacteria | 3843 |
| 73 | Ga0070690_101511534 | 3300005330 | Unclassified | 543 |
| 74 | Ga0070670_100026030 | 3300005331 | Bacteria | 5035 |
| 75 | Ga0070670_100123124 | 3300005331 | Unclassified | 2237 |
| 76 | Ga0070670_100366957 | 3300005331 | Bacteria | 1267 |
| 77 | Ga0070670_100548885 | 3300005331 | Unclassified | 1031 |
| 78 | Ga0070670_100600439 | 3300005331 | Unclassified | 985 |
| 79 | Ga0070670_100785445 | 3300005331 | Bacteria | 859 |
| 80 | Ga0070670_101140936 | 3300005331 | Unclassified | 711 |
| 81 | Ga0070670_101335581 | 3300005331 | Bacteria | 657 |
| 82 | Ga0070677_10014866 | 3300005333 | Bacteria | 2748 |
| 83 | Ga0070677_10069338 | 3300005333 | Bacteria | 1479 |
| 84 | Ga0070677_10182051 | 3300005333 | Bacteria | 1001 |
| 85 | Ga0068869_100005960 | 3300005334 | Bacteria | 7705 |
| 86 | Ga0068869_100009661 | 3300005334 | Bacteria | 6264 |
| 87 | Ga0068869_100088792 | 3300005334 | Unclassified | 2321 |
| 88 | Ga0068869_100188735 | 3300005334 | Bacteria | 1620 |
| 89 | Ga0068869_101355570 | 3300005334 | Unclassified | 629 |
| 90 | Ga0070666_10003206 | 3300005335 | Bacteria | 9950 |
| 91 | Ga0070666_10037711 | 3300005335 | Unclassified | 3215 |
| 92 | Ga0070666_10086792 | 3300005335 | Unclassified | 2144 |
| 93 | Ga0070666_10087689 | 3300005335 | Unclassified | 2133 |
| 94 | Ga0070680_100031273 | 3300005336 | Unclassified | 4279 |
| 95 | Ga0070680_100073100 | 3300005336 | Bacteria | 2819 |
| 96 | Ga0070680_100076264 | 3300005336 | Bacteria | 2759 |
| 97 | Ga0070680_101450127 | 3300005336 | Unclassified | 594 |
| 98 | Ga0070682_100068373 | 3300005337 | Bacteria | 2265 |
| 99 | Ga0070682_100153642 | 3300005337 | Unclassified | 1582 |
| 100 | Ga0070682_100789324 | 3300005337 | Bacteria | 770 |
| 101 | Ga0068868_100003134 | 3300005338 | Bacteria | 11508 |
| 102 | Ga0068868_100223164 | 3300005338 | Unclassified | 1578 |
| 103 | Ga0068868_100359284 | 3300005338 | Unclassified | 1249 |
| 104 | Ga0068868_100431522 | 3300005338 | Bacteria | 1143 |
| 105 | Ga0068868_101355732 | 3300005338 | Bacteria | 662 |
| 106 | Ga0068868_101417648 | 3300005338 | Unclassified | 648 |
| 107 | Ga0068868_101474190 | 3300005338 | Unclassified | 636 |
| 108 | Ga0070660_100001558 | 3300005339 | Bacteria | 15760 |
| 109 | Ga0070660_100068302 | 3300005339 | Bacteria | 2770 |
| 110 | Ga0070660_100097241 | 3300005339 | Bacteria | 2329 |
| 111 | Ga0070660_100308646 | 3300005339 | Bacteria | 1298 |
| 112 | Ga0070660_100361896 | 3300005339 | Bacteria | 1196 |
| 113 | Ga0070660_100451449 | 3300005339 | Bacteria | 1066 |
| 114 | Ga0070660_100486182 | 3300005339 | Bacteria | 1026 |
| 115 | Ga0070660_100964091 | 3300005339 | Bacteria | 720 |
| 116 | Ga0070689_100015371 | 3300005340 | Bacteria | 5580 |
| 117 | Ga0070689_100711257 | 3300005340 | Bacteria | 878 |
| 118 | Ga0070689_101532784 | 3300005340 | Bacteria | 604 |
| 119 | Ga0070691_10070158 | 3300005341 | Bacteria | 1699 |
| 120 | Ga0070687_100084904 | 3300005343 | Unclassified | 1736 |
| 121 | Ga0070687_100240710 | 3300005343 | Unclassified | 1119 |
| 122 | Ga0070687_100354360 | 3300005343 | Bacteria | 948 |
| 123 | Ga0070687_101111580 | 3300005343 | Unclassified | 579 |
| 124 | Ga0070661_100000716 | 3300005344 | Bacteria | 24318 |
| 125 | Ga0070661_100236064 | 3300005344 | Bacteria | 1406 |
| 126 | Ga0070661_101272938 | 3300005344 | Unclassified | 616 |
| 127 | Ga0070661_101708494 | 3300005344 | Bacteria | 533 |
| 128 | Ga0070692_10329317 | 3300005345 | Bacteria | 942 |
| 129 | Ga0070692_10417698 | 3300005345 | Bacteria | 851 |
| 130 | Ga0070692_10548503 | 3300005345 | Bacteria | 757 |
| 131 | Ga0070668_100011512 | 3300005347 | Bacteria | 6587 |
| 132 | Ga0070668_100066932 | 3300005347 | Bacteria | 2789 |
| 133 | Ga0070668_100083587 | 3300005347 | Bacteria | 2506 |
| 134 | Ga0070668_100326069 | 3300005347 | Bacteria | 1294 |
| 135 | Ga0070668_100331165 | 3300005347 | Bacteria | 1284 |
| 136 | Ga0070669_100002817 | 3300005353 | Bacteria | 12559 |
| 137 | Ga0070669_100126538 | 3300005353 | Unclassified | 1956 |
| 138 | Ga0070669_100330064 | 3300005353 | Unclassified | 1234 |
| 139 | Ga0070669_100887376 | 3300005353 | Bacteria | 761 |
| 140 | Ga0070669_101366184 | 3300005353 | Bacteria | 614 |
| 141 | Ga0070669_101991893 | 3300005353 | Bacteria | 508 |
| 142 | Ga0070675_100002107 | 3300005354 | Bacteria | 14716 |
| 143 | Ga0070675_100033122 | 3300005354 | Unclassified | 4186 |
| 144 | Ga0070675_100148821 | 3300005354 | Unclassified | 2006 |
| 145 | Ga0070675_100195754 | 3300005354 | Bacteria | 1753 |
| 146 | Ga0070675_100245564 | 3300005354 | Bacteria | 1565 |
| 147 | Ga0070671_100019722 | 3300005355 | Bacteria | 5491 |
| 148 | Ga0070671_100059583 | 3300005355 | Bacteria | 3177 |
| 149 | Ga0070671_100082299 | 3300005355 | Unclassified | 2691 |
| 150 | Ga0070671_100189540 | 3300005355 | Bacteria | 1743 |
| 151 | Ga0070671_100238866 | 3300005355 | Bacteria | 1542 |
| 152 | Ga0070671_100644228 | 3300005355 | Bacteria | 917 |
| 153 | Ga0070671_101303334 | 3300005355 | Bacteria | 641 |
| 154 | Ga0070674_100081660 | 3300005356 | Bacteria | 2310 |
| 155 | Ga0070674_100118139 | 3300005356 | Unclassified | 1959 |
| 156 | Ga0070674_100280305 | 3300005356 | Unclassified | 1321 |
| 157 | Ga0070674_100429194 | 3300005356 | Unclassified | 1086 |
| 158 | Ga0070674_100605243 | 3300005356 | Unclassified | 926 |
| 159 | Ga0070674_100898512 | 3300005356 | Bacteria | 771 |
| 160 | Ga0070674_100901610 | 3300005356 | Bacteria | 770 |
| 161 | Ga0070673_100002306 | 3300005364 | Bacteria | 11593 |
| 162 | Ga0070673_100032189 | 3300005364 | Bacteria | 3945 |
| 163 | Ga0070673_100122862 | 3300005364 | Bacteria | 2168 |
| 164 | Ga0070673_100239452 | 3300005364 | Bacteria | 1577 |
| 165 | Ga0070673_100757139 | 3300005364 | Bacteria | 895 |
| 166 | Ga0070673_100845769 | 3300005364 | Bacteria | 846 |
| 167 | Ga0070688_100009375 | 3300005365 | Bacteria | 5350 |
| 168 | Ga0070688_100018226 | 3300005365 | Bacteria | 4047 |
| 169 | Ga0070688_101407499 | 3300005365 | Bacteria | 565 |
| 170 | Ga0070659_100286926 | 3300005366 | Bacteria | 1370 |
| 171 | Ga0070659_100787336 | 3300005366 | Unclassified | 826 |
| 172 | Ga0070659_100835755 | 3300005366 | Bacteria | 802 |
| 173 | Ga0070659_100968893 | 3300005366 | Bacteria | 746 |
| 174 | Ga0070659_101050685 | 3300005366 | Bacteria | 716 |
| 175 | Ga0070659_101960879 | 3300005366 | Unclassified | 525 |
| 176 | Ga0070667_100007609 | 3300005367 | Bacteria | 8984 |
| 177 | Ga0070667_100049032 | 3300005367 | Unclassified | 3556 |
| 178 | Ga0070667_100067852 | 3300005367 | Bacteria | 3034 |
| 179 | Ga0070667_100195878 | 3300005367 | Bacteria | 1791 |
| 180 | Ga0070667_100223373 | 3300005367 | Unclassified | 1677 |
| 181 | Ga0070667_100880056 | 3300005367 | Bacteria | 833 |
| 182 | Ga0070667_101009961 | 3300005367 | Unclassified | 776 |
| 183 | Ga0070667_101059104 | 3300005367 | Bacteria | 757 |
| 184 | Ga0070703_10506814 | 3300005406 | Unclassified | 544 |
| 185 | Ga0070714_100669624 | 3300005435 | Bacteria | 1000 |
| 186 | Ga0070710_11434452 | 3300005437 | Bacteria | 517 |
| 187 | Ga0070701_10023227 | 3300005438 | Unclassified | 2983 |
| 188 | Ga0070701_10078565 | 3300005438 | Bacteria | 1781 |
| 189 | Ga0070705_100644389 | 3300005440 | Unclassified | 825 |
| 190 | Ga0070705_101365373 | 3300005440 | Unclassified | 589 |
| 191 | Ga0070700_100145353 | 3300005441 | Bacteria | 1616 |
| 192 | Ga0070700_100710557 | 3300005441 | Unclassified | 800 |
| 193 | Ga0070694_100508132 | 3300005444 | Unclassified | 960 |
| 194 | Ga0070663_100012032 | 3300005455 | Bacteria | 5460 |
| 195 | Ga0070663_100169767 | 3300005455 | Bacteria | 1685 |
| 196 | Ga0070663_100397292 | 3300005455 | Bacteria | 1126 |
| 197 | Ga0070678_100003286 | 3300005456 | Bacteria | 8990 |
| 198 | Ga0070678_100158474 | 3300005456 | Unclassified | 1831 |
| 199 | Ga0070662_100011603 | 3300005457 | Bacteria | 5815 |
| 200 | Ga0070662_100035523 | 3300005457 | Bacteria | 3520 |
| 201 | Ga0070662_100054392 | 3300005457 | Bacteria | 2901 |
| 202 | Ga0070662_100376237 | 3300005457 | Bacteria | 1168 |
| 203 | Ga0070662_100615819 | 3300005457 | Bacteria | 914 |
| 204 | Ga0070662_101176054 | 3300005457 | Bacteria | 659 |
| 205 | Ga0070662_101309745 | 3300005457 | Bacteria | 623 |
| 206 | Ga0070681_10088919 | 3300005458 | Bacteria | 3040 |
| 207 | Ga0070681_10095068 | 3300005458 | Bacteria | 2929 |
| 208 | Ga0070681_10527543 | 3300005458 | Bacteria | 1094 |
| 209 | Ga0070681_10810323 | 3300005458 | Bacteria | 854 |
| 210 | Ga0068867_100005650 | 3300005459 | Bacteria | 8865 |
| 211 | Ga0068867_100062803 | 3300005459 | Unclassified | 2760 |
| 212 | Ga0068867_100073950 | 3300005459 | Bacteria | 2553 |
| 213 | Ga0068867_100080722 | 3300005459 | Unclassified | 2450 |
| 214 | Ga0068867_100091339 | 3300005459 | Bacteria | 2311 |
| 215 | Ga0068867_100290819 | 3300005459 | Bacteria | 1343 |
| 216 | Ga0068867_100733825 | 3300005459 | Unclassified | 875 |
| 217 | Ga0068867_100775108 | 3300005459 | Bacteria | 853 |
| 218 | Ga0068867_100919472 | 3300005459 | Bacteria | 788 |
| 219 | Ga0068867_100933110 | 3300005459 | Bacteria | 783 |
| 220 | Ga0068867_101709782 | 3300005459 | Unclassified | 590 |
| 221 | Ga0070685_10021727 | 3300005466 | Unclassified | 3490 |
| 222 | Ga0070685_10194478 | 3300005466 | Bacteria | 1314 |
| 223 | Ga0070685_10265907 | 3300005466 | Unclassified | 1142 |
| 224 | Ga0070685_10606095 | 3300005466 | Bacteria | 789 |
| 225 | Ga0070685_10609501 | 3300005466 | Bacteria | 787 |
| 226 | Ga0070707_100318179 | 3300005468 | Unclassified | 1512 |
| 227 | Ga0070698_100000585 | 3300005471 | Bacteria | 39139 |
| 228 | Ga0070698_100000965 | 3300005471 | Bacteria | 31529 |
| 229 | Ga0070698_100032415 | 3300005471 | Bacteria | 5412 |
| 230 | Ga0070699_100493970 | 3300005518 | Unclassified | 1111 |
| 231 | Ga0070679_100070634 | 3300005530 | Unclassified | 3483 |
| 232 | Ga0070679_100173865 | 3300005530 | Bacteria | 2126 |
| 233 | Ga0070679_100431741 | 3300005530 | Bacteria | 1262 |
| 234 | Ga0070679_100554943 | 3300005530 | Bacteria | 1092 |
| 235 | Ga0070679_100647417 | 3300005530 | Bacteria | 999 |
| 236 | Ga0070684_100000134 | 3300005535 | Bacteria | 49154 |
| 237 | Ga0070684_100010110 | 3300005535 | Bacteria | 7462 |
| 238 | Ga0070684_101009235 | 3300005535 | Bacteria | 781 |
| 239 | Ga0070684_101325970 | 3300005535 | Bacteria | 677 |
| 240 | Ga0070697_101667294 | 3300005536 | Unclassified | 570 |
| 241 | Ga0068853_100000276 | 3300005539 | Bacteria | 36211 |
| 242 | Ga0068853_100020543 | 3300005539 | Bacteria | 5493 |
| 243 | Ga0068853_100050862 | 3300005539 | Bacteria | 3565 |
| 244 | Ga0068853_100063424 | 3300005539 | Bacteria | 3201 |
| 245 | Ga0068853_100164165 | 3300005539 | Bacteria | 2006 |
| 246 | Ga0068853_100169597 | 3300005539 | Bacteria | 1974 |
| 247 | Ga0068853_100221850 | 3300005539 | Unclassified | 1727 |
| 248 | Ga0068853_100366338 | 3300005539 | Unclassified | 1343 |
| 249 | Ga0068853_100604829 | 3300005539 | Bacteria | 1041 |
| 250 | Ga0068853_100722012 | 3300005539 | Unclassified | 951 |
| 251 | Ga0068853_101248095 | 3300005539 | Bacteria | 718 |
| 252 | Ga0068853_101354105 | 3300005539 | Bacteria | 688 |
| 253 | Ga0068853_101704560 | 3300005539 | Bacteria | 611 |
| 254 | Ga0068853_101773588 | 3300005539 | Unclassified | 598 |
| 255 | Ga0070672_100000891 | 3300005543 | Bacteria | 17929 |
| 256 | Ga0070672_100039214 | 3300005543 | Unclassified | 3626 |
| 257 | Ga0070672_100052704 | 3300005543 | Unclassified | 3177 |
| 258 | Ga0070672_100251835 | 3300005543 | Bacteria | 1487 |
| 259 | Ga0070672_100296308 | 3300005543 | Bacteria | 1370 |
| 260 | Ga0070672_101093836 | 3300005543 | Bacteria | 708 |
| 261 | Ga0070672_101152830 | 3300005543 | Unclassified | 690 |
| 262 | Ga0070686_101470741 | 3300005544 | Unclassified | 573 |
| 263 | Ga0070695_101353976 | 3300005545 | Unclassified | 589 |
| 264 | Ga0070665_100000717 | 3300005548 | Bacteria | 44083 |
| 265 | Ga0070704_100083692 | 3300005549 | Bacteria | 2356 |
| 266 | Ga0070704_100423900 | 3300005549 | Unclassified | 1140 |
| 267 | Ga0070704_101056900 | 3300005549 | Bacteria | 736 |
| 268 | Ga0070704_101256592 | 3300005549 | Bacteria | 677 |
| 269 | Ga0070704_101266160 | 3300005549 | Unclassified | 674 |
| 270 | Ga0070704_101843798 | 3300005549 | Bacteria | 560 |
| 271 | Ga0068855_100000210 | 3300005563 | Bacteria | 74786 |
| 272 | Ga0068855_100013494 | 3300005563 | Bacteria | 9850 |
| 273 | Ga0068855_100019662 | 3300005563 | Bacteria | 8111 |
| 274 | Ga0068855_100033420 | 3300005563 | Bacteria | 6138 |
| 275 | Ga0068855_100131020 | 3300005563 | Bacteria | 2864 |
| 276 | Ga0068855_100166003 | 3300005563 | Bacteria | 2503 |
| 277 | Ga0068855_100200676 | 3300005563 | Bacteria | 2245 |
| 278 | Ga0068855_100309054 | 3300005563 | Bacteria | 1749 |
| 279 | Ga0068855_100603126 | 3300005563 | Bacteria | 1184 |
| 280 | Ga0068855_100831639 | 3300005563 | Unclassified | 979 |
| 281 | Ga0070664_100001395 | 3300005564 | Bacteria | 19263 |
| 282 | Ga0070664_100030956 | 3300005564 | Bacteria | 4467 |
| 283 | Ga0070664_100042086 | 3300005564 | Bacteria | 3857 |
| 284 | Ga0070664_100098645 | 3300005564 | Unclassified | 2538 |
| 285 | Ga0070664_100112355 | 3300005564 | Unclassified | 2379 |
| 286 | Ga0070664_100132197 | 3300005564 | Unclassified | 2192 |
| 287 | Ga0070664_100500562 | 3300005564 | Unclassified | 1120 |
| 288 | Ga0070664_100897438 | 3300005564 | Bacteria | 831 |
| 289 | Ga0070664_101416906 | 3300005564 | Bacteria | 657 |
| 290 | Ga0068857_100001139 | 3300005577 | Bacteria | 20729 |
| 291 | Ga0068857_100011514 | 3300005577 | Bacteria | 7694 |
| 292 | Ga0068857_100023348 | 3300005577 | Bacteria | 5443 |
| 293 | Ga0068857_100031961 | 3300005577 | Bacteria | 4652 |
| 294 | Ga0068857_100086847 | 3300005577 | Bacteria | 2798 |
| 295 | Ga0068857_100111973 | 3300005577 | Bacteria | 2454 |
| 296 | Ga0068857_100131955 | 3300005577 | Bacteria | 2253 |
| 297 | Ga0068857_100259580 | 3300005577 | Unclassified | 1594 |
| 298 | Ga0068857_100389855 | 3300005577 | Bacteria | 1295 |
| 299 | Ga0068857_100729726 | 3300005577 | Bacteria | 943 |
| 300 | Ga0068857_102074695 | 3300005577 | Bacteria | 558 |
| 301 | Ga0068854_100039596 | 3300005578 | Bacteria | 3322 |
| 302 | Ga0068854_100078549 | 3300005578 | Bacteria | 2432 |
| 303 | Ga0068854_100309677 | 3300005578 | Bacteria | 1280 |
| 304 | Ga0068854_100474399 | 3300005578 | Bacteria | 1049 |
| 305 | Ga0068854_101052727 | 3300005578 | Bacteria | 723 |
| 306 | Ga0068854_101489163 | 3300005578 | Bacteria | 614 |
| 307 | Ga0068856_100002822 | 3300005614 | Bacteria | 17786 |
| 308 | Ga0068856_100120763 | 3300005614 | Bacteria | 2622 |
| 309 | Ga0068856_100168942 | 3300005614 | Unclassified | 2199 |
| 310 | Ga0068856_101697243 | 3300005614 | Unclassified | 644 |
| 311 | Ga0070702_100538398 | 3300005615 | Unclassified | 864 |
| 312 | Ga0068852_100028064 | 3300005616 | Bacteria | 4600 |
| 313 | Ga0068852_100119828 | 3300005616 | Unclassified | 2406 |
| 314 | Ga0068852_100125468 | 3300005616 | Bacteria | 2356 |
| 315 | Ga0068852_100179185 | 3300005616 | Unclassified | 1992 |
| 316 | Ga0068852_100310763 | 3300005616 | Bacteria | 1528 |
| 317 | Ga0068852_100411446 | 3300005616 | Bacteria | 1332 |
| 318 | Ga0068852_100786514 | 3300005616 | Bacteria | 965 |
| 319 | Ga0068852_101096546 | 3300005616 | Bacteria | 816 |
| 320 | Ga0068852_101368399 | 3300005616 | Unclassified | 730 |
| 321 | Ga0068852_102030748 | 3300005616 | Bacteria | 597 |
| 322 | Ga0068852_102314564 | 3300005616 | Bacteria | 558 |
| 323 | Ga0068852_102492543 | 3300005616 | Unclassified | 537 |
| 324 | Ga0068852_102518002 | 3300005616 | Unclassified | 535 |
| 325 | Ga0068859_100013947 | 3300005617 | Bacteria | 8061 |
| 326 | Ga0068859_100259173 | 3300005617 | Bacteria | 1830 |
| 327 | Ga0068859_100360211 | 3300005617 | Bacteria | 1549 |
| 328 | Ga0068859_100424214 | 3300005617 | Bacteria | 1426 |
| 329 | Ga0068859_100669199 | 3300005617 | Bacteria | 1130 |
| 330 | Ga0068859_100927488 | 3300005617 | Bacteria | 955 |
| 331 | Ga0068859_101559965 | 3300005617 | Unclassified | 729 |
| 332 | Ga0068859_101941512 | 3300005617 | Bacteria | 650 |
| 333 | Ga0068864_100005533 | 3300005618 | Bacteria | 10357 |
| 334 | Ga0068864_100047444 | 3300005618 | Bacteria | 3689 |
| 335 | Ga0068864_100245303 | 3300005618 | Unclassified | 1661 |
| 336 | Ga0068864_100437828 | 3300005618 | Unclassified | 1248 |
| 337 | Ga0068864_100956887 | 3300005618 | Unclassified | 848 |
| 338 | Ga0068864_101028180 | 3300005618 | Bacteria | 818 |
| 339 | Ga0068864_101128055 | 3300005618 | Unclassified | 781 |
| 340 | Ga0068866_10107701 | 3300005718 | Unclassified | 1549 |
| 341 | Ga0068866_10135369 | 3300005718 | Bacteria | 1407 |
| 342 | Ga0068866_10823681 | 3300005718 | Unclassified | 647 |
| 343 | Ga0068861_100089216 | 3300005719 | Bacteria | 2430 |
| 344 | Ga0068861_100100506 | 3300005719 | Unclassified | 2299 |
| 345 | Ga0068861_100174470 | 3300005719 | Unclassified | 1784 |
| 346 | Ga0068861_100230718 | 3300005719 | Bacteria | 1570 |
| 347 | Ga0068861_100657801 | 3300005719 | Bacteria | 969 |
| 348 | Ga0068861_100893828 | 3300005719 | Unclassified | 841 |
| 349 | Ga0068861_101067162 | 3300005719 | Bacteria | 775 |
| 350 | Ga0068861_101640057 | 3300005719 | Bacteria | 634 |
| 351 | Ga0068851_10007173 | 3300005834 | Bacteria | 5107 |
| 352 | Ga0068851_10050995 | 3300005834 | Bacteria | 2102 |
| 353 | Ga0068851_10062218 | 3300005834 | Bacteria | 1915 |
| 354 | Ga0068851_10110605 | 3300005834 | Bacteria | 1466 |
| 355 | Ga0068851_10122130 | 3300005834 | Bacteria | 1401 |
| 356 | Ga0068851_10940564 | 3300005834 | Unclassified | 543 |
| 357 | Ga0068870_10009083 | 3300005840 | Bacteria | 4502 |
| 358 | Ga0068870_10025610 | 3300005840 | Unclassified | 2930 |
| 359 | Ga0068870_10163524 | 3300005840 | Unclassified | 1322 |
| 360 | Ga0068870_10234500 | 3300005840 | Bacteria | 1130 |
| 361 | Ga0068863_100007041 | 3300005841 | Bacteria | 11020 |
| 362 | Ga0068863_100045831 | 3300005841 | Bacteria | 4150 |
| 363 | Ga0068863_100081203 | 3300005841 | Bacteria | 3071 |
| 364 | Ga0068863_100101556 | 3300005841 | Bacteria | 2734 |
| 365 | Ga0068863_100510458 | 3300005841 | Bacteria | 1184 |
| 366 | Ga0068863_101197020 | 3300005841 | Bacteria | 766 |
| 367 | Ga0068858_100015215 | 3300005842 | Bacteria | 7237 |
| 368 | Ga0068858_100108630 | 3300005842 | Bacteria | 2590 |
| 369 | Ga0068858_100240779 | 3300005842 | Unclassified | 1717 |
| 370 | Ga0068858_100406117 | 3300005842 | Bacteria | 1309 |
| 371 | Ga0068858_100502218 | 3300005842 | Unclassified | 1172 |
| 372 | Ga0068858_100599173 | 3300005842 | Bacteria | 1069 |
| 373 | Ga0068858_102500870 | 3300005842 | Unclassified | 510 |
| 374 | Ga0068860_100000004 | 3300005843 | Bacteria | 506126 |
| 375 | Ga0068860_100007960 | 3300005843 | Bacteria | 10572 |
| 376 | Ga0068860_100020751 | 3300005843 | Bacteria | 6364 |
| 377 | Ga0068860_100233604 | 3300005843 | Unclassified | 1787 |
| 378 | Ga0068860_100506895 | 3300005843 | Bacteria | 1205 |
| 379 | Ga0068860_100750878 | 3300005843 | Unclassified | 987 |
| 380 | Ga0068860_101326006 | 3300005843 | Bacteria | 741 |
| 381 | Ga0068862_100005611 | 3300005844 | Bacteria | 10488 |
| 382 | Ga0068862_100158940 | 3300005844 | Bacteria | 2016 |
| 383 | Ga0068862_100197896 | 3300005844 | Unclassified | 1811 |
| 384 | Ga0068862_100341456 | 3300005844 | Bacteria | 1387 |
| 385 | Ga0068862_100408531 | 3300005844 | Bacteria | 1271 |
| 386 | Ga0068862_101069346 | 3300005844 | Bacteria | 801 |
| 387 | Ga0068862_101666483 | 3300005844 | Unclassified | 646 |
| 388 | Ga0081540_1229819 | 3300005983 | Bacteria | 655 |
| 389 | Ga0081539_10028019 | 3300005985 | Unclassified | 3552 |
| 390 | Ga0070715_10104756 | 3300006163 | Bacteria | 1325 |
| 391 | Ga0070716_101598154 | 3300006173 | Bacteria | 535 |
| 392 | Ga0075366_10023733 | 3300006195 | Bacteria | 3574 |
| 393 | Ga0075366_10044341 | 3300006195 | Bacteria | 2636 |
| 394 | Ga0075366_10057126 | 3300006195 | Bacteria | 2319 |
| 395 | Ga0075366_10218143 | 3300006195 | Bacteria | 1162 |
| 396 | Ga0075366_10235577 | 3300006195 | Bacteria | 1116 |
| 397 | Ga0075366_10357496 | 3300006195 | Bacteria | 897 |
| 398 | Ga0075366_10542250 | 3300006195 | Bacteria | 720 |
| 399 | Ga0097621_100013926 | 3300006237 | Bacteria | 6006 |
| 400 | Ga0097621_100193560 | 3300006237 | Unclassified | 1762 |
| 401 | Ga0097621_100385504 | 3300006237 | Bacteria | 1252 |
| 402 | Ga0097621_100596043 | 3300006237 | Bacteria | 1009 |
| 403 | Ga0097621_100654672 | 3300006237 | Bacteria | 964 |
| 404 | Ga0097621_100891584 | 3300006237 | Bacteria | 828 |
| 405 | Ga0097621_101488749 | 3300006237 | Bacteria | 642 |
| 406 | Ga0097621_101778565 | 3300006237 | Unclassified | 587 |
| 407 | Ga0097621_102042925 | 3300006237 | Unclassified | 548 |
| 408 | Ga0068871_100000076 | 3300006358 | Bacteria | 55186 |
| 409 | Ga0068871_100006134 | 3300006358 | Bacteria | 8470 |
| 410 | Ga0068871_100061130 | 3300006358 | Bacteria | 3075 |
| 411 | Ga0068871_101753233 | 3300006358 | Unclassified | 589 |
| 412 | Ga0075428_100003531 | 3300006844 | Bacteria | 17124 |
| 413 | Ga0075428_100022783 | 3300006844 | Bacteria | 6931 |
| 414 | Ga0075428_100067391 | 3300006844 | Bacteria | 3918 |
| 415 | Ga0075428_100863557 | 3300006844 | Bacteria | 960 |
| 416 | Ga0075428_102009797 | 3300006844 | Bacteria | 599 |
| 417 | Ga0075428_102650439 | 3300006844 | Bacteria | 511 |
| 418 | Ga0075430_100003285 | 3300006846 | Bacteria | 13558 |
| 419 | Ga0075430_100078318 | 3300006846 | Bacteria | 2771 |
| 420 | Ga0075431_100003484 | 3300006847 | Bacteria | 15256 |
| 421 | Ga0075431_100106799 | 3300006847 | Bacteria | 2888 |
| 422 | Ga0075431_100169083 | 3300006847 | Bacteria | 2247 |
| 423 | Ga0075434_100257710 | 3300006871 | Unclassified | 1763 |
| 424 | Ga0075434_100468230 | 3300006871 | Unclassified | 1281 |
| 425 | Ga0075434_102369302 | 3300006871 | Bacteria | 533 |
| 426 | Ga0075429_100000539 | 3300006880 | Bacteria | 28785 |
| 427 | Ga0075429_100018881 | 3300006880 | Bacteria | 5973 |
| 428 | Ga0075429_100023645 | 3300006880 | Bacteria | 5332 |
| 429 | Ga0075429_101386936 | 3300006880 | Bacteria | 612 |
| 430 | Ga0068865_100004770 | 3300006881 | Bacteria | 8200 |
| 431 | Ga0068865_100189841 | 3300006881 | Bacteria | 1588 |
| 432 | Ga0068865_100471839 | 3300006881 | Bacteria | 1041 |
| 433 | Ga0068865_101007712 | 3300006881 | Bacteria | 729 |
| 434 | Ga0097620_100013947 | 3300006931 | Bacteria | 8061 |
| 435 | Ga0097620_100259160 | 3300006931 | Bacteria | 1830 |
| 436 | Ga0097620_100360205 | 3300006931 | Bacteria | 1549 |
| 437 | Ga0097620_100424215 | 3300006931 | Bacteria | 1426 |
| 438 | Ga0097620_100669149 | 3300006931 | Bacteria | 1130 |
| 439 | Ga0097620_100927408 | 3300006931 | Bacteria | 955 |
| 440 | Ga0097620_101559565 | 3300006931 | Unclassified | 729 |
| 441 | Ga0097620_101941053 | 3300006931 | Bacteria | 650 |
| 442 | Ga0075435_100671700 | 3300007076 | Unclassified | 900 |
| 443 | Ga0105251_10581992 | 3300009011 | Unclassified | 530 |
| 444 | Ga0105240_10002773 | 3300009093 | Bacteria | 27676 |
| 445 | Ga0105240_10014724 | 3300009093 | Bacteria | 10669 |
| 446 | Ga0105240_10078635 | 3300009093 | Bacteria | 4061 |
| 447 | Ga0105240_10122116 | 3300009093 | Unclassified | 3135 |
| 448 | Ga0105240_10268604 | 3300009093 | Bacteria | 1965 |
| 449 | Ga0105240_10417752 | 3300009093 | Bacteria | 1508 |
| 450 | Ga0105240_11028167 | 3300009093 | Unclassified | 880 |
| 451 | Ga0105240_11676293 | 3300009093 | Bacteria | 664 |
| 452 | Ga0105240_12736745 | 3300009093 | Unclassified | 508 |
| 453 | Ga0111539_10002138 | 3300009094 | Bacteria | 26441 |
| 454 | Ga0111539_10022224 | 3300009094 | Bacteria | 7798 |
| 455 | Ga0111539_10149801 | 3300009094 | Bacteria | 2731 |
| 456 | Ga0111539_10434093 | 3300009094 | Unclassified | 1529 |
| 457 | Ga0111539_10919964 | 3300009094 | Bacteria | 1017 |
| 458 | Ga0111539_11018787 | 3300009094 | Bacteria | 962 |
| 459 | Ga0111539_11135765 | 3300009094 | Bacteria | 908 |
| 460 | Ga0111539_11544361 | 3300009094 | Bacteria | 770 |
| 461 | Ga0111539_12137950 | 3300009094 | Unclassified | 649 |
| 462 | Ga0111539_12372126 | 3300009094 | Bacteria | 615 |
| 463 | Ga0105245_11474491 | 3300009098 | Bacteria | 731 |
| 464 | Ga0105247_10684236 | 3300009101 | Bacteria | 770 |
| 465 | Ga0114129_10005173 | 3300009147 | Bacteria | 18361 |
| 466 | Ga0114129_10044760 | 3300009147 | Bacteria | 6226 |
| 467 | Ga0114129_10135425 | 3300009147 | Bacteria | 3380 |
| 468 | Ga0114129_10469584 | 3300009147 | Unclassified | 1648 |
| 469 | Ga0105243_10258408 | 3300009148 | Unclassified | 1558 |
| 470 | Ga0105241_10152728 | 3300009174 | Bacteria | 1890 |
| 471 | Ga0105241_10183548 | 3300009174 | Unclassified | 1737 |
| 472 | Ga0105241_10308399 | 3300009174 | Unclassified | 1361 |
| 473 | Ga0105241_10357373 | 3300009174 | Unclassified | 1270 |
| 474 | Ga0105241_10611932 | 3300009174 | Archaea | 985 |
| 475 | Ga0105241_10779213 | 3300009174 | Bacteria | 879 |
| 476 | Ga0105241_10841871 | 3300009174 | Unclassified | 848 |
| 477 | Ga0105242_10028757 | 3300009176 | Bacteria | 4427 |
| 478 | Ga0105242_10032198 | 3300009176 | Bacteria | 4192 |
| 479 | Ga0105242_10090483 | 3300009176 | Bacteria | 2574 |
| 480 | Ga0105242_10199971 | 3300009176 | Bacteria | 1774 |
| 481 | Ga0105242_10205153 | 3300009176 | Unclassified | 1753 |
| 482 | Ga0105242_10248027 | 3300009176 | Bacteria | 1603 |
| 483 | Ga0105242_13039464 | 3300009176 | Bacteria | 519 |
| 484 | Ga0105248_10020088 | 3300009177 | Bacteria | 7400 |
| 485 | Ga0105248_10348836 | 3300009177 | Unclassified | 1666 |
| 486 | Ga0105248_11727454 | 3300009177 | Bacteria | 709 |
| 487 | Ga0105237_10011361 | 3300009545 | Bacteria | 9421 |
| 488 | Ga0105237_10035708 | 3300009545 | Bacteria | 5029 |
| 489 | Ga0105237_10216508 | 3300009545 | Unclassified | 1915 |
| 490 | Ga0105237_11291167 | 3300009545 | Bacteria | 736 |
| 491 | Ga0105238_10226021 | 3300009551 | Unclassified | 1848 |
| 492 | Ga0105238_10636568 | 3300009551 | Unclassified | 1076 |
| 493 | Ga0105249_10005610 | 3300009553 | Bacteria | 10854 |
| 494 | Ga0105249_10031654 | 3300009553 | Bacteria | 4784 |
| 495 | Ga0105249_10077890 | 3300009553 | Bacteria | 3075 |
| 496 | Ga0105249_10112450 | 3300009553 | Unclassified | 2575 |
| 497 | Ga0105249_10118001 | 3300009553 | Bacteria | 2517 |
| 498 | Ga0105249_10404191 | 3300009553 | Bacteria | 1396 |
| 499 | Ga0105249_10421211 | 3300009553 | Unclassified | 1369 |
| 500 | Ga0105249_10501367 | 3300009553 | Bacteria | 1259 |
| 501 | Ga0105249_12165957 | 3300009553 | Unclassified | 629 |
| 502 | Ga0099796_10220122 | 3300010159 | Bacteria | 778 |
| 503 | Ga0105239_10015012 | 3300010375 | Bacteria | 8586 |
| 504 | Ga0105239_10017962 | 3300010375 | Bacteria | 7822 |
| 505 | Ga0105239_10182821 | 3300010375 | Unclassified | 2346 |
| 506 | Ga0105239_10358684 | 3300010375 | Unclassified | 1646 |
| 507 | Ga0105239_10497244 | 3300010375 | Bacteria | 1386 |
| 508 | Ga0105239_10707686 | 3300010375 | Unclassified | 1152 |
| 509 | Ga0105239_10753466 | 3300010375 | Unclassified | 1115 |
| 510 | Ga0105239_11221869 | 3300010375 | Bacteria | 866 |
| 511 | Ga0105239_11537888 | 3300010375 | Unclassified | 769 |
| 512 | Ga0105239_12184380 | 3300010375 | Bacteria | 644 |
| 513 | Ga0105246_10072803 | 3300011119 | Bacteria | 2424 |
| 514 | Ga0105246_10086311 | 3300011119 | Unclassified | 2249 |
| 515 | Ga0105246_10618161 | 3300011119 | Unclassified | 939 |
| 516 | Ga0105246_11799013 | 3300011119 | Unclassified | 585 |
| 517 | Ga0157373_10002704 | 3300013100 | Bacteria | 13435 |
| 518 | Ga0157373_10019662 | 3300013100 | Bacteria | 4913 |
| 519 | Ga0157373_10021506 | 3300013100 | Bacteria | 4685 |
| 520 | Ga0157373_10196220 | 3300013100 | Bacteria | 1423 |
| 521 | Ga0157373_10228670 | 3300013100 | Bacteria | 1313 |
| 522 | Ga0157373_10507577 | 3300013100 | Bacteria | 871 |
| 523 | Ga0157373_10963142 | 3300013100 | Bacteria | 635 |
| 524 | Ga0157373_11053689 | 3300013100 | Bacteria | 609 |
| 525 | Ga0157373_11108618 | 3300013100 | Bacteria | 594 |
| 526 | Ga0157373_11355229 | 3300013100 | Bacteria | 540 |
| 527 | Ga0157371_10001533 | 3300013102 | Bacteria | 23794 |
| 528 | Ga0157371_10001693 | 3300013102 | Bacteria | 22451 |
| 529 | Ga0157371_10001829 | 3300013102 | Bacteria | 21446 |
| 530 | Ga0157371_10002330 | 3300013102 | Bacteria | 18216 |
| 531 | Ga0157371_10011626 | 3300013102 | Bacteria | 6767 |
| 532 | Ga0157371_10018324 | 3300013102 | Bacteria | 5178 |
| 533 | Ga0157371_10021176 | 3300013102 | Bacteria | 4775 |
| 534 | Ga0157371_10029612 | 3300013102 | Bacteria | 3957 |
| 535 | Ga0157371_10038547 | 3300013102 | Bacteria | 3418 |
| 536 | Ga0157371_10059402 | 3300013102 | Bacteria | 2711 |
| 537 | Ga0157371_10071327 | 3300013102 | Unclassified | 2459 |
| 538 | Ga0157371_10119043 | 3300013102 | Bacteria | 1877 |
| 539 | Ga0157371_10160572 | 3300013102 | Bacteria | 1605 |
| 540 | Ga0157371_10184413 | 3300013102 | Bacteria | 1493 |
| 541 | Ga0157371_10208722 | 3300013102 | Bacteria | 1401 |
| 542 | Ga0157371_10210062 | 3300013102 | Bacteria | 1397 |
| 543 | Ga0157371_10234254 | 3300013102 | Bacteria | 1320 |
| 544 | Ga0157371_10362065 | 3300013102 | Bacteria | 1057 |
| 545 | Ga0157371_10382135 | 3300013102 | Bacteria | 1028 |
| 546 | Ga0157371_10440790 | 3300013102 | Bacteria | 957 |
| 547 | Ga0157371_10524347 | 3300013102 | Bacteria | 876 |
| 548 | Ga0157371_11227938 | 3300013102 | Unclassified | 578 |
| 549 | Ga0157370_10002958 | 3300013104 | Bacteria | 20221 |
| 550 | Ga0157370_10046504 | 3300013104 | Bacteria | 4161 |
| 551 | Ga0157370_10106933 | 3300013104 | Bacteria | 2618 |
| 552 | Ga0157370_10348395 | 3300013104 | Bacteria | 1365 |
| 553 | Ga0157370_10420745 | 3300013104 | Bacteria | 1229 |
| 554 | Ga0157370_10542836 | 3300013104 | Unclassified | 1066 |
| 555 | Ga0157370_10701646 | 3300013104 | Bacteria | 924 |
| 556 | Ga0157370_10804684 | 3300013104 | Bacteria | 855 |
| 557 | Ga0157370_11116168 | 3300013104 | Bacteria | 712 |
| 558 | Ga0157370_11250469 | 3300013104 | Bacteria | 669 |
| 559 | Ga0157370_11604159 | 3300013104 | Bacteria | 585 |
| 560 | Ga0157369_10027523 | 3300013105 | Bacteria | 6301 |
| 561 | Ga0157369_10028011 | 3300013105 | Bacteria | 6239 |
| 562 | Ga0157369_10052489 | 3300013105 | Bacteria | 4410 |
| 563 | Ga0157369_10381472 | 3300013105 | Bacteria | 1463 |
| 564 | Ga0157369_10916103 | 3300013105 | Bacteria | 899 |
| 565 | Ga0157369_11381018 | 3300013105 | Bacteria | 717 |
| 566 | Ga0157369_11499312 | 3300013105 | Bacteria | 686 |
| 567 | Ga0157369_11894447 | 3300013105 | Unclassified | 605 |
| 568 | Ga0157369_11946669 | 3300013105 | Bacteria | 597 |
| 569 | Ga0157369_12291957 | 3300013105 | Bacteria | 547 |
| 570 | Ga0157374_10005530 | 3300013296 | Bacteria | 10626 |
| 571 | Ga0157374_10087995 | 3300013296 | Bacteria | 2958 |
| 572 | Ga0157374_10156970 | 3300013296 | Unclassified | 2215 |
| 573 | Ga0157374_10162410 | 3300013296 | Unclassified | 2176 |
| 574 | Ga0157374_10371371 | 3300013296 | Bacteria | 1424 |
| 575 | Ga0157374_10371449 | 3300013296 | Bacteria | 1423 |
| 576 | Ga0157374_10885639 | 3300013296 | Bacteria | 910 |
| 577 | Ga0157374_10891286 | 3300013296 | Bacteria | 907 |
| 578 | Ga0157374_10933942 | 3300013296 | Bacteria | 886 |
| 579 | Ga0157378_10013114 | 3300013297 | Bacteria | 7252 |
| 580 | Ga0157378_10066114 | 3300013297 | Unclassified | 3237 |
| 581 | Ga0157378_10166419 | 3300013297 | Bacteria | 2065 |
| 582 | Ga0157378_10686741 | 3300013297 | Unclassified | 1042 |
| 583 | Ga0157378_12267118 | 3300013297 | Unclassified | 594 |
| 584 | Ga0163162_10001306 | 3300013306 | Bacteria | 23316 |
| 585 | Ga0163162_10002620 | 3300013306 | Bacteria | 17068 |
| 586 | Ga0163162_10003840 | 3300013306 | Bacteria | 14404 |
| 587 | Ga0163162_10013381 | 3300013306 | Bacteria | 8013 |
| 588 | Ga0163162_10022875 | 3300013306 | Bacteria | 6163 |
| 589 | Ga0163162_10171390 | 3300013306 | Bacteria | 2295 |
| 590 | Ga0163162_10220623 | 3300013306 | Bacteria | 2026 |
| 591 | Ga0163162_10426408 | 3300013306 | Bacteria | 1458 |
| 592 | Ga0163162_10681328 | 3300013306 | Bacteria | 1151 |
| 593 | Ga0163162_11173128 | 3300013306 | Bacteria | 871 |
| 594 | Ga0163162_12816191 | 3300013306 | Bacteria | 560 |
| 595 | Ga0157372_10033742 | 3300013307 | Bacteria | 5624 |
| 596 | Ga0157372_10036205 | 3300013307 | Bacteria | 5439 |
| 597 | Ga0157372_10039132 | 3300013307 | Bacteria | 5235 |
| 598 | Ga0157372_10062107 | 3300013307 | Unclassified | 4185 |
| 599 | Ga0157372_10074457 | 3300013307 | Bacteria | 3829 |
| 600 | Ga0157372_10108796 | 3300013307 | Bacteria | 3173 |
| 601 | Ga0157372_10173771 | 3300013307 | Bacteria | 2493 |
| 602 | Ga0157372_10228957 | 3300013307 | Bacteria | 2155 |
| 603 | Ga0157372_10396117 | 3300013307 | Bacteria | 1609 |
| 604 | Ga0157372_10545396 | 3300013307 | Bacteria | 1352 |
| 605 | Ga0157372_10579821 | 3300013307 | Bacteria | 1307 |
| 606 | Ga0157372_10725767 | 3300013307 | Bacteria | 1156 |
| 607 | Ga0157372_10771811 | 3300013307 | Bacteria | 1117 |
| 608 | Ga0157372_10842069 | 3300013307 | Bacteria | 1065 |
| 609 | Ga0157372_10854859 | 3300013307 | Bacteria | 1056 |
| 610 | Ga0157372_10857681 | 3300013307 | Unclassified | 1054 |
| 611 | Ga0157372_10881933 | 3300013307 | Bacteria | 1038 |
| 612 | Ga0157372_10951457 | 3300013307 | Unclassified | 996 |
| 613 | Ga0157372_11433923 | 3300013307 | Unclassified | 796 |
| 614 | Ga0157372_11479885 | 3300013307 | Bacteria | 782 |
| 615 | Ga0157372_11774931 | 3300013307 | Unclassified | 710 |
| 616 | Ga0157372_12676452 | 3300013307 | Bacteria | 572 |
| 617 | Ga0157372_13212195 | 3300013307 | Unclassified | 521 |
| 618 | Ga0157375_10000754 | 3300013308 | Bacteria | 28363 |
| 619 | Ga0157375_10006460 | 3300013308 | Bacteria | 10211 |
| 620 | Ga0157375_10029310 | 3300013308 | Bacteria | 5174 |
| 621 | Ga0157375_10054153 | 3300013308 | Bacteria | 3951 |
| 622 | Ga0157375_10065453 | 3300013308 | Bacteria | 3624 |
| 623 | Ga0157375_10438656 | 3300013308 | Bacteria | 1472 |
| 624 | Ga0157375_10645273 | 3300013308 | Bacteria | 1215 |
| 625 | Ga0157375_10689479 | 3300013308 | Bacteria | 1176 |
| 626 | Ga0157375_12056566 | 3300013308 | Unclassified | 679 |
| 627 | Ga0163163_10001404 | 3300014325 | Bacteria | 20324 |
| 628 | Ga0163163_10008917 | 3300014325 | Bacteria | 8935 |
| 629 | Ga0163163_10018486 | 3300014325 | Bacteria | 6526 |
| 630 | Ga0163163_10133033 | 3300014325 | Bacteria | 2527 |
| 631 | Ga0163163_10267727 | 3300014325 | Unclassified | 1760 |
| 632 | Ga0163163_10540540 | 3300014325 | Bacteria | 1228 |
| 633 | Ga0163163_10652846 | 3300014325 | Bacteria | 1115 |
| 634 | Ga0163163_10870936 | 3300014325 | Bacteria | 964 |
| 635 | Ga0163163_10985242 | 3300014325 | Bacteria | 906 |
| 636 | Ga0163163_12554492 | 3300014325 | Unclassified | 569 |
| 637 | Ga0157380_10000955 | 3300014326 | Bacteria | 18339 |
| 638 | Ga0157380_10094278 | 3300014326 | Unclassified | 2477 |
| 639 | Ga0157380_10115010 | 3300014326 | Bacteria | 2268 |
| 640 | Ga0157380_10195776 | 3300014326 | Bacteria | 1789 |
| 641 | Ga0157380_10420825 | 3300014326 | Unclassified | 1274 |
| 642 | Ga0157380_10470314 | 3300014326 | Unclassified | 1213 |
| 643 | Ga0157380_10751118 | 3300014326 | Bacteria | 987 |
| 644 | Ga0157380_10894643 | 3300014326 | Unclassified | 913 |
| 645 | Ga0157380_11258074 | 3300014326 | Bacteria | 786 |
| 646 | Ga0157380_12537020 | 3300014326 | Bacteria | 578 |
| 647 | Ga0157380_12638680 | 3300014326 | Unclassified | 569 |
| 648 | Ga0157380_13135733 | 3300014326 | Unclassified | 527 |
| 649 | Ga0157377_10000680 | 3300014745 | Bacteria | 14060 |
| 650 | Ga0157377_10006129 | 3300014745 | Bacteria | 5709 |
| 651 | Ga0157377_10069521 | 3300014745 | Bacteria | 2032 |
| 652 | Ga0157377_10316267 | 3300014745 | Unclassified | 1036 |
| 653 | Ga0157377_11640248 | 3300014745 | Bacteria | 516 |
| 654 | Ga0157377_11746041 | 3300014745 | Unclassified | 503 |
| 655 | Ga0157379_10013306 | 3300014968 | Bacteria | 7205 |
| 656 | Ga0157379_10031078 | 3300014968 | Bacteria | 4758 |
| 657 | Ga0157379_10051382 | 3300014968 | Unclassified | 3682 |
| 658 | Ga0157379_10560273 | 3300014968 | Bacteria | 1064 |
| 659 | Ga0157379_10746417 | 3300014968 | Bacteria | 921 |
| 660 | Ga0157379_11547958 | 3300014968 | Bacteria | 646 |
| 661 | Ga0157379_11753436 | 3300014968 | Unclassified | 609 |
| 662 | Ga0157376_10002174 | 3300014969 | Bacteria | 13210 |
| 663 | Ga0157376_10007024 | 3300014969 | Bacteria | 7991 |
| 664 | Ga0157376_10035604 | 3300014969 | Bacteria | 4028 |
| 665 | Ga0157376_10156953 | 3300014969 | Bacteria | 2058 |
| 666 | Ga0157376_10263235 | 3300014969 | Bacteria | 1616 |
| 667 | Ga0157376_10550898 | 3300014969 | Bacteria | 1141 |
| 668 | Ga0157376_10686374 | 3300014969 | Unclassified | 1028 |
| 669 | Ga0157376_11019699 | 3300014969 | Unclassified | 851 |
| 670 | Ga0157376_11031486 | 3300014969 | Bacteria | 846 |
| 671 | Ga0157376_11476542 | 3300014969 | Bacteria | 712 |
| 672 | Ga0157376_11498510 | 3300014969 | Unclassified | 707 |
| 673 | Ga0182005_1000040 | 3300015265 | Bacteria | 151222 |
| 674 | Ga0163161_10002032 | 3300017792 | Bacteria | 14653 |
| 675 | Ga0163161_10005284 | 3300017792 | Bacteria | 8989 |
| 676 | Ga0163161_10177147 | 3300017792 | Bacteria | 1633 |
| 677 | Ga0163161_10836691 | 3300017792 | Unclassified | 776 |
| 678 | Ga0163161_10918078 | 3300017792 | Bacteria | 743 |
| 679 | Ga0163161_11109364 | 3300017792 | Unclassified | 680 |
| 680 | Ga0163161_11213525 | 3300017792 | Unclassified | 653 |
| 681 | Ga0209436_101017 | 3300025208 | Bacteria | 10735 |
| 682 | Ga0209436_103090 | 3300025208 | Bacteria | 4585 |
| 683 | Ga0209258_100075 | 3300025242 | Bacteria | 270751 |
| 684 | Ga0209258_118247 | 3300025242 | Bacteria | 759 |
| 685 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 686 | Ga0209646_1023538 | 3300025246 | Bacteria | 873 |
| 687 | Ga0209026_1000312 | 3300025250 | Bacteria | 52141 |
| 688 | Ga0209148_1000085 | 3300025254 | Bacteria | 265193 |
| 689 | Ga0209129_1040498 | 3300025258 | Bacteria | 740 |
| 690 | Ga0209673_1000197 | 3300025273 | Bacteria | 121313 |
| 691 | Ga0209130_1001772 | 3300025284 | Bacteria | 12744 |
| 692 | Ga0209758_1000742 | 3300025297 | Bacteria | 47450 |
| 693 | Ga0209758_1020083 | 3300025297 | Bacteria | 3181 |
| 694 | Ga0209758_1037270 | 3300025297 | Bacteria | 1882 |
| 695 | Ga0209050_1000204 | 3300025298 | Bacteria | 133087 |
| 696 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 697 | Ga0207426_1000332 | 3300025302 | Bacteria | 89192 |
| 698 | Ga0207426_1001542 | 3300025302 | Bacteria | 18718 |
| 699 | Ga0207426_1003820 | 3300025302 | Bacteria | 7784 |
| 700 | Ga0209051_1039742 | 3300025303 | Bacteria | 1695 |
| 701 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 702 | Ga0209257_1007784 | 3300025304 | Bacteria | 6356 |
| 703 | Ga0207697_10020826 | 3300025315 | Bacteria | 2684 |
| 704 | Ga0207697_10118976 | 3300025315 | Unclassified | 1136 |
| 705 | Ga0207697_10173480 | 3300025315 | Unclassified | 944 |
| 706 | Ga0207697_10357642 | 3300025315 | Unclassified | 648 |
| 707 | Ga0207656_10023282 | 3300025321 | Unclassified | 2492 |
| 708 | Ga0207656_10682167 | 3300025321 | Unclassified | 526 |
| 709 | Ga0207682_10142181 | 3300025893 | Bacteria | 1077 |
| 710 | Ga0207682_10153287 | 3300025893 | Bacteria | 1040 |
| 711 | Ga0207642_10075607 | 3300025899 | Unclassified | 1618 |
| 712 | Ga0207642_10128929 | 3300025899 | Bacteria | 1317 |
| 713 | Ga0207642_10902622 | 3300025899 | Bacteria | 566 |
| 714 | Ga0207688_10444780 | 3300025901 | Unclassified | 807 |
| 715 | Ga0207680_10005285 | 3300025903 | Bacteria | 6164 |
| 716 | Ga0207680_10011886 | 3300025903 | Bacteria | 4418 |
| 717 | Ga0207680_10129084 | 3300025903 | Unclassified | 1664 |
| 718 | Ga0207680_10207005 | 3300025903 | Unclassified | 1340 |
| 719 | Ga0207680_10807016 | 3300025903 | Bacteria | 673 |
| 720 | Ga0207647_10005350 | 3300025904 | Bacteria | 9434 |
| 721 | Ga0207647_10087715 | 3300025904 | Unclassified | 1858 |
| 722 | Ga0207647_10190289 | 3300025904 | Bacteria | 1189 |
| 723 | Ga0207647_10286589 | 3300025904 | Bacteria | 939 |
| 724 | Ga0207685_10107432 | 3300025905 | Bacteria | 1204 |
| 725 | Ga0207685_10120795 | 3300025905 | Bacteria | 1150 |
| 726 | Ga0207685_10310243 | 3300025905 | Bacteria | 783 |
| 727 | Ga0207645_10008166 | 3300025907 | Bacteria | 7330 |
| 728 | Ga0207645_10044413 | 3300025907 | Bacteria | 2844 |
| 729 | Ga0207645_10068778 | 3300025907 | Bacteria | 2265 |
| 730 | Ga0207645_10087134 | 3300025907 | Bacteria | 2006 |
| 731 | Ga0207643_10005497 | 3300025908 | Bacteria | 6774 |
| 732 | Ga0207643_10027531 | 3300025908 | Bacteria | 3152 |
| 733 | Ga0207643_10341390 | 3300025908 | Bacteria | 939 |
| 734 | Ga0207705_10004610 | 3300025909 | Bacteria | 10402 |
| 735 | Ga0207705_10040871 | 3300025909 | Unclassified | 3326 |
| 736 | Ga0207705_10047164 | 3300025909 | Bacteria | 3098 |
| 737 | Ga0207705_10058642 | 3300025909 | Bacteria | 2777 |
| 738 | Ga0207705_10078637 | 3300025909 | Unclassified | 2401 |
| 739 | Ga0207705_10258498 | 3300025909 | Bacteria | 1329 |
| 740 | Ga0207705_10611462 | 3300025909 | Bacteria | 847 |
| 741 | Ga0207705_10940187 | 3300025909 | Bacteria | 669 |
| 742 | Ga0207684_11625681 | 3300025910 | Bacteria | 522 |
| 743 | Ga0207654_10121539 | 3300025911 | Unclassified | 1641 |
| 744 | Ga0207654_10164170 | 3300025911 | Bacteria | 1437 |
| 745 | Ga0207654_10396069 | 3300025911 | Unclassified | 959 |
| 746 | Ga0207707_10213510 | 3300025912 | Bacteria | 1680 |
| 747 | Ga0207707_10712946 | 3300025912 | Bacteria | 841 |
| 748 | Ga0207707_11215977 | 3300025912 | Bacteria | 609 |
| 749 | Ga0207695_10000568 | 3300025913 | Bacteria | 75553 |
| 750 | Ga0207695_10001216 | 3300025913 | Bacteria | 44107 |
| 751 | Ga0207695_10023739 | 3300025913 | Bacteria | 6920 |
| 752 | Ga0207695_10145163 | 3300025913 | Unclassified | 2318 |
| 753 | Ga0207695_10260665 | 3300025913 | Unclassified | 1631 |
| 754 | Ga0207695_10705318 | 3300025913 | Unclassified | 890 |
| 755 | Ga0207671_10002095 | 3300025914 | Bacteria | 21819 |
| 756 | Ga0207671_10002783 | 3300025914 | Bacteria | 18250 |
| 757 | Ga0207671_10006310 | 3300025914 | Bacteria | 10589 |
| 758 | Ga0207671_10021805 | 3300025914 | Bacteria | 4853 |
| 759 | Ga0207660_10009646 | 3300025917 | Bacteria | 6249 |
| 760 | Ga0207660_10089701 | 3300025917 | Bacteria | 2276 |
| 761 | Ga0207660_10158337 | 3300025917 | Unclassified | 1745 |
| 762 | Ga0207660_10227636 | 3300025917 | Bacteria | 1465 |
| 763 | Ga0207660_11194969 | 3300025917 | Unclassified | 619 |
| 764 | Ga0207662_10340173 | 3300025918 | Unclassified | 1005 |
| 765 | Ga0207657_10003942 | 3300025919 | Bacteria | 15761 |
| 766 | Ga0207657_10021914 | 3300025919 | Bacteria | 6000 |
| 767 | Ga0207657_10068979 | 3300025919 | Bacteria | 3002 |
| 768 | Ga0207657_10074998 | 3300025919 | Bacteria | 2855 |
| 769 | Ga0207657_10163186 | 3300025919 | Bacteria | 1809 |
| 770 | Ga0207657_10282099 | 3300025919 | Bacteria | 1318 |
| 771 | Ga0207657_10593794 | 3300025919 | Bacteria | 864 |
| 772 | Ga0207657_10617524 | 3300025919 | Bacteria | 845 |
| 773 | Ga0207657_11032653 | 3300025919 | Bacteria | 630 |
| 774 | Ga0207657_11145477 | 3300025919 | Bacteria | 593 |
| 775 | Ga0207649_10000604 | 3300025920 | Bacteria | 24340 |
| 776 | Ga0207649_10292252 | 3300025920 | Bacteria | 1189 |
| 777 | Ga0207649_10297339 | 3300025920 | Bacteria | 1179 |
| 778 | Ga0207652_10001482 | 3300025921 | Bacteria | 20761 |
| 779 | Ga0207652_10013784 | 3300025921 | Bacteria | 6538 |
| 780 | Ga0207652_10053513 | 3300025921 | Unclassified | 3467 |
| 781 | Ga0207652_10891400 | 3300025921 | Bacteria | 786 |
| 782 | Ga0207646_10296134 | 3300025922 | Unclassified | 1462 |
| 783 | Ga0207681_10033369 | 3300025923 | Bacteria | 3374 |
| 784 | Ga0207681_10404124 | 3300025923 | Bacteria | 1104 |
| 785 | Ga0207681_10766923 | 3300025923 | Bacteria | 805 |
| 786 | Ga0207681_10817193 | 3300025923 | Bacteria | 779 |
| 787 | Ga0207681_11320138 | 3300025923 | Bacteria | 606 |
| 788 | Ga0207681_11343887 | 3300025923 | Bacteria | 600 |
| 789 | Ga0207694_10208788 | 3300025924 | Unclassified | 1590 |
| 790 | Ga0207694_10445343 | 3300025924 | Unclassified | 1081 |
| 791 | Ga0207694_11045740 | 3300025924 | Unclassified | 691 |
| 792 | Ga0207650_10002421 | 3300025925 | Bacteria | 12992 |
| 793 | Ga0207650_10005929 | 3300025925 | Bacteria | 8338 |
| 794 | Ga0207650_10079577 | 3300025925 | Bacteria | 2482 |
| 795 | Ga0207650_10091924 | 3300025925 | Bacteria | 2320 |
| 796 | Ga0207650_10105464 | 3300025925 | Unclassified | 2176 |
| 797 | Ga0207650_10364216 | 3300025925 | Unclassified | 1191 |
| 798 | Ga0207650_10517158 | 3300025925 | Unclassified | 999 |
| 799 | Ga0207650_10899888 | 3300025925 | Bacteria | 751 |
| 800 | Ga0207659_10034609 | 3300025926 | Bacteria | 3485 |
| 801 | Ga0207659_10081496 | 3300025926 | Unclassified | 2393 |
| 802 | Ga0207659_10135126 | 3300025926 | Unclassified | 1908 |
| 803 | Ga0207659_10236649 | 3300025926 | Bacteria | 1475 |
| 804 | Ga0207659_10380988 | 3300025926 | Bacteria | 1176 |
| 805 | Ga0207659_10851863 | 3300025926 | Bacteria | 783 |
| 806 | Ga0207659_11366723 | 3300025926 | Unclassified | 607 |
| 807 | Ga0207687_10857181 | 3300025927 | Bacteria | 776 |
| 808 | Ga0207664_10541691 | 3300025929 | Bacteria | 1044 |
| 809 | Ga0207644_10023211 | 3300025931 | Unclassified | 4246 |
| 810 | Ga0207644_10344380 | 3300025931 | Bacteria | 1209 |
| 811 | Ga0207644_10483973 | 3300025931 | Bacteria | 1019 |
| 812 | Ga0207644_11015997 | 3300025931 | Bacteria | 696 |
| 813 | Ga0207644_11154131 | 3300025931 | Bacteria | 651 |
| 814 | Ga0207690_10013425 | 3300025932 | Bacteria | 4922 |
| 815 | Ga0207690_10198160 | 3300025932 | Bacteria | 1523 |
| 816 | Ga0207690_11218847 | 3300025932 | Bacteria | 628 |
| 817 | Ga0207690_11373773 | 3300025932 | Bacteria | 591 |
| 818 | Ga0207706_10009822 | 3300025933 | Bacteria | 8779 |
| 819 | Ga0207706_10012314 | 3300025933 | Bacteria | 7792 |
| 820 | Ga0207706_10027858 | 3300025933 | Bacteria | 5050 |
| 821 | Ga0207706_10660842 | 3300025933 | Bacteria | 895 |
| 822 | Ga0207706_11107067 | 3300025933 | Unclassified | 661 |
| 823 | Ga0207706_11472575 | 3300025933 | Bacteria | 556 |
| 824 | Ga0207686_10011068 | 3300025934 | Bacteria | 4928 |
| 825 | Ga0207686_10016489 | 3300025934 | Bacteria | 4147 |
| 826 | Ga0207686_10058443 | 3300025934 | Unclassified | 2431 |
| 827 | Ga0207686_10259564 | 3300025934 | Unclassified | 1273 |
| 828 | Ga0207686_10279836 | 3300025934 | Bacteria | 1231 |
| 829 | Ga0207686_10653817 | 3300025934 | Bacteria | 832 |
| 830 | Ga0207709_10734303 | 3300025935 | Unclassified | 793 |
| 831 | Ga0207670_10010649 | 3300025936 | Bacteria | 5306 |
| 832 | Ga0207670_10525602 | 3300025936 | Unclassified | 964 |
| 833 | Ga0207670_11675889 | 3300025936 | Bacteria | 541 |
| 834 | Ga0207670_11874235 | 3300025936 | Bacteria | 510 |
| 835 | Ga0207669_10105614 | 3300025937 | Unclassified | 1874 |
| 836 | Ga0207669_10125710 | 3300025937 | Bacteria | 1751 |
| 837 | Ga0207669_10151790 | 3300025937 | Bacteria | 1624 |
| 838 | Ga0207669_10513019 | 3300025937 | Unclassified | 961 |
| 839 | Ga0207669_11044645 | 3300025937 | Bacteria | 688 |
| 840 | Ga0207704_10043459 | 3300025938 | Bacteria | 2654 |
| 841 | Ga0207704_10052867 | 3300025938 | Unclassified | 2465 |
| 842 | Ga0207704_11156642 | 3300025938 | Unclassified | 659 |
| 843 | Ga0207704_11292938 | 3300025938 | Unclassified | 623 |
| 844 | Ga0207691_10001933 | 3300025940 | Bacteria | 20218 |
| 845 | Ga0207691_10002669 | 3300025940 | Bacteria | 17432 |
| 846 | Ga0207691_10043504 | 3300025940 | Unclassified | 4139 |
| 847 | Ga0207691_10186296 | 3300025940 | Unclassified | 1812 |
| 848 | Ga0207691_10219346 | 3300025940 | Bacteria | 1650 |
| 849 | Ga0207691_10374474 | 3300025940 | Bacteria | 1216 |
| 850 | Ga0207691_10472351 | 3300025940 | Unclassified | 1066 |
| 851 | Ga0207691_11603607 | 3300025940 | Bacteria | 529 |
| 852 | Ga0207711_10149875 | 3300025941 | Bacteria | 2104 |
| 853 | Ga0207711_10335230 | 3300025941 | Unclassified | 1399 |
| 854 | Ga0207711_11661167 | 3300025941 | Bacteria | 582 |
| 855 | Ga0207689_10005093 | 3300025942 | Bacteria | 11826 |
| 856 | Ga0207689_10019949 | 3300025942 | Bacteria | 5645 |
| 857 | Ga0207689_10023318 | 3300025942 | Bacteria | 5196 |
| 858 | Ga0207689_10023524 | 3300025942 | Bacteria | 5169 |
| 859 | Ga0207689_10114930 | 3300025942 | Bacteria | 2212 |
| 860 | Ga0207689_10129778 | 3300025942 | Bacteria | 2074 |
| 861 | Ga0207689_10361012 | 3300025942 | Bacteria | 1208 |
| 862 | Ga0207689_10383673 | 3300025942 | Unclassified | 1170 |
| 863 | Ga0207689_10908764 | 3300025942 | Unclassified | 743 |
| 864 | Ga0207661_10000092 | 3300025944 | Bacteria | 57540 |
| 865 | Ga0207661_10001341 | 3300025944 | Bacteria | 16523 |
| 866 | Ga0207661_10152999 | 3300025944 | Unclassified | 1995 |
| 867 | Ga0207661_10461270 | 3300025944 | Bacteria | 1158 |
| 868 | Ga0207661_11752904 | 3300025944 | Bacteria | 566 |
| 869 | Ga0207679_10000146 | 3300025945 | Bacteria | 58219 |
| 870 | Ga0207679_10019209 | 3300025945 | Bacteria | 4589 |
| 871 | Ga0207679_10080748 | 3300025945 | Unclassified | 2484 |
| 872 | Ga0207679_10138949 | 3300025945 | Bacteria | 1961 |
| 873 | Ga0207679_10149398 | 3300025945 | Bacteria | 1899 |
| 874 | Ga0207679_10442248 | 3300025945 | Unclassified | 1151 |
| 875 | Ga0207679_11711839 | 3300025945 | Bacteria | 575 |
| 876 | Ga0207679_11786930 | 3300025945 | Unclassified | 562 |
| 877 | Ga0207667_10000222 | 3300025949 | Bacteria | 79873 |
| 878 | Ga0207667_10000246 | 3300025949 | Bacteria | 76379 |
| 879 | Ga0207667_10020120 | 3300025949 | Bacteria | 7432 |
| 880 | Ga0207667_10021828 | 3300025949 | Bacteria | 7086 |
| 881 | Ga0207667_10024382 | 3300025949 | Bacteria | 6642 |
| 882 | Ga0207667_10164834 | 3300025949 | Bacteria | 2278 |
| 883 | Ga0207667_10647540 | 3300025949 | Bacteria | 1062 |
| 884 | Ga0207667_10915784 | 3300025949 | Bacteria | 868 |
| 885 | Ga0207667_11247751 | 3300025949 | Bacteria | 721 |
| 886 | Ga0207667_11890409 | 3300025949 | Bacteria | 559 |
| 887 | Ga0207651_10002602 | 3300025960 | Bacteria | 8629 |
| 888 | Ga0207651_10027681 | 3300025960 | Bacteria | 3565 |
| 889 | Ga0207651_10102009 | 3300025960 | Bacteria | 2131 |
| 890 | Ga0207651_10137547 | 3300025960 | Bacteria | 1881 |
| 891 | Ga0207651_10167771 | 3300025960 | Bacteria | 1728 |
| 892 | Ga0207651_10195603 | 3300025960 | Bacteria | 1616 |
| 893 | Ga0207651_10795548 | 3300025960 | Bacteria | 838 |
| 894 | Ga0207651_11417867 | 3300025960 | Bacteria | 625 |
| 895 | Ga0207651_11635950 | 3300025960 | Bacteria | 580 |
| 896 | Ga0207712_10001299 | 3300025961 | Bacteria | 17115 |
| 897 | Ga0207712_10243116 | 3300025961 | Unclassified | 1451 |
| 898 | Ga0207712_10514752 | 3300025961 | Unclassified | 1025 |
| 899 | Ga0207712_10661546 | 3300025961 | Bacteria | 909 |
| 900 | Ga0207712_10724864 | 3300025961 | Unclassified | 869 |
| 901 | Ga0207712_11258939 | 3300025961 | Bacteria | 661 |
| 902 | Ga0207712_11969367 | 3300025961 | Bacteria | 523 |
| 903 | Ga0207668_10006124 | 3300025972 | Bacteria | 7096 |
| 904 | Ga0207668_10058112 | 3300025972 | Unclassified | 2702 |
| 905 | Ga0207668_10112004 | 3300025972 | Bacteria | 2049 |
| 906 | Ga0207668_10893661 | 3300025972 | Bacteria | 790 |
| 907 | Ga0207668_11981636 | 3300025972 | Unclassified | 525 |
| 908 | Ga0207640_10055055 | 3300025981 | Bacteria | 2604 |
| 909 | Ga0207640_10101689 | 3300025981 | Unclassified | 2017 |
| 910 | Ga0207640_10941562 | 3300025981 | Bacteria | 757 |
| 911 | Ga0207640_11068485 | 3300025981 | Bacteria | 713 |
| 912 | Ga0207640_11110265 | 3300025981 | Bacteria | 700 |
| 913 | Ga0207658_10014986 | 3300025986 | Bacteria | 5316 |
| 914 | Ga0207658_10214441 | 3300025986 | Bacteria | 1615 |
| 915 | Ga0207658_10317173 | 3300025986 | Unclassified | 1348 |
| 916 | Ga0207658_10397103 | 3300025986 | Bacteria | 1211 |
| 917 | Ga0207658_10614926 | 3300025986 | Unclassified | 977 |
| 918 | Ga0207658_10768646 | 3300025986 | Bacteria | 873 |
| 919 | Ga0207658_10895555 | 3300025986 | Unclassified | 808 |
| 920 | Ga0207658_11169226 | 3300025986 | Unclassified | 703 |
| 921 | Ga0207677_10014625 | 3300026023 | Bacteria | 4590 |
| 922 | Ga0207677_10022184 | 3300026023 | Bacteria | 3897 |
| 923 | Ga0207677_10097215 | 3300026023 | Unclassified | 2157 |
| 924 | Ga0207677_10186576 | 3300026023 | Bacteria | 1636 |
| 925 | Ga0207677_11259383 | 3300026023 | Unclassified | 678 |
| 926 | Ga0207677_11490246 | 3300026023 | Bacteria | 625 |
| 927 | Ga0207703_10038379 | 3300026035 | Bacteria | 3821 |
| 928 | Ga0207703_10179103 | 3300026035 | Unclassified | 1870 |
| 929 | Ga0207703_10424273 | 3300026035 | Unclassified | 1238 |
| 930 | Ga0207703_10703525 | 3300026035 | Bacteria | 961 |
| 931 | Ga0207703_12299335 | 3300026035 | Bacteria | 515 |
| 932 | Ga0207639_10000667 | 3300026041 | Bacteria | 23704 |
| 933 | Ga0207639_10003151 | 3300026041 | Bacteria | 11090 |
| 934 | Ga0207639_10008122 | 3300026041 | Bacteria | 7176 |
| 935 | Ga0207639_10037712 | 3300026041 | Bacteria | 3591 |
| 936 | Ga0207639_10073908 | 3300026041 | Bacteria | 2674 |
| 937 | Ga0207639_10093844 | 3300026041 | Bacteria | 2408 |
| 938 | Ga0207639_10147712 | 3300026041 | Unclassified | 1966 |
| 939 | Ga0207639_10213729 | 3300026041 | Bacteria | 1662 |
| 940 | Ga0207639_10782461 | 3300026041 | Bacteria | 888 |
| 941 | Ga0207639_12178634 | 3300026041 | Bacteria | 516 |
| 942 | Ga0207678_10069744 | 3300026067 | Bacteria | 3014 |
| 943 | Ga0207678_11060916 | 3300026067 | Unclassified | 717 |
| 944 | Ga0207708_10142100 | 3300026075 | Bacteria | 1884 |
| 945 | Ga0207708_10264844 | 3300026075 | Bacteria | 1388 |
| 946 | Ga0207708_10429960 | 3300026075 | Bacteria | 1096 |
| 947 | Ga0207702_10069754 | 3300026078 | Bacteria | 3023 |
| 948 | Ga0207702_10083782 | 3300026078 | Unclassified | 2775 |
| 949 | Ga0207702_10294553 | 3300026078 | Unclassified | 1538 |
| 950 | Ga0207702_10336799 | 3300026078 | Bacteria | 1440 |
| 951 | Ga0207641_10005038 | 3300026088 | Bacteria | 11317 |
| 952 | Ga0207641_10015563 | 3300026088 | Bacteria | 6233 |
| 953 | Ga0207641_10083106 | 3300026088 | Bacteria | 2784 |
| 954 | Ga0207641_10194694 | 3300026088 | Unclassified | 1865 |
| 955 | Ga0207641_10231764 | 3300026088 | Unclassified | 1716 |
| 956 | Ga0207641_10788839 | 3300026088 | Bacteria | 939 |
| 957 | Ga0207641_11471425 | 3300026088 | Bacteria | 683 |
| 958 | Ga0207641_12160616 | 3300026088 | Unclassified | 557 |
| 959 | Ga0207648_10003359 | 3300026089 | Bacteria | 16814 |
| 960 | Ga0207648_10004904 | 3300026089 | Bacteria | 13626 |
| 961 | Ga0207648_10030385 | 3300026089 | Unclassified | 4785 |
| 962 | Ga0207648_10042733 | 3300026089 | Bacteria | 3979 |
| 963 | Ga0207648_10043963 | 3300026089 | Unclassified | 3920 |
| 964 | Ga0207648_10076983 | 3300026089 | Bacteria | 2908 |
| 965 | Ga0207648_10497658 | 3300026089 | Unclassified | 1115 |
| 966 | Ga0207648_10701641 | 3300026089 | Unclassified | 938 |
| 967 | Ga0207648_11183945 | 3300026089 | Bacteria | 718 |
| 968 | Ga0207648_11254539 | 3300026089 | Bacteria | 696 |
| 969 | Ga0207648_11308898 | 3300026089 | Bacteria | 681 |
| 970 | Ga0207648_11406472 | 3300026089 | Unclassified | 656 |
| 971 | Ga0207648_12247336 | 3300026089 | Bacteria | 506 |
| 972 | Ga0207676_10036051 | 3300026095 | Bacteria | 3760 |
| 973 | Ga0207676_10187967 | 3300026095 | Unclassified | 1815 |
| 974 | Ga0207676_10262299 | 3300026095 | Bacteria | 1561 |
| 975 | Ga0207676_10440460 | 3300026095 | Unclassified | 1226 |
| 976 | Ga0207676_10542683 | 3300026095 | Bacteria | 1110 |
| 977 | Ga0207676_10961638 | 3300026095 | Unclassified | 840 |
| 978 | Ga0207676_11116736 | 3300026095 | Unclassified | 780 |
| 979 | Ga0207674_10002078 | 3300026116 | Bacteria | 25384 |
| 980 | Ga0207674_10005421 | 3300026116 | Bacteria | 15162 |
| 981 | Ga0207674_10005422 | 3300026116 | Bacteria | 15160 |
| 982 | Ga0207674_10035180 | 3300026116 | Bacteria | 5228 |
| 983 | Ga0207674_10062081 | 3300026116 | Bacteria | 3774 |
| 984 | Ga0207674_10070058 | 3300026116 | Bacteria | 3526 |
| 985 | Ga0207674_10101422 | 3300026116 | Bacteria | 2859 |
| 986 | Ga0207674_10116690 | 3300026116 | Bacteria | 2640 |
| 987 | Ga0207674_10719347 | 3300026116 | Bacteria | 964 |
| 988 | Ga0207675_100001355 | 3300026118 | Bacteria | 24522 |
| 989 | Ga0207675_100002256 | 3300026118 | Bacteria | 19155 |
| 990 | Ga0207675_100013142 | 3300026118 | Bacteria | 7726 |
| 991 | Ga0207675_100121228 | 3300026118 | Unclassified | 2474 |
| 992 | Ga0207675_100389884 | 3300026118 | Unclassified | 1371 |
| 993 | Ga0207675_100393048 | 3300026118 | Bacteria | 1365 |
| 994 | Ga0207675_101727901 | 3300026118 | Bacteria | 645 |
| 995 | Ga0207675_102217728 | 3300026118 | Bacteria | 564 |
| 996 | Ga0207675_102423822 | 3300026118 | Unclassified | 537 |
| 997 | Ga0207683_10011412 | 3300026121 | Bacteria | 7581 |
| 998 | Ga0207683_10292863 | 3300026121 | Unclassified | 1488 |
| 999 | Ga0207683_10381191 | 3300026121 | Bacteria | 1296 |
| 1000 | Ga0207698_10011730 | 3300026142 | Bacteria | 5695 |
| 1001 | Ga0207698_10047492 | 3300026142 | Bacteria | 3253 |
| 1002 | Ga0207698_10058369 | 3300026142 | Bacteria | 2990 |
| 1003 | Ga0207698_10077766 | 3300026142 | Unclassified | 2661 |
| 1004 | Ga0207698_10100063 | 3300026142 | Unclassified | 2400 |
| 1005 | Ga0207698_10317547 | 3300026142 | Unclassified | 1457 |
| 1006 | Ga0207698_10332725 | 3300026142 | Unclassified | 1427 |
| 1007 | Ga0207698_10562679 | 3300026142 | Bacteria | 1119 |
| 1008 | Ga0207698_10600608 | 3300026142 | Bacteria | 1085 |
| 1009 | Ga0207698_10710915 | 3300026142 | Bacteria | 1001 |
| 1010 | Ga0207698_11106263 | 3300026142 | Bacteria | 805 |
| 1011 | Ga0207698_11595902 | 3300026142 | Bacteria | 668 |
| 1012 | Ga0209968_1065681 | 3300027526 | Bacteria | 643 |
| 1013 | Ga0209970_1122154 | 3300027614 | Unclassified | 504 |
| 1014 | Ga0210002_1040614 | 3300027617 | Bacteria | 790 |
| 1015 | Ga0209971_1191907 | 3300027682 | Bacteria | 503 |
| 1016 | Ga0209974_10073162 | 3300027876 | Bacteria | 1171 |
| 1017 | Ga0207428_10398532 | 3300027907 | Unclassified | 1008 |
| 1018 | Ga0207428_10917966 | 3300027907 | Bacteria | 618 |
| 1019 | Ga0268266_10004126 | 3300028379 | Bacteria | 14038 |
| 1020 | Ga0268265_10106667 | 3300028380 | Bacteria | 2276 |
| 1021 | Ga0268265_10212556 | 3300028380 | Bacteria | 1686 |
| 1022 | Ga0268265_10264384 | 3300028380 | Unclassified | 1531 |
| 1023 | Ga0268265_10378264 | 3300028380 | Unclassified | 1302 |
| 1024 | Ga0268265_10468515 | 3300028380 | Unclassified | 1180 |
| 1025 | Ga0268265_10506190 | 3300028380 | Unclassified | 1139 |
| 1026 | Ga0268265_10661564 | 3300028380 | Bacteria | 1005 |
| 1027 | Ga0268265_10714630 | 3300028380 | Bacteria | 969 |
| 1028 | Ga0268265_12230135 | 3300028380 | Bacteria | 555 |
| 1029 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 1030 | Ga0268264_10006311 | 3300028381 | Bacteria | 9997 |
| 1031 | Ga0268264_10011319 | 3300028381 | Bacteria | 7369 |
| 1032 | Ga0268264_10058105 | 3300028381 | Bacteria | 3238 |
| 1033 | Ga0268264_10180193 | 3300028381 | Bacteria | 1918 |
| 1034 | Ga0268264_10216451 | 3300028381 | Unclassified | 1761 |
| 1035 | Ga0268264_10231903 | 3300028381 | Unclassified | 1705 |
| 1036 | Ga0268264_10544989 | 3300028381 | Bacteria | 1137 |
| 1037 | Ga0268264_11327856 | 3300028381 | Unclassified | 729 |
| 1038 | Ga0268264_12214651 | 3300028381 | Unclassified | 557 |
| 1039 | Ga0307515_10646695 | 3300028794 | Unclassified | 670 |
| 1040 | Ga0307515_10783553 | 3300028794 | Bacteria | 575 |
| 1041 | Ga0265327_10000054 | 3300031251 | Bacteria | 250337 |
| 1042 | Ga0307513_10063300 | 3300031456 | Bacteria | 3904 |
| 1043 | Ga0307513_10289372 | 3300031456 | Unclassified | 1411 |
| 1044 | Ga0307513_10554208 | 3300031456 | Bacteria | 862 |
| 1045 | Ga0307509_10060495 | 3300031507 | Bacteria | 4003 |
| 1046 | Ga0307509_10351506 | 3300031507 | Bacteria | 1197 |
| 1047 | Ga0307408_100038537 | 3300031548 | Bacteria | 3373 |
| 1048 | Ga0307508_10001362 | 3300031616 | Bacteria | 27521 |
| 1049 | Ga0307508_10137888 | 3300031616 | Bacteria | 2043 |
| 1050 | Ga0307516_10707148 | 3300031730 | Bacteria | 665 |
| 1051 | Ga0307413_10116477 | 3300031824 | Bacteria | 1800 |
| 1052 | Ga0307518_10442778 | 3300031838 | Unclassified | 700 |
| 1053 | Ga0307410_10030785 | 3300031852 | Bacteria | 3434 |
| 1054 | Ga0307410_10467619 | 3300031852 | Bacteria | 1032 |
| 1055 | Ga0307406_10064617 | 3300031901 | Unclassified | 2376 |
| 1056 | Ga0307406_10321385 | 3300031901 | Bacteria | 1197 |
| 1057 | Ga0307406_10871991 | 3300031901 | Unclassified | 764 |
| 1058 | Ga0307406_10902915 | 3300031901 | Bacteria | 752 |
| 1059 | Ga0307407_10123592 | 3300031903 | Unclassified | 1645 |
| 1060 | Ga0307407_11624652 | 3300031903 | Unclassified | 513 |
| 1061 | Ga0307409_100246560 | 3300031995 | Bacteria | 1630 |
| 1062 | Ga0307416_100093911 | 3300032002 | Bacteria | 2585 |
| 1063 | Ga0307416_101008761 | 3300032002 | Unclassified | 935 |
| 1064 | Ga0307416_101251816 | 3300032002 | Bacteria | 848 |
| 1065 | Ga0307414_10215357 | 3300032004 | Bacteria | 1573 |
| 1066 | Ga0307411_10058568 | 3300032005 | Bacteria | 2550 |
| 1067 | Ga0307411_10685249 | 3300032005 | Bacteria | 891 |
| 1068 | Ga0307415_100081356 | 3300032126 | Bacteria | 2313 |
| 1069 | Ga0307415_101677341 | 3300032126 | Unclassified | 612 |
| 1070 | Ga0307510_10008932 | 3300033180 | Bacteria | 11935 |
| 1071 | Ga0307510_10472157 | 3300033180 | Bacteria | 696 |
| 1072 | Ga0373926_0199553 | 3300035083 | Unclassified | 770 |
| 1073 | Ga0373934_0113565 | 3300035086 | Bacteria | 1100 |
| 1074 | Ga0373932_0233507 | 3300035112 | Bacteria | 665 |
| 1075 | Ga0373953_0359902 | 3300035117 | Bacteria | 638 |
| 1076 | Ga0373943_0701182 | 3300035170 | Bacteria | 600 |
| 1077 | Ga0373927_0625674 | 3300035695 | Bacteria | 711 |
| 1078 | Ga0373947_0092217 | 3300035725 | Bacteria | 1891 |
| 1079 | Ga0373937_0524033 | 3300036401 | Unclassified | 1126 |
| 1080 | Ga0373937_1682663 | 3300036401 | Bacteria | 581 |
| 1081 | Ga0373925_0604446 | 3300037068 | Bacteria | 903 |
| 1082 | Ga0395899_0009188 | 3300037312 | Bacteria | 7589 |
| 1083 | Ga0395899_0017005 | 3300037312 | Bacteria | 5542 |
| 1084 | Ga0395899_0187985 | 3300037312 | Bacteria | 1446 |
| 1085 | Ga0395899_0303192 | 3300037312 | Bacteria | 1080 |
| 1086 | Ga0395899_0389418 | 3300037312 | Bacteria | 924 |
| 1087 | Ga0395900_0111932 | 3300037418 | Unclassified | 2803 |
| 1088 | Ga0395900_0139848 | 3300037418 | Bacteria | 2480 |
| 1089 | Ga0395900_0156477 | 3300037418 | Bacteria | 2327 |
| 1090 | Ga0395900_0259663 | 3300037418 | Bacteria | 1735 |
| 1091 | Ga0395900_0475549 | 3300037418 | Bacteria | 1202 |
| 1092 | Ga0395898_0031201 | 3300037466 | Bacteria | 5327 |
| 1093 | Ga0395898_0072494 | 3300037466 | Bacteria | 3327 |
| 1094 | Ga0395898_0121784 | 3300037466 | Bacteria | 2499 |
| 1095 | Ga0395898_0436478 | 3300037466 | Bacteria | 1247 |
| 1096 | Ga0395898_0790483 | 3300037466 | Bacteria | 889 |
| 1097 | Ga0395905_0015405 | 3300037471 | Bacteria | 7267 |
| 1098 | Ga0395905_1201189 | 3300037471 | Bacteria | 662 |
| 1099 | Ga0395905_1246396 | 3300037471 | Bacteria | 647 |
| 1100 | Ga0395901_0011427 | 3300038443 | Bacteria | 8994 |
| 1101 | Ga0395901_0090659 | 3300038443 | Bacteria | 3199 |
| 1102 | Ga0395901_0318172 | 3300038443 | Bacteria | 1610 |
| 1103 | Ga0395901_0960966 | 3300038443 | Bacteria | 832 |
| 1104 | Ga0395901_1310136 | 3300038443 | Unclassified | 686 |
| 1105 | Ga0439436_0043744 | 3300041404 | Bacteria | 1277 |
| 1106 | Ga0439453_0084986 | 3300041408 | Bacteria | 687 |
| 1107 | Ga0439465_0025746 | 3300041413 | Bacteria | 1858 |
| 1108 | Ga0451789_0028015 | 3300041443 | Bacteria | 701 |
| 1109 | Ga0451789_1329307 | 3300041443 | Unclassified | 1664 |
| 1110 | Ga0451791_1712160 | 3300041451 | Bacteria | 955 |
| 1111 | Ga0451793_1160112 | 3300041452 | Unclassified | 562 |
| 1112 | Ga0451793_1897698 | 3300041452 | Bacteria | 695 |
| 1113 | Ga0451797_0660066 | 3300041453 | Bacteria | 580 |
| 1114 | Ga0451798_1113716 | 3300041458 | Unclassified | 600 |
| 1115 | Ga0451802_1455935 | 3300041460 | Bacteria | 994 |
| 1116 | Ga0451804_1150222 | 3300041463 | Bacteria | 755 |
| 1117 | Ga0451807_1268939 | 3300041486 | Unclassified | 645 |
| 1118 | Ga0451807_2475336 | 3300041486 | Unclassified | 508 |
| 1119 | Ga0451807_2595595 | 3300041486 | Unclassified | 1351 |
| 1120 | Ga0451833_1283552 | 3300041491 | Bacteria | 608 |
| 1121 | Ga0451835_1139044 | 3300041492 | Bacteria | 646 |
| 1122 | Ga0451841_0560704 | 3300041498 | Bacteria | 1056 |
| 1123 | Ga0451849_0397476 | 3300041505 | Bacteria | 1311 |
| 1124 | Ga0451843_1127470 | 3300041509 | Bacteria | 517 |
| 1125 | Ga0451853_0400010 | 3300041512 | Bacteria | 639 |
| 1126 | Ga0451853_0968399 | 3300041512 | Bacteria | 681 |
| 1127 | Ga0439431_0056863 | 3300041997 | Bacteria | 1023 |
| 1128 | Ga0439441_051664 | 3300042001 | Unclassified | 848 |
| 1129 | Ga0439443_024232 | 3300042003 | Bacteria | 972 |
| 1130 | Ga0439445_0066018 | 3300042004 | Bacteria | 996 |
| 1131 | Ga0439445_0084580 | 3300042004 | Bacteria | 889 |
| 1132 | Ga0439445_0175078 | 3300042004 | Bacteria | 629 |
| 1133 | Ga0439448_0318782 | 3300042005 | Bacteria | 553 |
| 1134 | Ga0439449_0068737 | 3300042007 | Bacteria | 1306 |
| 1135 | Ga0439449_0368677 | 3300042007 | Bacteria | 544 |
| 1136 | Ga0439451_137251 | 3300042009 | Bacteria | 500 |
| 1137 | Ga0439457_018068 | 3300042014 | Bacteria | 1565 |
| 1138 | Ga0439444_0126340 | 3300042437 | Unclassified | 601 |
| 1139 | Ga0450916_085541 | 3300042530 | Bacteria | 543 |
| 1140 | Ga0450893_0133841 | 3300042532 | Bacteria | 525 |
| 1141 | Ga0451577_0448381 | 3300042876 | Bacteria | 1172 |
| 1142 | Ga0466969_0000235 | 3300044656 | Bacteria | 30219 |
| 1143 | Ga0466969_0065404 | 3300044656 | Unclassified | 1758 |
| 1144 | Ga0466969_0086440 | 3300044656 | Bacteria | 1490 |
| 1145 | Ga0466972_0001764 | 3300044658 | Bacteria | 10604 |
| 1146 | Ga0466972_0055927 | 3300044658 | Bacteria | 1897 |
| 1147 | Ga0466972_0109777 | 3300044658 | Bacteria | 1304 |
| 1148 | Ga0466978_0544714 | 3300044671 | Bacteria | 585 |
| 1149 | Ga0453683_0978158 | 3300044673 | Bacteria | 561 |
| 1150 | Ga0466965_0153395 | 3300044683 | Bacteria | 1205 |
| 1151 | Ga0466966_0000280 | 3300044684 | Bacteria | 33412 |
| 1152 | Ga0466961_0120437 | 3300044693 | Bacteria | 1648 |
| 1153 | Ga0466964_0111636 | 3300044706 | Bacteria | 1220 |
| 1154 | Ga0453684_0032184 | 3300044712 | Bacteria | 7348 |
| 1155 | Ga0453684_0194318 | 3300044712 | Bacteria | 2371 |
| 1156 | Ga0453684_2163864 | 3300044712 | Bacteria | 556 |
| 1157 | Ga0466971_0372563 | 3300044719 | Bacteria | 693 |
| 1158 | Ga0466970_0536490 | 3300044765 | Bacteria | 675 |
| 1159 | Ga0466957_0001155 | 3300044842 | Bacteria | 13662 |
| 1160 | Ga0466957_0438989 | 3300044842 | Bacteria | 898 |
| 1161 | Ga0466957_0791592 | 3300044842 | Bacteria | 673 |
| 1162 | Ga0466957_0976959 | 3300044842 | Bacteria | 607 |
| 1163 | Ga0466960_0139711 | 3300044901 | Bacteria | 1286 |
| 1164 | Ga0466960_0143734 | 3300044901 | Unclassified | 1269 |
| 1165 | Ga0466959_0000015 | 3300045049 | Bacteria | 149242 |
| 1166 | Ga0466959_0105693 | 3300045049 | Unclassified | 2013 |
| 1167 | Ga0451576_2617267 | 3300045051 | Bacteria | 514 |
| 1168 | Ga0466967_1587308 | 3300045976 | Bacteria | 652 |
| 1169 | Ga0495627_016980 | 3300046453 | Bacteria | 2483 |
| 1170 | Ga0495592_0290004 | 3300046454 | Bacteria | 1067 |
| 1171 | Ga0495603_0205907 | 3300046455 | Bacteria | 1137 |
| 1172 | Ga0495638_0030292 | 3300046460 | Bacteria | 3485 |
| 1173 | Ga0495638_0352633 | 3300046460 | Bacteria | 777 |
| 1174 | Ga0495653_0151951 | 3300046463 | Bacteria | 1617 |
| 1175 | Ga0495650_0099742 | 3300046471 | Unclassified | 1092 |
| 1176 | Ga0495580_0712916 | 3300046472 | Bacteria | 656 |
| 1177 | Ga0495594_0464886 | 3300046499 | Bacteria | 719 |
| 1178 | Ga0495606_0011729 | 3300046507 | Bacteria | 7112 |
| 1179 | Ga0495608_0826026 | 3300046511 | Bacteria | 546 |
| 1180 | Ga0495618_0115589 | 3300046514 | Unclassified | 1718 |
| 1181 | Ga0495632_0112362 | 3300046519 | Bacteria | 1278 |
| 1182 | Ga0495632_0415810 | 3300046519 | Bacteria | 586 |
| 1183 | Ga0495643_0016526 | 3300046522 | Bacteria | 4335 |
| 1184 | Ga0495648_0013272 | 3300046524 | Bacteria | 6102 |
| 1185 | Ga0495648_0262033 | 3300046524 | Bacteria | 829 |
| 1186 | Ga0495586_0045963 | 3300046535 | Unclassified | 2354 |
| 1187 | Ga0495587_0020446 | 3300046536 | Unclassified | 4087 |
| 1188 | Ga0495609_0122795 | 3300046538 | Bacteria | 1116 |
| 1189 | Ga0495621_0020971 | 3300046539 | Bacteria | 2150 |
| 1190 | Ga0495621_0296441 | 3300046539 | Bacteria | 669 |
| 1191 | Ga0495633_0000017 | 3300046558 | Bacteria | 249973 |
| 1192 | Ga0495667_0723166 | 3300046559 | Bacteria | 616 |
| 1193 | Ga0495668_0012757 | 3300046616 | Bacteria | 4976 |
| 1194 | Ga0495611_0000021 | 3300046648 | Bacteria | 123657 |
| 1195 | Ga0495611_0088697 | 3300046648 | Unclassified | 1428 |
| 1196 | Ga0495611_0240602 | 3300046648 | Bacteria | 840 |
| 1197 | Ga0495625_0255807 | 3300046660 | Bacteria | 1135 |
| 1198 | Ga0495625_0281155 | 3300046660 | Unclassified | 1071 |
| 1199 | Ga0495625_0671050 | 3300046660 | Unclassified | 615 |
| 1200 | Ga0495657_0064332 | 3300046675 | Unclassified | 2417 |
| 1201 | Ga0495623_0720398 | 3300046679 | Bacteria | 510 |
| 1202 | Ga0495624_0566236 | 3300046690 | Bacteria | 678 |
| 1203 | Ga0495604_0486895 | 3300047317 | Bacteria | 802 |
| 1204 | Ga0495604_1054134 | 3300047317 | Unclassified | 501 |
| 1205 | Ga0495636_0509208 | 3300047318 | Bacteria | 583 |
| 1206 | Ga0495672_0022271 | 3300047320 | Bacteria | 4122 |
| 1207 | Ga0495672_0032365 | 3300047320 | Bacteria | 3254 |
| 1208 | Ga0495672_0297014 | 3300047320 | Bacteria | 766 |
| 1209 | Ga0495676_0774134 | 3300047321 | Bacteria | 619 |
| 1210 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 1211 | Ga0495687_152451 | 3300047443 | Bacteria | 788 |
| 1212 | Ga0496100_0607889 | 3300048903 | Unclassified | 849 |
| 1213 | Ga0496101_0051422 | 3300048904 | Unclassified | 2969 |
| 1214 | Ga0496101_0868937 | 3300048904 | Bacteria | 710 |
| 1215 | Ga0496104_0708629 | 3300048907 | Unclassified | 914 |
| 1216 | Ga0496104_1616706 | 3300048907 | Bacteria | 551 |
| 1217 | Ga0496106_0475339 | 3300048909 | Unclassified | 1004 |
| 1218 | Ga0496106_1051563 | 3300048909 | Unclassified | 639 |
| 1219 | Ga0496107_0201612 | 3300048910 | Unclassified | 1479 |
| 1220 | Ga0496107_0453325 | 3300048910 | Bacteria | 953 |
| 1221 | Ga0496108_0152255 | 3300048911 | Unclassified | 1996 |
| 1222 | Ga0496109_0101587 | 3300048912 | Unclassified | 2669 |
| 1223 | Ga0496110_0663368 | 3300048913 | Unclassified | 943 |
| 1224 | Ga0496110_0870963 | 3300048913 | Bacteria | 806 |
| 1225 | Ga0496113_1244683 | 3300048916 | Unclassified | 580 |
| 1226 | Ga0496114_0855669 | 3300048917 | Unclassified | 790 |
| 1227 | Ga0496115_1417800 | 3300048918 | Unclassified | 512 |
| 1228 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 1229 | Ga0496121_0909951 | 3300048924 | Bacteria | 505 |
| 1230 | Ga0496125_0295096 | 3300048928 | Bacteria | 996 |
| 1231 | Ga0496126_0127526 | 3300048929 | Bacteria | 2201 |
| 1232 | Ga0501031_0091768 | 3300049568 | Bacteria | 1981 |
| 1233 | Ga0501032_0734083 | 3300049569 | Bacteria | 625 |
| 1234 | Ga0501033_0245184 | 3300049570 | Bacteria | 1271 |
| 1235 | Ga0501033_0331835 | 3300049570 | Bacteria | 1067 |
| 1236 | Ga0501033_0656424 | 3300049570 | Bacteria | 716 |
| 1237 | Ga0501033_1135677 | 3300049570 | Bacteria | 519 |
| 1238 | Ga0501034_0025021 | 3300049571 | Bacteria | 6074 |
| 1239 | Ga0501034_0057903 | 3300049571 | Bacteria | 3896 |
| 1240 | Ga0501034_0083010 | 3300049571 | Bacteria | 3206 |
| 1241 | Ga0501034_0126766 | 3300049571 | Bacteria | 2537 |
| 1242 | Ga0501034_0153853 | 3300049571 | Bacteria | 2275 |
| 1243 | Ga0501034_0265313 | 3300049571 | Bacteria | 1659 |
| 1244 | Ga0501034_0337833 | 3300049571 | Bacteria | 1437 |
| 1245 | Ga0501036_0180174 | 3300049572 | Bacteria | 1779 |
| 1246 | Ga0501036_1186041 | 3300049572 | Unclassified | 622 |
| 1247 | Ga0501037_0125473 | 3300049573 | Unclassified | 1843 |
| 1248 | Ga0501037_0294920 | 3300049573 | Bacteria | 1127 |
| 1249 | Ga0501037_0708837 | 3300049573 | Unclassified | 669 |
| 1250 | Ga0501038_0017298 | 3300049574 | Bacteria | 6517 |
| 1251 | Ga0501038_0024630 | 3300049574 | Bacteria | 5366 |
| 1252 | Ga0501038_0469715 | 3300049574 | Bacteria | 965 |
| 1253 | Ga0501039_0037675 | 3300049575 | Bacteria | 3733 |
| 1254 | Ga0501039_0217942 | 3300049575 | Unclassified | 1501 |
| 1255 | Ga0501043_0017442 | 3300049579 | Bacteria | 5627 |
| 1256 | Ga0501043_0032312 | 3300049579 | Bacteria | 4114 |
| 1257 | Ga0501043_0347861 | 3300049579 | Bacteria | 1127 |
| 1258 | Ga0501046_0048287 | 3300049580 | Bacteria | 3372 |
| 1259 | Ga0501047_0011096 | 3300049581 | Bacteria | 8528 |
| 1260 | Ga0501047_0021076 | 3300049581 | Bacteria | 6258 |
| 1261 | Ga0501047_0400875 | 3300049581 | Bacteria | 1205 |
| 1262 | Ga0501047_0410855 | 3300049581 | Bacteria | 1186 |
| 1263 | Ga0501047_0445493 | 3300049581 | Bacteria | 1124 |
| 1264 | Ga0501047_0512270 | 3300049581 | Bacteria | 1026 |
| 1265 | Ga0501047_0865609 | 3300049581 | Bacteria | 717 |
| 1266 | Ga0501048_0145226 | 3300049582 | Bacteria | 1678 |
| 1267 | Ga0501068_1003418 | 3300049584 | Unclassified | 551 |
| 1268 | Ga0501070_0313642 | 3300049586 | Bacteria | 1276 |
| 1269 | Ga0501070_1013064 | 3300049586 | Unclassified | 644 |
| 1270 | Ga0501072_1156451 | 3300049588 | Bacteria | 601 |
| 1271 | Ga0501073_0110828 | 3300049589 | Bacteria | 1904 |
| 1272 | Ga0501198_014607 | 3300049649 | Bacteria | 1198 |
| 1273 | Ga0501199_007699 | 3300049650 | Unclassified | 1116 |
| 1274 | Ga0501201_003567 | 3300049651 | Bacteria | 1432 |
| 1275 | Ga0501202_003604 | 3300049652 | Bacteria | 2664 |
| 1276 | Ga0501206_022361 | 3300049653 | Unclassified | 907 |
| 1277 | Ga0501207_006177 | 3300049654 | Bacteria | 1675 |
| 1278 | Ga0501216_006858 | 3300049660 | Bacteria | 1758 |
| 1279 | Ga0501217_024187 | 3300049661 | Bacteria | 1451 |
| 1280 | Ga0501223_022442 | 3300049663 | Bacteria | 1233 |
| 1281 | Ga0501224_003267 | 3300049664 | Bacteria | 2257 |
| 1282 | Ga0501227_042388 | 3300049665 | Unclassified | 1128 |
| 1283 | Ga0501233_238348 | 3300049668 | Unclassified | 543 |
| 1284 | Ga0501235_004505 | 3300049669 | Bacteria | 3010 |
| 1285 | Ga0501238_038078 | 3300049671 | Bacteria | 704 |
| 1286 | Ga0501242_028661 | 3300049674 | Unclassified | 744 |
| 1287 | Ga0501243_004321 | 3300049675 | Bacteria | 2129 |
| 1288 | Ga0501249_213385 | 3300049679 | Bacteria | 511 |
| 1289 | Ga0501251_038662 | 3300049681 | Unclassified | 713 |
| 1290 | Ga0501252_009640 | 3300049682 | Bacteria | 1129 |
| 1291 | Ga0501255_009224 | 3300049684 | Bacteria | 1089 |
| 1292 | Ga0501257_128457 | 3300049686 | Bacteria | 684 |
| 1293 | Ga0501259_101707 | 3300049688 | Bacteria | 660 |
| 1294 | Ga0501259_143064 | 3300049688 | Unclassified | 587 |
| 1295 | Ga0501261_028897 | 3300049690 | Unclassified | 831 |
| 1296 | Ga0501221_044109 | 3300049704 | Unclassified | 983 |
| 1297 | Ga0501225_0011878 | 3300049705 | Bacteria | 2450 |
| 1298 | Ga0501234_022465 | 3300049707 | Unclassified | 1007 |
| 1299 | Ga0501245_016785 | 3300049708 | Unclassified | 1113 |
| 1300 | Ga0501080_0644282 | 3300049742 | Bacteria | 938 |
| 1301 | Ga0501080_1807239 | 3300049742 | Unclassified | 513 |
| 1302 | Ga0501083_0069451 | 3300049744 | Unclassified | 2344 |
| 1303 | Ga0501083_0242345 | 3300049744 | Bacteria | 1174 |
| 1304 | Ga0501266_002586 | 3300049763 | Unclassified | 2274 |
| 1305 | Ga0501272_035354 | 3300049769 | Unclassified | 649 |
| 1306 | Ga0501276_001576 | 3300049773 | Bacteria | 1554 |
| 1307 | Ga0501279_006140 | 3300049775 | Bacteria | 1586 |
| 1308 | Ga0501280_025068 | 3300049776 | Bacteria | 908 |
| 1309 | Ga0501280_065303 | 3300049776 | Bacteria | 641 |
| 1310 | Ga0501282_024731 | 3300049778 | Unclassified | 670 |
| 1311 | Ga0501035_0024751 | 3300049822 | Bacteria | 5503 |
| 1312 | Ga0501035_0160804 | 3300049822 | Bacteria | 1944 |
| 1313 | Ga0501035_0451212 | 3300049822 | Bacteria | 1064 |
| 1314 | Ga0501035_0469385 | 3300049822 | Bacteria | 1039 |
| 1315 | Ga0501035_0532507 | 3300049822 | Bacteria | 964 |
| 1316 | Ga0501035_0565224 | 3300049822 | Bacteria | 930 |
| 1317 | Ga0501044_0030285 | 3300049823 | Bacteria | 5705 |
| 1318 | Ga0501044_0078463 | 3300049823 | Bacteria | 3346 |
| 1319 | Ga0501044_0217087 | 3300049823 | Bacteria | 1864 |
| 1320 | Ga0501044_0241441 | 3300049823 | Bacteria | 1750 |
| 1321 | Ga0501044_0398994 | 3300049823 | Bacteria | 1288 |
| 1322 | Ga0501044_0434784 | 3300049823 | Bacteria | 1221 |
| 1323 | Ga0501044_1544675 | 3300049823 | Bacteria | 529 |
| 1324 | Ga0501200_05772 | 3300049849 | Unclassified | 597 |
| 1325 | Ga0501284_01154 | 3300050005 | Bacteria | 1383 |
| 1326 | nmdc:mga0k408_26435_c1 | 3300050493 | Bacteria | 3290 |
| 1327 | nmdc:mga0k408_31349_c1 | 3300050493 | Bacteria | 3035 |
| 1328 | nmdc:mga0k408_35150_c1 | 3300050493 | Bacteria | 2873 |
| 1329 | nmdc:mga0k408_409679_c1 | 3300050493 | Bacteria | 806 |
| 1330 | nmdc:mga0k408_582779_c1 | 3300050493 | Bacteria | 660 |
| 1331 | nmdc:mga0k408_798772_c1 | 3300050493 | Bacteria | 550 |
| 1332 | nmdc:mga05p37_1231339_c1 | 3300050507 | Bacteria | 770 |
| 1333 | nmdc:mga05p37_3235_c1 | 3300050507 | Bacteria | 18970 |
| 1334 | nmdc:mga05p37_841675_c1 | 3300050507 | Bacteria | 998 |
| 1335 | nmdc:mga09592_1546_c1 | 3300050508 | Bacteria | 18488 |
| 1336 | nmdc:mga09592_321074_c1 | 3300050508 | Bacteria | 1341 |
| 1337 | nmdc:mga09592_75829_c1 | 3300050508 | Bacteria | 2860 |
| 1338 | nmdc:mga0qj67_153861_c1 | 3300050509 | Unclassified | 1866 |
| 1339 | nmdc:mga0qj67_48198_c1 | 3300050509 | Bacteria | 3366 |
| 1340 | nmdc:mga0qj67_653831_c1 | 3300050509 | Bacteria | 838 |
| 1341 | nmdc:mga06r32_225327_c1 | 3300050510 | Unclassified | 1863 |
| 1342 | nmdc:mga06r32_4303_c1 | 3300050510 | Bacteria | 12745 |
| 1343 | nmdc:mga06r32_497226_c1 | 3300050510 | Bacteria | 1197 |
| 1344 | nmdc:mga08y16_2006363_c1 | 3300050511 | Bacteria | 528 |
| 1345 | nmdc:mga08y16_26379_c1 | 3300050511 | Bacteria | 6126 |
| 1346 | nmdc:mga08y16_401679_c1 | 3300050511 | Bacteria | 1402 |
| 1347 | nmdc:mga08y16_450759_c1 | 3300050511 | Bacteria | 1312 |
| 1348 | nmdc:mga08y16_622828_c1 | 3300050511 | Bacteria | 1086 |
| 1349 | nmdc:mga08y16_638753_c1 | 3300050511 | Unclassified | 1070 |
| 1350 | nmdc:mga0n895_1007371_c1 | 3300050512 | Unclassified | 814 |
| 1351 | nmdc:mga0n895_992540_c1 | 3300050512 | Unclassified | 821 |
| 1352 | nmdc:mga0rr50_813319_c1 | 3300050513 | Unclassified | 797 |
| 1353 | Ga0500644_0000233 | 3300053088 | Bacteria | 31422 |
| 1354 | Ga0500646_0007401 | 3300053090 | Bacteria | 2805 |
| 1355 | Ga0500646_0163812 | 3300053090 | Unclassified | 744 |
| 1356 | Ga0500646_0290563 | 3300053090 | Unclassified | 584 |
| 1357 | Ga0500583_0000224 | 3300053092 | Bacteria | 20897 |
| 1358 | Ga0500583_0036287 | 3300053092 | Bacteria | 2206 |
| 1359 | Ga0500583_0068941 | 3300053092 | Bacteria | 1688 |
| 1360 | Ga0500583_0078304 | 3300053092 | Bacteria | 1593 |
| 1361 | Ga0500651_0050349 | 3300053093 | Bacteria | 2615 |
| 1362 | Ga0500651_0528375 | 3300053093 | Unclassified | 648 |
| 1363 | Ga0500566_0213081 | 3300053094 | Bacteria | 966 |
| 1364 | Ga0500641_0344789 | 3300053096 | Unclassified | 600 |
| 1365 | Ga0500660_088515 | 3300053100 | Bacteria | 1392 |
| 1366 | Ga0500553_219187 | 3300053101 | Bacteria | 623 |
| 1367 | Ga0500556_0121013 | 3300053104 | Bacteria | 1021 |
| 1368 | Ga0500562_136297 | 3300053108 | Unclassified | 669 |
| 1369 | Ga0500569_001814 | 3300053109 | Bacteria | 4096 |
| 1370 | Ga0500594_0063931 | 3300053118 | Bacteria | 1067 |
| 1371 | Ga0500594_0063962 | 3300053118 | Bacteria | 1067 |
| 1372 | Ga0500607_065776 | 3300053121 | Bacteria | 1883 |
| 1373 | Ga0500621_200998 | 3300053126 | Bacteria | 706 |
| 1374 | Ga0500621_206911 | 3300053126 | Unclassified | 690 |
| 1375 | Ga0500628_131419 | 3300053129 | Bacteria | 687 |
| 1376 | Ga0500628_167897 | 3300053129 | Bacteria | 621 |
| 1377 | Ga0500642_0095309 | 3300053130 | Bacteria | 1379 |
| 1378 | Ga0500652_019542 | 3300053131 | Bacteria | 2519 |
| 1379 | Ga0500652_033710 | 3300053131 | Bacteria | 2025 |
| 1380 | Ga0500655_064269 | 3300053133 | Bacteria | 742 |
| 1381 | Ga0500658_0001405 | 3300053134 | Bacteria | 9705 |
| 1382 | Ga0500658_0147556 | 3300053134 | Bacteria | 1059 |
| 1383 | Ga0500559_0005888 | 3300053136 | Bacteria | 5586 |
| 1384 | Ga0500559_0138277 | 3300053136 | Bacteria | 1140 |
| 1385 | Ga0500559_0414681 | 3300053136 | Unclassified | 625 |
| 1386 | Ga0500568_0000593 | 3300053139 | Bacteria | 26321 |
| 1387 | Ga0500568_0050331 | 3300053139 | Unclassified | 1642 |
| 1388 | Ga0500577_0000924 | 3300053142 | Bacteria | 7613 |
| 1389 | Ga0500588_0039894 | 3300053146 | Unclassified | 1408 |
| 1390 | Ga0500588_0297885 | 3300053146 | Bacteria | 610 |
| 1391 | Ga0500589_064108 | 3300053147 | Bacteria | 1678 |
| 1392 | Ga0500589_074095 | 3300053147 | Bacteria | 1534 |
| 1393 | Ga0500590_016384 | 3300053148 | Bacteria | 3832 |
| 1394 | Ga0500603_022140 | 3300053150 | Bacteria | 1571 |
| 1395 | Ga0500604_0047037 | 3300053151 | Bacteria | 1321 |
| 1396 | Ga0500616_0050612 | 3300053153 | Bacteria | 2193 |
| 1397 | Ga0500616_0149002 | 3300053153 | Bacteria | 1085 |
| 1398 | Ga0500616_0438073 | 3300053153 | Bacteria | 516 |
| 1399 | Ga0500619_090429 | 3300053154 | Bacteria | 1034 |
| 1400 | Ga0500622_0000319 | 3300053156 | Bacteria | 48315 |
| 1401 | Ga0500622_0002252 | 3300053156 | Bacteria | 14190 |
| 1402 | Ga0500633_0051002 | 3300053160 | Bacteria | 1427 |
| 1403 | Ga0500634_0369540 | 3300053161 | Bacteria | 540 |
| 1404 | Ga0500636_0049874 | 3300053177 | Bacteria | 2462 |
| 1405 | Ga0500636_0145843 | 3300053177 | Bacteria | 1305 |
| 1406 | Ga0500637_0252674 | 3300053178 | Bacteria | 983 |
| 1407 | Ga0500611_000061 | 3300053727 | Bacteria | 45387 |
| 1408 | Ga0500645_028526 | 3300053730 | Bacteria | 1689 |
| 1409 | Ga0500587_007289 | 3300053739 | Bacteria | 1444 |
| 1410 | Ga0500661_027845 | 3300055283 | Bacteria | 998 |
| 1411 | Ga0500661_058724 | 3300055283 | Bacteria | 693 |
| 1412 | Ga0466962_0242986 | 3300061719 | Bacteria | 884 |
| 1413 | Ga0466962_0518041 | 3300061719 | Bacteria | 604 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0448381 | Ga0451577_0448381_584_796 | 70 |
| 2 | 3300003320 | rootH2_10004858 | rootH2_1000485816 | 72 |
| 3 | 3300003320 | rootH2_10052963 | rootH2_1005296311 | 72 |
| 4 | 3300005290 | Ga0065712_10228029 | Ga0065712_102280292 | 72 |
| 5 | 3300005327 | Ga0070658_11009185 | Ga0070658_110091852 | 72 |
| 6 | 3300005329 | Ga0070683_100008631 | Ga0070683_1000086315 | 72 |
| 7 | 3300005331 | Ga0070670_100026030 | Ga0070670_1000260304 | 72 |
| 8 | 3300005331 | Ga0070670_100600439 | Ga0070670_1006004392 | 72 |
| 9 | 3300005337 | Ga0070682_100789324 | Ga0070682_1007893241 | 72 |
| 10 | 3300005338 | Ga0068868_100359284 | Ga0068868_1003592842 | 72 |
| 11 | 3300005344 | Ga0070661_100236064 | Ga0070661_1002360641 | 72 |
| 12 | 3300005355 | Ga0070671_100082299 | Ga0070671_1000822994 | 72 |
| 13 | 3300005355 | Ga0070671_100238866 | Ga0070671_1002388663 | 72 |
| 14 | 3300005356 | Ga0070674_100898512 | Ga0070674_1008985122 | 72 |
| 15 | 3300005364 | Ga0070673_100239452 | Ga0070673_1002394522 | 72 |
| 16 | 3300005367 | Ga0070667_100880056 | Ga0070667_1008800562 | 72 |
| 17 | 3300005459 | Ga0068867_100091339 | Ga0068867_1000913392 | 72 |
| 18 | 3300005535 | Ga0070684_100010110 | Ga0070684_1000101104 | 72 |
| 19 | 3300005539 | Ga0068853_100000276 | Ga0068853_1000002762 | 72 |
| 20 | 3300005539 | Ga0068853_100169597 | Ga0068853_1001695972 | 72 |
| 21 | 3300005543 | Ga0070672_101093836 | Ga0070672_1010938362 | 72 |
| 22 | 3300005543 | Ga0070672_101152830 | Ga0070672_1011528302 | 72 |
| 23 | 3300005564 | Ga0070664_100030956 | Ga0070664_1000309563 | 72 |
| 24 | 3300005564 | Ga0070664_100112355 | Ga0070664_1001123552 | 72 |
| 25 | 3300005564 | Ga0070664_100897438 | Ga0070664_1008974382 | 72 |
| 26 | 3300005577 | Ga0068857_100259580 | Ga0068857_1002595803 | 72 |
| 27 | 3300005578 | Ga0068854_100039596 | Ga0068854_1000395962 | 72 |
| 28 | 3300005578 | Ga0068854_100474399 | Ga0068854_1004743991 | 72 |
| 29 | 3300005616 | Ga0068852_100786514 | Ga0068852_1007865142 | 72 |
| 30 | 3300005616 | Ga0068852_102030748 | Ga0068852_1020307482 | 72 |
| 31 | 3300005616 | Ga0068852_102518002 | Ga0068852_1025180022 | 72 |
| 32 | 3300005618 | Ga0068864_101028180 | Ga0068864_1010281802 | 72 |
| 33 | 3300005834 | Ga0068851_10050995 | Ga0068851_100509953 | 72 |
| 34 | 3300005842 | Ga0068858_102500870 | Ga0068858_1025008701 | 72 |
| 35 | 3300005843 | Ga0068860_100750878 | Ga0068860_1007508782 | 72 |
| 36 | 3300006237 | Ga0097621_100596043 | Ga0097621_1005960432 | 72 |
| 37 | 3300014969 | Ga0157376_10686374 | Ga0157376_106863742 | 72 |
| 38 | 3300025315 | Ga0207697_10173480 | Ga0207697_101734802 | 72 |
| 39 | 3300025903 | Ga0207680_10129084 | Ga0207680_101290842 | 72 |
| 40 | 3300025904 | Ga0207647_10190289 | Ga0207647_101902892 | 72 |
| 41 | 3300025907 | Ga0207645_10087134 | Ga0207645_100871343 | 72 |
| 42 | 3300025909 | Ga0207705_10611462 | Ga0207705_106114621 | 72 |
| 43 | 3300025913 | Ga0207695_10705318 | Ga0207695_107053182 | 72 |
| 44 | 3300025914 | Ga0207671_10002783 | Ga0207671_100027834 | 72 |
| 45 | 3300025914 | Ga0207671_10021805 | Ga0207671_100218054 | 72 |
| 46 | 3300025919 | Ga0207657_10163186 | Ga0207657_101631861 | 72 |
| 47 | 3300025920 | Ga0207649_10297339 | Ga0207649_102973392 | 72 |
| 48 | 3300025924 | Ga0207694_11045740 | Ga0207694_110457401 | 72 |
| 49 | 3300025925 | Ga0207650_10002421 | Ga0207650_100024214 | 72 |
| 50 | 3300025925 | Ga0207650_10517158 | Ga0207650_105171582 | 72 |
| 51 | 3300025926 | Ga0207659_10236649 | Ga0207659_102366491 | 72 |
| 52 | 3300025926 | Ga0207659_11366723 | Ga0207659_113667232 | 72 |
| 53 | 3300025931 | Ga0207644_10344380 | Ga0207644_103443802 | 72 |
| 54 | 3300025933 | Ga0207706_10009822 | Ga0207706_100098222 | 72 |
| 55 | 3300025933 | Ga0207706_10660842 | Ga0207706_106608421 | 72 |
| 56 | 3300025935 | Ga0207709_10734303 | Ga0207709_107343032 | 72 |
| 57 | 3300025940 | Ga0207691_10472351 | Ga0207691_104723512 | 72 |
| 58 | 3300025942 | Ga0207689_10908764 | Ga0207689_109087642 | 72 |
| 59 | 3300025944 | Ga0207661_10152999 | Ga0207661_101529992 | 72 |
| 60 | 3300025945 | Ga0207679_10019209 | Ga0207679_100192095 | 72 |
| 61 | 3300025945 | Ga0207679_10080748 | Ga0207679_100807484 | 72 |
| 62 | 3300025945 | Ga0207679_11786930 | Ga0207679_117869301 | 72 |
| 63 | 3300025949 | Ga0207667_10021828 | Ga0207667_100218284 | 72 |
| 64 | 3300025960 | Ga0207651_11417867 | Ga0207651_114178672 | 72 |
| 65 | 3300025961 | Ga0207712_11969367 | Ga0207712_119693672 | 72 |
| 66 | 3300025981 | Ga0207640_10941562 | Ga0207640_109415623 | 72 |
| 67 | 3300025986 | Ga0207658_10614926 | Ga0207658_106149262 | 72 |
| 68 | 3300025986 | Ga0207658_10768646 | Ga0207658_107686462 | 72 |
| 69 | 3300026023 | Ga0207677_10097215 | Ga0207677_100972153 | 72 |
| 70 | 3300026035 | Ga0207703_10703525 | Ga0207703_107035252 | 72 |
| 71 | 3300026041 | Ga0207639_10003151 | Ga0207639_100031518 | 72 |
| 72 | 3300026095 | Ga0207676_10542683 | Ga0207676_105426832 | 72 |
| 73 | 3300026116 | Ga0207674_10005421 | Ga0207674_1000542111 | 72 |
| 74 | 3300026116 | Ga0207674_10062081 | Ga0207674_100620814 | 72 |
| 75 | 3300026142 | Ga0207698_10011730 | Ga0207698_100117302 | 72 |
| 76 | 3300026142 | Ga0207698_10058369 | Ga0207698_100583693 | 72 |
| 77 | 3300026142 | Ga0207698_10562679 | Ga0207698_105626792 | 72 |
| 78 | 3300026142 | Ga0207698_10600608 | Ga0207698_106006082 | 72 |
| 79 | 3300027907 | Ga0207428_10398532 | Ga0207428_103985322 | 72 |
| 80 | 3300041408 | Ga0439453_0084986 | Ga0439453_0084986_454_672 | 72 |
| 81 | 3300041492 | Ga0451835_1139044 | Ga0451835_1139044_367_585 | 72 |
| 82 | 3300046679 | Ga0495623_0720398 | Ga0495623_0720398_281_499 | 72 |
| 83 | 3300047317 | Ga0495604_0486895 | Ga0495604_0486895_565_783 | 72 |
| 84 | 3300048916 | Ga0496113_1244683 | Ga0496113_1244683_14_232 | 72 |
| 85 | 3300049569 | Ga0501032_0734083 | Ga0501032_0734083_38_256 | 72 |
| 86 | 3300049572 | Ga0501036_1186041 | Ga0501036_1186041_38_256 | 72 |
| 87 | 3300049581 | Ga0501047_0410855 | Ga0501047_0410855_753_971 | 72 |
| 88 | 3300049682 | Ga0501252_009640 | Ga0501252_009640_719_949 | 72 |
| 89 | 3300049688 | Ga0501259_143064 | Ga0501259_143064_240_470 | 72 |
| 90 | 3300049742 | Ga0501080_0644282 | Ga0501080_0644282_19_240 | 72 |
| 91 | 3300050512 | nmdc:mga0n895_1007371_c1 | nmdc:mga0n895_1007371_c1_182_400 | 72 |
| 92 | 3300053101 | Ga0500553_219187 | Ga0500553_219187_26_244 | 72 |
| 93 | 3300053136 | Ga0500559_0138277 | Ga0500559_0138277_599_817 | 72 |
| 94 | 3300053151 | Ga0500604_0047037 | Ga0500604_0047037_452_670 | 72 |
| 95 | 3300013306 | Ga0163162_12816191 | Ga0163162_128161912 | 73 |
| 96 | 3300009093 | Ga0105240_11028167 | Ga0105240_110281672 | 74 |
| 97 | iso_pu_bacteria | 2738541278 | 2738724439 | 77 |
| 98 | iso_pu_bacteria | 2818991442 | 2819572020 | 77 |
| 99 | iso_pu_bacteria | 2818991460 | 2819677787 | 77 |
| 100 | iso_pu_bacteria | 2821136567 | 2821141736 | 77 |
| 101 | iso_pu_bacteria | 2881955468 | 2881956695 | 77 |
| 102 | iso_pu_bacteria | 2884791551 | 2884797739 | 77 |
| 103 | iso_pu_bacteria | 2896109856 | 2896114760 | 77 |
| 104 | iso_pu_bacteria | 2904467357 | 2904469849 | 77 |
| 105 | iso_pu_bacteria | 2929177148 | 2929183213 | 77 |
| 106 | iso_pu_bacteria | 2929921140 | 2929927594 | 77 |
| 107 | iso_pu_bacteria | 2945977869 | 2945979174 | 77 |
| 108 | iso_pu_bacteria | 2946013367 | 2946014958 | 77 |
| 109 | iso_pu_bacteria | 8003151029 | 8003151442 | 77 |
| 110 | 3300044712 | Ga0453684_0194318 | Ga0453684_0194318_737_976 | 79 |
| 111 | 3300002155 | JGI24033J26618_1015030 | JGI24033J26618_10150302 | 80 |
| 112 | 3300005290 | Ga0065712_10010245 | Ga0065712_100102453 | 80 |
| 113 | 3300005328 | Ga0070676_10027716 | Ga0070676_100277163 | 80 |
| 114 | 3300005329 | Ga0070683_100055456 | Ga0070683_1000554563 | 80 |
| 115 | 3300005330 | Ga0070690_100022674 | Ga0070690_1000226742 | 80 |
| 116 | 3300005331 | Ga0070670_100123124 | Ga0070670_1001231243 | 80 |
| 117 | 3300005331 | Ga0070670_100548885 | Ga0070670_1005488851 | 80 |
| 118 | 3300005334 | Ga0068869_100005960 | Ga0068869_1000059607 | 80 |
| 119 | 3300005334 | Ga0068869_100009661 | Ga0068869_1000096615 | 80 |
| 120 | 3300005335 | Ga0070666_10086792 | Ga0070666_100867922 | 80 |
| 121 | 3300005338 | Ga0068868_100223164 | Ga0068868_1002231642 | 80 |
| 122 | 3300005338 | Ga0068868_101474190 | Ga0068868_1014741902 | 80 |
| 123 | 3300005340 | Ga0070689_100015371 | Ga0070689_1000153713 | 80 |
| 124 | 3300005343 | Ga0070687_100354360 | Ga0070687_1003543602 | 80 |
| 125 | 3300005344 | Ga0070661_101272938 | Ga0070661_1012729381 | 80 |
| 126 | 3300005347 | Ga0070668_100066932 | Ga0070668_1000669324 | 80 |
| 127 | 3300005353 | Ga0070669_100002817 | Ga0070669_1000028175 | 80 |
| 128 | 3300005353 | Ga0070669_100887376 | Ga0070669_1008873761 | 80 |
| 129 | 3300005355 | Ga0070671_100059583 | Ga0070671_1000595832 | 80 |
| 130 | 3300005355 | Ga0070671_100189540 | Ga0070671_1001895402 | 80 |
| 131 | 3300005356 | Ga0070674_100901610 | Ga0070674_1009016102 | 80 |
| 132 | 3300005364 | Ga0070673_100032189 | Ga0070673_1000321893 | 80 |
| 133 | 3300005365 | Ga0070688_100009375 | Ga0070688_1000093755 | 80 |
| 134 | 3300005365 | Ga0070688_101407499 | Ga0070688_1014074992 | 80 |
| 135 | 3300005366 | Ga0070659_100787336 | Ga0070659_1007873362 | 80 |
| 136 | 3300005367 | Ga0070667_100067852 | Ga0070667_1000678523 | 80 |
| 137 | 3300005438 | Ga0070701_10078565 | Ga0070701_100785653 | 80 |
| 138 | 3300005441 | Ga0070700_100710557 | Ga0070700_1007105571 | 80 |
| 139 | 3300005456 | Ga0070678_100003286 | Ga0070678_1000032865 | 80 |
| 140 | 3300005457 | Ga0070662_100035523 | Ga0070662_1000355233 | 80 |
| 141 | 3300005457 | Ga0070662_100054392 | Ga0070662_1000543924 | 80 |
| 142 | 3300005459 | Ga0068867_100073950 | Ga0068867_1000739503 | 80 |
| 143 | 3300005459 | Ga0068867_100733825 | Ga0068867_1007338252 | 80 |
| 144 | 3300005466 | Ga0070685_10265907 | Ga0070685_102659072 | 80 |
| 145 | 3300005535 | Ga0070684_101325970 | Ga0070684_1013259702 | 80 |
| 146 | 3300005539 | Ga0068853_101773588 | Ga0068853_1017735881 | 80 |
| 147 | 3300005544 | Ga0070686_101470741 | Ga0070686_1014707411 | 80 |
| 148 | 3300005545 | Ga0070695_101353976 | Ga0070695_1013539762 | 80 |
| 149 | 3300005549 | Ga0070704_100083692 | Ga0070704_1000836923 | 80 |
| 150 | 3300005564 | Ga0070664_100042086 | Ga0070664_1000420862 | 80 |
| 151 | 3300005564 | Ga0070664_100132197 | Ga0070664_1001321972 | 80 |
| 152 | 3300005564 | Ga0070664_100500562 | Ga0070664_1005005622 | 80 |
| 153 | 3300005577 | Ga0068857_100023348 | Ga0068857_1000233483 | 80 |
| 154 | 3300005577 | Ga0068857_100131955 | Ga0068857_1001319552 | 80 |
| 155 | 3300005578 | Ga0068854_100078549 | Ga0068854_1000785493 | 80 |
| 156 | 3300005578 | Ga0068854_101052727 | Ga0068854_1010527272 | 80 |
| 157 | 3300005616 | Ga0068852_100179185 | Ga0068852_1001791853 | 80 |
| 158 | 3300005616 | Ga0068852_101096546 | Ga0068852_1010965461 | 80 |
| 159 | 3300005617 | Ga0068859_100360211 | Ga0068859_1003602111 | 80 |
| 160 | 3300005617 | Ga0068859_101559965 | Ga0068859_1015599652 | 80 |
| 161 | 3300005618 | Ga0068864_100437828 | Ga0068864_1004378282 | 80 |
| 162 | 3300005719 | Ga0068861_100230718 | Ga0068861_1002307182 | 80 |
| 163 | 3300005834 | Ga0068851_10940564 | Ga0068851_109405641 | 80 |
| 164 | 3300005840 | Ga0068870_10009083 | Ga0068870_100090832 | 80 |
| 165 | 3300005840 | Ga0068870_10163524 | Ga0068870_101635242 | 80 |
| 166 | 3300005841 | Ga0068863_100081203 | Ga0068863_1000812033 | 80 |
| 167 | 3300005844 | Ga0068862_100005611 | Ga0068862_1000056115 | 80 |
| 168 | 3300006163 | Ga0070715_10104756 | Ga0070715_101047562 | 80 |
| 169 | 3300006237 | Ga0097621_102042925 | Ga0097621_1020429252 | 80 |
| 170 | 3300006358 | Ga0068871_100061130 | Ga0068871_1000611303 | 80 |
| 171 | 3300006871 | Ga0075434_100468230 | Ga0075434_1004682302 | 80 |
| 172 | 3300006881 | Ga0068865_100189841 | Ga0068865_1001898412 | 80 |
| 173 | 3300006931 | Ga0097620_100360205 | Ga0097620_1003602053 | 80 |
| 174 | 3300006931 | Ga0097620_101559565 | Ga0097620_1015595652 | 80 |
| 175 | 3300009094 | Ga0111539_10002138 | Ga0111539_100021383 | 80 |
| 176 | 3300009174 | Ga0105241_10357373 | Ga0105241_103573733 | 80 |
| 177 | 3300009176 | Ga0105242_10090483 | Ga0105242_100904833 | 80 |
| 178 | 3300009177 | Ga0105248_11727454 | Ga0105248_117274542 | 80 |
| 179 | 3300009553 | Ga0105249_10031654 | Ga0105249_100316544 | 80 |
| 180 | 3300009553 | Ga0105249_12165957 | Ga0105249_121659572 | 80 |
| 181 | 3300010375 | Ga0105239_10707686 | Ga0105239_107076862 | 80 |
| 182 | 3300011119 | Ga0105246_11799013 | Ga0105246_117990131 | 80 |
| 183 | 3300013102 | Ga0157371_10071327 | Ga0157371_100713273 | 80 |
| 184 | 3300013296 | Ga0157374_10087995 | Ga0157374_100879952 | 80 |
| 185 | 3300013296 | Ga0157374_10156970 | Ga0157374_101569702 | 80 |
| 186 | 3300013297 | Ga0157378_10166419 | Ga0157378_101664193 | 80 |
| 187 | 3300013306 | Ga0163162_10681328 | Ga0163162_106813282 | 80 |
| 188 | 3300013307 | Ga0157372_11433923 | Ga0157372_114339232 | 80 |
| 189 | 3300013308 | Ga0157375_10029310 | Ga0157375_100293103 | 80 |
| 190 | 3300014325 | Ga0163163_10267727 | Ga0163163_102677273 | 80 |
| 191 | 3300014326 | Ga0157380_10000955 | Ga0157380_1000095521 | 80 |
| 192 | 3300014745 | Ga0157377_10000680 | Ga0157377_1000068012 | 80 |
| 193 | 3300014968 | Ga0157379_10031078 | Ga0157379_100310783 | 80 |
| 194 | 3300014969 | Ga0157376_10035604 | Ga0157376_100356043 | 80 |
| 195 | 3300017792 | Ga0163161_10177147 | Ga0163161_101771472 | 80 |
| 196 | 3300017792 | Ga0163161_11109364 | Ga0163161_111093642 | 80 |
| 197 | 3300025321 | Ga0207656_10682167 | Ga0207656_106821672 | 80 |
| 198 | 3300025901 | Ga0207688_10444780 | Ga0207688_104447802 | 80 |
| 199 | 3300025903 | Ga0207680_10011886 | Ga0207680_100118864 | 80 |
| 200 | 3300025905 | Ga0207685_10310243 | Ga0207685_103102432 | 80 |
| 201 | 3300025908 | Ga0207643_10027531 | Ga0207643_100275313 | 80 |
| 202 | 3300025923 | Ga0207681_10033369 | Ga0207681_100333693 | 80 |
| 203 | 3300025925 | Ga0207650_10079577 | Ga0207650_100795772 | 80 |
| 204 | 3300025925 | Ga0207650_10364216 | Ga0207650_103642162 | 80 |
| 205 | 3300025926 | Ga0207659_10034609 | Ga0207659_100346094 | 80 |
| 206 | 3300025931 | Ga0207644_10483973 | Ga0207644_104839732 | 80 |
| 207 | 3300025933 | Ga0207706_10012314 | Ga0207706_100123146 | 80 |
| 208 | 3300025934 | Ga0207686_10058443 | Ga0207686_100584433 | 80 |
| 209 | 3300025936 | Ga0207670_10525602 | Ga0207670_105256022 | 80 |
| 210 | 3300025937 | Ga0207669_10151790 | Ga0207669_101517902 | 80 |
| 211 | 3300025937 | Ga0207669_11044645 | Ga0207669_110446452 | 80 |
| 212 | 3300025938 | Ga0207704_11156642 | Ga0207704_111566421 | 80 |
| 213 | 3300025941 | Ga0207711_11661167 | Ga0207711_116611672 | 80 |
| 214 | 3300025942 | Ga0207689_10005093 | Ga0207689_100050937 | 80 |
| 215 | 3300025942 | Ga0207689_10023524 | Ga0207689_100235242 | 80 |
| 216 | 3300025945 | Ga0207679_10149398 | Ga0207679_101493982 | 80 |
| 217 | 3300025945 | Ga0207679_10442248 | Ga0207679_104422482 | 80 |
| 218 | 3300025960 | Ga0207651_10137547 | Ga0207651_101375472 | 80 |
| 219 | 3300025961 | Ga0207712_10514752 | Ga0207712_105147522 | 80 |
| 220 | 3300025972 | Ga0207668_10112004 | Ga0207668_101120042 | 80 |
| 221 | 3300025972 | Ga0207668_11981636 | Ga0207668_119816362 | 80 |
| 222 | 3300025981 | Ga0207640_10055055 | Ga0207640_100550553 | 80 |
| 223 | 3300025981 | Ga0207640_10101689 | Ga0207640_101016892 | 80 |
| 224 | 3300025986 | Ga0207658_10317173 | Ga0207658_103171731 | 80 |
| 225 | 3300026023 | Ga0207677_10014625 | Ga0207677_100146252 | 80 |
| 226 | 3300026023 | Ga0207677_11259383 | Ga0207677_112593832 | 80 |
| 227 | 3300026035 | Ga0207703_10179103 | Ga0207703_101791032 | 80 |
| 228 | 3300026075 | Ga0207708_10264844 | Ga0207708_102648441 | 80 |
| 229 | 3300026088 | Ga0207641_10788839 | Ga0207641_107888392 | 80 |
| 230 | 3300026089 | Ga0207648_10042733 | Ga0207648_100427334 | 80 |
| 231 | 3300026089 | Ga0207648_10497658 | Ga0207648_104976582 | 80 |
| 232 | 3300026095 | Ga0207676_10961638 | Ga0207676_109616382 | 80 |
| 233 | 3300026116 | Ga0207674_10005422 | Ga0207674_1000542211 | 80 |
| 234 | 3300026118 | Ga0207675_100001355 | Ga0207675_1000013552 | 80 |
| 235 | 3300026121 | Ga0207683_10011412 | Ga0207683_100114124 | 80 |
| 236 | 3300026142 | Ga0207698_10100063 | Ga0207698_101000632 | 80 |
| 237 | 3300028380 | Ga0268265_10212556 | Ga0268265_102125562 | 80 |
| 238 | 3300028381 | Ga0268264_10180193 | Ga0268264_101801933 | 80 |
| 239 | 3300031251 | Ga0265327_10000054 | Ga0265327_100000547 | 80 |
| 240 | 3300031852 | Ga0307410_10467619 | Ga0307410_104676192 | 80 |
| 241 | 3300031901 | Ga0307406_10902915 | Ga0307406_109029151 | 80 |
| 242 | 3300035083 | Ga0373926_0199553 | Ga0373926_0199553_365_607 | 80 |
| 243 | 3300035086 | Ga0373934_0113565 | Ga0373934_0113565_262_504 | 80 |
| 244 | 3300035170 | Ga0373943_0701182 | Ga0373943_0701182_40_288 | 80 |
| 245 | 3300035725 | Ga0373947_0092217 | Ga0373947_0092217_621_869 | 80 |
| 246 | 3300041512 | Ga0451853_0400010 | Ga0451853_0400010_167_409 | 80 |
| 247 | 3300044712 | Ga0453684_2163864 | Ga0453684_2163864_132_374 | 80 |
| 248 | 3300046454 | Ga0495592_0290004 | Ga0495592_0290004_256_498 | 80 |
| 249 | 3300046463 | Ga0495653_0151951 | Ga0495653_0151951_314_556 | 80 |
| 250 | 3300046472 | Ga0495580_0712916 | Ga0495580_0712916_62_304 | 80 |
| 251 | 3300046499 | Ga0495594_0464886 | Ga0495594_0464886_171_419 | 80 |
| 252 | 3300046514 | Ga0495618_0115589 | Ga0495618_0115589_1003_1245 | 80 |
| 253 | 3300046535 | Ga0495586_0045963 | Ga0495586_0045963_1136_1378 | 80 |
| 254 | 3300046536 | Ga0495587_0020446 | Ga0495587_0020446_1446_1688 | 80 |
| 255 | 3300046675 | Ga0495657_0064332 | Ga0495657_0064332_818_1060 | 80 |
| 256 | 3300047321 | Ga0495676_0774134 | Ga0495676_0774134_17_265 | 80 |
| 257 | 3300048903 | Ga0496100_0607889 | Ga0496100_0607889_332_574 | 80 |
| 258 | 3300048907 | Ga0496104_0708629 | Ga0496104_0708629_108_350 | 80 |
| 259 | 3300048909 | Ga0496106_0475339 | Ga0496106_0475339_603_845 | 80 |
| 260 | 3300048918 | Ga0496115_1417800 | Ga0496115_1417800_157_399 | 80 |
| 261 | 3300049671 | Ga0501238_038078 | Ga0501238_038078_154_399 | 80 |
| 262 | 3300050512 | nmdc:mga0n895_992540_c1 | nmdc:mga0n895_992540_c1_237_479 | 80 |
| 263 | 3300050513 | nmdc:mga0rr50_813319_c1 | nmdc:mga0rr50_813319_c1_64_306 | 80 |
| 264 | 2162886011 | MRS1b_contig_3991831 | MRS1b_0743.00003010 | 81 |
| 265 | 3300000545 | CNXas_1008144 | CNXas_10081441 | 81 |
| 266 | 3300001979 | JGI24740J21852_10004408 | JGI24740J21852_100044088 | 81 |
| 267 | 3300001989 | JGI24739J22299_10000154 | JGI24739J22299_100001545 | 81 |
| 268 | 3300001989 | JGI24739J22299_10088741 | JGI24739J22299_100887412 | 81 |
| 269 | 3300001989 | JGI24739J22299_10163145 | JGI24739J22299_101631452 | 81 |
| 270 | 3300001990 | JGI24737J22298_10124825 | JGI24737J22298_101248251 | 81 |
| 271 | 3300002459 | JGI24751J29686_10022844 | JGI24751J29686_100228442 | 81 |
| 272 | 3300002738 | JGI25154J39366_1000004 | JGI25154J39366_100000419 | 81 |
| 273 | 3300002739 | JGI25158J39367_1012243 | JGI25158J39367_10122432 | 81 |
| 274 | 3300002739 | JGI25158J39367_1020046 | JGI25158J39367_10200462 | 81 |
| 275 | 3300002741 | JGI25157J39369_1006614 | JGI25157J39369_10066143 | 81 |
| 276 | 3300002987 | JGI25159J45721_1011021 | JGI25159J45721_10110212 | 81 |
| 277 | 3300003215 | JGI25153J46596_10000224 | JGI25153J46596_1000022417 | 81 |
| 278 | 3300003215 | JGI25153J46596_10084177 | JGI25153J46596_100841771 | 81 |
| 279 | 3300003215 | JGI25153J46596_10125283 | JGI25153J46596_101252832 | 81 |
| 280 | 3300003316 | rootH1_10028725 | rootH1_100287255 | 81 |
| 281 | 3300003316 | rootH1_10105550 | rootH1_101055503 | 81 |
| 282 | 3300003320 | rootH2_10092470 | rootH2_100924703 | 81 |
| 283 | 3300003320 | rootH2_10168387 | rootH2_101683871 | 81 |
| 284 | 3300003320 | rootH2_10246825 | rootH2_102468252 | 81 |
| 285 | 3300003322 | rootL2_10108849 | rootL2_101088493 | 81 |
| 286 | 3300003322 | rootL2_10160668 | rootL2_101606683 | 81 |
| 287 | 3300003322 | rootL2_10303123 | rootL2_103031232 | 81 |
| 288 | 3300003323 | rootH1_10006382 | rootH1_100063822 | 81 |
| 289 | 3300003323 | rootH1_10071977 | rootH1_100719772 | 81 |
| 290 | 3300003323 | rootH1_10087949 | rootH1_100879492 | 81 |
| 291 | 3300003354 | JGI25160J50197_1007253 | JGI25160J50197_10072534 | 81 |
| 292 | 3300003354 | JGI25160J50197_1010399 | JGI25160J50197_10103995 | 81 |
| 293 | 3300003354 | JGI25160J50197_1025424 | JGI25160J50197_10254242 | 81 |
| 294 | 3300003761 | Ga0055535_1007135 | Ga0055535_10071352 | 81 |
| 295 | 3300003762 | Ga0055542_1006677 | Ga0055542_10066773 | 81 |
| 296 | 3300003790 | Ga0055528_1000355 | Ga0055528_10003559 | 81 |
| 297 | 3300003791 | Ga0055530_10000425 | Ga0055530_100004259 | 81 |
| 298 | 3300003794 | Ga0055531_10000411 | Ga0055531_1000041120 | 81 |
| 299 | 3300003794 | Ga0055531_10037717 | Ga0055531_100377172 | 81 |
| 300 | 3300005262 | Ga0065165_1000148 | Ga0065165_100014825 | 81 |
| 301 | 3300005262 | Ga0065165_1014842 | Ga0065165_10148422 | 81 |
| 302 | 3300005262 | Ga0065165_1030372 | Ga0065165_10303721 | 81 |
| 303 | 3300005288 | Ga0065714_10171921 | Ga0065714_101719212 | 81 |
| 304 | 3300005289 | Ga0065704_10375778 | Ga0065704_103757782 | 81 |
| 305 | 3300005289 | Ga0065704_10388791 | Ga0065704_103887912 | 81 |
| 306 | 3300005289 | Ga0065704_10843439 | Ga0065704_108434391 | 81 |
| 307 | 3300005290 | Ga0065712_10001417 | Ga0065712_100014175 | 81 |
| 308 | 3300005290 | Ga0065712_10149212 | Ga0065712_101492123 | 81 |
| 309 | 3300005290 | Ga0065712_10165992 | Ga0065712_101659922 | 81 |
| 310 | 3300005290 | Ga0065712_10332757 | Ga0065712_103327572 | 81 |
| 311 | 3300005290 | Ga0065712_10696653 | Ga0065712_106966531 | 81 |
| 312 | 3300005290 | Ga0065712_10719023 | Ga0065712_107190232 | 81 |
| 313 | 3300005293 | Ga0065715_10075105 | Ga0065715_100751052 | 81 |
| 314 | 3300005293 | Ga0065715_10236672 | Ga0065715_102366722 | 81 |
| 315 | 3300005295 | Ga0065707_10229826 | Ga0065707_102298262 | 81 |
| 316 | 3300005295 | Ga0065707_10425758 | Ga0065707_104257582 | 81 |
| 317 | 3300005327 | Ga0070658_10016557 | Ga0070658_100165575 | 81 |
| 318 | 3300005327 | Ga0070658_10029504 | Ga0070658_100295044 | 81 |
| 319 | 3300005327 | Ga0070658_10166171 | Ga0070658_101661712 | 81 |
| 320 | 3300005328 | Ga0070676_10004512 | Ga0070676_100045122 | 81 |
| 321 | 3300005328 | Ga0070676_10158946 | Ga0070676_101589462 | 81 |
| 322 | 3300005329 | Ga0070683_100000615 | Ga0070683_10000061527 | 81 |
| 323 | 3300005329 | Ga0070683_100002428 | Ga0070683_1000024288 | 81 |
| 324 | 3300005329 | Ga0070683_100048187 | Ga0070683_1000481871 | 81 |
| 325 | 3300005330 | Ga0070690_101511534 | Ga0070690_1015115341 | 81 |
| 326 | 3300005331 | Ga0070670_100366957 | Ga0070670_1003669572 | 81 |
| 327 | 3300005331 | Ga0070670_100785445 | Ga0070670_1007854452 | 81 |
| 328 | 3300005331 | Ga0070670_101140936 | Ga0070670_1011409362 | 81 |
| 329 | 3300005331 | Ga0070670_101335581 | Ga0070670_1013355811 | 81 |
| 330 | 3300005333 | Ga0070677_10014866 | Ga0070677_100148664 | 81 |
| 331 | 3300005333 | Ga0070677_10069338 | Ga0070677_100693383 | 81 |
| 332 | 3300005333 | Ga0070677_10182051 | Ga0070677_101820512 | 81 |
| 333 | 3300005334 | Ga0068869_100088792 | Ga0068869_1000887922 | 81 |
| 334 | 3300005334 | Ga0068869_100188735 | Ga0068869_1001887351 | 81 |
| 335 | 3300005334 | Ga0068869_101355570 | Ga0068869_1013555702 | 81 |
| 336 | 3300005335 | Ga0070666_10003206 | Ga0070666_100032067 | 81 |
| 337 | 3300005335 | Ga0070666_10037711 | Ga0070666_100377114 | 81 |
| 338 | 3300005335 | Ga0070666_10087689 | Ga0070666_100876892 | 81 |
| 339 | 3300005336 | Ga0070680_100031273 | Ga0070680_1000312733 | 81 |
| 340 | 3300005336 | Ga0070680_100073100 | Ga0070680_1000731003 | 81 |
| 341 | 3300005336 | Ga0070680_100076264 | Ga0070680_1000762644 | 81 |
| 342 | 3300005336 | Ga0070680_101450127 | Ga0070680_1014501271 | 81 |
| 343 | 3300005337 | Ga0070682_100068373 | Ga0070682_1000683733 | 81 |
| 344 | 3300005337 | Ga0070682_100153642 | Ga0070682_1001536423 | 81 |
| 345 | 3300005338 | Ga0068868_100003134 | Ga0068868_10000313410 | 81 |
| 346 | 3300005338 | Ga0068868_100431522 | Ga0068868_1004315222 | 81 |
| 347 | 3300005338 | Ga0068868_101355732 | Ga0068868_1013557322 | 81 |
| 348 | 3300005338 | Ga0068868_101417648 | Ga0068868_1014176481 | 81 |
| 349 | 3300005339 | Ga0070660_100001558 | Ga0070660_1000015583 | 81 |
| 350 | 3300005339 | Ga0070660_100068302 | Ga0070660_1000683023 | 81 |
| 351 | 3300005339 | Ga0070660_100097241 | Ga0070660_1000972412 | 81 |
| 352 | 3300005339 | Ga0070660_100308646 | Ga0070660_1003086462 | 81 |
| 353 | 3300005339 | Ga0070660_100361896 | Ga0070660_1003618962 | 81 |
| 354 | 3300005339 | Ga0070660_100451449 | Ga0070660_1004514491 | 81 |
| 355 | 3300005339 | Ga0070660_100486182 | Ga0070660_1004861822 | 81 |
| 356 | 3300005339 | Ga0070660_100964091 | Ga0070660_1009640911 | 81 |
| 357 | 3300005340 | Ga0070689_100711257 | Ga0070689_1007112572 | 81 |
| 358 | 3300005340 | Ga0070689_101532784 | Ga0070689_1015327842 | 81 |
| 359 | 3300005341 | Ga0070691_10070158 | Ga0070691_100701582 | 81 |
| 360 | 3300005343 | Ga0070687_100084904 | Ga0070687_1000849042 | 81 |
| 361 | 3300005343 | Ga0070687_100240710 | Ga0070687_1002407102 | 81 |
| 362 | 3300005343 | Ga0070687_101111580 | Ga0070687_1011115802 | 81 |
| 363 | 3300005344 | Ga0070661_100000716 | Ga0070661_10000071624 | 81 |
| 364 | 3300005344 | Ga0070661_101708494 | Ga0070661_1017084942 | 81 |
| 365 | 3300005345 | Ga0070692_10329317 | Ga0070692_103293172 | 81 |
| 366 | 3300005345 | Ga0070692_10417698 | Ga0070692_104176982 | 81 |
| 367 | 3300005345 | Ga0070692_10548503 | Ga0070692_105485032 | 81 |
| 368 | 3300005347 | Ga0070668_100011512 | Ga0070668_1000115123 | 81 |
| 369 | 3300005347 | Ga0070668_100083587 | Ga0070668_1000835873 | 81 |
| 370 | 3300005347 | Ga0070668_100326069 | Ga0070668_1003260692 | 81 |
| 371 | 3300005347 | Ga0070668_100331165 | Ga0070668_1003311652 | 81 |
| 372 | 3300005353 | Ga0070669_100126538 | Ga0070669_1001265383 | 81 |
| 373 | 3300005353 | Ga0070669_100330064 | Ga0070669_1003300642 | 81 |
| 374 | 3300005353 | Ga0070669_101366184 | Ga0070669_1013661842 | 81 |
| 375 | 3300005353 | Ga0070669_101991893 | Ga0070669_1019918932 | 81 |
| 376 | 3300005354 | Ga0070675_100002107 | Ga0070675_1000021076 | 81 |
| 377 | 3300005354 | Ga0070675_100033122 | Ga0070675_1000331225 | 81 |
| 378 | 3300005354 | Ga0070675_100148821 | Ga0070675_1001488213 | 81 |
| 379 | 3300005354 | Ga0070675_100195754 | Ga0070675_1001957542 | 81 |
| 380 | 3300005354 | Ga0070675_100245564 | Ga0070675_1002455642 | 81 |
| 381 | 3300005355 | Ga0070671_100019722 | Ga0070671_1000197225 | 81 |
| 382 | 3300005355 | Ga0070671_100644228 | Ga0070671_1006442282 | 81 |
| 383 | 3300005355 | Ga0070671_101303334 | Ga0070671_1013033342 | 81 |
| 384 | 3300005356 | Ga0070674_100081660 | Ga0070674_1000816603 | 81 |
| 385 | 3300005356 | Ga0070674_100118139 | Ga0070674_1001181393 | 81 |
| 386 | 3300005356 | Ga0070674_100280305 | Ga0070674_1002803052 | 81 |
| 387 | 3300005356 | Ga0070674_100429194 | Ga0070674_1004291942 | 81 |
| 388 | 3300005356 | Ga0070674_100605243 | Ga0070674_1006052432 | 81 |
| 389 | 3300005364 | Ga0070673_100002306 | Ga0070673_10000230611 | 81 |
| 390 | 3300005364 | Ga0070673_100122862 | Ga0070673_1001228621 | 81 |
| 391 | 3300005364 | Ga0070673_100757139 | Ga0070673_1007571392 | 81 |
| 392 | 3300005364 | Ga0070673_100845769 | Ga0070673_1008457691 | 81 |
| 393 | 3300005365 | Ga0070688_100018226 | Ga0070688_1000182262 | 81 |
| 394 | 3300005366 | Ga0070659_100286926 | Ga0070659_1002869263 | 81 |
| 395 | 3300005366 | Ga0070659_100835755 | Ga0070659_1008357552 | 81 |
| 396 | 3300005366 | Ga0070659_100968893 | Ga0070659_1009688932 | 81 |
| 397 | 3300005366 | Ga0070659_101050685 | Ga0070659_1010506852 | 81 |
| 398 | 3300005366 | Ga0070659_101960879 | Ga0070659_1019608791 | 81 |
| 399 | 3300005367 | Ga0070667_100007609 | Ga0070667_1000076099 | 81 |
| 400 | 3300005367 | Ga0070667_100049032 | Ga0070667_1000490323 | 81 |
| 401 | 3300005367 | Ga0070667_100195878 | Ga0070667_1001958782 | 81 |
| 402 | 3300005367 | Ga0070667_100223373 | Ga0070667_1002233733 | 81 |
| 403 | 3300005367 | Ga0070667_101009961 | Ga0070667_1010099612 | 81 |
| 404 | 3300005367 | Ga0070667_101059104 | Ga0070667_1010591042 | 81 |
| 405 | 3300005406 | Ga0070703_10506814 | Ga0070703_105068142 | 81 |
| 406 | 3300005435 | Ga0070714_100669624 | Ga0070714_1006696242 | 81 |
| 407 | 3300005437 | Ga0070710_11434452 | Ga0070710_114344521 | 81 |
| 408 | 3300005438 | Ga0070701_10023227 | Ga0070701_100232273 | 81 |
| 409 | 3300005440 | Ga0070705_100644389 | Ga0070705_1006443891 | 81 |
| 410 | 3300005440 | Ga0070705_101365373 | Ga0070705_1013653732 | 81 |
| 411 | 3300005441 | Ga0070700_100145353 | Ga0070700_1001453532 | 81 |
| 412 | 3300005444 | Ga0070694_100508132 | Ga0070694_1005081322 | 81 |
| 413 | 3300005455 | Ga0070663_100012032 | Ga0070663_1000120322 | 81 |
| 414 | 3300005455 | Ga0070663_100169767 | Ga0070663_1001697672 | 81 |
| 415 | 3300005455 | Ga0070663_100397292 | Ga0070663_1003972922 | 81 |
| 416 | 3300005456 | Ga0070678_100158474 | Ga0070678_1001584743 | 81 |
| 417 | 3300005457 | Ga0070662_100011603 | Ga0070662_1000116033 | 81 |
| 418 | 3300005457 | Ga0070662_100376237 | Ga0070662_1003762372 | 81 |
| 419 | 3300005457 | Ga0070662_100615819 | Ga0070662_1006158192 | 81 |
| 420 | 3300005457 | Ga0070662_101176054 | Ga0070662_1011760542 | 81 |
| 421 | 3300005457 | Ga0070662_101309745 | Ga0070662_1013097452 | 81 |
| 422 | 3300005458 | Ga0070681_10088919 | Ga0070681_100889192 | 81 |
| 423 | 3300005458 | Ga0070681_10095068 | Ga0070681_100950683 | 81 |
| 424 | 3300005458 | Ga0070681_10527543 | Ga0070681_105275432 | 81 |
| 425 | 3300005458 | Ga0070681_10810323 | Ga0070681_108103232 | 81 |
| 426 | 3300005459 | Ga0068867_100005650 | Ga0068867_1000056503 | 81 |
| 427 | 3300005459 | Ga0068867_100062803 | Ga0068867_1000628033 | 81 |
| 428 | 3300005459 | Ga0068867_100080722 | Ga0068867_1000807224 | 81 |
| 429 | 3300005459 | Ga0068867_100290819 | Ga0068867_1002908192 | 81 |
| 430 | 3300005459 | Ga0068867_100775108 | Ga0068867_1007751082 | 81 |
| 431 | 3300005459 | Ga0068867_100919472 | Ga0068867_1009194722 | 81 |
| 432 | 3300005459 | Ga0068867_100933110 | Ga0068867_1009331101 | 81 |
| 433 | 3300005459 | Ga0068867_101709782 | Ga0068867_1017097821 | 81 |
| 434 | 3300005466 | Ga0070685_10021727 | Ga0070685_100217272 | 81 |
| 435 | 3300005466 | Ga0070685_10194478 | Ga0070685_101944781 | 81 |
| 436 | 3300005466 | Ga0070685_10606095 | Ga0070685_106060952 | 81 |
| 437 | 3300005466 | Ga0070685_10609501 | Ga0070685_106095012 | 81 |
| 438 | 3300005468 | Ga0070707_100318179 | Ga0070707_1003181792 | 81 |
| 439 | 3300005471 | Ga0070698_100000585 | Ga0070698_10000058521 | 81 |
| 440 | 3300005471 | Ga0070698_100000965 | Ga0070698_10000096531 | 81 |
| 441 | 3300005471 | Ga0070698_100032415 | Ga0070698_1000324155 | 81 |
| 442 | 3300005518 | Ga0070699_100493970 | Ga0070699_1004939702 | 81 |
| 443 | 3300005530 | Ga0070679_100070634 | Ga0070679_1000706342 | 81 |
| 444 | 3300005530 | Ga0070679_100173865 | Ga0070679_1001738653 | 81 |
| 445 | 3300005530 | Ga0070679_100431741 | Ga0070679_1004317412 | 81 |
| 446 | 3300005530 | Ga0070679_100554943 | Ga0070679_1005549431 | 81 |
| 447 | 3300005530 | Ga0070679_100647417 | Ga0070679_1006474173 | 81 |
| 448 | 3300005535 | Ga0070684_100000134 | Ga0070684_1000001343 | 81 |
| 449 | 3300005535 | Ga0070684_101009235 | Ga0070684_1010092352 | 81 |
| 450 | 3300005536 | Ga0070697_101667294 | Ga0070697_1016672941 | 81 |
| 451 | 3300005539 | Ga0068853_100020543 | Ga0068853_1000205435 | 81 |
| 452 | 3300005539 | Ga0068853_100050862 | Ga0068853_1000508623 | 81 |
| 453 | 3300005539 | Ga0068853_100063424 | Ga0068853_1000634244 | 81 |
| 454 | 3300005539 | Ga0068853_100164165 | Ga0068853_1001641653 | 81 |
| 455 | 3300005539 | Ga0068853_100221850 | Ga0068853_1002218502 | 81 |
| 456 | 3300005539 | Ga0068853_100366338 | Ga0068853_1003663382 | 81 |
| 457 | 3300005539 | Ga0068853_100604829 | Ga0068853_1006048292 | 81 |
| 458 | 3300005539 | Ga0068853_100722012 | Ga0068853_1007220121 | 81 |
| 459 | 3300005539 | Ga0068853_101248095 | Ga0068853_1012480952 | 81 |
| 460 | 3300005539 | Ga0068853_101354105 | Ga0068853_1013541052 | 81 |
| 461 | 3300005539 | Ga0068853_101704560 | Ga0068853_1017045602 | 81 |
| 462 | 3300005543 | Ga0070672_100000891 | Ga0070672_1000008918 | 81 |
| 463 | 3300005543 | Ga0070672_100039214 | Ga0070672_1000392142 | 81 |
| 464 | 3300005543 | Ga0070672_100052704 | Ga0070672_1000527043 | 81 |
| 465 | 3300005543 | Ga0070672_100251835 | Ga0070672_1002518352 | 81 |
| 466 | 3300005543 | Ga0070672_100296308 | Ga0070672_1002963083 | 81 |
| 467 | 3300005548 | Ga0070665_100000717 | Ga0070665_10000071732 | 81 |
| 468 | 3300005549 | Ga0070704_100423900 | Ga0070704_1004239002 | 81 |
| 469 | 3300005549 | Ga0070704_101056900 | Ga0070704_1010569002 | 81 |
| 470 | 3300005549 | Ga0070704_101256592 | Ga0070704_1012565922 | 81 |
| 471 | 3300005549 | Ga0070704_101266160 | Ga0070704_1012661601 | 81 |
| 472 | 3300005549 | Ga0070704_101843798 | Ga0070704_1018437982 | 81 |
| 473 | 3300005563 | Ga0068855_100000210 | Ga0068855_10000021038 | 81 |
| 474 | 3300005563 | Ga0068855_100013494 | Ga0068855_1000134945 | 81 |
| 475 | 3300005563 | Ga0068855_100019662 | Ga0068855_1000196624 | 81 |
| 476 | 3300005563 | Ga0068855_100033420 | Ga0068855_1000334204 | 81 |
| 477 | 3300005563 | Ga0068855_100131020 | Ga0068855_1001310202 | 81 |
| 478 | 3300005563 | Ga0068855_100166003 | Ga0068855_1001660032 | 81 |
| 479 | 3300005563 | Ga0068855_100200676 | Ga0068855_1002006763 | 81 |
| 480 | 3300005563 | Ga0068855_100309054 | Ga0068855_1003090542 | 81 |
| 481 | 3300005563 | Ga0068855_100603126 | Ga0068855_1006031262 | 81 |
| 482 | 3300005563 | Ga0068855_100831639 | Ga0068855_1008316393 | 81 |
| 483 | 3300005564 | Ga0070664_100001395 | Ga0070664_10000139519 | 81 |
| 484 | 3300005564 | Ga0070664_100098645 | Ga0070664_1000986453 | 81 |
| 485 | 3300005564 | Ga0070664_101416906 | Ga0070664_1014169062 | 81 |
| 486 | 3300005577 | Ga0068857_100001139 | Ga0068857_10000113922 | 81 |
| 487 | 3300005577 | Ga0068857_100011514 | Ga0068857_1000115145 | 81 |
| 488 | 3300005577 | Ga0068857_100031961 | Ga0068857_1000319614 | 81 |
| 489 | 3300005577 | Ga0068857_100086847 | Ga0068857_1000868474 | 81 |
| 490 | 3300005577 | Ga0068857_100111973 | Ga0068857_1001119733 | 81 |
| 491 | 3300005577 | Ga0068857_100389855 | Ga0068857_1003898552 | 81 |
| 492 | 3300005577 | Ga0068857_100729726 | Ga0068857_1007297261 | 81 |
| 493 | 3300005577 | Ga0068857_102074695 | Ga0068857_1020746951 | 81 |
| 494 | 3300005578 | Ga0068854_100309677 | Ga0068854_1003096772 | 81 |
| 495 | 3300005578 | Ga0068854_101489163 | Ga0068854_1014891631 | 81 |
| 496 | 3300005614 | Ga0068856_100002822 | Ga0068856_1000028228 | 81 |
| 497 | 3300005614 | Ga0068856_100120763 | Ga0068856_1001207633 | 81 |
| 498 | 3300005614 | Ga0068856_100168942 | Ga0068856_1001689423 | 81 |
| 499 | 3300005614 | Ga0068856_101697243 | Ga0068856_1016972431 | 81 |
| 500 | 3300005615 | Ga0070702_100538398 | Ga0070702_1005383982 | 81 |
| 501 | 3300005616 | Ga0068852_100028064 | Ga0068852_1000280642 | 81 |
| 502 | 3300005616 | Ga0068852_100119828 | Ga0068852_1001198282 | 81 |
| 503 | 3300005616 | Ga0068852_100125468 | Ga0068852_1001254683 | 81 |
| 504 | 3300005616 | Ga0068852_100310763 | Ga0068852_1003107633 | 81 |
| 505 | 3300005616 | Ga0068852_100411446 | Ga0068852_1004114463 | 81 |
| 506 | 3300005616 | Ga0068852_101368399 | Ga0068852_1013683992 | 81 |
| 507 | 3300005616 | Ga0068852_102314564 | Ga0068852_1023145641 | 81 |
| 508 | 3300005616 | Ga0068852_102492543 | Ga0068852_1024925432 | 81 |
| 509 | 3300005617 | Ga0068859_100013947 | Ga0068859_10001394710 | 81 |
| 510 | 3300005617 | Ga0068859_100259173 | Ga0068859_1002591732 | 81 |
| 511 | 3300005617 | Ga0068859_100424214 | Ga0068859_1004242142 | 81 |
| 512 | 3300005617 | Ga0068859_100669199 | Ga0068859_1006691992 | 81 |
| 513 | 3300005617 | Ga0068859_100927488 | Ga0068859_1009274881 | 81 |
| 514 | 3300005617 | Ga0068859_101941512 | Ga0068859_1019415121 | 81 |
| 515 | 3300005618 | Ga0068864_100005533 | Ga0068864_1000055339 | 81 |
| 516 | 3300005618 | Ga0068864_100047444 | Ga0068864_1000474443 | 81 |
| 517 | 3300005618 | Ga0068864_100245303 | Ga0068864_1002453032 | 81 |
| 518 | 3300005618 | Ga0068864_100956887 | Ga0068864_1009568872 | 81 |
| 519 | 3300005618 | Ga0068864_101128055 | Ga0068864_1011280552 | 81 |
| 520 | 3300005718 | Ga0068866_10107701 | Ga0068866_101077012 | 81 |
| 521 | 3300005718 | Ga0068866_10135369 | Ga0068866_101353692 | 81 |
| 522 | 3300005718 | Ga0068866_10823681 | Ga0068866_108236812 | 81 |
| 523 | 3300005719 | Ga0068861_100089216 | Ga0068861_1000892162 | 81 |
| 524 | 3300005719 | Ga0068861_100100506 | Ga0068861_1001005062 | 81 |
| 525 | 3300005719 | Ga0068861_100174470 | Ga0068861_1001744703 | 81 |
| 526 | 3300005719 | Ga0068861_100657801 | Ga0068861_1006578012 | 81 |
| 527 | 3300005719 | Ga0068861_100893828 | Ga0068861_1008938282 | 81 |
| 528 | 3300005719 | Ga0068861_101067162 | Ga0068861_1010671622 | 81 |
| 529 | 3300005719 | Ga0068861_101640057 | Ga0068861_1016400571 | 81 |
| 530 | 3300005834 | Ga0068851_10007173 | Ga0068851_100071735 | 81 |
| 531 | 3300005834 | Ga0068851_10062218 | Ga0068851_100622182 | 81 |
| 532 | 3300005834 | Ga0068851_10110605 | Ga0068851_101106052 | 81 |
| 533 | 3300005834 | Ga0068851_10122130 | Ga0068851_101221302 | 81 |
| 534 | 3300005840 | Ga0068870_10025610 | Ga0068870_100256103 | 81 |
| 535 | 3300005840 | Ga0068870_10234500 | Ga0068870_102345002 | 81 |
| 536 | 3300005841 | Ga0068863_100007041 | Ga0068863_1000070416 | 81 |
| 537 | 3300005841 | Ga0068863_100045831 | Ga0068863_1000458315 | 81 |
| 538 | 3300005841 | Ga0068863_100101556 | Ga0068863_1001015562 | 81 |
| 539 | 3300005841 | Ga0068863_100510458 | Ga0068863_1005104582 | 81 |
| 540 | 3300005841 | Ga0068863_101197020 | Ga0068863_1011970201 | 81 |
| 541 | 3300005842 | Ga0068858_100015215 | Ga0068858_1000152153 | 81 |
| 542 | 3300005842 | Ga0068858_100108630 | Ga0068858_1001086301 | 81 |
| 543 | 3300005842 | Ga0068858_100240779 | Ga0068858_1002407792 | 81 |
| 544 | 3300005842 | Ga0068858_100406117 | Ga0068858_1004061172 | 81 |
| 545 | 3300005842 | Ga0068858_100502218 | Ga0068858_1005022182 | 81 |
| 546 | 3300005842 | Ga0068858_100599173 | Ga0068858_1005991731 | 81 |
| 547 | 3300005843 | Ga0068860_100000004 | Ga0068860_100000004159 | 81 |
| 548 | 3300005843 | Ga0068860_100007960 | Ga0068860_1000079603 | 81 |
| 549 | 3300005843 | Ga0068860_100020751 | Ga0068860_1000207513 | 81 |
| 550 | 3300005843 | Ga0068860_100233604 | Ga0068860_1002336043 | 81 |
| 551 | 3300005843 | Ga0068860_100506895 | Ga0068860_1005068952 | 81 |
| 552 | 3300005843 | Ga0068860_101326006 | Ga0068860_1013260062 | 81 |
| 553 | 3300005844 | Ga0068862_100158940 | Ga0068862_1001589403 | 81 |
| 554 | 3300005844 | Ga0068862_100197896 | Ga0068862_1001978962 | 81 |
| 555 | 3300005844 | Ga0068862_100341456 | Ga0068862_1003414562 | 81 |
| 556 | 3300005844 | Ga0068862_100408531 | Ga0068862_1004085312 | 81 |
| 557 | 3300005844 | Ga0068862_101069346 | Ga0068862_1010693462 | 81 |
| 558 | 3300005844 | Ga0068862_101666483 | Ga0068862_1016664832 | 81 |
| 559 | 3300005983 | Ga0081540_1229819 | Ga0081540_12298192 | 81 |
| 560 | 3300005985 | Ga0081539_10028019 | Ga0081539_100280192 | 81 |
| 561 | 3300006173 | Ga0070716_101598154 | Ga0070716_1015981542 | 81 |
| 562 | 3300006195 | Ga0075366_10023733 | Ga0075366_100237334 | 81 |
| 563 | 3300006195 | Ga0075366_10044341 | Ga0075366_100443412 | 81 |
| 564 | 3300006195 | Ga0075366_10057126 | Ga0075366_100571263 | 81 |
| 565 | 3300006195 | Ga0075366_10218143 | Ga0075366_102181432 | 81 |
| 566 | 3300006195 | Ga0075366_10235577 | Ga0075366_102355772 | 81 |
| 567 | 3300006195 | Ga0075366_10357496 | Ga0075366_103574962 | 81 |
| 568 | 3300006195 | Ga0075366_10542250 | Ga0075366_105422502 | 81 |
| 569 | 3300006237 | Ga0097621_100013926 | Ga0097621_1000139263 | 81 |
| 570 | 3300006237 | Ga0097621_100193560 | Ga0097621_1001935602 | 81 |
| 571 | 3300006237 | Ga0097621_100385504 | Ga0097621_1003855043 | 81 |
| 572 | 3300006237 | Ga0097621_100654672 | Ga0097621_1006546722 | 81 |
| 573 | 3300006237 | Ga0097621_100891584 | Ga0097621_1008915842 | 81 |
| 574 | 3300006237 | Ga0097621_101488749 | Ga0097621_1014887492 | 81 |
| 575 | 3300006237 | Ga0097621_101778565 | Ga0097621_1017785652 | 81 |
| 576 | 3300006358 | Ga0068871_100000076 | Ga0068871_10000007617 | 81 |
| 577 | 3300006358 | Ga0068871_100006134 | Ga0068871_1000061349 | 81 |
| 578 | 3300006358 | Ga0068871_101753233 | Ga0068871_1017532332 | 81 |
| 579 | 3300006844 | Ga0075428_100003531 | Ga0075428_1000035318 | 81 |
| 580 | 3300006844 | Ga0075428_100022783 | Ga0075428_1000227833 | 81 |
| 581 | 3300006844 | Ga0075428_100067391 | Ga0075428_1000673911 | 81 |
| 582 | 3300006844 | Ga0075428_100863557 | Ga0075428_1008635572 | 81 |
| 583 | 3300006844 | Ga0075428_102009797 | Ga0075428_1020097972 | 81 |
| 584 | 3300006844 | Ga0075428_102650439 | Ga0075428_1026504392 | 81 |
| 585 | 3300006846 | Ga0075430_100003285 | Ga0075430_1000032852 | 81 |
| 586 | 3300006846 | Ga0075430_100078318 | Ga0075430_1000783184 | 81 |
| 587 | 3300006847 | Ga0075431_100003484 | Ga0075431_1000034844 | 81 |
| 588 | 3300006847 | Ga0075431_100106799 | Ga0075431_1001067992 | 81 |
| 589 | 3300006847 | Ga0075431_100169083 | Ga0075431_1001690832 | 81 |
| 590 | 3300006871 | Ga0075434_100257710 | Ga0075434_1002577102 | 81 |
| 591 | 3300006871 | Ga0075434_102369302 | Ga0075434_1023693022 | 81 |
| 592 | 3300006880 | Ga0075429_100000539 | Ga0075429_10000053917 | 81 |
| 593 | 3300006880 | Ga0075429_100018881 | Ga0075429_1000188812 | 81 |
| 594 | 3300006880 | Ga0075429_100023645 | Ga0075429_1000236454 | 81 |
| 595 | 3300006880 | Ga0075429_101386936 | Ga0075429_1013869362 | 81 |
| 596 | 3300006881 | Ga0068865_100004770 | Ga0068865_1000047705 | 81 |
| 597 | 3300006881 | Ga0068865_100471839 | Ga0068865_1004718392 | 81 |
| 598 | 3300006881 | Ga0068865_101007712 | Ga0068865_1010077122 | 81 |
| 599 | 3300006931 | Ga0097620_100013947 | Ga0097620_10001394710 | 81 |
| 600 | 3300006931 | Ga0097620_100259160 | Ga0097620_1002591603 | 81 |
| 601 | 3300006931 | Ga0097620_100424215 | Ga0097620_1004242152 | 81 |
| 602 | 3300006931 | Ga0097620_100669149 | Ga0097620_1006691492 | 81 |
| 603 | 3300006931 | Ga0097620_100927408 | Ga0097620_1009274082 | 81 |
| 604 | 3300006931 | Ga0097620_101941053 | Ga0097620_1019410531 | 81 |
| 605 | 3300007076 | Ga0075435_100671700 | Ga0075435_1006717002 | 81 |
| 606 | 3300009011 | Ga0105251_10581992 | Ga0105251_105819922 | 81 |
| 607 | 3300009093 | Ga0105240_10002773 | Ga0105240_100027733 | 81 |
| 608 | 3300009093 | Ga0105240_10014724 | Ga0105240_100147246 | 81 |
| 609 | 3300009093 | Ga0105240_10078635 | Ga0105240_100786354 | 81 |
| 610 | 3300009093 | Ga0105240_10122116 | Ga0105240_101221163 | 81 |
| 611 | 3300009093 | Ga0105240_10268604 | Ga0105240_102686042 | 81 |
| 612 | 3300009093 | Ga0105240_10417752 | Ga0105240_104177522 | 81 |
| 613 | 3300009093 | Ga0105240_11676293 | Ga0105240_116762932 | 81 |
| 614 | 3300009093 | Ga0105240_12736745 | Ga0105240_127367451 | 81 |
| 615 | 3300009094 | Ga0111539_10022224 | Ga0111539_100222246 | 81 |
| 616 | 3300009094 | Ga0111539_10149801 | Ga0111539_101498012 | 81 |
| 617 | 3300009094 | Ga0111539_10434093 | Ga0111539_104340932 | 81 |
| 618 | 3300009094 | Ga0111539_10919964 | Ga0111539_109199641 | 81 |
| 619 | 3300009094 | Ga0111539_11018787 | Ga0111539_110187872 | 81 |
| 620 | 3300009094 | Ga0111539_11135765 | Ga0111539_111357651 | 81 |
| 621 | 3300009094 | Ga0111539_11544361 | Ga0111539_115443612 | 81 |
| 622 | 3300009094 | Ga0111539_12137950 | Ga0111539_121379501 | 81 |
| 623 | 3300009094 | Ga0111539_12372126 | Ga0111539_123721261 | 81 |
| 624 | 3300009098 | Ga0105245_11474491 | Ga0105245_114744912 | 81 |
| 625 | 3300009101 | Ga0105247_10684236 | Ga0105247_106842361 | 81 |
| 626 | 3300009147 | Ga0114129_10005173 | Ga0114129_1000517316 | 81 |
| 627 | 3300009147 | Ga0114129_10044760 | Ga0114129_100447607 | 81 |
| 628 | 3300009147 | Ga0114129_10135425 | Ga0114129_101354253 | 81 |
| 629 | 3300009147 | Ga0114129_10469584 | Ga0114129_104695843 | 81 |
| 630 | 3300009148 | Ga0105243_10258408 | Ga0105243_102584082 | 81 |
| 631 | 3300009174 | Ga0105241_10152728 | Ga0105241_101527283 | 81 |
| 632 | 3300009174 | Ga0105241_10183548 | Ga0105241_101835482 | 81 |
| 633 | 3300009174 | Ga0105241_10308399 | Ga0105241_103083992 | 81 |
| 634 | 3300009174 | Ga0105241_10611932 | Ga0105241_106119322 | 81 |
| 635 | 3300009174 | Ga0105241_10779213 | Ga0105241_107792132 | 81 |
| 636 | 3300009174 | Ga0105241_10841871 | Ga0105241_108418712 | 81 |
| 637 | 3300009176 | Ga0105242_10028757 | Ga0105242_100287574 | 81 |
| 638 | 3300009176 | Ga0105242_10032198 | Ga0105242_100321983 | 81 |
| 639 | 3300009176 | Ga0105242_10199971 | Ga0105242_101999713 | 81 |
| 640 | 3300009176 | Ga0105242_10205153 | Ga0105242_102051531 | 81 |
| 641 | 3300009176 | Ga0105242_10248027 | Ga0105242_102480272 | 81 |
| 642 | 3300009176 | Ga0105242_13039464 | Ga0105242_130394641 | 81 |
| 643 | 3300009177 | Ga0105248_10020088 | Ga0105248_100200885 | 81 |
| 644 | 3300009177 | Ga0105248_10348836 | Ga0105248_103488362 | 81 |
| 645 | 3300009545 | Ga0105237_10011361 | Ga0105237_100113616 | 81 |
| 646 | 3300009545 | Ga0105237_10035708 | Ga0105237_100357084 | 81 |
| 647 | 3300009545 | Ga0105237_10216508 | Ga0105237_102165083 | 81 |
| 648 | 3300009545 | Ga0105237_11291167 | Ga0105237_112911672 | 81 |
| 649 | 3300009551 | Ga0105238_10226021 | Ga0105238_102260213 | 81 |
| 650 | 3300009551 | Ga0105238_10636568 | Ga0105238_106365682 | 81 |
| 651 | 3300009553 | Ga0105249_10005610 | Ga0105249_100056106 | 81 |
| 652 | 3300009553 | Ga0105249_10077890 | Ga0105249_100778905 | 81 |
| 653 | 3300009553 | Ga0105249_10112450 | Ga0105249_101124504 | 81 |
| 654 | 3300009553 | Ga0105249_10118001 | Ga0105249_101180012 | 81 |
| 655 | 3300009553 | Ga0105249_10404191 | Ga0105249_104041912 | 81 |
| 656 | 3300009553 | Ga0105249_10421211 | Ga0105249_104212112 | 81 |
| 657 | 3300009553 | Ga0105249_10501367 | Ga0105249_105013673 | 81 |
| 658 | 3300010159 | Ga0099796_10220122 | Ga0099796_102201221 | 81 |
| 659 | 3300010375 | Ga0105239_10015012 | Ga0105239_100150124 | 81 |
| 660 | 3300010375 | Ga0105239_10017962 | Ga0105239_100179626 | 81 |
| 661 | 3300010375 | Ga0105239_10182821 | Ga0105239_101828213 | 81 |
| 662 | 3300010375 | Ga0105239_10358684 | Ga0105239_103586842 | 81 |
| 663 | 3300010375 | Ga0105239_10497244 | Ga0105239_104972442 | 81 |
| 664 | 3300010375 | Ga0105239_10753466 | Ga0105239_107534662 | 81 |
| 665 | 3300010375 | Ga0105239_11221869 | Ga0105239_112218692 | 81 |
| 666 | 3300010375 | Ga0105239_11537888 | Ga0105239_115378882 | 81 |
| 667 | 3300010375 | Ga0105239_12184380 | Ga0105239_121843802 | 81 |
| 668 | 3300011119 | Ga0105246_10072803 | Ga0105246_100728033 | 81 |
| 669 | 3300011119 | Ga0105246_10086311 | Ga0105246_100863113 | 81 |
| 670 | 3300011119 | Ga0105246_10618161 | Ga0105246_106181612 | 81 |
| 671 | 3300013100 | Ga0157373_10002704 | Ga0157373_1000270411 | 81 |
| 672 | 3300013100 | Ga0157373_10019662 | Ga0157373_100196624 | 81 |
| 673 | 3300013100 | Ga0157373_10021506 | Ga0157373_100215065 | 81 |
| 674 | 3300013100 | Ga0157373_10196220 | Ga0157373_101962202 | 81 |
| 675 | 3300013100 | Ga0157373_10228670 | Ga0157373_102286703 | 81 |
| 676 | 3300013100 | Ga0157373_10507577 | Ga0157373_105075771 | 81 |
| 677 | 3300013100 | Ga0157373_10963142 | Ga0157373_109631421 | 81 |
| 678 | 3300013100 | Ga0157373_11053689 | Ga0157373_110536892 | 81 |
| 679 | 3300013100 | Ga0157373_11108618 | Ga0157373_111086182 | 81 |
| 680 | 3300013100 | Ga0157373_11355229 | Ga0157373_113552292 | 81 |
| 681 | 3300013102 | Ga0157371_10001533 | Ga0157371_100015334 | 81 |
| 682 | 3300013102 | Ga0157371_10001693 | Ga0157371_1000169320 | 81 |
| 683 | 3300013102 | Ga0157371_10001829 | Ga0157371_1000182911 | 81 |
| 684 | 3300013102 | Ga0157371_10002330 | Ga0157371_100023305 | 81 |
| 685 | 3300013102 | Ga0157371_10011626 | Ga0157371_100116265 | 81 |
| 686 | 3300013102 | Ga0157371_10018324 | Ga0157371_100183246 | 81 |
| 687 | 3300013102 | Ga0157371_10021176 | Ga0157371_100211765 | 81 |
| 688 | 3300013102 | Ga0157371_10029612 | Ga0157371_100296124 | 81 |
| 689 | 3300013102 | Ga0157371_10038547 | Ga0157371_100385473 | 81 |
| 690 | 3300013102 | Ga0157371_10059402 | Ga0157371_100594023 | 81 |
| 691 | 3300013102 | Ga0157371_10119043 | Ga0157371_101190433 | 81 |
| 692 | 3300013102 | Ga0157371_10160572 | Ga0157371_101605722 | 81 |
| 693 | 3300013102 | Ga0157371_10184413 | Ga0157371_101844132 | 81 |
| 694 | 3300013102 | Ga0157371_10208722 | Ga0157371_102087222 | 81 |
| 695 | 3300013102 | Ga0157371_10210062 | Ga0157371_102100624 | 81 |
| 696 | 3300013102 | Ga0157371_10234254 | Ga0157371_102342542 | 81 |
| 697 | 3300013102 | Ga0157371_10362065 | Ga0157371_103620652 | 81 |
| 698 | 3300013102 | Ga0157371_10382135 | Ga0157371_103821352 | 81 |
| 699 | 3300013102 | Ga0157371_10440790 | Ga0157371_104407902 | 81 |
| 700 | 3300013102 | Ga0157371_10524347 | Ga0157371_105243472 | 81 |
| 701 | 3300013102 | Ga0157371_11227938 | Ga0157371_112279382 | 81 |
| 702 | 3300013104 | Ga0157370_10002958 | Ga0157370_100029586 | 81 |
| 703 | 3300013104 | Ga0157370_10046504 | Ga0157370_100465043 | 81 |
| 704 | 3300013104 | Ga0157370_10106933 | Ga0157370_101069333 | 81 |
| 705 | 3300013104 | Ga0157370_10348395 | Ga0157370_103483952 | 81 |
| 706 | 3300013104 | Ga0157370_10420745 | Ga0157370_104207452 | 81 |
| 707 | 3300013104 | Ga0157370_10542836 | Ga0157370_105428362 | 81 |
| 708 | 3300013104 | Ga0157370_10701646 | Ga0157370_107016462 | 81 |
| 709 | 3300013104 | Ga0157370_10804684 | Ga0157370_108046842 | 81 |
| 710 | 3300013104 | Ga0157370_11116168 | Ga0157370_111161682 | 81 |
| 711 | 3300013104 | Ga0157370_11250469 | Ga0157370_112504691 | 81 |
| 712 | 3300013104 | Ga0157370_11604159 | Ga0157370_116041591 | 81 |
| 713 | 3300013105 | Ga0157369_10027523 | Ga0157369_100275234 | 81 |
| 714 | 3300013105 | Ga0157369_10028011 | Ga0157369_100280117 | 81 |
| 715 | 3300013105 | Ga0157369_10052489 | Ga0157369_100524895 | 81 |
| 716 | 3300013105 | Ga0157369_10381472 | Ga0157369_103814722 | 81 |
| 717 | 3300013105 | Ga0157369_10916103 | Ga0157369_109161032 | 81 |
| 718 | 3300013105 | Ga0157369_11381018 | Ga0157369_113810181 | 81 |
| 719 | 3300013105 | Ga0157369_11499312 | Ga0157369_114993122 | 81 |
| 720 | 3300013105 | Ga0157369_11894447 | Ga0157369_118944472 | 81 |
| 721 | 3300013105 | Ga0157369_11946669 | Ga0157369_119466692 | 81 |
| 722 | 3300013105 | Ga0157369_12291957 | Ga0157369_122919572 | 81 |
| 723 | 3300013296 | Ga0157374_10005530 | Ga0157374_100055309 | 81 |
| 724 | 3300013296 | Ga0157374_10162410 | Ga0157374_101624102 | 81 |
| 725 | 3300013296 | Ga0157374_10371371 | Ga0157374_103713712 | 81 |
| 726 | 3300013296 | Ga0157374_10371449 | Ga0157374_103714493 | 81 |
| 727 | 3300013296 | Ga0157374_10885639 | Ga0157374_108856392 | 81 |
| 728 | 3300013296 | Ga0157374_10891286 | Ga0157374_108912862 | 81 |
| 729 | 3300013296 | Ga0157374_10933942 | Ga0157374_109339422 | 81 |
| 730 | 3300013297 | Ga0157378_10013114 | Ga0157378_100131145 | 81 |
| 731 | 3300013297 | Ga0157378_10066114 | Ga0157378_100661143 | 81 |
| 732 | 3300013297 | Ga0157378_10686741 | Ga0157378_106867412 | 81 |
| 733 | 3300013297 | Ga0157378_12267118 | Ga0157378_122671181 | 81 |
| 734 | 3300013306 | Ga0163162_10001306 | Ga0163162_1000130615 | 81 |
| 735 | 3300013306 | Ga0163162_10002620 | Ga0163162_100026205 | 81 |
| 736 | 3300013306 | Ga0163162_10003840 | Ga0163162_100038407 | 81 |
| 737 | 3300013306 | Ga0163162_10013381 | Ga0163162_100133813 | 81 |
| 738 | 3300013306 | Ga0163162_10022875 | Ga0163162_100228753 | 81 |
| 739 | 3300013306 | Ga0163162_10171390 | Ga0163162_101713903 | 81 |
| 740 | 3300013306 | Ga0163162_10220623 | Ga0163162_102206232 | 81 |
| 741 | 3300013306 | Ga0163162_10426408 | Ga0163162_104264082 | 81 |
| 742 | 3300013306 | Ga0163162_11173128 | Ga0163162_111731282 | 81 |
| 743 | 3300013307 | Ga0157372_10033742 | Ga0157372_100337422 | 81 |
| 744 | 3300013307 | Ga0157372_10036205 | Ga0157372_100362052 | 81 |
| 745 | 3300013307 | Ga0157372_10039132 | Ga0157372_100391327 | 81 |
| 746 | 3300013307 | Ga0157372_10062107 | Ga0157372_100621073 | 81 |
| 747 | 3300013307 | Ga0157372_10074457 | Ga0157372_100744572 | 81 |
| 748 | 3300013307 | Ga0157372_10108796 | Ga0157372_101087962 | 81 |
| 749 | 3300013307 | Ga0157372_10173771 | Ga0157372_101737714 | 81 |
| 750 | 3300013307 | Ga0157372_10228957 | Ga0157372_102289573 | 81 |
| 751 | 3300013307 | Ga0157372_10396117 | Ga0157372_103961172 | 81 |
| 752 | 3300013307 | Ga0157372_10545396 | Ga0157372_105453961 | 81 |
| 753 | 3300013307 | Ga0157372_10579821 | Ga0157372_105798212 | 81 |
| 754 | 3300013307 | Ga0157372_10725767 | Ga0157372_107257672 | 81 |
| 755 | 3300013307 | Ga0157372_10771811 | Ga0157372_107718114 | 81 |
| 756 | 3300013307 | Ga0157372_10842069 | Ga0157372_108420692 | 81 |
| 757 | 3300013307 | Ga0157372_10854859 | Ga0157372_108548592 | 81 |
| 758 | 3300013307 | Ga0157372_10857681 | Ga0157372_108576814 | 81 |
| 759 | 3300013307 | Ga0157372_10881933 | Ga0157372_108819332 | 81 |
| 760 | 3300013307 | Ga0157372_10951457 | Ga0157372_109514571 | 81 |
| 761 | 3300013307 | Ga0157372_11479885 | Ga0157372_114798852 | 81 |
| 762 | 3300013307 | Ga0157372_11774931 | Ga0157372_117749312 | 81 |
| 763 | 3300013307 | Ga0157372_12676452 | Ga0157372_126764522 | 81 |
| 764 | 3300013307 | Ga0157372_13212195 | Ga0157372_132121952 | 81 |
| 765 | 3300013308 | Ga0157375_10000754 | Ga0157375_1000075417 | 81 |
| 766 | 3300013308 | Ga0157375_10006460 | Ga0157375_100064608 | 81 |
| 767 | 3300013308 | Ga0157375_10054153 | Ga0157375_100541534 | 81 |
| 768 | 3300013308 | Ga0157375_10065453 | Ga0157375_100654534 | 81 |
| 769 | 3300013308 | Ga0157375_10438656 | Ga0157375_104386562 | 81 |
| 770 | 3300013308 | Ga0157375_10645273 | Ga0157375_106452732 | 81 |
| 771 | 3300013308 | Ga0157375_10689479 | Ga0157375_106894791 | 81 |
| 772 | 3300013308 | Ga0157375_12056566 | Ga0157375_120565662 | 81 |
| 773 | 3300014325 | Ga0163163_10001404 | Ga0163163_1000140416 | 81 |
| 774 | 3300014325 | Ga0163163_10008917 | Ga0163163_100089173 | 81 |
| 775 | 3300014325 | Ga0163163_10018486 | Ga0163163_100184864 | 81 |
| 776 | 3300014325 | Ga0163163_10133033 | Ga0163163_101330331 | 81 |
| 777 | 3300014325 | Ga0163163_10540540 | Ga0163163_105405401 | 81 |
| 778 | 3300014325 | Ga0163163_10652846 | Ga0163163_106528461 | 81 |
| 779 | 3300014325 | Ga0163163_10870936 | Ga0163163_108709362 | 81 |
| 780 | 3300014325 | Ga0163163_10985242 | Ga0163163_109852422 | 81 |
| 781 | 3300014325 | Ga0163163_12554492 | Ga0163163_125544922 | 81 |
| 782 | 3300014326 | Ga0157380_10094278 | Ga0157380_100942784 | 81 |
| 783 | 3300014326 | Ga0157380_10115010 | Ga0157380_101150102 | 81 |
| 784 | 3300014326 | Ga0157380_10195776 | Ga0157380_101957762 | 81 |
| 785 | 3300014326 | Ga0157380_10420825 | Ga0157380_104208252 | 81 |
| 786 | 3300014326 | Ga0157380_10470314 | Ga0157380_104703142 | 81 |
| 787 | 3300014326 | Ga0157380_10751118 | Ga0157380_107511182 | 81 |
| 788 | 3300014326 | Ga0157380_10894643 | Ga0157380_108946432 | 81 |
| 789 | 3300014326 | Ga0157380_11258074 | Ga0157380_112580742 | 81 |
| 790 | 3300014326 | Ga0157380_12537020 | Ga0157380_125370201 | 81 |
| 791 | 3300014326 | Ga0157380_12638680 | Ga0157380_126386802 | 81 |
| 792 | 3300014326 | Ga0157380_13135733 | Ga0157380_131357332 | 81 |
| 793 | 3300014745 | Ga0157377_10006129 | Ga0157377_100061294 | 81 |
| 794 | 3300014745 | Ga0157377_10069521 | Ga0157377_100695212 | 81 |
| 795 | 3300014745 | Ga0157377_10316267 | Ga0157377_103162672 | 81 |
| 796 | 3300014745 | Ga0157377_11640248 | Ga0157377_116402481 | 81 |
| 797 | 3300014745 | Ga0157377_11746041 | Ga0157377_117460412 | 81 |
| 798 | 3300014968 | Ga0157379_10013306 | Ga0157379_100133066 | 81 |
| 799 | 3300014968 | Ga0157379_10051382 | Ga0157379_100513822 | 81 |
| 800 | 3300014968 | Ga0157379_10560273 | Ga0157379_105602732 | 81 |
| 801 | 3300014968 | Ga0157379_10746417 | Ga0157379_107464171 | 81 |
| 802 | 3300014968 | Ga0157379_11547958 | Ga0157379_115479581 | 81 |
| 803 | 3300014968 | Ga0157379_11753436 | Ga0157379_117534361 | 81 |
| 804 | 3300014969 | Ga0157376_10002174 | Ga0157376_100021745 | 81 |
| 805 | 3300014969 | Ga0157376_10007024 | Ga0157376_100070242 | 81 |
| 806 | 3300014969 | Ga0157376_10156953 | Ga0157376_101569532 | 81 |
| 807 | 3300014969 | Ga0157376_10263235 | Ga0157376_102632352 | 81 |
| 808 | 3300014969 | Ga0157376_10550898 | Ga0157376_105508982 | 81 |
| 809 | 3300014969 | Ga0157376_11019699 | Ga0157376_110196992 | 81 |
| 810 | 3300014969 | Ga0157376_11031486 | Ga0157376_110314862 | 81 |
| 811 | 3300014969 | Ga0157376_11476542 | Ga0157376_114765421 | 81 |
| 812 | 3300014969 | Ga0157376_11498510 | Ga0157376_114985102 | 81 |
| 813 | 3300015265 | Ga0182005_1000040 | Ga0182005_100004014 | 81 |
| 814 | 3300017792 | Ga0163161_10002032 | Ga0163161_100020325 | 81 |
| 815 | 3300017792 | Ga0163161_10005284 | Ga0163161_100052844 | 81 |
| 816 | 3300017792 | Ga0163161_10836691 | Ga0163161_108366912 | 81 |
| 817 | 3300017792 | Ga0163161_10918078 | Ga0163161_109180782 | 81 |
| 818 | 3300017792 | Ga0163161_11213525 | Ga0163161_112135252 | 81 |
| 819 | 3300025208 | Ga0209436_101017 | Ga0209436_1010179 | 81 |
| 820 | 3300025208 | Ga0209436_103090 | Ga0209436_1030902 | 81 |
| 821 | 3300025242 | Ga0209258_100075 | Ga0209258_100075169 | 81 |
| 822 | 3300025242 | Ga0209258_118247 | Ga0209258_1182472 | 81 |
| 823 | 3300025246 | Ga0209646_1000025 | Ga0209646_1000025319 | 81 |
| 824 | 3300025246 | Ga0209646_1023538 | Ga0209646_10235382 | 81 |
| 825 | 3300025250 | Ga0209026_1000312 | Ga0209026_100031218 | 81 |
| 826 | 3300025254 | Ga0209148_1000085 | Ga0209148_100008560 | 81 |
| 827 | 3300025258 | Ga0209129_1040498 | Ga0209129_10404982 | 81 |
| 828 | 3300025273 | Ga0209673_1000197 | Ga0209673_100019763 | 81 |
| 829 | 3300025284 | Ga0209130_1001772 | Ga0209130_100177210 | 81 |
| 830 | 3300025297 | Ga0209758_1000742 | Ga0209758_100074212 | 81 |
| 831 | 3300025297 | Ga0209758_1020083 | Ga0209758_10200833 | 81 |
| 832 | 3300025297 | Ga0209758_1037270 | Ga0209758_10372702 | 81 |
| 833 | 3300025298 | Ga0209050_1000204 | Ga0209050_1000204105 | 81 |
| 834 | 3300025302 | Ga0207426_1000057 | Ga0207426_1000057138 | 81 |
| 835 | 3300025302 | Ga0207426_1000332 | Ga0207426_100033268 | 81 |
| 836 | 3300025302 | Ga0207426_1001542 | Ga0207426_100154214 | 81 |
| 837 | 3300025302 | Ga0207426_1003820 | Ga0207426_10038204 | 81 |
| 838 | 3300025303 | Ga0209051_1039742 | Ga0209051_10397422 | 81 |
| 839 | 3300025304 | Ga0209257_1000004 | Ga0209257_10000041175 | 81 |
| 840 | 3300025304 | Ga0209257_1007784 | Ga0209257_10077843 | 81 |
| 841 | 3300025315 | Ga0207697_10020826 | Ga0207697_100208264 | 81 |
| 842 | 3300025315 | Ga0207697_10118976 | Ga0207697_101189762 | 81 |
| 843 | 3300025315 | Ga0207697_10357642 | Ga0207697_103576422 | 81 |
| 844 | 3300025321 | Ga0207656_10023282 | Ga0207656_100232823 | 81 |
| 845 | 3300025893 | Ga0207682_10142181 | Ga0207682_101421812 | 81 |
| 846 | 3300025893 | Ga0207682_10153287 | Ga0207682_101532872 | 81 |
| 847 | 3300025899 | Ga0207642_10075607 | Ga0207642_100756072 | 81 |
| 848 | 3300025899 | Ga0207642_10128929 | Ga0207642_101289292 | 81 |
| 849 | 3300025899 | Ga0207642_10902622 | Ga0207642_109026222 | 81 |
| 850 | 3300025903 | Ga0207680_10005285 | Ga0207680_100052853 | 81 |
| 851 | 3300025903 | Ga0207680_10207005 | Ga0207680_102070053 | 81 |
| 852 | 3300025903 | Ga0207680_10807016 | Ga0207680_108070162 | 81 |
| 853 | 3300025904 | Ga0207647_10005350 | Ga0207647_100053509 | 81 |
| 854 | 3300025904 | Ga0207647_10087715 | Ga0207647_100877152 | 81 |
| 855 | 3300025904 | Ga0207647_10286589 | Ga0207647_102865892 | 81 |
| 856 | 3300025905 | Ga0207685_10107432 | Ga0207685_101074322 | 81 |
| 857 | 3300025905 | Ga0207685_10120795 | Ga0207685_101207952 | 81 |
| 858 | 3300025907 | Ga0207645_10008166 | Ga0207645_100081667 | 81 |
| 859 | 3300025907 | Ga0207645_10044413 | Ga0207645_100444132 | 81 |
| 860 | 3300025907 | Ga0207645_10068778 | Ga0207645_100687783 | 81 |
| 861 | 3300025908 | Ga0207643_10005497 | Ga0207643_100054976 | 81 |
| 862 | 3300025908 | Ga0207643_10341390 | Ga0207643_103413902 | 81 |
| 863 | 3300025909 | Ga0207705_10004610 | Ga0207705_100046106 | 81 |
| 864 | 3300025909 | Ga0207705_10040871 | Ga0207705_100408713 | 81 |
| 865 | 3300025909 | Ga0207705_10047164 | Ga0207705_100471643 | 81 |
| 866 | 3300025909 | Ga0207705_10058642 | Ga0207705_100586422 | 81 |
| 867 | 3300025909 | Ga0207705_10078637 | Ga0207705_100786373 | 81 |
| 868 | 3300025909 | Ga0207705_10258498 | Ga0207705_102584982 | 81 |
| 869 | 3300025909 | Ga0207705_10940187 | Ga0207705_109401872 | 81 |
| 870 | 3300025910 | Ga0207684_11625681 | Ga0207684_116256812 | 81 |
| 871 | 3300025911 | Ga0207654_10121539 | Ga0207654_101215392 | 81 |
| 872 | 3300025911 | Ga0207654_10164170 | Ga0207654_101641702 | 81 |
| 873 | 3300025911 | Ga0207654_10396069 | Ga0207654_103960692 | 81 |
| 874 | 3300025912 | Ga0207707_10213510 | Ga0207707_102135102 | 81 |
| 875 | 3300025912 | Ga0207707_10712946 | Ga0207707_107129462 | 81 |
| 876 | 3300025912 | Ga0207707_11215977 | Ga0207707_112159772 | 81 |
| 877 | 3300025913 | Ga0207695_10000568 | Ga0207695_1000056839 | 81 |
| 878 | 3300025913 | Ga0207695_10001216 | Ga0207695_1000121622 | 81 |
| 879 | 3300025913 | Ga0207695_10023739 | Ga0207695_100237392 | 81 |
| 880 | 3300025913 | Ga0207695_10145163 | Ga0207695_101451632 | 81 |
| 881 | 3300025913 | Ga0207695_10260665 | Ga0207695_102606652 | 81 |
| 882 | 3300025914 | Ga0207671_10002095 | Ga0207671_1000209517 | 81 |
| 883 | 3300025914 | Ga0207671_10006310 | Ga0207671_100063105 | 81 |
| 884 | 3300025917 | Ga0207660_10009646 | Ga0207660_100096462 | 81 |
| 885 | 3300025917 | Ga0207660_10089701 | Ga0207660_100897012 | 81 |
| 886 | 3300025917 | Ga0207660_10158337 | Ga0207660_101583372 | 81 |
| 887 | 3300025917 | Ga0207660_10227636 | Ga0207660_102276362 | 81 |
| 888 | 3300025917 | Ga0207660_11194969 | Ga0207660_111949691 | 81 |
| 889 | 3300025918 | Ga0207662_10340173 | Ga0207662_103401731 | 81 |
| 890 | 3300025919 | Ga0207657_10003942 | Ga0207657_100039423 | 81 |
| 891 | 3300025919 | Ga0207657_10021914 | Ga0207657_100219143 | 81 |
| 892 | 3300025919 | Ga0207657_10068979 | Ga0207657_100689794 | 81 |
| 893 | 3300025919 | Ga0207657_10074998 | Ga0207657_100749984 | 81 |
| 894 | 3300025919 | Ga0207657_10282099 | Ga0207657_102820992 | 81 |
| 895 | 3300025919 | Ga0207657_10593794 | Ga0207657_105937941 | 81 |
| 896 | 3300025919 | Ga0207657_10617524 | Ga0207657_106175242 | 81 |
| 897 | 3300025919 | Ga0207657_11032653 | Ga0207657_110326532 | 81 |
| 898 | 3300025919 | Ga0207657_11145477 | Ga0207657_111454772 | 81 |
| 899 | 3300025920 | Ga0207649_10000604 | Ga0207649_100006045 | 81 |
| 900 | 3300025920 | Ga0207649_10292252 | Ga0207649_102922522 | 81 |
| 901 | 3300025921 | Ga0207652_10001482 | Ga0207652_100014823 | 81 |
| 902 | 3300025921 | Ga0207652_10013784 | Ga0207652_100137844 | 81 |
| 903 | 3300025921 | Ga0207652_10053513 | Ga0207652_100535132 | 81 |
| 904 | 3300025921 | Ga0207652_10891400 | Ga0207652_108914001 | 81 |
| 905 | 3300025922 | Ga0207646_10296134 | Ga0207646_102961343 | 81 |
| 906 | 3300025923 | Ga0207681_10404124 | Ga0207681_104041242 | 81 |
| 907 | 3300025923 | Ga0207681_10766923 | Ga0207681_107669231 | 81 |
| 908 | 3300025923 | Ga0207681_10817193 | Ga0207681_108171931 | 81 |
| 909 | 3300025923 | Ga0207681_11320138 | Ga0207681_113201382 | 81 |
| 910 | 3300025923 | Ga0207681_11343887 | Ga0207681_113438872 | 81 |
| 911 | 3300025924 | Ga0207694_10208788 | Ga0207694_102087882 | 81 |
| 912 | 3300025924 | Ga0207694_10445343 | Ga0207694_104453432 | 81 |
| 913 | 3300025925 | Ga0207650_10005929 | Ga0207650_100059291 | 81 |
| 914 | 3300025925 | Ga0207650_10091924 | Ga0207650_100919243 | 81 |
| 915 | 3300025925 | Ga0207650_10105464 | Ga0207650_101054642 | 81 |
| 916 | 3300025925 | Ga0207650_10899888 | Ga0207650_108998881 | 81 |
| 917 | 3300025926 | Ga0207659_10081496 | Ga0207659_100814962 | 81 |
| 918 | 3300025926 | Ga0207659_10135126 | Ga0207659_101351262 | 81 |
| 919 | 3300025926 | Ga0207659_10380988 | Ga0207659_103809882 | 81 |
| 920 | 3300025926 | Ga0207659_10851863 | Ga0207659_108518631 | 81 |
| 921 | 3300025927 | Ga0207687_10857181 | Ga0207687_108571812 | 81 |
| 922 | 3300025929 | Ga0207664_10541691 | Ga0207664_105416912 | 81 |
| 923 | 3300025931 | Ga0207644_10023211 | Ga0207644_100232113 | 81 |
| 924 | 3300025931 | Ga0207644_11015997 | Ga0207644_110159972 | 81 |
| 925 | 3300025931 | Ga0207644_11154131 | Ga0207644_111541311 | 81 |
| 926 | 3300025932 | Ga0207690_10013425 | Ga0207690_100134253 | 81 |
| 927 | 3300025932 | Ga0207690_10198160 | Ga0207690_101981602 | 81 |
| 928 | 3300025932 | Ga0207690_11218847 | Ga0207690_112188472 | 81 |
| 929 | 3300025932 | Ga0207690_11373773 | Ga0207690_113737731 | 81 |
| 930 | 3300025933 | Ga0207706_10027858 | Ga0207706_100278583 | 81 |
| 931 | 3300025933 | Ga0207706_11107067 | Ga0207706_111070672 | 81 |
| 932 | 3300025933 | Ga0207706_11472575 | Ga0207706_114725751 | 81 |
| 933 | 3300025934 | Ga0207686_10011068 | Ga0207686_100110683 | 81 |
| 934 | 3300025934 | Ga0207686_10016489 | Ga0207686_100164893 | 81 |
| 935 | 3300025934 | Ga0207686_10259564 | Ga0207686_102595642 | 81 |
| 936 | 3300025934 | Ga0207686_10279836 | Ga0207686_102798362 | 81 |
| 937 | 3300025934 | Ga0207686_10653817 | Ga0207686_106538171 | 81 |
| 938 | 3300025936 | Ga0207670_10010649 | Ga0207670_100106496 | 81 |
| 939 | 3300025936 | Ga0207670_11675889 | Ga0207670_116758891 | 81 |
| 940 | 3300025936 | Ga0207670_11874235 | Ga0207670_118742352 | 81 |
| 941 | 3300025937 | Ga0207669_10105614 | Ga0207669_101056143 | 81 |
| 942 | 3300025937 | Ga0207669_10125710 | Ga0207669_101257102 | 81 |
| 943 | 3300025937 | Ga0207669_10513019 | Ga0207669_105130192 | 81 |
| 944 | 3300025938 | Ga0207704_10043459 | Ga0207704_100434593 | 81 |
| 945 | 3300025938 | Ga0207704_10052867 | Ga0207704_100528673 | 81 |
| 946 | 3300025938 | Ga0207704_11292938 | Ga0207704_112929382 | 81 |
| 947 | 3300025940 | Ga0207691_10001933 | Ga0207691_1000193310 | 81 |
| 948 | 3300025940 | Ga0207691_10002669 | Ga0207691_1000266913 | 81 |
| 949 | 3300025940 | Ga0207691_10043504 | Ga0207691_100435043 | 81 |
| 950 | 3300025940 | Ga0207691_10186296 | Ga0207691_101862962 | 81 |
| 951 | 3300025940 | Ga0207691_10219346 | Ga0207691_102193463 | 81 |
| 952 | 3300025940 | Ga0207691_10374474 | Ga0207691_103744742 | 81 |
| 953 | 3300025940 | Ga0207691_11603607 | Ga0207691_116036072 | 81 |
| 954 | 3300025941 | Ga0207711_10149875 | Ga0207711_101498753 | 81 |
| 955 | 3300025941 | Ga0207711_10335230 | Ga0207711_103352302 | 81 |
| 956 | 3300025942 | Ga0207689_10019949 | Ga0207689_100199493 | 81 |
| 957 | 3300025942 | Ga0207689_10023318 | Ga0207689_100233183 | 81 |
| 958 | 3300025942 | Ga0207689_10114930 | Ga0207689_101149301 | 81 |
| 959 | 3300025942 | Ga0207689_10129778 | Ga0207689_101297783 | 81 |
| 960 | 3300025942 | Ga0207689_10361012 | Ga0207689_103610122 | 81 |
| 961 | 3300025942 | Ga0207689_10383673 | Ga0207689_103836732 | 81 |
| 962 | 3300025944 | Ga0207661_10000092 | Ga0207661_100000926 | 81 |
| 963 | 3300025944 | Ga0207661_10001341 | Ga0207661_100013419 | 81 |
| 964 | 3300025944 | Ga0207661_10461270 | Ga0207661_104612702 | 81 |
| 965 | 3300025944 | Ga0207661_11752904 | Ga0207661_117529042 | 81 |
| 966 | 3300025945 | Ga0207679_10000146 | Ga0207679_100001466 | 81 |
| 967 | 3300025945 | Ga0207679_10138949 | Ga0207679_101389492 | 81 |
| 968 | 3300025945 | Ga0207679_11711839 | Ga0207679_117118391 | 81 |
| 969 | 3300025949 | Ga0207667_10000222 | Ga0207667_1000022259 | 81 |
| 970 | 3300025949 | Ga0207667_10000246 | Ga0207667_1000024632 | 81 |
| 971 | 3300025949 | Ga0207667_10020120 | Ga0207667_100201206 | 81 |
| 972 | 3300025949 | Ga0207667_10024382 | Ga0207667_100243826 | 81 |
| 973 | 3300025949 | Ga0207667_10164834 | Ga0207667_101648343 | 81 |
| 974 | 3300025949 | Ga0207667_10647540 | Ga0207667_106475402 | 81 |
| 975 | 3300025949 | Ga0207667_10915784 | Ga0207667_109157841 | 81 |
| 976 | 3300025949 | Ga0207667_11247751 | Ga0207667_112477511 | 81 |
| 977 | 3300025949 | Ga0207667_11890409 | Ga0207667_118904091 | 81 |
| 978 | 3300025960 | Ga0207651_10002602 | Ga0207651_100026023 | 81 |
| 979 | 3300025960 | Ga0207651_10027681 | Ga0207651_100276812 | 81 |
| 980 | 3300025960 | Ga0207651_10102009 | Ga0207651_101020091 | 81 |
| 981 | 3300025960 | Ga0207651_10167771 | Ga0207651_101677712 | 81 |
| 982 | 3300025960 | Ga0207651_10195603 | Ga0207651_101956033 | 81 |
| 983 | 3300025960 | Ga0207651_10795548 | Ga0207651_107955482 | 81 |
| 984 | 3300025960 | Ga0207651_11635950 | Ga0207651_116359501 | 81 |
| 985 | 3300025961 | Ga0207712_10001299 | Ga0207712_100012997 | 81 |
| 986 | 3300025961 | Ga0207712_10243116 | Ga0207712_102431163 | 81 |
| 987 | 3300025961 | Ga0207712_10661546 | Ga0207712_106615462 | 81 |
| 988 | 3300025961 | Ga0207712_10724864 | Ga0207712_107248642 | 81 |
| 989 | 3300025961 | Ga0207712_11258939 | Ga0207712_112589391 | 81 |
| 990 | 3300025972 | Ga0207668_10006124 | Ga0207668_100061243 | 81 |
| 991 | 3300025972 | Ga0207668_10058112 | Ga0207668_100581122 | 81 |
| 992 | 3300025972 | Ga0207668_10893661 | Ga0207668_108936612 | 81 |
| 993 | 3300025981 | Ga0207640_11068485 | Ga0207640_110684852 | 81 |
| 994 | 3300025981 | Ga0207640_11110265 | Ga0207640_111102651 | 81 |
| 995 | 3300025986 | Ga0207658_10014986 | Ga0207658_100149865 | 81 |
| 996 | 3300025986 | Ga0207658_10214441 | Ga0207658_102144412 | 81 |
| 997 | 3300025986 | Ga0207658_10397103 | Ga0207658_103971032 | 81 |
| 998 | 3300025986 | Ga0207658_10895555 | Ga0207658_108955552 | 81 |
| 999 | 3300025986 | Ga0207658_11169226 | Ga0207658_111692261 | 81 |
| 1000 | 3300026023 | Ga0207677_10022184 | Ga0207677_100221843 | 81 |
| 1001 | 3300026023 | Ga0207677_10186576 | Ga0207677_101865762 | 81 |
| 1002 | 3300026023 | Ga0207677_11490246 | Ga0207677_114902461 | 81 |
| 1003 | 3300026035 | Ga0207703_10038379 | Ga0207703_100383793 | 81 |
| 1004 | 3300026035 | Ga0207703_10424273 | Ga0207703_104242732 | 81 |
| 1005 | 3300026035 | Ga0207703_12299335 | Ga0207703_122993352 | 81 |
| 1006 | 3300026041 | Ga0207639_10000667 | Ga0207639_100006675 | 81 |
| 1007 | 3300026041 | Ga0207639_10008122 | Ga0207639_100081223 | 81 |
| 1008 | 3300026041 | Ga0207639_10037712 | Ga0207639_100377123 | 81 |
| 1009 | 3300026041 | Ga0207639_10073908 | Ga0207639_100739083 | 81 |
| 1010 | 3300026041 | Ga0207639_10093844 | Ga0207639_100938442 | 81 |
| 1011 | 3300026041 | Ga0207639_10147712 | Ga0207639_101477122 | 81 |
| 1012 | 3300026041 | Ga0207639_10213729 | Ga0207639_102137292 | 81 |
| 1013 | 3300026041 | Ga0207639_10782461 | Ga0207639_107824612 | 81 |
| 1014 | 3300026041 | Ga0207639_12178634 | Ga0207639_121786342 | 81 |
| 1015 | 3300026067 | Ga0207678_10069744 | Ga0207678_100697441 | 81 |
| 1016 | 3300026067 | Ga0207678_11060916 | Ga0207678_110609162 | 81 |
| 1017 | 3300026075 | Ga0207708_10142100 | Ga0207708_101421003 | 81 |
| 1018 | 3300026075 | Ga0207708_10429960 | Ga0207708_104299602 | 81 |
| 1019 | 3300026078 | Ga0207702_10069754 | Ga0207702_100697543 | 81 |
| 1020 | 3300026078 | Ga0207702_10083782 | Ga0207702_100837823 | 81 |
| 1021 | 3300026078 | Ga0207702_10294553 | Ga0207702_102945532 | 81 |
| 1022 | 3300026078 | Ga0207702_10336799 | Ga0207702_103367992 | 81 |
| 1023 | 3300026088 | Ga0207641_10005038 | Ga0207641_100050383 | 81 |
| 1024 | 3300026088 | Ga0207641_10015563 | Ga0207641_100155633 | 81 |
| 1025 | 3300026088 | Ga0207641_10083106 | Ga0207641_100831061 | 81 |
| 1026 | 3300026088 | Ga0207641_10194694 | Ga0207641_101946943 | 81 |
| 1027 | 3300026088 | Ga0207641_10231764 | Ga0207641_102317642 | 81 |
| 1028 | 3300026088 | Ga0207641_11471425 | Ga0207641_114714251 | 81 |
| 1029 | 3300026088 | Ga0207641_12160616 | Ga0207641_121606162 | 81 |
| 1030 | 3300026089 | Ga0207648_10003359 | Ga0207648_1000335913 | 81 |
| 1031 | 3300026089 | Ga0207648_10004904 | Ga0207648_1000490412 | 81 |
| 1032 | 3300026089 | Ga0207648_10030385 | Ga0207648_100303854 | 81 |
| 1033 | 3300026089 | Ga0207648_10043963 | Ga0207648_100439634 | 81 |
| 1034 | 3300026089 | Ga0207648_10076983 | Ga0207648_100769832 | 81 |
| 1035 | 3300026089 | Ga0207648_10701641 | Ga0207648_107016412 | 81 |
| 1036 | 3300026089 | Ga0207648_11183945 | Ga0207648_111839452 | 81 |
| 1037 | 3300026089 | Ga0207648_11254539 | Ga0207648_112545391 | 81 |
| 1038 | 3300026089 | Ga0207648_11308898 | Ga0207648_113088982 | 81 |
| 1039 | 3300026089 | Ga0207648_11406472 | Ga0207648_114064721 | 81 |
| 1040 | 3300026089 | Ga0207648_12247336 | Ga0207648_122473362 | 81 |
| 1041 | 3300026095 | Ga0207676_10036051 | Ga0207676_100360513 | 81 |
| 1042 | 3300026095 | Ga0207676_10187967 | Ga0207676_101879672 | 81 |
| 1043 | 3300026095 | Ga0207676_10262299 | Ga0207676_102622992 | 81 |
| 1044 | 3300026095 | Ga0207676_10440460 | Ga0207676_104404602 | 81 |
| 1045 | 3300026095 | Ga0207676_11116736 | Ga0207676_111167362 | 81 |
| 1046 | 3300026116 | Ga0207674_10002078 | Ga0207674_1000207824 | 81 |
| 1047 | 3300026116 | Ga0207674_10035180 | Ga0207674_100351804 | 81 |
| 1048 | 3300026116 | Ga0207674_10070058 | Ga0207674_100700584 | 81 |
| 1049 | 3300026116 | Ga0207674_10101422 | Ga0207674_101014222 | 81 |
| 1050 | 3300026116 | Ga0207674_10116690 | Ga0207674_101166903 | 81 |
| 1051 | 3300026116 | Ga0207674_10719347 | Ga0207674_107193472 | 81 |
| 1052 | 3300026118 | Ga0207675_100002256 | Ga0207675_1000022563 | 81 |
| 1053 | 3300026118 | Ga0207675_100013142 | Ga0207675_1000131422 | 81 |
| 1054 | 3300026118 | Ga0207675_100121228 | Ga0207675_1001212282 | 81 |
| 1055 | 3300026118 | Ga0207675_100389884 | Ga0207675_1003898843 | 81 |
| 1056 | 3300026118 | Ga0207675_100393048 | Ga0207675_1003930482 | 81 |
| 1057 | 3300026118 | Ga0207675_101727901 | Ga0207675_1017279012 | 81 |
| 1058 | 3300026118 | Ga0207675_102217728 | Ga0207675_1022177282 | 81 |
| 1059 | 3300026118 | Ga0207675_102423822 | Ga0207675_1024238222 | 81 |
| 1060 | 3300026121 | Ga0207683_10292863 | Ga0207683_102928632 | 81 |
| 1061 | 3300026121 | Ga0207683_10381191 | Ga0207683_103811912 | 81 |
| 1062 | 3300026142 | Ga0207698_10047492 | Ga0207698_100474922 | 81 |
| 1063 | 3300026142 | Ga0207698_10077766 | Ga0207698_100777663 | 81 |
| 1064 | 3300026142 | Ga0207698_10317547 | Ga0207698_103175472 | 81 |
| 1065 | 3300026142 | Ga0207698_10332725 | Ga0207698_103327252 | 81 |
| 1066 | 3300026142 | Ga0207698_10710915 | Ga0207698_107109152 | 81 |
| 1067 | 3300026142 | Ga0207698_11106263 | Ga0207698_111062632 | 81 |
| 1068 | 3300026142 | Ga0207698_11595902 | Ga0207698_115959022 | 81 |
| 1069 | 3300027526 | Ga0209968_1065681 | Ga0209968_10656812 | 81 |
| 1070 | 3300027614 | Ga0209970_1122154 | Ga0209970_11221541 | 81 |
| 1071 | 3300027617 | Ga0210002_1040614 | Ga0210002_10406141 | 81 |
| 1072 | 3300027682 | Ga0209971_1191907 | Ga0209971_11919071 | 81 |
| 1073 | 3300027876 | Ga0209974_10073162 | Ga0209974_100731621 | 81 |
| 1074 | 3300027907 | Ga0207428_10917966 | Ga0207428_109179661 | 81 |
| 1075 | 3300028379 | Ga0268266_10004126 | Ga0268266_100041263 | 81 |
| 1076 | 3300028380 | Ga0268265_10106667 | Ga0268265_101066672 | 81 |
| 1077 | 3300028380 | Ga0268265_10264384 | Ga0268265_102643843 | 81 |
| 1078 | 3300028380 | Ga0268265_10378264 | Ga0268265_103782642 | 81 |
| 1079 | 3300028380 | Ga0268265_10468515 | Ga0268265_104685152 | 81 |
| 1080 | 3300028380 | Ga0268265_10506190 | Ga0268265_105061902 | 81 |
| 1081 | 3300028380 | Ga0268265_10661564 | Ga0268265_106615642 | 81 |
| 1082 | 3300028380 | Ga0268265_10714630 | Ga0268265_107146302 | 81 |
| 1083 | 3300028380 | Ga0268265_12230135 | Ga0268265_122301352 | 81 |
| 1084 | 3300028381 | Ga0268264_10000011 | Ga0268264_10000011208 | 81 |
| 1085 | 3300028381 | Ga0268264_10006311 | Ga0268264_100063113 | 81 |
| 1086 | 3300028381 | Ga0268264_10011319 | Ga0268264_100113192 | 81 |
| 1087 | 3300028381 | Ga0268264_10058105 | Ga0268264_100581052 | 81 |
| 1088 | 3300028381 | Ga0268264_10216451 | Ga0268264_102164513 | 81 |
| 1089 | 3300028381 | Ga0268264_10231903 | Ga0268264_102319032 | 81 |
| 1090 | 3300028381 | Ga0268264_10544989 | Ga0268264_105449892 | 81 |
| 1091 | 3300028381 | Ga0268264_11327856 | Ga0268264_113278562 | 81 |
| 1092 | 3300028381 | Ga0268264_12214651 | Ga0268264_122146512 | 81 |
| 1093 | 3300028794 | Ga0307515_10646695 | Ga0307515_106466952 | 81 |
| 1094 | 3300028794 | Ga0307515_10783553 | Ga0307515_107835532 | 81 |
| 1095 | 3300031456 | Ga0307513_10063300 | Ga0307513_100633004 | 81 |
| 1096 | 3300031456 | Ga0307513_10289372 | Ga0307513_102893722 | 81 |
| 1097 | 3300031456 | Ga0307513_10554208 | Ga0307513_105542081 | 81 |
| 1098 | 3300031507 | Ga0307509_10060495 | Ga0307509_100604954 | 81 |
| 1099 | 3300031507 | Ga0307509_10351506 | Ga0307509_103515062 | 81 |
| 1100 | 3300031548 | Ga0307408_100038537 | Ga0307408_1000385374 | 81 |
| 1101 | 3300031616 | Ga0307508_10001362 | Ga0307508_1000136210 | 81 |
| 1102 | 3300031616 | Ga0307508_10137888 | Ga0307508_101378883 | 81 |
| 1103 | 3300031730 | Ga0307516_10707148 | Ga0307516_107071482 | 81 |
| 1104 | 3300031824 | Ga0307413_10116477 | Ga0307413_101164772 | 81 |
| 1105 | 3300031838 | Ga0307518_10442778 | Ga0307518_104427782 | 81 |
| 1106 | 3300031852 | Ga0307410_10030785 | Ga0307410_100307852 | 81 |
| 1107 | 3300031901 | Ga0307406_10064617 | Ga0307406_100646171 | 81 |
| 1108 | 3300031901 | Ga0307406_10321385 | Ga0307406_103213852 | 81 |
| 1109 | 3300031901 | Ga0307406_10871991 | Ga0307406_108719911 | 81 |
| 1110 | 3300031903 | Ga0307407_10123592 | Ga0307407_101235922 | 81 |
| 1111 | 3300031903 | Ga0307407_11624652 | Ga0307407_116246521 | 81 |
| 1112 | 3300031995 | Ga0307409_100246560 | Ga0307409_1002465602 | 81 |
| 1113 | 3300032002 | Ga0307416_100093911 | Ga0307416_1000939112 | 81 |
| 1114 | 3300032002 | Ga0307416_101008761 | Ga0307416_1010087612 | 81 |
| 1115 | 3300032002 | Ga0307416_101251816 | Ga0307416_1012518161 | 81 |
| 1116 | 3300032004 | Ga0307414_10215357 | Ga0307414_102153571 | 81 |
| 1117 | 3300032005 | Ga0307411_10058568 | Ga0307411_100585683 | 81 |
| 1118 | 3300032005 | Ga0307411_10685249 | Ga0307411_106852492 | 81 |
| 1119 | 3300032126 | Ga0307415_100081356 | Ga0307415_1000813562 | 81 |
| 1120 | 3300032126 | Ga0307415_101677341 | Ga0307415_1016773411 | 81 |
| 1121 | 3300033180 | Ga0307510_10008932 | Ga0307510_1000893210 | 81 |
| 1122 | 3300033180 | Ga0307510_10472157 | Ga0307510_104721572 | 81 |
| 1123 | 3300035112 | Ga0373932_0233507 | Ga0373932_0233507_21_266 | 81 |
| 1124 | 3300035117 | Ga0373953_0359902 | Ga0373953_0359902_105_350 | 81 |
| 1125 | 3300035695 | Ga0373927_0625674 | Ga0373927_0625674_101_346 | 81 |
| 1126 | 3300036401 | Ga0373937_0524033 | Ga0373937_0524033_62_307 | 81 |
| 1127 | 3300036401 | Ga0373937_1682663 | Ga0373937_1682663_235_480 | 81 |
| 1128 | 3300037068 | Ga0373925_0604446 | Ga0373925_0604446_389_634 | 81 |
| 1129 | 3300037312 | Ga0395899_0009188 | Ga0395899_0009188_6737_6982 | 81 |
| 1130 | 3300037312 | Ga0395899_0017005 | Ga0395899_0017005_249_500 | 81 |
| 1131 | 3300037312 | Ga0395899_0187985 | Ga0395899_0187985_1157_1402 | 81 |
| 1132 | 3300037312 | Ga0395899_0303192 | Ga0395899_0303192_62_313 | 81 |
| 1133 | 3300037312 | Ga0395899_0389418 | Ga0395899_0389418_114_359 | 81 |
| 1134 | 3300037418 | Ga0395900_0111932 | Ga0395900_0111932_301_552 | 81 |
| 1135 | 3300037418 | Ga0395900_0139848 | Ga0395900_0139848_871_1116 | 81 |
| 1136 | 3300037418 | Ga0395900_0156477 | Ga0395900_0156477_1985_2230 | 81 |
| 1137 | 3300037418 | Ga0395900_0259663 | Ga0395900_0259663_656_901 | 81 |
| 1138 | 3300037418 | Ga0395900_0475549 | Ga0395900_0475549_818_1063 | 81 |
| 1139 | 3300037466 | Ga0395898_0031201 | Ga0395898_0031201_4295_4546 | 81 |
| 1140 | 3300037466 | Ga0395898_0072494 | Ga0395898_0072494_34_279 | 81 |
| 1141 | 3300037466 | Ga0395898_0121784 | Ga0395898_0121784_2223_2468 | 81 |
| 1142 | 3300037466 | Ga0395898_0436478 | Ga0395898_0436478_832_1077 | 81 |
| 1143 | 3300037466 | Ga0395898_0790483 | Ga0395898_0790483_572_823 | 81 |
| 1144 | 3300037471 | Ga0395905_0015405 | Ga0395905_0015405_3297_3542 | 81 |
| 1145 | 3300037471 | Ga0395905_1201189 | Ga0395905_1201189_373_618 | 81 |
| 1146 | 3300037471 | Ga0395905_1246396 | Ga0395905_1246396_331_579 | 81 |
| 1147 | 3300038443 | Ga0395901_0011427 | Ga0395901_0011427_2019_2264 | 81 |
| 1148 | 3300038443 | Ga0395901_0090659 | Ga0395901_0090659_2921_3166 | 81 |
| 1149 | 3300038443 | Ga0395901_0318172 | Ga0395901_0318172_534_779 | 81 |
| 1150 | 3300038443 | Ga0395901_0960966 | Ga0395901_0960966_557_808 | 81 |
| 1151 | 3300038443 | Ga0395901_1310136 | Ga0395901_1310136_23_268 | 81 |
| 1152 | 3300041404 | Ga0439436_0043744 | Ga0439436_0043744_704_949 | 81 |
| 1153 | 3300041413 | Ga0439465_0025746 | Ga0439465_0025746_537_782 | 81 |
| 1154 | 3300041443 | Ga0451789_0028015 | Ga0451789_0028015_141_386 | 81 |
| 1155 | 3300041443 | Ga0451789_1329307 | Ga0451789_1329307_165_422 | 81 |
| 1156 | 3300041451 | Ga0451791_1712160 | Ga0451791_1712160_652_897 | 81 |
| 1157 | 3300041452 | Ga0451793_1160112 | Ga0451793_1160112_262_507 | 81 |
| 1158 | 3300041452 | Ga0451793_1897698 | Ga0451793_1897698_335_580 | 81 |
| 1159 | 3300041453 | Ga0451797_0660066 | Ga0451797_0660066_220_465 | 81 |
| 1160 | 3300041458 | Ga0451798_1113716 | Ga0451798_1113716_240_485 | 81 |
| 1161 | 3300041460 | Ga0451802_1455935 | Ga0451802_1455935_535_780 | 81 |
| 1162 | 3300041463 | Ga0451804_1150222 | Ga0451804_1150222_224_469 | 81 |
| 1163 | 3300041486 | Ga0451807_1268939 | Ga0451807_1268939_262_510 | 81 |
| 1164 | 3300041486 | Ga0451807_2475336 | Ga0451807_2475336_107_355 | 81 |
| 1165 | 3300041486 | Ga0451807_2595595 | Ga0451807_2595595_408_653 | 81 |
| 1166 | 3300041491 | Ga0451833_1283552 | Ga0451833_1283552_284_529 | 81 |
| 1167 | 3300041498 | Ga0451841_0560704 | Ga0451841_0560704_317_562 | 81 |
| 1168 | 3300041505 | Ga0451849_0397476 | Ga0451849_0397476_59_304 | 81 |
| 1169 | 3300041509 | Ga0451843_1127470 | Ga0451843_1127470_118_363 | 81 |
| 1170 | 3300041512 | Ga0451853_0968399 | Ga0451853_0968399_398_643 | 81 |
| 1171 | 3300041997 | Ga0439431_0056863 | Ga0439431_0056863_710_955 | 81 |
| 1172 | 3300042001 | Ga0439441_051664 | Ga0439441_051664_212_457 | 81 |
| 1173 | 3300042003 | Ga0439443_024232 | Ga0439443_024232_676_921 | 81 |
| 1174 | 3300042004 | Ga0439445_0066018 | Ga0439445_0066018_552_797 | 81 |
| 1175 | 3300042004 | Ga0439445_0084580 | Ga0439445_0084580_291_536 | 81 |
| 1176 | 3300042004 | Ga0439445_0175078 | Ga0439445_0175078_257_502 | 81 |
| 1177 | 3300042005 | Ga0439448_0318782 | Ga0439448_0318782_177_425 | 81 |
| 1178 | 3300042007 | Ga0439449_0068737 | Ga0439449_0068737_898_1143 | 81 |
| 1179 | 3300042007 | Ga0439449_0368677 | Ga0439449_0368677_283_528 | 81 |
| 1180 | 3300042009 | Ga0439451_137251 | Ga0439451_137251_101_355 | 81 |
| 1181 | 3300042014 | Ga0439457_018068 | Ga0439457_018068_807_1052 | 81 |
| 1182 | 3300042437 | Ga0439444_0126340 | Ga0439444_0126340_128_385 | 81 |
| 1183 | 3300042530 | Ga0450916_085541 | Ga0450916_085541_104_349 | 81 |
| 1184 | 3300042532 | Ga0450893_0133841 | Ga0450893_0133841_262_507 | 81 |
| 1185 | 3300044656 | Ga0466969_0000235 | Ga0466969_0000235_18196_18444 | 81 |
| 1186 | 3300044656 | Ga0466969_0065404 | Ga0466969_0065404_790_1035 | 81 |
| 1187 | 3300044656 | Ga0466969_0086440 | Ga0466969_0086440_114_359 | 81 |
| 1188 | 3300044658 | Ga0466972_0001764 | Ga0466972_0001764_9351_9596 | 81 |
| 1189 | 3300044658 | Ga0466972_0055927 | Ga0466972_0055927_1486_1731 | 81 |
| 1190 | 3300044658 | Ga0466972_0109777 | Ga0466972_0109777_980_1225 | 81 |
| 1191 | 3300044671 | Ga0466978_0544714 | Ga0466978_0544714_269_514 | 81 |
| 1192 | 3300044673 | Ga0453683_0978158 | Ga0453683_0978158_69_314 | 81 |
| 1193 | 3300044683 | Ga0466965_0153395 | Ga0466965_0153395_398_646 | 81 |
| 1194 | 3300044684 | Ga0466966_0000280 | Ga0466966_0000280_28529_28777 | 81 |
| 1195 | 3300044693 | Ga0466961_0120437 | Ga0466961_0120437_241_489 | 81 |
| 1196 | 3300044706 | Ga0466964_0111636 | Ga0466964_0111636_388_636 | 81 |
| 1197 | 3300044712 | Ga0453684_0032184 | Ga0453684_0032184_2778_3023 | 81 |
| 1198 | 3300044719 | Ga0466971_0372563 | Ga0466971_0372563_385_633 | 81 |
| 1199 | 3300044765 | Ga0466970_0536490 | Ga0466970_0536490_416_664 | 81 |
| 1200 | 3300044842 | Ga0466957_0001155 | Ga0466957_0001155_9092_9340 | 81 |
| 1201 | 3300044842 | Ga0466957_0438989 | Ga0466957_0438989_623_868 | 81 |
| 1202 | 3300044842 | Ga0466957_0791592 | Ga0466957_0791592_128_373 | 81 |
| 1203 | 3300044842 | Ga0466957_0976959 | Ga0466957_0976959_299_544 | 81 |
| 1204 | 3300044901 | Ga0466960_0139711 | Ga0466960_0139711_423_671 | 81 |
| 1205 | 3300044901 | Ga0466960_0143734 | Ga0466960_0143734_772_1017 | 81 |
| 1206 | 3300045049 | Ga0466959_0000015 | Ga0466959_0000015_109372_109620 | 81 |
| 1207 | 3300045049 | Ga0466959_0105693 | Ga0466959_0105693_77_322 | 81 |
| 1208 | 3300045051 | Ga0451576_2617267 | Ga0451576_2617267_249_494 | 81 |
| 1209 | 3300045976 | Ga0466967_1587308 | Ga0466967_1587308_107_355 | 81 |
| 1210 | 3300046453 | Ga0495627_016980 | Ga0495627_016980_1672_1917 | 81 |
| 1211 | 3300046455 | Ga0495603_0205907 | Ga0495603_0205907_427_672 | 81 |
| 1212 | 3300046460 | Ga0495638_0030292 | Ga0495638_0030292_1244_1489 | 81 |
| 1213 | 3300046460 | Ga0495638_0352633 | Ga0495638_0352633_356_601 | 81 |
| 1214 | 3300046471 | Ga0495650_0099742 | Ga0495650_0099742_445_690 | 81 |
| 1215 | 3300046507 | Ga0495606_0011729 | Ga0495606_0011729_3128_3373 | 81 |
| 1216 | 3300046511 | Ga0495608_0826026 | Ga0495608_0826026_112_357 | 81 |
| 1217 | 3300046519 | Ga0495632_0112362 | Ga0495632_0112362_390_635 | 81 |
| 1218 | 3300046519 | Ga0495632_0415810 | Ga0495632_0415810_153_398 | 81 |
| 1219 | 3300046522 | Ga0495643_0016526 | Ga0495643_0016526_2106_2351 | 81 |
| 1220 | 3300046524 | Ga0495648_0013272 | Ga0495648_0013272_5522_5767 | 81 |
| 1221 | 3300046524 | Ga0495648_0262033 | Ga0495648_0262033_551_796 | 81 |
| 1222 | 3300046538 | Ga0495609_0122795 | Ga0495609_0122795_23_268 | 81 |
| 1223 | 3300046539 | Ga0495621_0020971 | Ga0495621_0020971_1738_1983 | 81 |
| 1224 | 3300046539 | Ga0495621_0296441 | Ga0495621_0296441_240_497 | 81 |
| 1225 | 3300046558 | Ga0495633_0000017 | Ga0495633_0000017_221100_221345 | 81 |
| 1226 | 3300046559 | Ga0495667_0723166 | Ga0495667_0723166_122_367 | 81 |
| 1227 | 3300046616 | Ga0495668_0012757 | Ga0495668_0012757_1385_1630 | 81 |
| 1228 | 3300046648 | Ga0495611_0000021 | Ga0495611_0000021_55441_55686 | 81 |
| 1229 | 3300046648 | Ga0495611_0088697 | Ga0495611_0088697_108_353 | 81 |
| 1230 | 3300046648 | Ga0495611_0240602 | Ga0495611_0240602_68_313 | 81 |
| 1231 | 3300046660 | Ga0495625_0255807 | Ga0495625_0255807_49_294 | 81 |
| 1232 | 3300046660 | Ga0495625_0281155 | Ga0495625_0281155_300_545 | 81 |
| 1233 | 3300046660 | Ga0495625_0671050 | Ga0495625_0671050_277_522 | 81 |
| 1234 | 3300046690 | Ga0495624_0566236 | Ga0495624_0566236_123_368 | 81 |
| 1235 | 3300047317 | Ga0495604_1054134 | Ga0495604_1054134_147_392 | 81 |
| 1236 | 3300047318 | Ga0495636_0509208 | Ga0495636_0509208_177_422 | 81 |
| 1237 | 3300047320 | Ga0495672_0022271 | Ga0495672_0022271_163_408 | 81 |
| 1238 | 3300047320 | Ga0495672_0032365 | Ga0495672_0032365_1493_1738 | 81 |
| 1239 | 3300047320 | Ga0495672_0297014 | Ga0495672_0297014_234_479 | 81 |
| 1240 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_1185350_1185595 | 81 |
| 1241 | 3300047443 | Ga0495687_152451 | Ga0495687_152451_304_549 | 81 |
| 1242 | 3300048904 | Ga0496101_0051422 | Ga0496101_0051422_1594_1839 | 81 |
| 1243 | 3300048904 | Ga0496101_0868937 | Ga0496101_0868937_17_262 | 81 |
| 1244 | 3300048907 | Ga0496104_1616706 | Ga0496104_1616706_126_371 | 81 |
| 1245 | 3300048909 | Ga0496106_1051563 | Ga0496106_1051563_119_364 | 81 |
| 1246 | 3300048910 | Ga0496107_0201612 | Ga0496107_0201612_624_869 | 81 |
| 1247 | 3300048910 | Ga0496107_0453325 | Ga0496107_0453325_137_382 | 81 |
| 1248 | 3300048911 | Ga0496108_0152255 | Ga0496108_0152255_1017_1262 | 81 |
| 1249 | 3300048912 | Ga0496109_0101587 | Ga0496109_0101587_895_1140 | 81 |
| 1250 | 3300048913 | Ga0496110_0663368 | Ga0496110_0663368_667_912 | 81 |
| 1251 | 3300048913 | Ga0496110_0870963 | Ga0496110_0870963_490_735 | 81 |
| 1252 | 3300048917 | Ga0496114_0855669 | Ga0496114_0855669_524_769 | 81 |
| 1253 | 3300048924 | Ga0496121_0000010 | Ga0496121_0000010_287957_288202 | 81 |
| 1254 | 3300048924 | Ga0496121_0909951 | Ga0496121_0909951_192_437 | 81 |
| 1255 | 3300048928 | Ga0496125_0295096 | Ga0496125_0295096_248_493 | 81 |
| 1256 | 3300048929 | Ga0496126_0127526 | Ga0496126_0127526_772_1017 | 81 |
| 1257 | 3300049568 | Ga0501031_0091768 | Ga0501031_0091768_343_588 | 81 |
| 1258 | 3300049570 | Ga0501033_0245184 | Ga0501033_0245184_575_820 | 81 |
| 1259 | 3300049570 | Ga0501033_0331835 | Ga0501033_0331835_201_446 | 81 |
| 1260 | 3300049570 | Ga0501033_0656424 | Ga0501033_0656424_70_315 | 81 |
| 1261 | 3300049570 | Ga0501033_1135677 | Ga0501033_1135677_50_295 | 81 |
| 1262 | 3300049571 | Ga0501034_0025021 | Ga0501034_0025021_748_996 | 81 |
| 1263 | 3300049571 | Ga0501034_0057903 | Ga0501034_0057903_2397_2642 | 81 |
| 1264 | 3300049571 | Ga0501034_0083010 | Ga0501034_0083010_1533_1778 | 81 |
| 1265 | 3300049571 | Ga0501034_0126766 | Ga0501034_0126766_1367_1612 | 81 |
| 1266 | 3300049571 | Ga0501034_0153853 | Ga0501034_0153853_908_1156 | 81 |
| 1267 | 3300049571 | Ga0501034_0265313 | Ga0501034_0265313_913_1158 | 81 |
| 1268 | 3300049571 | Ga0501034_0337833 | Ga0501034_0337833_897_1142 | 81 |
| 1269 | 3300049572 | Ga0501036_0180174 | Ga0501036_0180174_757_1002 | 81 |
| 1270 | 3300049573 | Ga0501037_0125473 | Ga0501037_0125473_1374_1619 | 81 |
| 1271 | 3300049573 | Ga0501037_0294920 | Ga0501037_0294920_350_595 | 81 |
| 1272 | 3300049573 | Ga0501037_0708837 | Ga0501037_0708837_18_263 | 81 |
| 1273 | 3300049574 | Ga0501038_0017298 | Ga0501038_0017298_5888_6133 | 81 |
| 1274 | 3300049574 | Ga0501038_0024630 | Ga0501038_0024630_4497_4745 | 81 |
| 1275 | 3300049574 | Ga0501038_0469715 | Ga0501038_0469715_690_935 | 81 |
| 1276 | 3300049575 | Ga0501039_0037675 | Ga0501039_0037675_1403_1648 | 81 |
| 1277 | 3300049575 | Ga0501039_0217942 | Ga0501039_0217942_828_1073 | 81 |
| 1278 | 3300049579 | Ga0501043_0017442 | Ga0501043_0017442_4610_4855 | 81 |
| 1279 | 3300049579 | Ga0501043_0032312 | Ga0501043_0032312_3068_3316 | 81 |
| 1280 | 3300049579 | Ga0501043_0347861 | Ga0501043_0347861_677_922 | 81 |
| 1281 | 3300049580 | Ga0501046_0048287 | Ga0501046_0048287_1591_1836 | 81 |
| 1282 | 3300049581 | Ga0501047_0011096 | Ga0501047_0011096_212_457 | 81 |
| 1283 | 3300049581 | Ga0501047_0021076 | Ga0501047_0021076_1044_1289 | 81 |
| 1284 | 3300049581 | Ga0501047_0400875 | Ga0501047_0400875_791_1036 | 81 |
| 1285 | 3300049581 | Ga0501047_0445493 | Ga0501047_0445493_860_1105 | 81 |
| 1286 | 3300049581 | Ga0501047_0512270 | Ga0501047_0512270_763_1011 | 81 |
| 1287 | 3300049581 | Ga0501047_0865609 | Ga0501047_0865609_423_668 | 81 |
| 1288 | 3300049582 | Ga0501048_0145226 | Ga0501048_0145226_760_1005 | 81 |
| 1289 | 3300049584 | Ga0501068_1003418 | Ga0501068_1003418_201_446 | 81 |
| 1290 | 3300049586 | Ga0501070_0313642 | Ga0501070_0313642_12_257 | 81 |
| 1291 | 3300049586 | Ga0501070_1013064 | Ga0501070_1013064_44_289 | 81 |
| 1292 | 3300049588 | Ga0501072_1156451 | Ga0501072_1156451_281_526 | 81 |
| 1293 | 3300049589 | Ga0501073_0110828 | Ga0501073_0110828_471_716 | 81 |
| 1294 | 3300049649 | Ga0501198_014607 | Ga0501198_014607_63_308 | 81 |
| 1295 | 3300049650 | Ga0501199_007699 | Ga0501199_007699_319_564 | 81 |
| 1296 | 3300049651 | Ga0501201_003567 | Ga0501201_003567_791_1036 | 81 |
| 1297 | 3300049652 | Ga0501202_003604 | Ga0501202_003604_1381_1626 | 81 |
| 1298 | 3300049653 | Ga0501206_022361 | Ga0501206_022361_114_359 | 81 |
| 1299 | 3300049654 | Ga0501207_006177 | Ga0501207_006177_1058_1303 | 81 |
| 1300 | 3300049660 | Ga0501216_006858 | Ga0501216_006858_1374_1619 | 81 |
| 1301 | 3300049661 | Ga0501217_024187 | Ga0501217_024187_889_1134 | 81 |
| 1302 | 3300049663 | Ga0501223_022442 | Ga0501223_022442_888_1133 | 81 |
| 1303 | 3300049664 | Ga0501224_003267 | Ga0501224_003267_1837_2082 | 81 |
| 1304 | 3300049665 | Ga0501227_042388 | Ga0501227_042388_323_568 | 81 |
| 1305 | 3300049668 | Ga0501233_238348 | Ga0501233_238348_249_506 | 81 |
| 1306 | 3300049669 | Ga0501235_004505 | Ga0501235_004505_1578_1823 | 81 |
| 1307 | 3300049674 | Ga0501242_028661 | Ga0501242_028661_376_621 | 81 |
| 1308 | 3300049675 | Ga0501243_004321 | Ga0501243_004321_483_728 | 81 |
| 1309 | 3300049679 | Ga0501249_213385 | Ga0501249_213385_57_314 | 81 |
| 1310 | 3300049681 | Ga0501251_038662 | Ga0501251_038662_311_556 | 81 |
| 1311 | 3300049684 | Ga0501255_009224 | Ga0501255_009224_705_950 | 81 |
| 1312 | 3300049686 | Ga0501257_128457 | Ga0501257_128457_344_589 | 81 |
| 1313 | 3300049688 | Ga0501259_101707 | Ga0501259_101707_267_512 | 81 |
| 1314 | 3300049690 | Ga0501261_028897 | Ga0501261_028897_341_586 | 81 |
| 1315 | 3300049704 | Ga0501221_044109 | Ga0501221_044109_563_808 | 81 |
| 1316 | 3300049705 | Ga0501225_0011878 | Ga0501225_0011878_862_1107 | 81 |
| 1317 | 3300049707 | Ga0501234_022465 | Ga0501234_022465_522_767 | 81 |
| 1318 | 3300049708 | Ga0501245_016785 | Ga0501245_016785_698_943 | 81 |
| 1319 | 3300049742 | Ga0501080_1807239 | Ga0501080_1807239_171_416 | 81 |
| 1320 | 3300049744 | Ga0501083_0069451 | Ga0501083_0069451_434_688 | 81 |
| 1321 | 3300049744 | Ga0501083_0242345 | Ga0501083_0242345_681_926 | 81 |
| 1322 | 3300049763 | Ga0501266_002586 | Ga0501266_002586_849_1094 | 81 |
| 1323 | 3300049769 | Ga0501272_035354 | Ga0501272_035354_270_515 | 81 |
| 1324 | 3300049773 | Ga0501276_001576 | Ga0501276_001576_892_1137 | 81 |
| 1325 | 3300049775 | Ga0501279_006140 | Ga0501279_006140_1180_1425 | 81 |
| 1326 | 3300049776 | Ga0501280_025068 | Ga0501280_025068_135_380 | 81 |
| 1327 | 3300049776 | Ga0501280_065303 | Ga0501280_065303_273_518 | 81 |
| 1328 | 3300049778 | Ga0501282_024731 | Ga0501282_024731_199_444 | 81 |
| 1329 | 3300049822 | Ga0501035_0024751 | Ga0501035_0024751_1313_1558 | 81 |
| 1330 | 3300049822 | Ga0501035_0160804 | Ga0501035_0160804_1145_1390 | 81 |
| 1331 | 3300049822 | Ga0501035_0451212 | Ga0501035_0451212_679_924 | 81 |
| 1332 | 3300049822 | Ga0501035_0469385 | Ga0501035_0469385_91_336 | 81 |
| 1333 | 3300049822 | Ga0501035_0532507 | Ga0501035_0532507_643_888 | 81 |
| 1334 | 3300049822 | Ga0501035_0565224 | Ga0501035_0565224_326_571 | 81 |
| 1335 | 3300049823 | Ga0501044_0030285 | Ga0501044_0030285_925_1170 | 81 |
| 1336 | 3300049823 | Ga0501044_0078463 | Ga0501044_0078463_1348_1596 | 81 |
| 1337 | 3300049823 | Ga0501044_0217087 | Ga0501044_0217087_648_893 | 81 |
| 1338 | 3300049823 | Ga0501044_0241441 | Ga0501044_0241441_871_1116 | 81 |
| 1339 | 3300049823 | Ga0501044_0398994 | Ga0501044_0398994_76_321 | 81 |
| 1340 | 3300049823 | Ga0501044_0434784 | Ga0501044_0434784_448_693 | 81 |
| 1341 | 3300049823 | Ga0501044_1544675 | Ga0501044_1544675_81_326 | 81 |
| 1342 | 3300049849 | Ga0501200_05772 | Ga0501200_05772_161_406 | 81 |
| 1343 | 3300050005 | Ga0501284_01154 | Ga0501284_01154_708_956 | 81 |
| 1344 | 3300050493 | nmdc:mga0k408_26435_c1 | nmdc:mga0k408_26435_c1_2841_3086 | 81 |
| 1345 | 3300050493 | nmdc:mga0k408_31349_c1 | nmdc:mga0k408_31349_c1_615_860 | 81 |
| 1346 | 3300050493 | nmdc:mga0k408_35150_c1 | nmdc:mga0k408_35150_c1_2273_2518 | 81 |
| 1347 | 3300050493 | nmdc:mga0k408_409679_c1 | nmdc:mga0k408_409679_c1_308_553 | 81 |
| 1348 | 3300050493 | nmdc:mga0k408_582779_c1 | nmdc:mga0k408_582779_c1_95_340 | 81 |
| 1349 | 3300050493 | nmdc:mga0k408_798772_c1 | nmdc:mga0k408_798772_c1_176_421 | 81 |
| 1350 | 3300050507 | nmdc:mga05p37_1231339_c1 | nmdc:mga05p37_1231339_c1_265_513 | 81 |
| 1351 | 3300050507 | nmdc:mga05p37_3235_c1 | nmdc:mga05p37_3235_c1_16506_16751 | 81 |
| 1352 | 3300050507 | nmdc:mga05p37_841675_c1 | nmdc:mga05p37_841675_c1_484_729 | 81 |
| 1353 | 3300050508 | nmdc:mga09592_1546_c1 | nmdc:mga09592_1546_c1_2276_2521 | 81 |
| 1354 | 3300050508 | nmdc:mga09592_321074_c1 | nmdc:mga09592_321074_c1_233_481 | 81 |
| 1355 | 3300050508 | nmdc:mga09592_75829_c1 | nmdc:mga09592_75829_c1_1460_1705 | 81 |
| 1356 | 3300050509 | nmdc:mga0qj67_153861_c1 | nmdc:mga0qj67_153861_c1_810_1055 | 81 |
| 1357 | 3300050509 | nmdc:mga0qj67_48198_c1 | nmdc:mga0qj67_48198_c1_2637_2882 | 81 |
| 1358 | 3300050509 | nmdc:mga0qj67_653831_c1 | nmdc:mga0qj67_653831_c1_474_719 | 81 |
| 1359 | 3300050510 | nmdc:mga06r32_225327_c1 | nmdc:mga06r32_225327_c1_892_1137 | 81 |
| 1360 | 3300050510 | nmdc:mga06r32_4303_c1 | nmdc:mga06r32_4303_c1_731_979 | 81 |
| 1361 | 3300050510 | nmdc:mga06r32_497226_c1 | nmdc:mga06r32_497226_c1_287_532 | 81 |
| 1362 | 3300050511 | nmdc:mga08y16_2006363_c1 | nmdc:mga08y16_2006363_c1_40_297 | 81 |
| 1363 | 3300050511 | nmdc:mga08y16_26379_c1 | nmdc:mga08y16_26379_c1_2928_3176 | 81 |
| 1364 | 3300050511 | nmdc:mga08y16_401679_c1 | nmdc:mga08y16_401679_c1_581_826 | 81 |
| 1365 | 3300050511 | nmdc:mga08y16_450759_c1 | nmdc:mga08y16_450759_c1_979_1224 | 81 |
| 1366 | 3300050511 | nmdc:mga08y16_622828_c1 | nmdc:mga08y16_622828_c1_522_782 | 81 |
| 1367 | 3300050511 | nmdc:mga08y16_638753_c1 | nmdc:mga08y16_638753_c1_494_739 | 81 |
| 1368 | 3300053088 | Ga0500644_0000233 | Ga0500644_0000233_6765_7010 | 81 |
| 1369 | 3300053090 | Ga0500646_0007401 | Ga0500646_0007401_771_1016 | 81 |
| 1370 | 3300053090 | Ga0500646_0163812 | Ga0500646_0163812_319_564 | 81 |
| 1371 | 3300053090 | Ga0500646_0290563 | Ga0500646_0290563_81_326 | 81 |
| 1372 | 3300053092 | Ga0500583_0000224 | Ga0500583_0000224_3699_3944 | 81 |
| 1373 | 3300053092 | Ga0500583_0036287 | Ga0500583_0036287_1787_2032 | 81 |
| 1374 | 3300053092 | Ga0500583_0068941 | Ga0500583_0068941_929_1174 | 81 |
| 1375 | 3300053092 | Ga0500583_0078304 | Ga0500583_0078304_24_269 | 81 |
| 1376 | 3300053093 | Ga0500651_0050349 | Ga0500651_0050349_737_982 | 81 |
| 1377 | 3300053093 | Ga0500651_0528375 | Ga0500651_0528375_323_568 | 81 |
| 1378 | 3300053094 | Ga0500566_0213081 | Ga0500566_0213081_245_490 | 81 |
| 1379 | 3300053096 | Ga0500641_0344789 | Ga0500641_0344789_253_498 | 81 |
| 1380 | 3300053100 | Ga0500660_088515 | Ga0500660_088515_146_391 | 81 |
| 1381 | 3300053104 | Ga0500556_0121013 | Ga0500556_0121013_226_471 | 81 |
| 1382 | 3300053108 | Ga0500562_136297 | Ga0500562_136297_70_315 | 81 |
| 1383 | 3300053109 | Ga0500569_001814 | Ga0500569_001814_1855_2100 | 81 |
| 1384 | 3300053118 | Ga0500594_0063931 | Ga0500594_0063931_156_401 | 81 |
| 1385 | 3300053118 | Ga0500594_0063962 | Ga0500594_0063962_176_421 | 81 |
| 1386 | 3300053121 | Ga0500607_065776 | Ga0500607_065776_181_426 | 81 |
| 1387 | 3300053126 | Ga0500621_200998 | Ga0500621_200998_69_314 | 81 |
| 1388 | 3300053126 | Ga0500621_206911 | Ga0500621_206911_204_449 | 81 |
| 1389 | 3300053129 | Ga0500628_131419 | Ga0500628_131419_158_403 | 81 |
| 1390 | 3300053129 | Ga0500628_167897 | Ga0500628_167897_113_358 | 81 |
| 1391 | 3300053130 | Ga0500642_0095309 | Ga0500642_0095309_431_676 | 81 |
| 1392 | 3300053131 | Ga0500652_019542 | Ga0500652_019542_1094_1339 | 81 |
| 1393 | 3300053131 | Ga0500652_033710 | Ga0500652_033710_472_717 | 81 |
| 1394 | 3300053133 | Ga0500655_064269 | Ga0500655_064269_327_572 | 81 |
| 1395 | 3300053134 | Ga0500658_0001405 | Ga0500658_0001405_7081_7326 | 81 |
| 1396 | 3300053134 | Ga0500658_0147556 | Ga0500658_0147556_542_787 | 81 |
| 1397 | 3300053136 | Ga0500559_0005888 | Ga0500559_0005888_2780_3025 | 81 |
| 1398 | 3300053136 | Ga0500559_0414681 | Ga0500559_0414681_194_442 | 81 |
| 1399 | 3300053139 | Ga0500568_0000593 | Ga0500568_0000593_23537_23782 | 81 |
| 1400 | 3300053139 | Ga0500568_0050331 | Ga0500568_0050331_1168_1413 | 81 |
| 1401 | 3300053142 | Ga0500577_0000924 | Ga0500577_0000924_5635_5880 | 81 |
| 1402 | 3300053146 | Ga0500588_0039894 | Ga0500588_0039894_1001_1246 | 81 |
| 1403 | 3300053146 | Ga0500588_0297885 | Ga0500588_0297885_125_370 | 81 |
| 1404 | 3300053147 | Ga0500589_064108 | Ga0500589_064108_155_400 | 81 |
| 1405 | 3300053147 | Ga0500589_074095 | Ga0500589_074095_925_1170 | 81 |
| 1406 | 3300053148 | Ga0500590_016384 | Ga0500590_016384_2157_2402 | 81 |
| 1407 | 3300053150 | Ga0500603_022140 | Ga0500603_022140_85_330 | 81 |
| 1408 | 3300053153 | Ga0500616_0050612 | Ga0500616_0050612_116_361 | 81 |
| 1409 | 3300053153 | Ga0500616_0149002 | Ga0500616_0149002_140_385 | 81 |
| 1410 | 3300053153 | Ga0500616_0438073 | Ga0500616_0438073_171_416 | 81 |
| 1411 | 3300053154 | Ga0500619_090429 | Ga0500619_090429_528_773 | 81 |
| 1412 | 3300053156 | Ga0500622_0000319 | Ga0500622_0000319_23331_23576 | 81 |
| 1413 | 3300053156 | Ga0500622_0002252 | Ga0500622_0002252_8480_8725 | 81 |
| 1414 | 3300053160 | Ga0500633_0051002 | Ga0500633_0051002_39_284 | 81 |
| 1415 | 3300053161 | Ga0500634_0369540 | Ga0500634_0369540_99_344 | 81 |
| 1416 | 3300053177 | Ga0500636_0049874 | Ga0500636_0049874_1214_1459 | 81 |
| 1417 | 3300053177 | Ga0500636_0145843 | Ga0500636_0145843_349_594 | 81 |
| 1418 | 3300053178 | Ga0500637_0252674 | Ga0500637_0252674_525_770 | 81 |
| 1419 | 3300053727 | Ga0500611_000061 | Ga0500611_000061_28797_29042 | 81 |
| 1420 | 3300053730 | Ga0500645_028526 | Ga0500645_028526_498_743 | 81 |
| 1421 | 3300053739 | Ga0500587_007289 | Ga0500587_007289_375_620 | 81 |
| 1422 | 3300055283 | Ga0500661_027845 | Ga0500661_027845_597_842 | 81 |
| 1423 | 3300055283 | Ga0500661_058724 | Ga0500661_058724_105_350 | 81 |
| 1424 | 3300061719 | Ga0466962_0242986 | Ga0466962_0242986_80_328 | 81 |
| 1425 | 3300061719 | Ga0466962_0518041 | Ga0466962_0518041_231_479 | 81 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vq3-assembly1.cif.gz_C | crystal structure of phosphoribosylformylglycinamidine synthase, purs subunit (ec 6.3.5.3) (tm1244) from thermotoga maritima at 1.90 a resolution | 0.7778 | 1 | 81 |
| 1vq3-assembly1.cif.gz_C | crystal structure of phosphoribosylformylglycinamidine synthase, purs subunit (ec 6.3.5.3) (tm1244) from thermotoga maritima at 1.90 a resolution | 0.7698 | 1 | 81 |
| 3d54-assembly1.cif.gz_J | structure of purlqs from thermotoga maritima | 0.7583 | 1 | 81 |
| 3d54-assembly1.cif.gz_J | structure of purlqs from thermotoga maritima | 0.7505 | 1 | 81 |
| 2dgb-assembly1.cif.gz_D | structure of thermus thermophilus purs in the p21 form | 0.7463 | 1 | 79 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dgbA00 | Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS | 0.7996 | 1 | 81 | 3.30.1280.10 |
| 3d54J00 | Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS | 0.7583 | 1 | 81 | 3.30.1280.10 |
| 3d54J00 | Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS | 0.7505 | 1 | 81 | 3.30.1280.10 |
| af_Q2FZJ2_1_81_3.30.1280.10 | Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS | 0.7305 | 3 | 81 | 3.30.1280.10 |
| 2zw2B00 | Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS | 0.7204 | 1 | 81 | 3.30.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3PB86-F1-model_v4 | Phosphoribosylformylglycinamidine synthase | 0.8382 | 1 | 59 |
GO:0004642
GO:0005524 GO:0005737 GO:0006164 |
| AF-A0A1F8TPV3-F1-model_v4 | Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) | 0.825 | 1 | 81 |
GO:0004642
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A1F7FYP8-F1-model_v4 | Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) | 0.8242 | 1 | 81 |
GO:0004642
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A1Q8AAM7-F1-model_v4 | Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) | 0.8202 | 2 | 81 |
GO:0004642
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A7V3YLU7-F1-model_v4 | Phosphoribosylformylglycinamidine synthase subunit PurS | 0.8202 | 1 | 62 |
GO:0004642
GO:0005524 GO:0005737 GO:0009152 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar