F493865

General Info

Members Datasets Scaffolds Average Seq Length
1425 462 1413 81

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10149801|Ga0111539_101498012
Length 86
Sequence MTYTVQIKVMPLKELLDPQGKAVMGGLQNLGLSGVEDVRVGKNITLQLNASSPEQAKQLAEEASKKLLANPVMEYFEVLCETPNSA

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
5 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
6 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
9 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
10 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
11 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
12 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
13 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
14 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
159 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
247 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
248 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
249 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
256 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
257 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
258 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
271 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
272 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
273 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
274 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
275 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
276 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
277 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
278 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
279 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
280 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
281 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
282 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
283 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
284 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
285 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
289 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
290 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
291 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
292 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
293 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
294 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
295 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
296 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
297 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
298 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
299 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
300 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
301 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
302 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
307 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
308 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
312 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
313 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
316 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
317 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
318 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
321 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
334 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
335 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
336 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
337 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
377 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
378 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
379 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
380 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
381 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
382 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
383 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
384 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
385 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
386 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
387 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
388 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
389 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
390 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
391 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
392 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
393 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
394 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
395 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
396 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
397 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
398 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
399 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
400 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
401 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
402 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
405 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
406 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
407 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
408 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
409 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
410 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
411 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
414 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
418 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
421 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
422 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
423 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
424 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
425 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
426 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
427 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
428 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
429 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
430 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
431 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
432 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
433 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
434 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
435 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
436 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
437 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
438 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
439 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
440 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
441 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
442 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
443 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
444 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
445 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
446 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
447 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
448 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
449 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
452 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
453 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
454 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
457 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
458 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
459 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
460 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
461 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
462 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.65
Nodule 0
Rhizoplane 1.96
Rhizosphere 86.74
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3991831 2162886011 Unclassified 1031
2 CNXas_1008144 3300000545 Bacteria 738
3 JGI24740J21852_10004408 3300001979 Bacteria 6048
4 JGI24739J22299_10000154 3300001989 Bacteria 22212
5 JGI24739J22299_10088741 3300001989 Bacteria 943
6 JGI24739J22299_10163145 3300001989 Bacteria 657
7 JGI24737J22298_10124825 3300001990 Bacteria 760
8 JGI24033J26618_1015030 3300002155 Unclassified 952
9 JGI24751J29686_10022844 3300002459 Unclassified 1296
10 JGI25154J39366_1000004 3300002738 Bacteria 346460
11 JGI25158J39367_1012243 3300002739 Bacteria 1133
12 JGI25158J39367_1020046 3300002739 Bacteria 819
13 JGI25157J39369_1006614 3300002741 Bacteria 1744
14 JGI25159J45721_1011021 3300002987 Bacteria 2249
15 JGI25153J46596_10000224 3300003215 Bacteria 48671
16 JGI25153J46596_10084177 3300003215 Bacteria 785
17 JGI25153J46596_10125283 3300003215 Bacteria 574
18 rootH1_10028725 3300003316 Bacteria 5378
19 rootH1_10105550 3300003316 Bacteria 4751
20 rootH2_10004858 3300003320 Bacteria 14814
21 rootH2_10052963 3300003320 Bacteria 13053
22 rootH2_10092470 3300003320 Bacteria 1865
23 rootH2_10168387 3300003320 Bacteria 1111
24 rootH2_10246825 3300003320 Viruses 1738
25 rootL2_10108849 3300003322 Bacteria 4894
26 rootL2_10160668 3300003322 Bacteria 3909
27 rootL2_10303123 3300003322 Bacteria 1215
28 rootH1_10006382 3300003323 Bacteria 6024
29 rootH1_10071977 3300003323 Bacteria 1755
30 rootH1_10087949 3300003316 Bacteria 1209
31 rootH1_10087949 3300003323 Bacteria 1955
32 JGI25160J50197_1007253 3300003354 Bacteria 4359
33 JGI25160J50197_1010399 3300003354 Bacteria 3369
34 JGI25160J50197_1025424 3300003354 Bacteria 1657
35 Ga0055535_1007135 3300003761 Bacteria 2166
36 Ga0055542_1006677 3300003762 Bacteria 2437
37 Ga0055528_1000355 3300003790 Bacteria 37201
38 Ga0055530_10000425 3300003791 Bacteria 37501
39 Ga0055531_10000411 3300003794 Bacteria 41180
40 Ga0055531_10037717 3300003794 Bacteria 1464
41 Ga0065165_1000148 3300005262 Bacteria 122640
42 Ga0065165_1014842 3300005262 Bacteria 3003
43 Ga0065165_1030372 3300005262 Bacteria 1720
44 Ga0065714_10171921 3300005288 Unclassified 1000
45 Ga0065704_10375778 3300005289 Bacteria 779
46 Ga0065704_10388791 3300005289 Bacteria 765
47 Ga0065704_10843439 3300005289 Unclassified 511
48 Ga0065712_10001417 3300005290 Bacteria 6359
49 Ga0065712_10010245 3300005290 Bacteria 2748
50 Ga0065712_10149212 3300005290 Bacteria 1375
51 Ga0065712_10165992 3300005290 Bacteria 1273
52 Ga0065712_10228029 3300005290 Unclassified 1020
53 Ga0065712_10332757 3300005290 Unclassified 811
54 Ga0065712_10696653 3300005290 Bacteria 548
55 Ga0065712_10719023 3300005290 Bacteria 539
56 Ga0065715_10075105 3300005293 Bacteria 661
57 Ga0065715_10236672 3300005293 Unclassified 1214
58 Ga0065707_10229826 3300005295 Bacteria 1193
59 Ga0065707_10425758 3300005295 Unclassified 825
60 Ga0070658_10016557 3300005327 Bacteria 5899
61 Ga0070658_10029504 3300005327 Unclassified 4407
62 Ga0070658_10166171 3300005327 Bacteria 1852
63 Ga0070658_11009185 3300005327 Bacteria 724
64 Ga0070676_10004512 3300005328 Bacteria 7327
65 Ga0070676_10027716 3300005328 Bacteria 3214
66 Ga0070676_10158946 3300005328 Bacteria 1453
67 Ga0070683_100000615 3300005329 Bacteria 25605
68 Ga0070683_100002428 3300005329 Bacteria 14813
69 Ga0070683_100008631 3300005329 Bacteria 8659
70 Ga0070683_100048187 3300005329 Bacteria 3939
71 Ga0070683_100055456 3300005329 Unclassified 3678
72 Ga0070690_100022674 3300005330 Bacteria 3843
73 Ga0070690_101511534 3300005330 Unclassified 543
74 Ga0070670_100026030 3300005331 Bacteria 5035
75 Ga0070670_100123124 3300005331 Unclassified 2237
76 Ga0070670_100366957 3300005331 Bacteria 1267
77 Ga0070670_100548885 3300005331 Unclassified 1031
78 Ga0070670_100600439 3300005331 Unclassified 985
79 Ga0070670_100785445 3300005331 Bacteria 859
80 Ga0070670_101140936 3300005331 Unclassified 711
81 Ga0070670_101335581 3300005331 Bacteria 657
82 Ga0070677_10014866 3300005333 Bacteria 2748
83 Ga0070677_10069338 3300005333 Bacteria 1479
84 Ga0070677_10182051 3300005333 Bacteria 1001
85 Ga0068869_100005960 3300005334 Bacteria 7705
86 Ga0068869_100009661 3300005334 Bacteria 6264
87 Ga0068869_100088792 3300005334 Unclassified 2321
88 Ga0068869_100188735 3300005334 Bacteria 1620
89 Ga0068869_101355570 3300005334 Unclassified 629
90 Ga0070666_10003206 3300005335 Bacteria 9950
91 Ga0070666_10037711 3300005335 Unclassified 3215
92 Ga0070666_10086792 3300005335 Unclassified 2144
93 Ga0070666_10087689 3300005335 Unclassified 2133
94 Ga0070680_100031273 3300005336 Unclassified 4279
95 Ga0070680_100073100 3300005336 Bacteria 2819
96 Ga0070680_100076264 3300005336 Bacteria 2759
97 Ga0070680_101450127 3300005336 Unclassified 594
98 Ga0070682_100068373 3300005337 Bacteria 2265
99 Ga0070682_100153642 3300005337 Unclassified 1582
100 Ga0070682_100789324 3300005337 Bacteria 770
101 Ga0068868_100003134 3300005338 Bacteria 11508
102 Ga0068868_100223164 3300005338 Unclassified 1578
103 Ga0068868_100359284 3300005338 Unclassified 1249
104 Ga0068868_100431522 3300005338 Bacteria 1143
105 Ga0068868_101355732 3300005338 Bacteria 662
106 Ga0068868_101417648 3300005338 Unclassified 648
107 Ga0068868_101474190 3300005338 Unclassified 636
108 Ga0070660_100001558 3300005339 Bacteria 15760
109 Ga0070660_100068302 3300005339 Bacteria 2770
110 Ga0070660_100097241 3300005339 Bacteria 2329
111 Ga0070660_100308646 3300005339 Bacteria 1298
112 Ga0070660_100361896 3300005339 Bacteria 1196
113 Ga0070660_100451449 3300005339 Bacteria 1066
114 Ga0070660_100486182 3300005339 Bacteria 1026
115 Ga0070660_100964091 3300005339 Bacteria 720
116 Ga0070689_100015371 3300005340 Bacteria 5580
117 Ga0070689_100711257 3300005340 Bacteria 878
118 Ga0070689_101532784 3300005340 Bacteria 604
119 Ga0070691_10070158 3300005341 Bacteria 1699
120 Ga0070687_100084904 3300005343 Unclassified 1736
121 Ga0070687_100240710 3300005343 Unclassified 1119
122 Ga0070687_100354360 3300005343 Bacteria 948
123 Ga0070687_101111580 3300005343 Unclassified 579
124 Ga0070661_100000716 3300005344 Bacteria 24318
125 Ga0070661_100236064 3300005344 Bacteria 1406
126 Ga0070661_101272938 3300005344 Unclassified 616
127 Ga0070661_101708494 3300005344 Bacteria 533
128 Ga0070692_10329317 3300005345 Bacteria 942
129 Ga0070692_10417698 3300005345 Bacteria 851
130 Ga0070692_10548503 3300005345 Bacteria 757
131 Ga0070668_100011512 3300005347 Bacteria 6587
132 Ga0070668_100066932 3300005347 Bacteria 2789
133 Ga0070668_100083587 3300005347 Bacteria 2506
134 Ga0070668_100326069 3300005347 Bacteria 1294
135 Ga0070668_100331165 3300005347 Bacteria 1284
136 Ga0070669_100002817 3300005353 Bacteria 12559
137 Ga0070669_100126538 3300005353 Unclassified 1956
138 Ga0070669_100330064 3300005353 Unclassified 1234
139 Ga0070669_100887376 3300005353 Bacteria 761
140 Ga0070669_101366184 3300005353 Bacteria 614
141 Ga0070669_101991893 3300005353 Bacteria 508
142 Ga0070675_100002107 3300005354 Bacteria 14716
143 Ga0070675_100033122 3300005354 Unclassified 4186
144 Ga0070675_100148821 3300005354 Unclassified 2006
145 Ga0070675_100195754 3300005354 Bacteria 1753
146 Ga0070675_100245564 3300005354 Bacteria 1565
147 Ga0070671_100019722 3300005355 Bacteria 5491
148 Ga0070671_100059583 3300005355 Bacteria 3177
149 Ga0070671_100082299 3300005355 Unclassified 2691
150 Ga0070671_100189540 3300005355 Bacteria 1743
151 Ga0070671_100238866 3300005355 Bacteria 1542
152 Ga0070671_100644228 3300005355 Bacteria 917
153 Ga0070671_101303334 3300005355 Bacteria 641
154 Ga0070674_100081660 3300005356 Bacteria 2310
155 Ga0070674_100118139 3300005356 Unclassified 1959
156 Ga0070674_100280305 3300005356 Unclassified 1321
157 Ga0070674_100429194 3300005356 Unclassified 1086
158 Ga0070674_100605243 3300005356 Unclassified 926
159 Ga0070674_100898512 3300005356 Bacteria 771
160 Ga0070674_100901610 3300005356 Bacteria 770
161 Ga0070673_100002306 3300005364 Bacteria 11593
162 Ga0070673_100032189 3300005364 Bacteria 3945
163 Ga0070673_100122862 3300005364 Bacteria 2168
164 Ga0070673_100239452 3300005364 Bacteria 1577
165 Ga0070673_100757139 3300005364 Bacteria 895
166 Ga0070673_100845769 3300005364 Bacteria 846
167 Ga0070688_100009375 3300005365 Bacteria 5350
168 Ga0070688_100018226 3300005365 Bacteria 4047
169 Ga0070688_101407499 3300005365 Bacteria 565
170 Ga0070659_100286926 3300005366 Bacteria 1370
171 Ga0070659_100787336 3300005366 Unclassified 826
172 Ga0070659_100835755 3300005366 Bacteria 802
173 Ga0070659_100968893 3300005366 Bacteria 746
174 Ga0070659_101050685 3300005366 Bacteria 716
175 Ga0070659_101960879 3300005366 Unclassified 525
176 Ga0070667_100007609 3300005367 Bacteria 8984
177 Ga0070667_100049032 3300005367 Unclassified 3556
178 Ga0070667_100067852 3300005367 Bacteria 3034
179 Ga0070667_100195878 3300005367 Bacteria 1791
180 Ga0070667_100223373 3300005367 Unclassified 1677
181 Ga0070667_100880056 3300005367 Bacteria 833
182 Ga0070667_101009961 3300005367 Unclassified 776
183 Ga0070667_101059104 3300005367 Bacteria 757
184 Ga0070703_10506814 3300005406 Unclassified 544
185 Ga0070714_100669624 3300005435 Bacteria 1000
186 Ga0070710_11434452 3300005437 Bacteria 517
187 Ga0070701_10023227 3300005438 Unclassified 2983
188 Ga0070701_10078565 3300005438 Bacteria 1781
189 Ga0070705_100644389 3300005440 Unclassified 825
190 Ga0070705_101365373 3300005440 Unclassified 589
191 Ga0070700_100145353 3300005441 Bacteria 1616
192 Ga0070700_100710557 3300005441 Unclassified 800
193 Ga0070694_100508132 3300005444 Unclassified 960
194 Ga0070663_100012032 3300005455 Bacteria 5460
195 Ga0070663_100169767 3300005455 Bacteria 1685
196 Ga0070663_100397292 3300005455 Bacteria 1126
197 Ga0070678_100003286 3300005456 Bacteria 8990
198 Ga0070678_100158474 3300005456 Unclassified 1831
199 Ga0070662_100011603 3300005457 Bacteria 5815
200 Ga0070662_100035523 3300005457 Bacteria 3520
201 Ga0070662_100054392 3300005457 Bacteria 2901
202 Ga0070662_100376237 3300005457 Bacteria 1168
203 Ga0070662_100615819 3300005457 Bacteria 914
204 Ga0070662_101176054 3300005457 Bacteria 659
205 Ga0070662_101309745 3300005457 Bacteria 623
206 Ga0070681_10088919 3300005458 Bacteria 3040
207 Ga0070681_10095068 3300005458 Bacteria 2929
208 Ga0070681_10527543 3300005458 Bacteria 1094
209 Ga0070681_10810323 3300005458 Bacteria 854
210 Ga0068867_100005650 3300005459 Bacteria 8865
211 Ga0068867_100062803 3300005459 Unclassified 2760
212 Ga0068867_100073950 3300005459 Bacteria 2553
213 Ga0068867_100080722 3300005459 Unclassified 2450
214 Ga0068867_100091339 3300005459 Bacteria 2311
215 Ga0068867_100290819 3300005459 Bacteria 1343
216 Ga0068867_100733825 3300005459 Unclassified 875
217 Ga0068867_100775108 3300005459 Bacteria 853
218 Ga0068867_100919472 3300005459 Bacteria 788
219 Ga0068867_100933110 3300005459 Bacteria 783
220 Ga0068867_101709782 3300005459 Unclassified 590
221 Ga0070685_10021727 3300005466 Unclassified 3490
222 Ga0070685_10194478 3300005466 Bacteria 1314
223 Ga0070685_10265907 3300005466 Unclassified 1142
224 Ga0070685_10606095 3300005466 Bacteria 789
225 Ga0070685_10609501 3300005466 Bacteria 787
226 Ga0070707_100318179 3300005468 Unclassified 1512
227 Ga0070698_100000585 3300005471 Bacteria 39139
228 Ga0070698_100000965 3300005471 Bacteria 31529
229 Ga0070698_100032415 3300005471 Bacteria 5412
230 Ga0070699_100493970 3300005518 Unclassified 1111
231 Ga0070679_100070634 3300005530 Unclassified 3483
232 Ga0070679_100173865 3300005530 Bacteria 2126
233 Ga0070679_100431741 3300005530 Bacteria 1262
234 Ga0070679_100554943 3300005530 Bacteria 1092
235 Ga0070679_100647417 3300005530 Bacteria 999
236 Ga0070684_100000134 3300005535 Bacteria 49154
237 Ga0070684_100010110 3300005535 Bacteria 7462
238 Ga0070684_101009235 3300005535 Bacteria 781
239 Ga0070684_101325970 3300005535 Bacteria 677
240 Ga0070697_101667294 3300005536 Unclassified 570
241 Ga0068853_100000276 3300005539 Bacteria 36211
242 Ga0068853_100020543 3300005539 Bacteria 5493
243 Ga0068853_100050862 3300005539 Bacteria 3565
244 Ga0068853_100063424 3300005539 Bacteria 3201
245 Ga0068853_100164165 3300005539 Bacteria 2006
246 Ga0068853_100169597 3300005539 Bacteria 1974
247 Ga0068853_100221850 3300005539 Unclassified 1727
248 Ga0068853_100366338 3300005539 Unclassified 1343
249 Ga0068853_100604829 3300005539 Bacteria 1041
250 Ga0068853_100722012 3300005539 Unclassified 951
251 Ga0068853_101248095 3300005539 Bacteria 718
252 Ga0068853_101354105 3300005539 Bacteria 688
253 Ga0068853_101704560 3300005539 Bacteria 611
254 Ga0068853_101773588 3300005539 Unclassified 598
255 Ga0070672_100000891 3300005543 Bacteria 17929
256 Ga0070672_100039214 3300005543 Unclassified 3626
257 Ga0070672_100052704 3300005543 Unclassified 3177
258 Ga0070672_100251835 3300005543 Bacteria 1487
259 Ga0070672_100296308 3300005543 Bacteria 1370
260 Ga0070672_101093836 3300005543 Bacteria 708
261 Ga0070672_101152830 3300005543 Unclassified 690
262 Ga0070686_101470741 3300005544 Unclassified 573
263 Ga0070695_101353976 3300005545 Unclassified 589
264 Ga0070665_100000717 3300005548 Bacteria 44083
265 Ga0070704_100083692 3300005549 Bacteria 2356
266 Ga0070704_100423900 3300005549 Unclassified 1140
267 Ga0070704_101056900 3300005549 Bacteria 736
268 Ga0070704_101256592 3300005549 Bacteria 677
269 Ga0070704_101266160 3300005549 Unclassified 674
270 Ga0070704_101843798 3300005549 Bacteria 560
271 Ga0068855_100000210 3300005563 Bacteria 74786
272 Ga0068855_100013494 3300005563 Bacteria 9850
273 Ga0068855_100019662 3300005563 Bacteria 8111
274 Ga0068855_100033420 3300005563 Bacteria 6138
275 Ga0068855_100131020 3300005563 Bacteria 2864
276 Ga0068855_100166003 3300005563 Bacteria 2503
277 Ga0068855_100200676 3300005563 Bacteria 2245
278 Ga0068855_100309054 3300005563 Bacteria 1749
279 Ga0068855_100603126 3300005563 Bacteria 1184
280 Ga0068855_100831639 3300005563 Unclassified 979
281 Ga0070664_100001395 3300005564 Bacteria 19263
282 Ga0070664_100030956 3300005564 Bacteria 4467
283 Ga0070664_100042086 3300005564 Bacteria 3857
284 Ga0070664_100098645 3300005564 Unclassified 2538
285 Ga0070664_100112355 3300005564 Unclassified 2379
286 Ga0070664_100132197 3300005564 Unclassified 2192
287 Ga0070664_100500562 3300005564 Unclassified 1120
288 Ga0070664_100897438 3300005564 Bacteria 831
289 Ga0070664_101416906 3300005564 Bacteria 657
290 Ga0068857_100001139 3300005577 Bacteria 20729
291 Ga0068857_100011514 3300005577 Bacteria 7694
292 Ga0068857_100023348 3300005577 Bacteria 5443
293 Ga0068857_100031961 3300005577 Bacteria 4652
294 Ga0068857_100086847 3300005577 Bacteria 2798
295 Ga0068857_100111973 3300005577 Bacteria 2454
296 Ga0068857_100131955 3300005577 Bacteria 2253
297 Ga0068857_100259580 3300005577 Unclassified 1594
298 Ga0068857_100389855 3300005577 Bacteria 1295
299 Ga0068857_100729726 3300005577 Bacteria 943
300 Ga0068857_102074695 3300005577 Bacteria 558
301 Ga0068854_100039596 3300005578 Bacteria 3322
302 Ga0068854_100078549 3300005578 Bacteria 2432
303 Ga0068854_100309677 3300005578 Bacteria 1280
304 Ga0068854_100474399 3300005578 Bacteria 1049
305 Ga0068854_101052727 3300005578 Bacteria 723
306 Ga0068854_101489163 3300005578 Bacteria 614
307 Ga0068856_100002822 3300005614 Bacteria 17786
308 Ga0068856_100120763 3300005614 Bacteria 2622
309 Ga0068856_100168942 3300005614 Unclassified 2199
310 Ga0068856_101697243 3300005614 Unclassified 644
311 Ga0070702_100538398 3300005615 Unclassified 864
312 Ga0068852_100028064 3300005616 Bacteria 4600
313 Ga0068852_100119828 3300005616 Unclassified 2406
314 Ga0068852_100125468 3300005616 Bacteria 2356
315 Ga0068852_100179185 3300005616 Unclassified 1992
316 Ga0068852_100310763 3300005616 Bacteria 1528
317 Ga0068852_100411446 3300005616 Bacteria 1332
318 Ga0068852_100786514 3300005616 Bacteria 965
319 Ga0068852_101096546 3300005616 Bacteria 816
320 Ga0068852_101368399 3300005616 Unclassified 730
321 Ga0068852_102030748 3300005616 Bacteria 597
322 Ga0068852_102314564 3300005616 Bacteria 558
323 Ga0068852_102492543 3300005616 Unclassified 537
324 Ga0068852_102518002 3300005616 Unclassified 535
325 Ga0068859_100013947 3300005617 Bacteria 8061
326 Ga0068859_100259173 3300005617 Bacteria 1830
327 Ga0068859_100360211 3300005617 Bacteria 1549
328 Ga0068859_100424214 3300005617 Bacteria 1426
329 Ga0068859_100669199 3300005617 Bacteria 1130
330 Ga0068859_100927488 3300005617 Bacteria 955
331 Ga0068859_101559965 3300005617 Unclassified 729
332 Ga0068859_101941512 3300005617 Bacteria 650
333 Ga0068864_100005533 3300005618 Bacteria 10357
334 Ga0068864_100047444 3300005618 Bacteria 3689
335 Ga0068864_100245303 3300005618 Unclassified 1661
336 Ga0068864_100437828 3300005618 Unclassified 1248
337 Ga0068864_100956887 3300005618 Unclassified 848
338 Ga0068864_101028180 3300005618 Bacteria 818
339 Ga0068864_101128055 3300005618 Unclassified 781
340 Ga0068866_10107701 3300005718 Unclassified 1549
341 Ga0068866_10135369 3300005718 Bacteria 1407
342 Ga0068866_10823681 3300005718 Unclassified 647
343 Ga0068861_100089216 3300005719 Bacteria 2430
344 Ga0068861_100100506 3300005719 Unclassified 2299
345 Ga0068861_100174470 3300005719 Unclassified 1784
346 Ga0068861_100230718 3300005719 Bacteria 1570
347 Ga0068861_100657801 3300005719 Bacteria 969
348 Ga0068861_100893828 3300005719 Unclassified 841
349 Ga0068861_101067162 3300005719 Bacteria 775
350 Ga0068861_101640057 3300005719 Bacteria 634
351 Ga0068851_10007173 3300005834 Bacteria 5107
352 Ga0068851_10050995 3300005834 Bacteria 2102
353 Ga0068851_10062218 3300005834 Bacteria 1915
354 Ga0068851_10110605 3300005834 Bacteria 1466
355 Ga0068851_10122130 3300005834 Bacteria 1401
356 Ga0068851_10940564 3300005834 Unclassified 543
357 Ga0068870_10009083 3300005840 Bacteria 4502
358 Ga0068870_10025610 3300005840 Unclassified 2930
359 Ga0068870_10163524 3300005840 Unclassified 1322
360 Ga0068870_10234500 3300005840 Bacteria 1130
361 Ga0068863_100007041 3300005841 Bacteria 11020
362 Ga0068863_100045831 3300005841 Bacteria 4150
363 Ga0068863_100081203 3300005841 Bacteria 3071
364 Ga0068863_100101556 3300005841 Bacteria 2734
365 Ga0068863_100510458 3300005841 Bacteria 1184
366 Ga0068863_101197020 3300005841 Bacteria 766
367 Ga0068858_100015215 3300005842 Bacteria 7237
368 Ga0068858_100108630 3300005842 Bacteria 2590
369 Ga0068858_100240779 3300005842 Unclassified 1717
370 Ga0068858_100406117 3300005842 Bacteria 1309
371 Ga0068858_100502218 3300005842 Unclassified 1172
372 Ga0068858_100599173 3300005842 Bacteria 1069
373 Ga0068858_102500870 3300005842 Unclassified 510
374 Ga0068860_100000004 3300005843 Bacteria 506126
375 Ga0068860_100007960 3300005843 Bacteria 10572
376 Ga0068860_100020751 3300005843 Bacteria 6364
377 Ga0068860_100233604 3300005843 Unclassified 1787
378 Ga0068860_100506895 3300005843 Bacteria 1205
379 Ga0068860_100750878 3300005843 Unclassified 987
380 Ga0068860_101326006 3300005843 Bacteria 741
381 Ga0068862_100005611 3300005844 Bacteria 10488
382 Ga0068862_100158940 3300005844 Bacteria 2016
383 Ga0068862_100197896 3300005844 Unclassified 1811
384 Ga0068862_100341456 3300005844 Bacteria 1387
385 Ga0068862_100408531 3300005844 Bacteria 1271
386 Ga0068862_101069346 3300005844 Bacteria 801
387 Ga0068862_101666483 3300005844 Unclassified 646
388 Ga0081540_1229819 3300005983 Bacteria 655
389 Ga0081539_10028019 3300005985 Unclassified 3552
390 Ga0070715_10104756 3300006163 Bacteria 1325
391 Ga0070716_101598154 3300006173 Bacteria 535
392 Ga0075366_10023733 3300006195 Bacteria 3574
393 Ga0075366_10044341 3300006195 Bacteria 2636
394 Ga0075366_10057126 3300006195 Bacteria 2319
395 Ga0075366_10218143 3300006195 Bacteria 1162
396 Ga0075366_10235577 3300006195 Bacteria 1116
397 Ga0075366_10357496 3300006195 Bacteria 897
398 Ga0075366_10542250 3300006195 Bacteria 720
399 Ga0097621_100013926 3300006237 Bacteria 6006
400 Ga0097621_100193560 3300006237 Unclassified 1762
401 Ga0097621_100385504 3300006237 Bacteria 1252
402 Ga0097621_100596043 3300006237 Bacteria 1009
403 Ga0097621_100654672 3300006237 Bacteria 964
404 Ga0097621_100891584 3300006237 Bacteria 828
405 Ga0097621_101488749 3300006237 Bacteria 642
406 Ga0097621_101778565 3300006237 Unclassified 587
407 Ga0097621_102042925 3300006237 Unclassified 548
408 Ga0068871_100000076 3300006358 Bacteria 55186
409 Ga0068871_100006134 3300006358 Bacteria 8470
410 Ga0068871_100061130 3300006358 Bacteria 3075
411 Ga0068871_101753233 3300006358 Unclassified 589
412 Ga0075428_100003531 3300006844 Bacteria 17124
413 Ga0075428_100022783 3300006844 Bacteria 6931
414 Ga0075428_100067391 3300006844 Bacteria 3918
415 Ga0075428_100863557 3300006844 Bacteria 960
416 Ga0075428_102009797 3300006844 Bacteria 599
417 Ga0075428_102650439 3300006844 Bacteria 511
418 Ga0075430_100003285 3300006846 Bacteria 13558
419 Ga0075430_100078318 3300006846 Bacteria 2771
420 Ga0075431_100003484 3300006847 Bacteria 15256
421 Ga0075431_100106799 3300006847 Bacteria 2888
422 Ga0075431_100169083 3300006847 Bacteria 2247
423 Ga0075434_100257710 3300006871 Unclassified 1763
424 Ga0075434_100468230 3300006871 Unclassified 1281
425 Ga0075434_102369302 3300006871 Bacteria 533
426 Ga0075429_100000539 3300006880 Bacteria 28785
427 Ga0075429_100018881 3300006880 Bacteria 5973
428 Ga0075429_100023645 3300006880 Bacteria 5332
429 Ga0075429_101386936 3300006880 Bacteria 612
430 Ga0068865_100004770 3300006881 Bacteria 8200
431 Ga0068865_100189841 3300006881 Bacteria 1588
432 Ga0068865_100471839 3300006881 Bacteria 1041
433 Ga0068865_101007712 3300006881 Bacteria 729
434 Ga0097620_100013947 3300006931 Bacteria 8061
435 Ga0097620_100259160 3300006931 Bacteria 1830
436 Ga0097620_100360205 3300006931 Bacteria 1549
437 Ga0097620_100424215 3300006931 Bacteria 1426
438 Ga0097620_100669149 3300006931 Bacteria 1130
439 Ga0097620_100927408 3300006931 Bacteria 955
440 Ga0097620_101559565 3300006931 Unclassified 729
441 Ga0097620_101941053 3300006931 Bacteria 650
442 Ga0075435_100671700 3300007076 Unclassified 900
443 Ga0105251_10581992 3300009011 Unclassified 530
444 Ga0105240_10002773 3300009093 Bacteria 27676
445 Ga0105240_10014724 3300009093 Bacteria 10669
446 Ga0105240_10078635 3300009093 Bacteria 4061
447 Ga0105240_10122116 3300009093 Unclassified 3135
448 Ga0105240_10268604 3300009093 Bacteria 1965
449 Ga0105240_10417752 3300009093 Bacteria 1508
450 Ga0105240_11028167 3300009093 Unclassified 880
451 Ga0105240_11676293 3300009093 Bacteria 664
452 Ga0105240_12736745 3300009093 Unclassified 508
453 Ga0111539_10002138 3300009094 Bacteria 26441
454 Ga0111539_10022224 3300009094 Bacteria 7798
455 Ga0111539_10149801 3300009094 Bacteria 2731
456 Ga0111539_10434093 3300009094 Unclassified 1529
457 Ga0111539_10919964 3300009094 Bacteria 1017
458 Ga0111539_11018787 3300009094 Bacteria 962
459 Ga0111539_11135765 3300009094 Bacteria 908
460 Ga0111539_11544361 3300009094 Bacteria 770
461 Ga0111539_12137950 3300009094 Unclassified 649
462 Ga0111539_12372126 3300009094 Bacteria 615
463 Ga0105245_11474491 3300009098 Bacteria 731
464 Ga0105247_10684236 3300009101 Bacteria 770
465 Ga0114129_10005173 3300009147 Bacteria 18361
466 Ga0114129_10044760 3300009147 Bacteria 6226
467 Ga0114129_10135425 3300009147 Bacteria 3380
468 Ga0114129_10469584 3300009147 Unclassified 1648
469 Ga0105243_10258408 3300009148 Unclassified 1558
470 Ga0105241_10152728 3300009174 Bacteria 1890
471 Ga0105241_10183548 3300009174 Unclassified 1737
472 Ga0105241_10308399 3300009174 Unclassified 1361
473 Ga0105241_10357373 3300009174 Unclassified 1270
474 Ga0105241_10611932 3300009174 Archaea 985
475 Ga0105241_10779213 3300009174 Bacteria 879
476 Ga0105241_10841871 3300009174 Unclassified 848
477 Ga0105242_10028757 3300009176 Bacteria 4427
478 Ga0105242_10032198 3300009176 Bacteria 4192
479 Ga0105242_10090483 3300009176 Bacteria 2574
480 Ga0105242_10199971 3300009176 Bacteria 1774
481 Ga0105242_10205153 3300009176 Unclassified 1753
482 Ga0105242_10248027 3300009176 Bacteria 1603
483 Ga0105242_13039464 3300009176 Bacteria 519
484 Ga0105248_10020088 3300009177 Bacteria 7400
485 Ga0105248_10348836 3300009177 Unclassified 1666
486 Ga0105248_11727454 3300009177 Bacteria 709
487 Ga0105237_10011361 3300009545 Bacteria 9421
488 Ga0105237_10035708 3300009545 Bacteria 5029
489 Ga0105237_10216508 3300009545 Unclassified 1915
490 Ga0105237_11291167 3300009545 Bacteria 736
491 Ga0105238_10226021 3300009551 Unclassified 1848
492 Ga0105238_10636568 3300009551 Unclassified 1076
493 Ga0105249_10005610 3300009553 Bacteria 10854
494 Ga0105249_10031654 3300009553 Bacteria 4784
495 Ga0105249_10077890 3300009553 Bacteria 3075
496 Ga0105249_10112450 3300009553 Unclassified 2575
497 Ga0105249_10118001 3300009553 Bacteria 2517
498 Ga0105249_10404191 3300009553 Bacteria 1396
499 Ga0105249_10421211 3300009553 Unclassified 1369
500 Ga0105249_10501367 3300009553 Bacteria 1259
501 Ga0105249_12165957 3300009553 Unclassified 629
502 Ga0099796_10220122 3300010159 Bacteria 778
503 Ga0105239_10015012 3300010375 Bacteria 8586
504 Ga0105239_10017962 3300010375 Bacteria 7822
505 Ga0105239_10182821 3300010375 Unclassified 2346
506 Ga0105239_10358684 3300010375 Unclassified 1646
507 Ga0105239_10497244 3300010375 Bacteria 1386
508 Ga0105239_10707686 3300010375 Unclassified 1152
509 Ga0105239_10753466 3300010375 Unclassified 1115
510 Ga0105239_11221869 3300010375 Bacteria 866
511 Ga0105239_11537888 3300010375 Unclassified 769
512 Ga0105239_12184380 3300010375 Bacteria 644
513 Ga0105246_10072803 3300011119 Bacteria 2424
514 Ga0105246_10086311 3300011119 Unclassified 2249
515 Ga0105246_10618161 3300011119 Unclassified 939
516 Ga0105246_11799013 3300011119 Unclassified 585
517 Ga0157373_10002704 3300013100 Bacteria 13435
518 Ga0157373_10019662 3300013100 Bacteria 4913
519 Ga0157373_10021506 3300013100 Bacteria 4685
520 Ga0157373_10196220 3300013100 Bacteria 1423
521 Ga0157373_10228670 3300013100 Bacteria 1313
522 Ga0157373_10507577 3300013100 Bacteria 871
523 Ga0157373_10963142 3300013100 Bacteria 635
524 Ga0157373_11053689 3300013100 Bacteria 609
525 Ga0157373_11108618 3300013100 Bacteria 594
526 Ga0157373_11355229 3300013100 Bacteria 540
527 Ga0157371_10001533 3300013102 Bacteria 23794
528 Ga0157371_10001693 3300013102 Bacteria 22451
529 Ga0157371_10001829 3300013102 Bacteria 21446
530 Ga0157371_10002330 3300013102 Bacteria 18216
531 Ga0157371_10011626 3300013102 Bacteria 6767
532 Ga0157371_10018324 3300013102 Bacteria 5178
533 Ga0157371_10021176 3300013102 Bacteria 4775
534 Ga0157371_10029612 3300013102 Bacteria 3957
535 Ga0157371_10038547 3300013102 Bacteria 3418
536 Ga0157371_10059402 3300013102 Bacteria 2711
537 Ga0157371_10071327 3300013102 Unclassified 2459
538 Ga0157371_10119043 3300013102 Bacteria 1877
539 Ga0157371_10160572 3300013102 Bacteria 1605
540 Ga0157371_10184413 3300013102 Bacteria 1493
541 Ga0157371_10208722 3300013102 Bacteria 1401
542 Ga0157371_10210062 3300013102 Bacteria 1397
543 Ga0157371_10234254 3300013102 Bacteria 1320
544 Ga0157371_10362065 3300013102 Bacteria 1057
545 Ga0157371_10382135 3300013102 Bacteria 1028
546 Ga0157371_10440790 3300013102 Bacteria 957
547 Ga0157371_10524347 3300013102 Bacteria 876
548 Ga0157371_11227938 3300013102 Unclassified 578
549 Ga0157370_10002958 3300013104 Bacteria 20221
550 Ga0157370_10046504 3300013104 Bacteria 4161
551 Ga0157370_10106933 3300013104 Bacteria 2618
552 Ga0157370_10348395 3300013104 Bacteria 1365
553 Ga0157370_10420745 3300013104 Bacteria 1229
554 Ga0157370_10542836 3300013104 Unclassified 1066
555 Ga0157370_10701646 3300013104 Bacteria 924
556 Ga0157370_10804684 3300013104 Bacteria 855
557 Ga0157370_11116168 3300013104 Bacteria 712
558 Ga0157370_11250469 3300013104 Bacteria 669
559 Ga0157370_11604159 3300013104 Bacteria 585
560 Ga0157369_10027523 3300013105 Bacteria 6301
561 Ga0157369_10028011 3300013105 Bacteria 6239
562 Ga0157369_10052489 3300013105 Bacteria 4410
563 Ga0157369_10381472 3300013105 Bacteria 1463
564 Ga0157369_10916103 3300013105 Bacteria 899
565 Ga0157369_11381018 3300013105 Bacteria 717
566 Ga0157369_11499312 3300013105 Bacteria 686
567 Ga0157369_11894447 3300013105 Unclassified 605
568 Ga0157369_11946669 3300013105 Bacteria 597
569 Ga0157369_12291957 3300013105 Bacteria 547
570 Ga0157374_10005530 3300013296 Bacteria 10626
571 Ga0157374_10087995 3300013296 Bacteria 2958
572 Ga0157374_10156970 3300013296 Unclassified 2215
573 Ga0157374_10162410 3300013296 Unclassified 2176
574 Ga0157374_10371371 3300013296 Bacteria 1424
575 Ga0157374_10371449 3300013296 Bacteria 1423
576 Ga0157374_10885639 3300013296 Bacteria 910
577 Ga0157374_10891286 3300013296 Bacteria 907
578 Ga0157374_10933942 3300013296 Bacteria 886
579 Ga0157378_10013114 3300013297 Bacteria 7252
580 Ga0157378_10066114 3300013297 Unclassified 3237
581 Ga0157378_10166419 3300013297 Bacteria 2065
582 Ga0157378_10686741 3300013297 Unclassified 1042
583 Ga0157378_12267118 3300013297 Unclassified 594
584 Ga0163162_10001306 3300013306 Bacteria 23316
585 Ga0163162_10002620 3300013306 Bacteria 17068
586 Ga0163162_10003840 3300013306 Bacteria 14404
587 Ga0163162_10013381 3300013306 Bacteria 8013
588 Ga0163162_10022875 3300013306 Bacteria 6163
589 Ga0163162_10171390 3300013306 Bacteria 2295
590 Ga0163162_10220623 3300013306 Bacteria 2026
591 Ga0163162_10426408 3300013306 Bacteria 1458
592 Ga0163162_10681328 3300013306 Bacteria 1151
593 Ga0163162_11173128 3300013306 Bacteria 871
594 Ga0163162_12816191 3300013306 Bacteria 560
595 Ga0157372_10033742 3300013307 Bacteria 5624
596 Ga0157372_10036205 3300013307 Bacteria 5439
597 Ga0157372_10039132 3300013307 Bacteria 5235
598 Ga0157372_10062107 3300013307 Unclassified 4185
599 Ga0157372_10074457 3300013307 Bacteria 3829
600 Ga0157372_10108796 3300013307 Bacteria 3173
601 Ga0157372_10173771 3300013307 Bacteria 2493
602 Ga0157372_10228957 3300013307 Bacteria 2155
603 Ga0157372_10396117 3300013307 Bacteria 1609
604 Ga0157372_10545396 3300013307 Bacteria 1352
605 Ga0157372_10579821 3300013307 Bacteria 1307
606 Ga0157372_10725767 3300013307 Bacteria 1156
607 Ga0157372_10771811 3300013307 Bacteria 1117
608 Ga0157372_10842069 3300013307 Bacteria 1065
609 Ga0157372_10854859 3300013307 Bacteria 1056
610 Ga0157372_10857681 3300013307 Unclassified 1054
611 Ga0157372_10881933 3300013307 Bacteria 1038
612 Ga0157372_10951457 3300013307 Unclassified 996
613 Ga0157372_11433923 3300013307 Unclassified 796
614 Ga0157372_11479885 3300013307 Bacteria 782
615 Ga0157372_11774931 3300013307 Unclassified 710
616 Ga0157372_12676452 3300013307 Bacteria 572
617 Ga0157372_13212195 3300013307 Unclassified 521
618 Ga0157375_10000754 3300013308 Bacteria 28363
619 Ga0157375_10006460 3300013308 Bacteria 10211
620 Ga0157375_10029310 3300013308 Bacteria 5174
621 Ga0157375_10054153 3300013308 Bacteria 3951
622 Ga0157375_10065453 3300013308 Bacteria 3624
623 Ga0157375_10438656 3300013308 Bacteria 1472
624 Ga0157375_10645273 3300013308 Bacteria 1215
625 Ga0157375_10689479 3300013308 Bacteria 1176
626 Ga0157375_12056566 3300013308 Unclassified 679
627 Ga0163163_10001404 3300014325 Bacteria 20324
628 Ga0163163_10008917 3300014325 Bacteria 8935
629 Ga0163163_10018486 3300014325 Bacteria 6526
630 Ga0163163_10133033 3300014325 Bacteria 2527
631 Ga0163163_10267727 3300014325 Unclassified 1760
632 Ga0163163_10540540 3300014325 Bacteria 1228
633 Ga0163163_10652846 3300014325 Bacteria 1115
634 Ga0163163_10870936 3300014325 Bacteria 964
635 Ga0163163_10985242 3300014325 Bacteria 906
636 Ga0163163_12554492 3300014325 Unclassified 569
637 Ga0157380_10000955 3300014326 Bacteria 18339
638 Ga0157380_10094278 3300014326 Unclassified 2477
639 Ga0157380_10115010 3300014326 Bacteria 2268
640 Ga0157380_10195776 3300014326 Bacteria 1789
641 Ga0157380_10420825 3300014326 Unclassified 1274
642 Ga0157380_10470314 3300014326 Unclassified 1213
643 Ga0157380_10751118 3300014326 Bacteria 987
644 Ga0157380_10894643 3300014326 Unclassified 913
645 Ga0157380_11258074 3300014326 Bacteria 786
646 Ga0157380_12537020 3300014326 Bacteria 578
647 Ga0157380_12638680 3300014326 Unclassified 569
648 Ga0157380_13135733 3300014326 Unclassified 527
649 Ga0157377_10000680 3300014745 Bacteria 14060
650 Ga0157377_10006129 3300014745 Bacteria 5709
651 Ga0157377_10069521 3300014745 Bacteria 2032
652 Ga0157377_10316267 3300014745 Unclassified 1036
653 Ga0157377_11640248 3300014745 Bacteria 516
654 Ga0157377_11746041 3300014745 Unclassified 503
655 Ga0157379_10013306 3300014968 Bacteria 7205
656 Ga0157379_10031078 3300014968 Bacteria 4758
657 Ga0157379_10051382 3300014968 Unclassified 3682
658 Ga0157379_10560273 3300014968 Bacteria 1064
659 Ga0157379_10746417 3300014968 Bacteria 921
660 Ga0157379_11547958 3300014968 Bacteria 646
661 Ga0157379_11753436 3300014968 Unclassified 609
662 Ga0157376_10002174 3300014969 Bacteria 13210
663 Ga0157376_10007024 3300014969 Bacteria 7991
664 Ga0157376_10035604 3300014969 Bacteria 4028
665 Ga0157376_10156953 3300014969 Bacteria 2058
666 Ga0157376_10263235 3300014969 Bacteria 1616
667 Ga0157376_10550898 3300014969 Bacteria 1141
668 Ga0157376_10686374 3300014969 Unclassified 1028
669 Ga0157376_11019699 3300014969 Unclassified 851
670 Ga0157376_11031486 3300014969 Bacteria 846
671 Ga0157376_11476542 3300014969 Bacteria 712
672 Ga0157376_11498510 3300014969 Unclassified 707
673 Ga0182005_1000040 3300015265 Bacteria 151222
674 Ga0163161_10002032 3300017792 Bacteria 14653
675 Ga0163161_10005284 3300017792 Bacteria 8989
676 Ga0163161_10177147 3300017792 Bacteria 1633
677 Ga0163161_10836691 3300017792 Unclassified 776
678 Ga0163161_10918078 3300017792 Bacteria 743
679 Ga0163161_11109364 3300017792 Unclassified 680
680 Ga0163161_11213525 3300017792 Unclassified 653
681 Ga0209436_101017 3300025208 Bacteria 10735
682 Ga0209436_103090 3300025208 Bacteria 4585
683 Ga0209258_100075 3300025242 Bacteria 270751
684 Ga0209258_118247 3300025242 Bacteria 759
685 Ga0209646_1000025 3300025246 Bacteria 406493
686 Ga0209646_1023538 3300025246 Bacteria 873
687 Ga0209026_1000312 3300025250 Bacteria 52141
688 Ga0209148_1000085 3300025254 Bacteria 265193
689 Ga0209129_1040498 3300025258 Bacteria 740
690 Ga0209673_1000197 3300025273 Bacteria 121313
691 Ga0209130_1001772 3300025284 Bacteria 12744
692 Ga0209758_1000742 3300025297 Bacteria 47450
693 Ga0209758_1020083 3300025297 Bacteria 3181
694 Ga0209758_1037270 3300025297 Bacteria 1882
695 Ga0209050_1000204 3300025298 Bacteria 133087
696 Ga0207426_1000057 3300025302 Bacteria 369548
697 Ga0207426_1000332 3300025302 Bacteria 89192
698 Ga0207426_1001542 3300025302 Bacteria 18718
699 Ga0207426_1003820 3300025302 Bacteria 7784
700 Ga0209051_1039742 3300025303 Bacteria 1695
701 Ga0209257_1000004 3300025304 Bacteria 1678347
702 Ga0209257_1007784 3300025304 Bacteria 6356
703 Ga0207697_10020826 3300025315 Bacteria 2684
704 Ga0207697_10118976 3300025315 Unclassified 1136
705 Ga0207697_10173480 3300025315 Unclassified 944
706 Ga0207697_10357642 3300025315 Unclassified 648
707 Ga0207656_10023282 3300025321 Unclassified 2492
708 Ga0207656_10682167 3300025321 Unclassified 526
709 Ga0207682_10142181 3300025893 Bacteria 1077
710 Ga0207682_10153287 3300025893 Bacteria 1040
711 Ga0207642_10075607 3300025899 Unclassified 1618
712 Ga0207642_10128929 3300025899 Bacteria 1317
713 Ga0207642_10902622 3300025899 Bacteria 566
714 Ga0207688_10444780 3300025901 Unclassified 807
715 Ga0207680_10005285 3300025903 Bacteria 6164
716 Ga0207680_10011886 3300025903 Bacteria 4418
717 Ga0207680_10129084 3300025903 Unclassified 1664
718 Ga0207680_10207005 3300025903 Unclassified 1340
719 Ga0207680_10807016 3300025903 Bacteria 673
720 Ga0207647_10005350 3300025904 Bacteria 9434
721 Ga0207647_10087715 3300025904 Unclassified 1858
722 Ga0207647_10190289 3300025904 Bacteria 1189
723 Ga0207647_10286589 3300025904 Bacteria 939
724 Ga0207685_10107432 3300025905 Bacteria 1204
725 Ga0207685_10120795 3300025905 Bacteria 1150
726 Ga0207685_10310243 3300025905 Bacteria 783
727 Ga0207645_10008166 3300025907 Bacteria 7330
728 Ga0207645_10044413 3300025907 Bacteria 2844
729 Ga0207645_10068778 3300025907 Bacteria 2265
730 Ga0207645_10087134 3300025907 Bacteria 2006
731 Ga0207643_10005497 3300025908 Bacteria 6774
732 Ga0207643_10027531 3300025908 Bacteria 3152
733 Ga0207643_10341390 3300025908 Bacteria 939
734 Ga0207705_10004610 3300025909 Bacteria 10402
735 Ga0207705_10040871 3300025909 Unclassified 3326
736 Ga0207705_10047164 3300025909 Bacteria 3098
737 Ga0207705_10058642 3300025909 Bacteria 2777
738 Ga0207705_10078637 3300025909 Unclassified 2401
739 Ga0207705_10258498 3300025909 Bacteria 1329
740 Ga0207705_10611462 3300025909 Bacteria 847
741 Ga0207705_10940187 3300025909 Bacteria 669
742 Ga0207684_11625681 3300025910 Bacteria 522
743 Ga0207654_10121539 3300025911 Unclassified 1641
744 Ga0207654_10164170 3300025911 Bacteria 1437
745 Ga0207654_10396069 3300025911 Unclassified 959
746 Ga0207707_10213510 3300025912 Bacteria 1680
747 Ga0207707_10712946 3300025912 Bacteria 841
748 Ga0207707_11215977 3300025912 Bacteria 609
749 Ga0207695_10000568 3300025913 Bacteria 75553
750 Ga0207695_10001216 3300025913 Bacteria 44107
751 Ga0207695_10023739 3300025913 Bacteria 6920
752 Ga0207695_10145163 3300025913 Unclassified 2318
753 Ga0207695_10260665 3300025913 Unclassified 1631
754 Ga0207695_10705318 3300025913 Unclassified 890
755 Ga0207671_10002095 3300025914 Bacteria 21819
756 Ga0207671_10002783 3300025914 Bacteria 18250
757 Ga0207671_10006310 3300025914 Bacteria 10589
758 Ga0207671_10021805 3300025914 Bacteria 4853
759 Ga0207660_10009646 3300025917 Bacteria 6249
760 Ga0207660_10089701 3300025917 Bacteria 2276
761 Ga0207660_10158337 3300025917 Unclassified 1745
762 Ga0207660_10227636 3300025917 Bacteria 1465
763 Ga0207660_11194969 3300025917 Unclassified 619
764 Ga0207662_10340173 3300025918 Unclassified 1005
765 Ga0207657_10003942 3300025919 Bacteria 15761
766 Ga0207657_10021914 3300025919 Bacteria 6000
767 Ga0207657_10068979 3300025919 Bacteria 3002
768 Ga0207657_10074998 3300025919 Bacteria 2855
769 Ga0207657_10163186 3300025919 Bacteria 1809
770 Ga0207657_10282099 3300025919 Bacteria 1318
771 Ga0207657_10593794 3300025919 Bacteria 864
772 Ga0207657_10617524 3300025919 Bacteria 845
773 Ga0207657_11032653 3300025919 Bacteria 630
774 Ga0207657_11145477 3300025919 Bacteria 593
775 Ga0207649_10000604 3300025920 Bacteria 24340
776 Ga0207649_10292252 3300025920 Bacteria 1189
777 Ga0207649_10297339 3300025920 Bacteria 1179
778 Ga0207652_10001482 3300025921 Bacteria 20761
779 Ga0207652_10013784 3300025921 Bacteria 6538
780 Ga0207652_10053513 3300025921 Unclassified 3467
781 Ga0207652_10891400 3300025921 Bacteria 786
782 Ga0207646_10296134 3300025922 Unclassified 1462
783 Ga0207681_10033369 3300025923 Bacteria 3374
784 Ga0207681_10404124 3300025923 Bacteria 1104
785 Ga0207681_10766923 3300025923 Bacteria 805
786 Ga0207681_10817193 3300025923 Bacteria 779
787 Ga0207681_11320138 3300025923 Bacteria 606
788 Ga0207681_11343887 3300025923 Bacteria 600
789 Ga0207694_10208788 3300025924 Unclassified 1590
790 Ga0207694_10445343 3300025924 Unclassified 1081
791 Ga0207694_11045740 3300025924 Unclassified 691
792 Ga0207650_10002421 3300025925 Bacteria 12992
793 Ga0207650_10005929 3300025925 Bacteria 8338
794 Ga0207650_10079577 3300025925 Bacteria 2482
795 Ga0207650_10091924 3300025925 Bacteria 2320
796 Ga0207650_10105464 3300025925 Unclassified 2176
797 Ga0207650_10364216 3300025925 Unclassified 1191
798 Ga0207650_10517158 3300025925 Unclassified 999
799 Ga0207650_10899888 3300025925 Bacteria 751
800 Ga0207659_10034609 3300025926 Bacteria 3485
801 Ga0207659_10081496 3300025926 Unclassified 2393
802 Ga0207659_10135126 3300025926 Unclassified 1908
803 Ga0207659_10236649 3300025926 Bacteria 1475
804 Ga0207659_10380988 3300025926 Bacteria 1176
805 Ga0207659_10851863 3300025926 Bacteria 783
806 Ga0207659_11366723 3300025926 Unclassified 607
807 Ga0207687_10857181 3300025927 Bacteria 776
808 Ga0207664_10541691 3300025929 Bacteria 1044
809 Ga0207644_10023211 3300025931 Unclassified 4246
810 Ga0207644_10344380 3300025931 Bacteria 1209
811 Ga0207644_10483973 3300025931 Bacteria 1019
812 Ga0207644_11015997 3300025931 Bacteria 696
813 Ga0207644_11154131 3300025931 Bacteria 651
814 Ga0207690_10013425 3300025932 Bacteria 4922
815 Ga0207690_10198160 3300025932 Bacteria 1523
816 Ga0207690_11218847 3300025932 Bacteria 628
817 Ga0207690_11373773 3300025932 Bacteria 591
818 Ga0207706_10009822 3300025933 Bacteria 8779
819 Ga0207706_10012314 3300025933 Bacteria 7792
820 Ga0207706_10027858 3300025933 Bacteria 5050
821 Ga0207706_10660842 3300025933 Bacteria 895
822 Ga0207706_11107067 3300025933 Unclassified 661
823 Ga0207706_11472575 3300025933 Bacteria 556
824 Ga0207686_10011068 3300025934 Bacteria 4928
825 Ga0207686_10016489 3300025934 Bacteria 4147
826 Ga0207686_10058443 3300025934 Unclassified 2431
827 Ga0207686_10259564 3300025934 Unclassified 1273
828 Ga0207686_10279836 3300025934 Bacteria 1231
829 Ga0207686_10653817 3300025934 Bacteria 832
830 Ga0207709_10734303 3300025935 Unclassified 793
831 Ga0207670_10010649 3300025936 Bacteria 5306
832 Ga0207670_10525602 3300025936 Unclassified 964
833 Ga0207670_11675889 3300025936 Bacteria 541
834 Ga0207670_11874235 3300025936 Bacteria 510
835 Ga0207669_10105614 3300025937 Unclassified 1874
836 Ga0207669_10125710 3300025937 Bacteria 1751
837 Ga0207669_10151790 3300025937 Bacteria 1624
838 Ga0207669_10513019 3300025937 Unclassified 961
839 Ga0207669_11044645 3300025937 Bacteria 688
840 Ga0207704_10043459 3300025938 Bacteria 2654
841 Ga0207704_10052867 3300025938 Unclassified 2465
842 Ga0207704_11156642 3300025938 Unclassified 659
843 Ga0207704_11292938 3300025938 Unclassified 623
844 Ga0207691_10001933 3300025940 Bacteria 20218
845 Ga0207691_10002669 3300025940 Bacteria 17432
846 Ga0207691_10043504 3300025940 Unclassified 4139
847 Ga0207691_10186296 3300025940 Unclassified 1812
848 Ga0207691_10219346 3300025940 Bacteria 1650
849 Ga0207691_10374474 3300025940 Bacteria 1216
850 Ga0207691_10472351 3300025940 Unclassified 1066
851 Ga0207691_11603607 3300025940 Bacteria 529
852 Ga0207711_10149875 3300025941 Bacteria 2104
853 Ga0207711_10335230 3300025941 Unclassified 1399
854 Ga0207711_11661167 3300025941 Bacteria 582
855 Ga0207689_10005093 3300025942 Bacteria 11826
856 Ga0207689_10019949 3300025942 Bacteria 5645
857 Ga0207689_10023318 3300025942 Bacteria 5196
858 Ga0207689_10023524 3300025942 Bacteria 5169
859 Ga0207689_10114930 3300025942 Bacteria 2212
860 Ga0207689_10129778 3300025942 Bacteria 2074
861 Ga0207689_10361012 3300025942 Bacteria 1208
862 Ga0207689_10383673 3300025942 Unclassified 1170
863 Ga0207689_10908764 3300025942 Unclassified 743
864 Ga0207661_10000092 3300025944 Bacteria 57540
865 Ga0207661_10001341 3300025944 Bacteria 16523
866 Ga0207661_10152999 3300025944 Unclassified 1995
867 Ga0207661_10461270 3300025944 Bacteria 1158
868 Ga0207661_11752904 3300025944 Bacteria 566
869 Ga0207679_10000146 3300025945 Bacteria 58219
870 Ga0207679_10019209 3300025945 Bacteria 4589
871 Ga0207679_10080748 3300025945 Unclassified 2484
872 Ga0207679_10138949 3300025945 Bacteria 1961
873 Ga0207679_10149398 3300025945 Bacteria 1899
874 Ga0207679_10442248 3300025945 Unclassified 1151
875 Ga0207679_11711839 3300025945 Bacteria 575
876 Ga0207679_11786930 3300025945 Unclassified 562
877 Ga0207667_10000222 3300025949 Bacteria 79873
878 Ga0207667_10000246 3300025949 Bacteria 76379
879 Ga0207667_10020120 3300025949 Bacteria 7432
880 Ga0207667_10021828 3300025949 Bacteria 7086
881 Ga0207667_10024382 3300025949 Bacteria 6642
882 Ga0207667_10164834 3300025949 Bacteria 2278
883 Ga0207667_10647540 3300025949 Bacteria 1062
884 Ga0207667_10915784 3300025949 Bacteria 868
885 Ga0207667_11247751 3300025949 Bacteria 721
886 Ga0207667_11890409 3300025949 Bacteria 559
887 Ga0207651_10002602 3300025960 Bacteria 8629
888 Ga0207651_10027681 3300025960 Bacteria 3565
889 Ga0207651_10102009 3300025960 Bacteria 2131
890 Ga0207651_10137547 3300025960 Bacteria 1881
891 Ga0207651_10167771 3300025960 Bacteria 1728
892 Ga0207651_10195603 3300025960 Bacteria 1616
893 Ga0207651_10795548 3300025960 Bacteria 838
894 Ga0207651_11417867 3300025960 Bacteria 625
895 Ga0207651_11635950 3300025960 Bacteria 580
896 Ga0207712_10001299 3300025961 Bacteria 17115
897 Ga0207712_10243116 3300025961 Unclassified 1451
898 Ga0207712_10514752 3300025961 Unclassified 1025
899 Ga0207712_10661546 3300025961 Bacteria 909
900 Ga0207712_10724864 3300025961 Unclassified 869
901 Ga0207712_11258939 3300025961 Bacteria 661
902 Ga0207712_11969367 3300025961 Bacteria 523
903 Ga0207668_10006124 3300025972 Bacteria 7096
904 Ga0207668_10058112 3300025972 Unclassified 2702
905 Ga0207668_10112004 3300025972 Bacteria 2049
906 Ga0207668_10893661 3300025972 Bacteria 790
907 Ga0207668_11981636 3300025972 Unclassified 525
908 Ga0207640_10055055 3300025981 Bacteria 2604
909 Ga0207640_10101689 3300025981 Unclassified 2017
910 Ga0207640_10941562 3300025981 Bacteria 757
911 Ga0207640_11068485 3300025981 Bacteria 713
912 Ga0207640_11110265 3300025981 Bacteria 700
913 Ga0207658_10014986 3300025986 Bacteria 5316
914 Ga0207658_10214441 3300025986 Bacteria 1615
915 Ga0207658_10317173 3300025986 Unclassified 1348
916 Ga0207658_10397103 3300025986 Bacteria 1211
917 Ga0207658_10614926 3300025986 Unclassified 977
918 Ga0207658_10768646 3300025986 Bacteria 873
919 Ga0207658_10895555 3300025986 Unclassified 808
920 Ga0207658_11169226 3300025986 Unclassified 703
921 Ga0207677_10014625 3300026023 Bacteria 4590
922 Ga0207677_10022184 3300026023 Bacteria 3897
923 Ga0207677_10097215 3300026023 Unclassified 2157
924 Ga0207677_10186576 3300026023 Bacteria 1636
925 Ga0207677_11259383 3300026023 Unclassified 678
926 Ga0207677_11490246 3300026023 Bacteria 625
927 Ga0207703_10038379 3300026035 Bacteria 3821
928 Ga0207703_10179103 3300026035 Unclassified 1870
929 Ga0207703_10424273 3300026035 Unclassified 1238
930 Ga0207703_10703525 3300026035 Bacteria 961
931 Ga0207703_12299335 3300026035 Bacteria 515
932 Ga0207639_10000667 3300026041 Bacteria 23704
933 Ga0207639_10003151 3300026041 Bacteria 11090
934 Ga0207639_10008122 3300026041 Bacteria 7176
935 Ga0207639_10037712 3300026041 Bacteria 3591
936 Ga0207639_10073908 3300026041 Bacteria 2674
937 Ga0207639_10093844 3300026041 Bacteria 2408
938 Ga0207639_10147712 3300026041 Unclassified 1966
939 Ga0207639_10213729 3300026041 Bacteria 1662
940 Ga0207639_10782461 3300026041 Bacteria 888
941 Ga0207639_12178634 3300026041 Bacteria 516
942 Ga0207678_10069744 3300026067 Bacteria 3014
943 Ga0207678_11060916 3300026067 Unclassified 717
944 Ga0207708_10142100 3300026075 Bacteria 1884
945 Ga0207708_10264844 3300026075 Bacteria 1388
946 Ga0207708_10429960 3300026075 Bacteria 1096
947 Ga0207702_10069754 3300026078 Bacteria 3023
948 Ga0207702_10083782 3300026078 Unclassified 2775
949 Ga0207702_10294553 3300026078 Unclassified 1538
950 Ga0207702_10336799 3300026078 Bacteria 1440
951 Ga0207641_10005038 3300026088 Bacteria 11317
952 Ga0207641_10015563 3300026088 Bacteria 6233
953 Ga0207641_10083106 3300026088 Bacteria 2784
954 Ga0207641_10194694 3300026088 Unclassified 1865
955 Ga0207641_10231764 3300026088 Unclassified 1716
956 Ga0207641_10788839 3300026088 Bacteria 939
957 Ga0207641_11471425 3300026088 Bacteria 683
958 Ga0207641_12160616 3300026088 Unclassified 557
959 Ga0207648_10003359 3300026089 Bacteria 16814
960 Ga0207648_10004904 3300026089 Bacteria 13626
961 Ga0207648_10030385 3300026089 Unclassified 4785
962 Ga0207648_10042733 3300026089 Bacteria 3979
963 Ga0207648_10043963 3300026089 Unclassified 3920
964 Ga0207648_10076983 3300026089 Bacteria 2908
965 Ga0207648_10497658 3300026089 Unclassified 1115
966 Ga0207648_10701641 3300026089 Unclassified 938
967 Ga0207648_11183945 3300026089 Bacteria 718
968 Ga0207648_11254539 3300026089 Bacteria 696
969 Ga0207648_11308898 3300026089 Bacteria 681
970 Ga0207648_11406472 3300026089 Unclassified 656
971 Ga0207648_12247336 3300026089 Bacteria 506
972 Ga0207676_10036051 3300026095 Bacteria 3760
973 Ga0207676_10187967 3300026095 Unclassified 1815
974 Ga0207676_10262299 3300026095 Bacteria 1561
975 Ga0207676_10440460 3300026095 Unclassified 1226
976 Ga0207676_10542683 3300026095 Bacteria 1110
977 Ga0207676_10961638 3300026095 Unclassified 840
978 Ga0207676_11116736 3300026095 Unclassified 780
979 Ga0207674_10002078 3300026116 Bacteria 25384
980 Ga0207674_10005421 3300026116 Bacteria 15162
981 Ga0207674_10005422 3300026116 Bacteria 15160
982 Ga0207674_10035180 3300026116 Bacteria 5228
983 Ga0207674_10062081 3300026116 Bacteria 3774
984 Ga0207674_10070058 3300026116 Bacteria 3526
985 Ga0207674_10101422 3300026116 Bacteria 2859
986 Ga0207674_10116690 3300026116 Bacteria 2640
987 Ga0207674_10719347 3300026116 Bacteria 964
988 Ga0207675_100001355 3300026118 Bacteria 24522
989 Ga0207675_100002256 3300026118 Bacteria 19155
990 Ga0207675_100013142 3300026118 Bacteria 7726
991 Ga0207675_100121228 3300026118 Unclassified 2474
992 Ga0207675_100389884 3300026118 Unclassified 1371
993 Ga0207675_100393048 3300026118 Bacteria 1365
994 Ga0207675_101727901 3300026118 Bacteria 645
995 Ga0207675_102217728 3300026118 Bacteria 564
996 Ga0207675_102423822 3300026118 Unclassified 537
997 Ga0207683_10011412 3300026121 Bacteria 7581
998 Ga0207683_10292863 3300026121 Unclassified 1488
999 Ga0207683_10381191 3300026121 Bacteria 1296
1000 Ga0207698_10011730 3300026142 Bacteria 5695
1001 Ga0207698_10047492 3300026142 Bacteria 3253
1002 Ga0207698_10058369 3300026142 Bacteria 2990
1003 Ga0207698_10077766 3300026142 Unclassified 2661
1004 Ga0207698_10100063 3300026142 Unclassified 2400
1005 Ga0207698_10317547 3300026142 Unclassified 1457
1006 Ga0207698_10332725 3300026142 Unclassified 1427
1007 Ga0207698_10562679 3300026142 Bacteria 1119
1008 Ga0207698_10600608 3300026142 Bacteria 1085
1009 Ga0207698_10710915 3300026142 Bacteria 1001
1010 Ga0207698_11106263 3300026142 Bacteria 805
1011 Ga0207698_11595902 3300026142 Bacteria 668
1012 Ga0209968_1065681 3300027526 Bacteria 643
1013 Ga0209970_1122154 3300027614 Unclassified 504
1014 Ga0210002_1040614 3300027617 Bacteria 790
1015 Ga0209971_1191907 3300027682 Bacteria 503
1016 Ga0209974_10073162 3300027876 Bacteria 1171
1017 Ga0207428_10398532 3300027907 Unclassified 1008
1018 Ga0207428_10917966 3300027907 Bacteria 618
1019 Ga0268266_10004126 3300028379 Bacteria 14038
1020 Ga0268265_10106667 3300028380 Bacteria 2276
1021 Ga0268265_10212556 3300028380 Bacteria 1686
1022 Ga0268265_10264384 3300028380 Unclassified 1531
1023 Ga0268265_10378264 3300028380 Unclassified 1302
1024 Ga0268265_10468515 3300028380 Unclassified 1180
1025 Ga0268265_10506190 3300028380 Unclassified 1139
1026 Ga0268265_10661564 3300028380 Bacteria 1005
1027 Ga0268265_10714630 3300028380 Bacteria 969
1028 Ga0268265_12230135 3300028380 Bacteria 555
1029 Ga0268264_10000011 3300028381 Bacteria 580884
1030 Ga0268264_10006311 3300028381 Bacteria 9997
1031 Ga0268264_10011319 3300028381 Bacteria 7369
1032 Ga0268264_10058105 3300028381 Bacteria 3238
1033 Ga0268264_10180193 3300028381 Bacteria 1918
1034 Ga0268264_10216451 3300028381 Unclassified 1761
1035 Ga0268264_10231903 3300028381 Unclassified 1705
1036 Ga0268264_10544989 3300028381 Bacteria 1137
1037 Ga0268264_11327856 3300028381 Unclassified 729
1038 Ga0268264_12214651 3300028381 Unclassified 557
1039 Ga0307515_10646695 3300028794 Unclassified 670
1040 Ga0307515_10783553 3300028794 Bacteria 575
1041 Ga0265327_10000054 3300031251 Bacteria 250337
1042 Ga0307513_10063300 3300031456 Bacteria 3904
1043 Ga0307513_10289372 3300031456 Unclassified 1411
1044 Ga0307513_10554208 3300031456 Bacteria 862
1045 Ga0307509_10060495 3300031507 Bacteria 4003
1046 Ga0307509_10351506 3300031507 Bacteria 1197
1047 Ga0307408_100038537 3300031548 Bacteria 3373
1048 Ga0307508_10001362 3300031616 Bacteria 27521
1049 Ga0307508_10137888 3300031616 Bacteria 2043
1050 Ga0307516_10707148 3300031730 Bacteria 665
1051 Ga0307413_10116477 3300031824 Bacteria 1800
1052 Ga0307518_10442778 3300031838 Unclassified 700
1053 Ga0307410_10030785 3300031852 Bacteria 3434
1054 Ga0307410_10467619 3300031852 Bacteria 1032
1055 Ga0307406_10064617 3300031901 Unclassified 2376
1056 Ga0307406_10321385 3300031901 Bacteria 1197
1057 Ga0307406_10871991 3300031901 Unclassified 764
1058 Ga0307406_10902915 3300031901 Bacteria 752
1059 Ga0307407_10123592 3300031903 Unclassified 1645
1060 Ga0307407_11624652 3300031903 Unclassified 513
1061 Ga0307409_100246560 3300031995 Bacteria 1630
1062 Ga0307416_100093911 3300032002 Bacteria 2585
1063 Ga0307416_101008761 3300032002 Unclassified 935
1064 Ga0307416_101251816 3300032002 Bacteria 848
1065 Ga0307414_10215357 3300032004 Bacteria 1573
1066 Ga0307411_10058568 3300032005 Bacteria 2550
1067 Ga0307411_10685249 3300032005 Bacteria 891
1068 Ga0307415_100081356 3300032126 Bacteria 2313
1069 Ga0307415_101677341 3300032126 Unclassified 612
1070 Ga0307510_10008932 3300033180 Bacteria 11935
1071 Ga0307510_10472157 3300033180 Bacteria 696
1072 Ga0373926_0199553 3300035083 Unclassified 770
1073 Ga0373934_0113565 3300035086 Bacteria 1100
1074 Ga0373932_0233507 3300035112 Bacteria 665
1075 Ga0373953_0359902 3300035117 Bacteria 638
1076 Ga0373943_0701182 3300035170 Bacteria 600
1077 Ga0373927_0625674 3300035695 Bacteria 711
1078 Ga0373947_0092217 3300035725 Bacteria 1891
1079 Ga0373937_0524033 3300036401 Unclassified 1126
1080 Ga0373937_1682663 3300036401 Bacteria 581
1081 Ga0373925_0604446 3300037068 Bacteria 903
1082 Ga0395899_0009188 3300037312 Bacteria 7589
1083 Ga0395899_0017005 3300037312 Bacteria 5542
1084 Ga0395899_0187985 3300037312 Bacteria 1446
1085 Ga0395899_0303192 3300037312 Bacteria 1080
1086 Ga0395899_0389418 3300037312 Bacteria 924
1087 Ga0395900_0111932 3300037418 Unclassified 2803
1088 Ga0395900_0139848 3300037418 Bacteria 2480
1089 Ga0395900_0156477 3300037418 Bacteria 2327
1090 Ga0395900_0259663 3300037418 Bacteria 1735
1091 Ga0395900_0475549 3300037418 Bacteria 1202
1092 Ga0395898_0031201 3300037466 Bacteria 5327
1093 Ga0395898_0072494 3300037466 Bacteria 3327
1094 Ga0395898_0121784 3300037466 Bacteria 2499
1095 Ga0395898_0436478 3300037466 Bacteria 1247
1096 Ga0395898_0790483 3300037466 Bacteria 889
1097 Ga0395905_0015405 3300037471 Bacteria 7267
1098 Ga0395905_1201189 3300037471 Bacteria 662
1099 Ga0395905_1246396 3300037471 Bacteria 647
1100 Ga0395901_0011427 3300038443 Bacteria 8994
1101 Ga0395901_0090659 3300038443 Bacteria 3199
1102 Ga0395901_0318172 3300038443 Bacteria 1610
1103 Ga0395901_0960966 3300038443 Bacteria 832
1104 Ga0395901_1310136 3300038443 Unclassified 686
1105 Ga0439436_0043744 3300041404 Bacteria 1277
1106 Ga0439453_0084986 3300041408 Bacteria 687
1107 Ga0439465_0025746 3300041413 Bacteria 1858
1108 Ga0451789_0028015 3300041443 Bacteria 701
1109 Ga0451789_1329307 3300041443 Unclassified 1664
1110 Ga0451791_1712160 3300041451 Bacteria 955
1111 Ga0451793_1160112 3300041452 Unclassified 562
1112 Ga0451793_1897698 3300041452 Bacteria 695
1113 Ga0451797_0660066 3300041453 Bacteria 580
1114 Ga0451798_1113716 3300041458 Unclassified 600
1115 Ga0451802_1455935 3300041460 Bacteria 994
1116 Ga0451804_1150222 3300041463 Bacteria 755
1117 Ga0451807_1268939 3300041486 Unclassified 645
1118 Ga0451807_2475336 3300041486 Unclassified 508
1119 Ga0451807_2595595 3300041486 Unclassified 1351
1120 Ga0451833_1283552 3300041491 Bacteria 608
1121 Ga0451835_1139044 3300041492 Bacteria 646
1122 Ga0451841_0560704 3300041498 Bacteria 1056
1123 Ga0451849_0397476 3300041505 Bacteria 1311
1124 Ga0451843_1127470 3300041509 Bacteria 517
1125 Ga0451853_0400010 3300041512 Bacteria 639
1126 Ga0451853_0968399 3300041512 Bacteria 681
1127 Ga0439431_0056863 3300041997 Bacteria 1023
1128 Ga0439441_051664 3300042001 Unclassified 848
1129 Ga0439443_024232 3300042003 Bacteria 972
1130 Ga0439445_0066018 3300042004 Bacteria 996
1131 Ga0439445_0084580 3300042004 Bacteria 889
1132 Ga0439445_0175078 3300042004 Bacteria 629
1133 Ga0439448_0318782 3300042005 Bacteria 553
1134 Ga0439449_0068737 3300042007 Bacteria 1306
1135 Ga0439449_0368677 3300042007 Bacteria 544
1136 Ga0439451_137251 3300042009 Bacteria 500
1137 Ga0439457_018068 3300042014 Bacteria 1565
1138 Ga0439444_0126340 3300042437 Unclassified 601
1139 Ga0450916_085541 3300042530 Bacteria 543
1140 Ga0450893_0133841 3300042532 Bacteria 525
1141 Ga0451577_0448381 3300042876 Bacteria 1172
1142 Ga0466969_0000235 3300044656 Bacteria 30219
1143 Ga0466969_0065404 3300044656 Unclassified 1758
1144 Ga0466969_0086440 3300044656 Bacteria 1490
1145 Ga0466972_0001764 3300044658 Bacteria 10604
1146 Ga0466972_0055927 3300044658 Bacteria 1897
1147 Ga0466972_0109777 3300044658 Bacteria 1304
1148 Ga0466978_0544714 3300044671 Bacteria 585
1149 Ga0453683_0978158 3300044673 Bacteria 561
1150 Ga0466965_0153395 3300044683 Bacteria 1205
1151 Ga0466966_0000280 3300044684 Bacteria 33412
1152 Ga0466961_0120437 3300044693 Bacteria 1648
1153 Ga0466964_0111636 3300044706 Bacteria 1220
1154 Ga0453684_0032184 3300044712 Bacteria 7348
1155 Ga0453684_0194318 3300044712 Bacteria 2371
1156 Ga0453684_2163864 3300044712 Bacteria 556
1157 Ga0466971_0372563 3300044719 Bacteria 693
1158 Ga0466970_0536490 3300044765 Bacteria 675
1159 Ga0466957_0001155 3300044842 Bacteria 13662
1160 Ga0466957_0438989 3300044842 Bacteria 898
1161 Ga0466957_0791592 3300044842 Bacteria 673
1162 Ga0466957_0976959 3300044842 Bacteria 607
1163 Ga0466960_0139711 3300044901 Bacteria 1286
1164 Ga0466960_0143734 3300044901 Unclassified 1269
1165 Ga0466959_0000015 3300045049 Bacteria 149242
1166 Ga0466959_0105693 3300045049 Unclassified 2013
1167 Ga0451576_2617267 3300045051 Bacteria 514
1168 Ga0466967_1587308 3300045976 Bacteria 652
1169 Ga0495627_016980 3300046453 Bacteria 2483
1170 Ga0495592_0290004 3300046454 Bacteria 1067
1171 Ga0495603_0205907 3300046455 Bacteria 1137
1172 Ga0495638_0030292 3300046460 Bacteria 3485
1173 Ga0495638_0352633 3300046460 Bacteria 777
1174 Ga0495653_0151951 3300046463 Bacteria 1617
1175 Ga0495650_0099742 3300046471 Unclassified 1092
1176 Ga0495580_0712916 3300046472 Bacteria 656
1177 Ga0495594_0464886 3300046499 Bacteria 719
1178 Ga0495606_0011729 3300046507 Bacteria 7112
1179 Ga0495608_0826026 3300046511 Bacteria 546
1180 Ga0495618_0115589 3300046514 Unclassified 1718
1181 Ga0495632_0112362 3300046519 Bacteria 1278
1182 Ga0495632_0415810 3300046519 Bacteria 586
1183 Ga0495643_0016526 3300046522 Bacteria 4335
1184 Ga0495648_0013272 3300046524 Bacteria 6102
1185 Ga0495648_0262033 3300046524 Bacteria 829
1186 Ga0495586_0045963 3300046535 Unclassified 2354
1187 Ga0495587_0020446 3300046536 Unclassified 4087
1188 Ga0495609_0122795 3300046538 Bacteria 1116
1189 Ga0495621_0020971 3300046539 Bacteria 2150
1190 Ga0495621_0296441 3300046539 Bacteria 669
1191 Ga0495633_0000017 3300046558 Bacteria 249973
1192 Ga0495667_0723166 3300046559 Bacteria 616
1193 Ga0495668_0012757 3300046616 Bacteria 4976
1194 Ga0495611_0000021 3300046648 Bacteria 123657
1195 Ga0495611_0088697 3300046648 Unclassified 1428
1196 Ga0495611_0240602 3300046648 Bacteria 840
1197 Ga0495625_0255807 3300046660 Bacteria 1135
1198 Ga0495625_0281155 3300046660 Unclassified 1071
1199 Ga0495625_0671050 3300046660 Unclassified 615
1200 Ga0495657_0064332 3300046675 Unclassified 2417
1201 Ga0495623_0720398 3300046679 Bacteria 510
1202 Ga0495624_0566236 3300046690 Bacteria 678
1203 Ga0495604_0486895 3300047317 Bacteria 802
1204 Ga0495604_1054134 3300047317 Unclassified 501
1205 Ga0495636_0509208 3300047318 Bacteria 583
1206 Ga0495672_0022271 3300047320 Bacteria 4122
1207 Ga0495672_0032365 3300047320 Bacteria 3254
1208 Ga0495672_0297014 3300047320 Bacteria 766
1209 Ga0495676_0774134 3300047321 Bacteria 619
1210 Ga0495687_000001 3300047443 Bacteria 1215582
1211 Ga0495687_152451 3300047443 Bacteria 788
1212 Ga0496100_0607889 3300048903 Unclassified 849
1213 Ga0496101_0051422 3300048904 Unclassified 2969
1214 Ga0496101_0868937 3300048904 Bacteria 710
1215 Ga0496104_0708629 3300048907 Unclassified 914
1216 Ga0496104_1616706 3300048907 Bacteria 551
1217 Ga0496106_0475339 3300048909 Unclassified 1004
1218 Ga0496106_1051563 3300048909 Unclassified 639
1219 Ga0496107_0201612 3300048910 Unclassified 1479
1220 Ga0496107_0453325 3300048910 Bacteria 953
1221 Ga0496108_0152255 3300048911 Unclassified 1996
1222 Ga0496109_0101587 3300048912 Unclassified 2669
1223 Ga0496110_0663368 3300048913 Unclassified 943
1224 Ga0496110_0870963 3300048913 Bacteria 806
1225 Ga0496113_1244683 3300048916 Unclassified 580
1226 Ga0496114_0855669 3300048917 Unclassified 790
1227 Ga0496115_1417800 3300048918 Unclassified 512
1228 Ga0496121_0000010 3300048924 Bacteria 793488
1229 Ga0496121_0909951 3300048924 Bacteria 505
1230 Ga0496125_0295096 3300048928 Bacteria 996
1231 Ga0496126_0127526 3300048929 Bacteria 2201
1232 Ga0501031_0091768 3300049568 Bacteria 1981
1233 Ga0501032_0734083 3300049569 Bacteria 625
1234 Ga0501033_0245184 3300049570 Bacteria 1271
1235 Ga0501033_0331835 3300049570 Bacteria 1067
1236 Ga0501033_0656424 3300049570 Bacteria 716
1237 Ga0501033_1135677 3300049570 Bacteria 519
1238 Ga0501034_0025021 3300049571 Bacteria 6074
1239 Ga0501034_0057903 3300049571 Bacteria 3896
1240 Ga0501034_0083010 3300049571 Bacteria 3206
1241 Ga0501034_0126766 3300049571 Bacteria 2537
1242 Ga0501034_0153853 3300049571 Bacteria 2275
1243 Ga0501034_0265313 3300049571 Bacteria 1659
1244 Ga0501034_0337833 3300049571 Bacteria 1437
1245 Ga0501036_0180174 3300049572 Bacteria 1779
1246 Ga0501036_1186041 3300049572 Unclassified 622
1247 Ga0501037_0125473 3300049573 Unclassified 1843
1248 Ga0501037_0294920 3300049573 Bacteria 1127
1249 Ga0501037_0708837 3300049573 Unclassified 669
1250 Ga0501038_0017298 3300049574 Bacteria 6517
1251 Ga0501038_0024630 3300049574 Bacteria 5366
1252 Ga0501038_0469715 3300049574 Bacteria 965
1253 Ga0501039_0037675 3300049575 Bacteria 3733
1254 Ga0501039_0217942 3300049575 Unclassified 1501
1255 Ga0501043_0017442 3300049579 Bacteria 5627
1256 Ga0501043_0032312 3300049579 Bacteria 4114
1257 Ga0501043_0347861 3300049579 Bacteria 1127
1258 Ga0501046_0048287 3300049580 Bacteria 3372
1259 Ga0501047_0011096 3300049581 Bacteria 8528
1260 Ga0501047_0021076 3300049581 Bacteria 6258
1261 Ga0501047_0400875 3300049581 Bacteria 1205
1262 Ga0501047_0410855 3300049581 Bacteria 1186
1263 Ga0501047_0445493 3300049581 Bacteria 1124
1264 Ga0501047_0512270 3300049581 Bacteria 1026
1265 Ga0501047_0865609 3300049581 Bacteria 717
1266 Ga0501048_0145226 3300049582 Bacteria 1678
1267 Ga0501068_1003418 3300049584 Unclassified 551
1268 Ga0501070_0313642 3300049586 Bacteria 1276
1269 Ga0501070_1013064 3300049586 Unclassified 644
1270 Ga0501072_1156451 3300049588 Bacteria 601
1271 Ga0501073_0110828 3300049589 Bacteria 1904
1272 Ga0501198_014607 3300049649 Bacteria 1198
1273 Ga0501199_007699 3300049650 Unclassified 1116
1274 Ga0501201_003567 3300049651 Bacteria 1432
1275 Ga0501202_003604 3300049652 Bacteria 2664
1276 Ga0501206_022361 3300049653 Unclassified 907
1277 Ga0501207_006177 3300049654 Bacteria 1675
1278 Ga0501216_006858 3300049660 Bacteria 1758
1279 Ga0501217_024187 3300049661 Bacteria 1451
1280 Ga0501223_022442 3300049663 Bacteria 1233
1281 Ga0501224_003267 3300049664 Bacteria 2257
1282 Ga0501227_042388 3300049665 Unclassified 1128
1283 Ga0501233_238348 3300049668 Unclassified 543
1284 Ga0501235_004505 3300049669 Bacteria 3010
1285 Ga0501238_038078 3300049671 Bacteria 704
1286 Ga0501242_028661 3300049674 Unclassified 744
1287 Ga0501243_004321 3300049675 Bacteria 2129
1288 Ga0501249_213385 3300049679 Bacteria 511
1289 Ga0501251_038662 3300049681 Unclassified 713
1290 Ga0501252_009640 3300049682 Bacteria 1129
1291 Ga0501255_009224 3300049684 Bacteria 1089
1292 Ga0501257_128457 3300049686 Bacteria 684
1293 Ga0501259_101707 3300049688 Bacteria 660
1294 Ga0501259_143064 3300049688 Unclassified 587
1295 Ga0501261_028897 3300049690 Unclassified 831
1296 Ga0501221_044109 3300049704 Unclassified 983
1297 Ga0501225_0011878 3300049705 Bacteria 2450
1298 Ga0501234_022465 3300049707 Unclassified 1007
1299 Ga0501245_016785 3300049708 Unclassified 1113
1300 Ga0501080_0644282 3300049742 Bacteria 938
1301 Ga0501080_1807239 3300049742 Unclassified 513
1302 Ga0501083_0069451 3300049744 Unclassified 2344
1303 Ga0501083_0242345 3300049744 Bacteria 1174
1304 Ga0501266_002586 3300049763 Unclassified 2274
1305 Ga0501272_035354 3300049769 Unclassified 649
1306 Ga0501276_001576 3300049773 Bacteria 1554
1307 Ga0501279_006140 3300049775 Bacteria 1586
1308 Ga0501280_025068 3300049776 Bacteria 908
1309 Ga0501280_065303 3300049776 Bacteria 641
1310 Ga0501282_024731 3300049778 Unclassified 670
1311 Ga0501035_0024751 3300049822 Bacteria 5503
1312 Ga0501035_0160804 3300049822 Bacteria 1944
1313 Ga0501035_0451212 3300049822 Bacteria 1064
1314 Ga0501035_0469385 3300049822 Bacteria 1039
1315 Ga0501035_0532507 3300049822 Bacteria 964
1316 Ga0501035_0565224 3300049822 Bacteria 930
1317 Ga0501044_0030285 3300049823 Bacteria 5705
1318 Ga0501044_0078463 3300049823 Bacteria 3346
1319 Ga0501044_0217087 3300049823 Bacteria 1864
1320 Ga0501044_0241441 3300049823 Bacteria 1750
1321 Ga0501044_0398994 3300049823 Bacteria 1288
1322 Ga0501044_0434784 3300049823 Bacteria 1221
1323 Ga0501044_1544675 3300049823 Bacteria 529
1324 Ga0501200_05772 3300049849 Unclassified 597
1325 Ga0501284_01154 3300050005 Bacteria 1383
1326 nmdc:mga0k408_26435_c1 3300050493 Bacteria 3290
1327 nmdc:mga0k408_31349_c1 3300050493 Bacteria 3035
1328 nmdc:mga0k408_35150_c1 3300050493 Bacteria 2873
1329 nmdc:mga0k408_409679_c1 3300050493 Bacteria 806
1330 nmdc:mga0k408_582779_c1 3300050493 Bacteria 660
1331 nmdc:mga0k408_798772_c1 3300050493 Bacteria 550
1332 nmdc:mga05p37_1231339_c1 3300050507 Bacteria 770
1333 nmdc:mga05p37_3235_c1 3300050507 Bacteria 18970
1334 nmdc:mga05p37_841675_c1 3300050507 Bacteria 998
1335 nmdc:mga09592_1546_c1 3300050508 Bacteria 18488
1336 nmdc:mga09592_321074_c1 3300050508 Bacteria 1341
1337 nmdc:mga09592_75829_c1 3300050508 Bacteria 2860
1338 nmdc:mga0qj67_153861_c1 3300050509 Unclassified 1866
1339 nmdc:mga0qj67_48198_c1 3300050509 Bacteria 3366
1340 nmdc:mga0qj67_653831_c1 3300050509 Bacteria 838
1341 nmdc:mga06r32_225327_c1 3300050510 Unclassified 1863
1342 nmdc:mga06r32_4303_c1 3300050510 Bacteria 12745
1343 nmdc:mga06r32_497226_c1 3300050510 Bacteria 1197
1344 nmdc:mga08y16_2006363_c1 3300050511 Bacteria 528
1345 nmdc:mga08y16_26379_c1 3300050511 Bacteria 6126
1346 nmdc:mga08y16_401679_c1 3300050511 Bacteria 1402
1347 nmdc:mga08y16_450759_c1 3300050511 Bacteria 1312
1348 nmdc:mga08y16_622828_c1 3300050511 Bacteria 1086
1349 nmdc:mga08y16_638753_c1 3300050511 Unclassified 1070
1350 nmdc:mga0n895_1007371_c1 3300050512 Unclassified 814
1351 nmdc:mga0n895_992540_c1 3300050512 Unclassified 821
1352 nmdc:mga0rr50_813319_c1 3300050513 Unclassified 797
1353 Ga0500644_0000233 3300053088 Bacteria 31422
1354 Ga0500646_0007401 3300053090 Bacteria 2805
1355 Ga0500646_0163812 3300053090 Unclassified 744
1356 Ga0500646_0290563 3300053090 Unclassified 584
1357 Ga0500583_0000224 3300053092 Bacteria 20897
1358 Ga0500583_0036287 3300053092 Bacteria 2206
1359 Ga0500583_0068941 3300053092 Bacteria 1688
1360 Ga0500583_0078304 3300053092 Bacteria 1593
1361 Ga0500651_0050349 3300053093 Bacteria 2615
1362 Ga0500651_0528375 3300053093 Unclassified 648
1363 Ga0500566_0213081 3300053094 Bacteria 966
1364 Ga0500641_0344789 3300053096 Unclassified 600
1365 Ga0500660_088515 3300053100 Bacteria 1392
1366 Ga0500553_219187 3300053101 Bacteria 623
1367 Ga0500556_0121013 3300053104 Bacteria 1021
1368 Ga0500562_136297 3300053108 Unclassified 669
1369 Ga0500569_001814 3300053109 Bacteria 4096
1370 Ga0500594_0063931 3300053118 Bacteria 1067
1371 Ga0500594_0063962 3300053118 Bacteria 1067
1372 Ga0500607_065776 3300053121 Bacteria 1883
1373 Ga0500621_200998 3300053126 Bacteria 706
1374 Ga0500621_206911 3300053126 Unclassified 690
1375 Ga0500628_131419 3300053129 Bacteria 687
1376 Ga0500628_167897 3300053129 Bacteria 621
1377 Ga0500642_0095309 3300053130 Bacteria 1379
1378 Ga0500652_019542 3300053131 Bacteria 2519
1379 Ga0500652_033710 3300053131 Bacteria 2025
1380 Ga0500655_064269 3300053133 Bacteria 742
1381 Ga0500658_0001405 3300053134 Bacteria 9705
1382 Ga0500658_0147556 3300053134 Bacteria 1059
1383 Ga0500559_0005888 3300053136 Bacteria 5586
1384 Ga0500559_0138277 3300053136 Bacteria 1140
1385 Ga0500559_0414681 3300053136 Unclassified 625
1386 Ga0500568_0000593 3300053139 Bacteria 26321
1387 Ga0500568_0050331 3300053139 Unclassified 1642
1388 Ga0500577_0000924 3300053142 Bacteria 7613
1389 Ga0500588_0039894 3300053146 Unclassified 1408
1390 Ga0500588_0297885 3300053146 Bacteria 610
1391 Ga0500589_064108 3300053147 Bacteria 1678
1392 Ga0500589_074095 3300053147 Bacteria 1534
1393 Ga0500590_016384 3300053148 Bacteria 3832
1394 Ga0500603_022140 3300053150 Bacteria 1571
1395 Ga0500604_0047037 3300053151 Bacteria 1321
1396 Ga0500616_0050612 3300053153 Bacteria 2193
1397 Ga0500616_0149002 3300053153 Bacteria 1085
1398 Ga0500616_0438073 3300053153 Bacteria 516
1399 Ga0500619_090429 3300053154 Bacteria 1034
1400 Ga0500622_0000319 3300053156 Bacteria 48315
1401 Ga0500622_0002252 3300053156 Bacteria 14190
1402 Ga0500633_0051002 3300053160 Bacteria 1427
1403 Ga0500634_0369540 3300053161 Bacteria 540
1404 Ga0500636_0049874 3300053177 Bacteria 2462
1405 Ga0500636_0145843 3300053177 Bacteria 1305
1406 Ga0500637_0252674 3300053178 Bacteria 983
1407 Ga0500611_000061 3300053727 Bacteria 45387
1408 Ga0500645_028526 3300053730 Bacteria 1689
1409 Ga0500587_007289 3300053739 Bacteria 1444
1410 Ga0500661_027845 3300055283 Bacteria 998
1411 Ga0500661_058724 3300055283 Bacteria 693
1412 Ga0466962_0242986 3300061719 Bacteria 884
1413 Ga0466962_0518041 3300061719 Bacteria 604

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0448381 Ga0451577_0448381_584_796 70
2 3300003320 rootH2_10004858 rootH2_1000485816 72
3 3300003320 rootH2_10052963 rootH2_1005296311 72
4 3300005290 Ga0065712_10228029 Ga0065712_102280292 72
5 3300005327 Ga0070658_11009185 Ga0070658_110091852 72
6 3300005329 Ga0070683_100008631 Ga0070683_1000086315 72
7 3300005331 Ga0070670_100026030 Ga0070670_1000260304 72
8 3300005331 Ga0070670_100600439 Ga0070670_1006004392 72
9 3300005337 Ga0070682_100789324 Ga0070682_1007893241 72
10 3300005338 Ga0068868_100359284 Ga0068868_1003592842 72
11 3300005344 Ga0070661_100236064 Ga0070661_1002360641 72
12 3300005355 Ga0070671_100082299 Ga0070671_1000822994 72
13 3300005355 Ga0070671_100238866 Ga0070671_1002388663 72
14 3300005356 Ga0070674_100898512 Ga0070674_1008985122 72
15 3300005364 Ga0070673_100239452 Ga0070673_1002394522 72
16 3300005367 Ga0070667_100880056 Ga0070667_1008800562 72
17 3300005459 Ga0068867_100091339 Ga0068867_1000913392 72
18 3300005535 Ga0070684_100010110 Ga0070684_1000101104 72
19 3300005539 Ga0068853_100000276 Ga0068853_1000002762 72
20 3300005539 Ga0068853_100169597 Ga0068853_1001695972 72
21 3300005543 Ga0070672_101093836 Ga0070672_1010938362 72
22 3300005543 Ga0070672_101152830 Ga0070672_1011528302 72
23 3300005564 Ga0070664_100030956 Ga0070664_1000309563 72
24 3300005564 Ga0070664_100112355 Ga0070664_1001123552 72
25 3300005564 Ga0070664_100897438 Ga0070664_1008974382 72
26 3300005577 Ga0068857_100259580 Ga0068857_1002595803 72
27 3300005578 Ga0068854_100039596 Ga0068854_1000395962 72
28 3300005578 Ga0068854_100474399 Ga0068854_1004743991 72
29 3300005616 Ga0068852_100786514 Ga0068852_1007865142 72
30 3300005616 Ga0068852_102030748 Ga0068852_1020307482 72
31 3300005616 Ga0068852_102518002 Ga0068852_1025180022 72
32 3300005618 Ga0068864_101028180 Ga0068864_1010281802 72
33 3300005834 Ga0068851_10050995 Ga0068851_100509953 72
34 3300005842 Ga0068858_102500870 Ga0068858_1025008701 72
35 3300005843 Ga0068860_100750878 Ga0068860_1007508782 72
36 3300006237 Ga0097621_100596043 Ga0097621_1005960432 72
37 3300014969 Ga0157376_10686374 Ga0157376_106863742 72
38 3300025315 Ga0207697_10173480 Ga0207697_101734802 72
39 3300025903 Ga0207680_10129084 Ga0207680_101290842 72
40 3300025904 Ga0207647_10190289 Ga0207647_101902892 72
41 3300025907 Ga0207645_10087134 Ga0207645_100871343 72
42 3300025909 Ga0207705_10611462 Ga0207705_106114621 72
43 3300025913 Ga0207695_10705318 Ga0207695_107053182 72
44 3300025914 Ga0207671_10002783 Ga0207671_100027834 72
45 3300025914 Ga0207671_10021805 Ga0207671_100218054 72
46 3300025919 Ga0207657_10163186 Ga0207657_101631861 72
47 3300025920 Ga0207649_10297339 Ga0207649_102973392 72
48 3300025924 Ga0207694_11045740 Ga0207694_110457401 72
49 3300025925 Ga0207650_10002421 Ga0207650_100024214 72
50 3300025925 Ga0207650_10517158 Ga0207650_105171582 72
51 3300025926 Ga0207659_10236649 Ga0207659_102366491 72
52 3300025926 Ga0207659_11366723 Ga0207659_113667232 72
53 3300025931 Ga0207644_10344380 Ga0207644_103443802 72
54 3300025933 Ga0207706_10009822 Ga0207706_100098222 72
55 3300025933 Ga0207706_10660842 Ga0207706_106608421 72
56 3300025935 Ga0207709_10734303 Ga0207709_107343032 72
57 3300025940 Ga0207691_10472351 Ga0207691_104723512 72
58 3300025942 Ga0207689_10908764 Ga0207689_109087642 72
59 3300025944 Ga0207661_10152999 Ga0207661_101529992 72
60 3300025945 Ga0207679_10019209 Ga0207679_100192095 72
61 3300025945 Ga0207679_10080748 Ga0207679_100807484 72
62 3300025945 Ga0207679_11786930 Ga0207679_117869301 72
63 3300025949 Ga0207667_10021828 Ga0207667_100218284 72
64 3300025960 Ga0207651_11417867 Ga0207651_114178672 72
65 3300025961 Ga0207712_11969367 Ga0207712_119693672 72
66 3300025981 Ga0207640_10941562 Ga0207640_109415623 72
67 3300025986 Ga0207658_10614926 Ga0207658_106149262 72
68 3300025986 Ga0207658_10768646 Ga0207658_107686462 72
69 3300026023 Ga0207677_10097215 Ga0207677_100972153 72
70 3300026035 Ga0207703_10703525 Ga0207703_107035252 72
71 3300026041 Ga0207639_10003151 Ga0207639_100031518 72
72 3300026095 Ga0207676_10542683 Ga0207676_105426832 72
73 3300026116 Ga0207674_10005421 Ga0207674_1000542111 72
74 3300026116 Ga0207674_10062081 Ga0207674_100620814 72
75 3300026142 Ga0207698_10011730 Ga0207698_100117302 72
76 3300026142 Ga0207698_10058369 Ga0207698_100583693 72
77 3300026142 Ga0207698_10562679 Ga0207698_105626792 72
78 3300026142 Ga0207698_10600608 Ga0207698_106006082 72
79 3300027907 Ga0207428_10398532 Ga0207428_103985322 72
80 3300041408 Ga0439453_0084986 Ga0439453_0084986_454_672 72
81 3300041492 Ga0451835_1139044 Ga0451835_1139044_367_585 72
82 3300046679 Ga0495623_0720398 Ga0495623_0720398_281_499 72
83 3300047317 Ga0495604_0486895 Ga0495604_0486895_565_783 72
84 3300048916 Ga0496113_1244683 Ga0496113_1244683_14_232 72
85 3300049569 Ga0501032_0734083 Ga0501032_0734083_38_256 72
86 3300049572 Ga0501036_1186041 Ga0501036_1186041_38_256 72
87 3300049581 Ga0501047_0410855 Ga0501047_0410855_753_971 72
88 3300049682 Ga0501252_009640 Ga0501252_009640_719_949 72
89 3300049688 Ga0501259_143064 Ga0501259_143064_240_470 72
90 3300049742 Ga0501080_0644282 Ga0501080_0644282_19_240 72
91 3300050512 nmdc:mga0n895_1007371_c1 nmdc:mga0n895_1007371_c1_182_400 72
92 3300053101 Ga0500553_219187 Ga0500553_219187_26_244 72
93 3300053136 Ga0500559_0138277 Ga0500559_0138277_599_817 72
94 3300053151 Ga0500604_0047037 Ga0500604_0047037_452_670 72
95 3300013306 Ga0163162_12816191 Ga0163162_128161912 73
96 3300009093 Ga0105240_11028167 Ga0105240_110281672 74
97 iso_pu_bacteria 2738541278 2738724439 77
98 iso_pu_bacteria 2818991442 2819572020 77
99 iso_pu_bacteria 2818991460 2819677787 77
100 iso_pu_bacteria 2821136567 2821141736 77
101 iso_pu_bacteria 2881955468 2881956695 77
102 iso_pu_bacteria 2884791551 2884797739 77
103 iso_pu_bacteria 2896109856 2896114760 77
104 iso_pu_bacteria 2904467357 2904469849 77
105 iso_pu_bacteria 2929177148 2929183213 77
106 iso_pu_bacteria 2929921140 2929927594 77
107 iso_pu_bacteria 2945977869 2945979174 77
108 iso_pu_bacteria 2946013367 2946014958 77
109 iso_pu_bacteria 8003151029 8003151442 77
110 3300044712 Ga0453684_0194318 Ga0453684_0194318_737_976 79
111 3300002155 JGI24033J26618_1015030 JGI24033J26618_10150302 80
112 3300005290 Ga0065712_10010245 Ga0065712_100102453 80
113 3300005328 Ga0070676_10027716 Ga0070676_100277163 80
114 3300005329 Ga0070683_100055456 Ga0070683_1000554563 80
115 3300005330 Ga0070690_100022674 Ga0070690_1000226742 80
116 3300005331 Ga0070670_100123124 Ga0070670_1001231243 80
117 3300005331 Ga0070670_100548885 Ga0070670_1005488851 80
118 3300005334 Ga0068869_100005960 Ga0068869_1000059607 80
119 3300005334 Ga0068869_100009661 Ga0068869_1000096615 80
120 3300005335 Ga0070666_10086792 Ga0070666_100867922 80
121 3300005338 Ga0068868_100223164 Ga0068868_1002231642 80
122 3300005338 Ga0068868_101474190 Ga0068868_1014741902 80
123 3300005340 Ga0070689_100015371 Ga0070689_1000153713 80
124 3300005343 Ga0070687_100354360 Ga0070687_1003543602 80
125 3300005344 Ga0070661_101272938 Ga0070661_1012729381 80
126 3300005347 Ga0070668_100066932 Ga0070668_1000669324 80
127 3300005353 Ga0070669_100002817 Ga0070669_1000028175 80
128 3300005353 Ga0070669_100887376 Ga0070669_1008873761 80
129 3300005355 Ga0070671_100059583 Ga0070671_1000595832 80
130 3300005355 Ga0070671_100189540 Ga0070671_1001895402 80
131 3300005356 Ga0070674_100901610 Ga0070674_1009016102 80
132 3300005364 Ga0070673_100032189 Ga0070673_1000321893 80
133 3300005365 Ga0070688_100009375 Ga0070688_1000093755 80
134 3300005365 Ga0070688_101407499 Ga0070688_1014074992 80
135 3300005366 Ga0070659_100787336 Ga0070659_1007873362 80
136 3300005367 Ga0070667_100067852 Ga0070667_1000678523 80
137 3300005438 Ga0070701_10078565 Ga0070701_100785653 80
138 3300005441 Ga0070700_100710557 Ga0070700_1007105571 80
139 3300005456 Ga0070678_100003286 Ga0070678_1000032865 80
140 3300005457 Ga0070662_100035523 Ga0070662_1000355233 80
141 3300005457 Ga0070662_100054392 Ga0070662_1000543924 80
142 3300005459 Ga0068867_100073950 Ga0068867_1000739503 80
143 3300005459 Ga0068867_100733825 Ga0068867_1007338252 80
144 3300005466 Ga0070685_10265907 Ga0070685_102659072 80
145 3300005535 Ga0070684_101325970 Ga0070684_1013259702 80
146 3300005539 Ga0068853_101773588 Ga0068853_1017735881 80
147 3300005544 Ga0070686_101470741 Ga0070686_1014707411 80
148 3300005545 Ga0070695_101353976 Ga0070695_1013539762 80
149 3300005549 Ga0070704_100083692 Ga0070704_1000836923 80
150 3300005564 Ga0070664_100042086 Ga0070664_1000420862 80
151 3300005564 Ga0070664_100132197 Ga0070664_1001321972 80
152 3300005564 Ga0070664_100500562 Ga0070664_1005005622 80
153 3300005577 Ga0068857_100023348 Ga0068857_1000233483 80
154 3300005577 Ga0068857_100131955 Ga0068857_1001319552 80
155 3300005578 Ga0068854_100078549 Ga0068854_1000785493 80
156 3300005578 Ga0068854_101052727 Ga0068854_1010527272 80
157 3300005616 Ga0068852_100179185 Ga0068852_1001791853 80
158 3300005616 Ga0068852_101096546 Ga0068852_1010965461 80
159 3300005617 Ga0068859_100360211 Ga0068859_1003602111 80
160 3300005617 Ga0068859_101559965 Ga0068859_1015599652 80
161 3300005618 Ga0068864_100437828 Ga0068864_1004378282 80
162 3300005719 Ga0068861_100230718 Ga0068861_1002307182 80
163 3300005834 Ga0068851_10940564 Ga0068851_109405641 80
164 3300005840 Ga0068870_10009083 Ga0068870_100090832 80
165 3300005840 Ga0068870_10163524 Ga0068870_101635242 80
166 3300005841 Ga0068863_100081203 Ga0068863_1000812033 80
167 3300005844 Ga0068862_100005611 Ga0068862_1000056115 80
168 3300006163 Ga0070715_10104756 Ga0070715_101047562 80
169 3300006237 Ga0097621_102042925 Ga0097621_1020429252 80
170 3300006358 Ga0068871_100061130 Ga0068871_1000611303 80
171 3300006871 Ga0075434_100468230 Ga0075434_1004682302 80
172 3300006881 Ga0068865_100189841 Ga0068865_1001898412 80
173 3300006931 Ga0097620_100360205 Ga0097620_1003602053 80
174 3300006931 Ga0097620_101559565 Ga0097620_1015595652 80
175 3300009094 Ga0111539_10002138 Ga0111539_100021383 80
176 3300009174 Ga0105241_10357373 Ga0105241_103573733 80
177 3300009176 Ga0105242_10090483 Ga0105242_100904833 80
178 3300009177 Ga0105248_11727454 Ga0105248_117274542 80
179 3300009553 Ga0105249_10031654 Ga0105249_100316544 80
180 3300009553 Ga0105249_12165957 Ga0105249_121659572 80
181 3300010375 Ga0105239_10707686 Ga0105239_107076862 80
182 3300011119 Ga0105246_11799013 Ga0105246_117990131 80
183 3300013102 Ga0157371_10071327 Ga0157371_100713273 80
184 3300013296 Ga0157374_10087995 Ga0157374_100879952 80
185 3300013296 Ga0157374_10156970 Ga0157374_101569702 80
186 3300013297 Ga0157378_10166419 Ga0157378_101664193 80
187 3300013306 Ga0163162_10681328 Ga0163162_106813282 80
188 3300013307 Ga0157372_11433923 Ga0157372_114339232 80
189 3300013308 Ga0157375_10029310 Ga0157375_100293103 80
190 3300014325 Ga0163163_10267727 Ga0163163_102677273 80
191 3300014326 Ga0157380_10000955 Ga0157380_1000095521 80
192 3300014745 Ga0157377_10000680 Ga0157377_1000068012 80
193 3300014968 Ga0157379_10031078 Ga0157379_100310783 80
194 3300014969 Ga0157376_10035604 Ga0157376_100356043 80
195 3300017792 Ga0163161_10177147 Ga0163161_101771472 80
196 3300017792 Ga0163161_11109364 Ga0163161_111093642 80
197 3300025321 Ga0207656_10682167 Ga0207656_106821672 80
198 3300025901 Ga0207688_10444780 Ga0207688_104447802 80
199 3300025903 Ga0207680_10011886 Ga0207680_100118864 80
200 3300025905 Ga0207685_10310243 Ga0207685_103102432 80
201 3300025908 Ga0207643_10027531 Ga0207643_100275313 80
202 3300025923 Ga0207681_10033369 Ga0207681_100333693 80
203 3300025925 Ga0207650_10079577 Ga0207650_100795772 80
204 3300025925 Ga0207650_10364216 Ga0207650_103642162 80
205 3300025926 Ga0207659_10034609 Ga0207659_100346094 80
206 3300025931 Ga0207644_10483973 Ga0207644_104839732 80
207 3300025933 Ga0207706_10012314 Ga0207706_100123146 80
208 3300025934 Ga0207686_10058443 Ga0207686_100584433 80
209 3300025936 Ga0207670_10525602 Ga0207670_105256022 80
210 3300025937 Ga0207669_10151790 Ga0207669_101517902 80
211 3300025937 Ga0207669_11044645 Ga0207669_110446452 80
212 3300025938 Ga0207704_11156642 Ga0207704_111566421 80
213 3300025941 Ga0207711_11661167 Ga0207711_116611672 80
214 3300025942 Ga0207689_10005093 Ga0207689_100050937 80
215 3300025942 Ga0207689_10023524 Ga0207689_100235242 80
216 3300025945 Ga0207679_10149398 Ga0207679_101493982 80
217 3300025945 Ga0207679_10442248 Ga0207679_104422482 80
218 3300025960 Ga0207651_10137547 Ga0207651_101375472 80
219 3300025961 Ga0207712_10514752 Ga0207712_105147522 80
220 3300025972 Ga0207668_10112004 Ga0207668_101120042 80
221 3300025972 Ga0207668_11981636 Ga0207668_119816362 80
222 3300025981 Ga0207640_10055055 Ga0207640_100550553 80
223 3300025981 Ga0207640_10101689 Ga0207640_101016892 80
224 3300025986 Ga0207658_10317173 Ga0207658_103171731 80
225 3300026023 Ga0207677_10014625 Ga0207677_100146252 80
226 3300026023 Ga0207677_11259383 Ga0207677_112593832 80
227 3300026035 Ga0207703_10179103 Ga0207703_101791032 80
228 3300026075 Ga0207708_10264844 Ga0207708_102648441 80
229 3300026088 Ga0207641_10788839 Ga0207641_107888392 80
230 3300026089 Ga0207648_10042733 Ga0207648_100427334 80
231 3300026089 Ga0207648_10497658 Ga0207648_104976582 80
232 3300026095 Ga0207676_10961638 Ga0207676_109616382 80
233 3300026116 Ga0207674_10005422 Ga0207674_1000542211 80
234 3300026118 Ga0207675_100001355 Ga0207675_1000013552 80
235 3300026121 Ga0207683_10011412 Ga0207683_100114124 80
236 3300026142 Ga0207698_10100063 Ga0207698_101000632 80
237 3300028380 Ga0268265_10212556 Ga0268265_102125562 80
238 3300028381 Ga0268264_10180193 Ga0268264_101801933 80
239 3300031251 Ga0265327_10000054 Ga0265327_100000547 80
240 3300031852 Ga0307410_10467619 Ga0307410_104676192 80
241 3300031901 Ga0307406_10902915 Ga0307406_109029151 80
242 3300035083 Ga0373926_0199553 Ga0373926_0199553_365_607 80
243 3300035086 Ga0373934_0113565 Ga0373934_0113565_262_504 80
244 3300035170 Ga0373943_0701182 Ga0373943_0701182_40_288 80
245 3300035725 Ga0373947_0092217 Ga0373947_0092217_621_869 80
246 3300041512 Ga0451853_0400010 Ga0451853_0400010_167_409 80
247 3300044712 Ga0453684_2163864 Ga0453684_2163864_132_374 80
248 3300046454 Ga0495592_0290004 Ga0495592_0290004_256_498 80
249 3300046463 Ga0495653_0151951 Ga0495653_0151951_314_556 80
250 3300046472 Ga0495580_0712916 Ga0495580_0712916_62_304 80
251 3300046499 Ga0495594_0464886 Ga0495594_0464886_171_419 80
252 3300046514 Ga0495618_0115589 Ga0495618_0115589_1003_1245 80
253 3300046535 Ga0495586_0045963 Ga0495586_0045963_1136_1378 80
254 3300046536 Ga0495587_0020446 Ga0495587_0020446_1446_1688 80
255 3300046675 Ga0495657_0064332 Ga0495657_0064332_818_1060 80
256 3300047321 Ga0495676_0774134 Ga0495676_0774134_17_265 80
257 3300048903 Ga0496100_0607889 Ga0496100_0607889_332_574 80
258 3300048907 Ga0496104_0708629 Ga0496104_0708629_108_350 80
259 3300048909 Ga0496106_0475339 Ga0496106_0475339_603_845 80
260 3300048918 Ga0496115_1417800 Ga0496115_1417800_157_399 80
261 3300049671 Ga0501238_038078 Ga0501238_038078_154_399 80
262 3300050512 nmdc:mga0n895_992540_c1 nmdc:mga0n895_992540_c1_237_479 80
263 3300050513 nmdc:mga0rr50_813319_c1 nmdc:mga0rr50_813319_c1_64_306 80
264 2162886011 MRS1b_contig_3991831 MRS1b_0743.00003010 81
265 3300000545 CNXas_1008144 CNXas_10081441 81
266 3300001979 JGI24740J21852_10004408 JGI24740J21852_100044088 81
267 3300001989 JGI24739J22299_10000154 JGI24739J22299_100001545 81
268 3300001989 JGI24739J22299_10088741 JGI24739J22299_100887412 81
269 3300001989 JGI24739J22299_10163145 JGI24739J22299_101631452 81
270 3300001990 JGI24737J22298_10124825 JGI24737J22298_101248251 81
271 3300002459 JGI24751J29686_10022844 JGI24751J29686_100228442 81
272 3300002738 JGI25154J39366_1000004 JGI25154J39366_100000419 81
273 3300002739 JGI25158J39367_1012243 JGI25158J39367_10122432 81
274 3300002739 JGI25158J39367_1020046 JGI25158J39367_10200462 81
275 3300002741 JGI25157J39369_1006614 JGI25157J39369_10066143 81
276 3300002987 JGI25159J45721_1011021 JGI25159J45721_10110212 81
277 3300003215 JGI25153J46596_10000224 JGI25153J46596_1000022417 81
278 3300003215 JGI25153J46596_10084177 JGI25153J46596_100841771 81
279 3300003215 JGI25153J46596_10125283 JGI25153J46596_101252832 81
280 3300003316 rootH1_10028725 rootH1_100287255 81
281 3300003316 rootH1_10105550 rootH1_101055503 81
282 3300003320 rootH2_10092470 rootH2_100924703 81
283 3300003320 rootH2_10168387 rootH2_101683871 81
284 3300003320 rootH2_10246825 rootH2_102468252 81
285 3300003322 rootL2_10108849 rootL2_101088493 81
286 3300003322 rootL2_10160668 rootL2_101606683 81
287 3300003322 rootL2_10303123 rootL2_103031232 81
288 3300003323 rootH1_10006382 rootH1_100063822 81
289 3300003323 rootH1_10071977 rootH1_100719772 81
290 3300003323 rootH1_10087949 rootH1_100879492 81
291 3300003354 JGI25160J50197_1007253 JGI25160J50197_10072534 81
292 3300003354 JGI25160J50197_1010399 JGI25160J50197_10103995 81
293 3300003354 JGI25160J50197_1025424 JGI25160J50197_10254242 81
294 3300003761 Ga0055535_1007135 Ga0055535_10071352 81
295 3300003762 Ga0055542_1006677 Ga0055542_10066773 81
296 3300003790 Ga0055528_1000355 Ga0055528_10003559 81
297 3300003791 Ga0055530_10000425 Ga0055530_100004259 81
298 3300003794 Ga0055531_10000411 Ga0055531_1000041120 81
299 3300003794 Ga0055531_10037717 Ga0055531_100377172 81
300 3300005262 Ga0065165_1000148 Ga0065165_100014825 81
301 3300005262 Ga0065165_1014842 Ga0065165_10148422 81
302 3300005262 Ga0065165_1030372 Ga0065165_10303721 81
303 3300005288 Ga0065714_10171921 Ga0065714_101719212 81
304 3300005289 Ga0065704_10375778 Ga0065704_103757782 81
305 3300005289 Ga0065704_10388791 Ga0065704_103887912 81
306 3300005289 Ga0065704_10843439 Ga0065704_108434391 81
307 3300005290 Ga0065712_10001417 Ga0065712_100014175 81
308 3300005290 Ga0065712_10149212 Ga0065712_101492123 81
309 3300005290 Ga0065712_10165992 Ga0065712_101659922 81
310 3300005290 Ga0065712_10332757 Ga0065712_103327572 81
311 3300005290 Ga0065712_10696653 Ga0065712_106966531 81
312 3300005290 Ga0065712_10719023 Ga0065712_107190232 81
313 3300005293 Ga0065715_10075105 Ga0065715_100751052 81
314 3300005293 Ga0065715_10236672 Ga0065715_102366722 81
315 3300005295 Ga0065707_10229826 Ga0065707_102298262 81
316 3300005295 Ga0065707_10425758 Ga0065707_104257582 81
317 3300005327 Ga0070658_10016557 Ga0070658_100165575 81
318 3300005327 Ga0070658_10029504 Ga0070658_100295044 81
319 3300005327 Ga0070658_10166171 Ga0070658_101661712 81
320 3300005328 Ga0070676_10004512 Ga0070676_100045122 81
321 3300005328 Ga0070676_10158946 Ga0070676_101589462 81
322 3300005329 Ga0070683_100000615 Ga0070683_10000061527 81
323 3300005329 Ga0070683_100002428 Ga0070683_1000024288 81
324 3300005329 Ga0070683_100048187 Ga0070683_1000481871 81
325 3300005330 Ga0070690_101511534 Ga0070690_1015115341 81
326 3300005331 Ga0070670_100366957 Ga0070670_1003669572 81
327 3300005331 Ga0070670_100785445 Ga0070670_1007854452 81
328 3300005331 Ga0070670_101140936 Ga0070670_1011409362 81
329 3300005331 Ga0070670_101335581 Ga0070670_1013355811 81
330 3300005333 Ga0070677_10014866 Ga0070677_100148664 81
331 3300005333 Ga0070677_10069338 Ga0070677_100693383 81
332 3300005333 Ga0070677_10182051 Ga0070677_101820512 81
333 3300005334 Ga0068869_100088792 Ga0068869_1000887922 81
334 3300005334 Ga0068869_100188735 Ga0068869_1001887351 81
335 3300005334 Ga0068869_101355570 Ga0068869_1013555702 81
336 3300005335 Ga0070666_10003206 Ga0070666_100032067 81
337 3300005335 Ga0070666_10037711 Ga0070666_100377114 81
338 3300005335 Ga0070666_10087689 Ga0070666_100876892 81
339 3300005336 Ga0070680_100031273 Ga0070680_1000312733 81
340 3300005336 Ga0070680_100073100 Ga0070680_1000731003 81
341 3300005336 Ga0070680_100076264 Ga0070680_1000762644 81
342 3300005336 Ga0070680_101450127 Ga0070680_1014501271 81
343 3300005337 Ga0070682_100068373 Ga0070682_1000683733 81
344 3300005337 Ga0070682_100153642 Ga0070682_1001536423 81
345 3300005338 Ga0068868_100003134 Ga0068868_10000313410 81
346 3300005338 Ga0068868_100431522 Ga0068868_1004315222 81
347 3300005338 Ga0068868_101355732 Ga0068868_1013557322 81
348 3300005338 Ga0068868_101417648 Ga0068868_1014176481 81
349 3300005339 Ga0070660_100001558 Ga0070660_1000015583 81
350 3300005339 Ga0070660_100068302 Ga0070660_1000683023 81
351 3300005339 Ga0070660_100097241 Ga0070660_1000972412 81
352 3300005339 Ga0070660_100308646 Ga0070660_1003086462 81
353 3300005339 Ga0070660_100361896 Ga0070660_1003618962 81
354 3300005339 Ga0070660_100451449 Ga0070660_1004514491 81
355 3300005339 Ga0070660_100486182 Ga0070660_1004861822 81
356 3300005339 Ga0070660_100964091 Ga0070660_1009640911 81
357 3300005340 Ga0070689_100711257 Ga0070689_1007112572 81
358 3300005340 Ga0070689_101532784 Ga0070689_1015327842 81
359 3300005341 Ga0070691_10070158 Ga0070691_100701582 81
360 3300005343 Ga0070687_100084904 Ga0070687_1000849042 81
361 3300005343 Ga0070687_100240710 Ga0070687_1002407102 81
362 3300005343 Ga0070687_101111580 Ga0070687_1011115802 81
363 3300005344 Ga0070661_100000716 Ga0070661_10000071624 81
364 3300005344 Ga0070661_101708494 Ga0070661_1017084942 81
365 3300005345 Ga0070692_10329317 Ga0070692_103293172 81
366 3300005345 Ga0070692_10417698 Ga0070692_104176982 81
367 3300005345 Ga0070692_10548503 Ga0070692_105485032 81
368 3300005347 Ga0070668_100011512 Ga0070668_1000115123 81
369 3300005347 Ga0070668_100083587 Ga0070668_1000835873 81
370 3300005347 Ga0070668_100326069 Ga0070668_1003260692 81
371 3300005347 Ga0070668_100331165 Ga0070668_1003311652 81
372 3300005353 Ga0070669_100126538 Ga0070669_1001265383 81
373 3300005353 Ga0070669_100330064 Ga0070669_1003300642 81
374 3300005353 Ga0070669_101366184 Ga0070669_1013661842 81
375 3300005353 Ga0070669_101991893 Ga0070669_1019918932 81
376 3300005354 Ga0070675_100002107 Ga0070675_1000021076 81
377 3300005354 Ga0070675_100033122 Ga0070675_1000331225 81
378 3300005354 Ga0070675_100148821 Ga0070675_1001488213 81
379 3300005354 Ga0070675_100195754 Ga0070675_1001957542 81
380 3300005354 Ga0070675_100245564 Ga0070675_1002455642 81
381 3300005355 Ga0070671_100019722 Ga0070671_1000197225 81
382 3300005355 Ga0070671_100644228 Ga0070671_1006442282 81
383 3300005355 Ga0070671_101303334 Ga0070671_1013033342 81
384 3300005356 Ga0070674_100081660 Ga0070674_1000816603 81
385 3300005356 Ga0070674_100118139 Ga0070674_1001181393 81
386 3300005356 Ga0070674_100280305 Ga0070674_1002803052 81
387 3300005356 Ga0070674_100429194 Ga0070674_1004291942 81
388 3300005356 Ga0070674_100605243 Ga0070674_1006052432 81
389 3300005364 Ga0070673_100002306 Ga0070673_10000230611 81
390 3300005364 Ga0070673_100122862 Ga0070673_1001228621 81
391 3300005364 Ga0070673_100757139 Ga0070673_1007571392 81
392 3300005364 Ga0070673_100845769 Ga0070673_1008457691 81
393 3300005365 Ga0070688_100018226 Ga0070688_1000182262 81
394 3300005366 Ga0070659_100286926 Ga0070659_1002869263 81
395 3300005366 Ga0070659_100835755 Ga0070659_1008357552 81
396 3300005366 Ga0070659_100968893 Ga0070659_1009688932 81
397 3300005366 Ga0070659_101050685 Ga0070659_1010506852 81
398 3300005366 Ga0070659_101960879 Ga0070659_1019608791 81
399 3300005367 Ga0070667_100007609 Ga0070667_1000076099 81
400 3300005367 Ga0070667_100049032 Ga0070667_1000490323 81
401 3300005367 Ga0070667_100195878 Ga0070667_1001958782 81
402 3300005367 Ga0070667_100223373 Ga0070667_1002233733 81
403 3300005367 Ga0070667_101009961 Ga0070667_1010099612 81
404 3300005367 Ga0070667_101059104 Ga0070667_1010591042 81
405 3300005406 Ga0070703_10506814 Ga0070703_105068142 81
406 3300005435 Ga0070714_100669624 Ga0070714_1006696242 81
407 3300005437 Ga0070710_11434452 Ga0070710_114344521 81
408 3300005438 Ga0070701_10023227 Ga0070701_100232273 81
409 3300005440 Ga0070705_100644389 Ga0070705_1006443891 81
410 3300005440 Ga0070705_101365373 Ga0070705_1013653732 81
411 3300005441 Ga0070700_100145353 Ga0070700_1001453532 81
412 3300005444 Ga0070694_100508132 Ga0070694_1005081322 81
413 3300005455 Ga0070663_100012032 Ga0070663_1000120322 81
414 3300005455 Ga0070663_100169767 Ga0070663_1001697672 81
415 3300005455 Ga0070663_100397292 Ga0070663_1003972922 81
416 3300005456 Ga0070678_100158474 Ga0070678_1001584743 81
417 3300005457 Ga0070662_100011603 Ga0070662_1000116033 81
418 3300005457 Ga0070662_100376237 Ga0070662_1003762372 81
419 3300005457 Ga0070662_100615819 Ga0070662_1006158192 81
420 3300005457 Ga0070662_101176054 Ga0070662_1011760542 81
421 3300005457 Ga0070662_101309745 Ga0070662_1013097452 81
422 3300005458 Ga0070681_10088919 Ga0070681_100889192 81
423 3300005458 Ga0070681_10095068 Ga0070681_100950683 81
424 3300005458 Ga0070681_10527543 Ga0070681_105275432 81
425 3300005458 Ga0070681_10810323 Ga0070681_108103232 81
426 3300005459 Ga0068867_100005650 Ga0068867_1000056503 81
427 3300005459 Ga0068867_100062803 Ga0068867_1000628033 81
428 3300005459 Ga0068867_100080722 Ga0068867_1000807224 81
429 3300005459 Ga0068867_100290819 Ga0068867_1002908192 81
430 3300005459 Ga0068867_100775108 Ga0068867_1007751082 81
431 3300005459 Ga0068867_100919472 Ga0068867_1009194722 81
432 3300005459 Ga0068867_100933110 Ga0068867_1009331101 81
433 3300005459 Ga0068867_101709782 Ga0068867_1017097821 81
434 3300005466 Ga0070685_10021727 Ga0070685_100217272 81
435 3300005466 Ga0070685_10194478 Ga0070685_101944781 81
436 3300005466 Ga0070685_10606095 Ga0070685_106060952 81
437 3300005466 Ga0070685_10609501 Ga0070685_106095012 81
438 3300005468 Ga0070707_100318179 Ga0070707_1003181792 81
439 3300005471 Ga0070698_100000585 Ga0070698_10000058521 81
440 3300005471 Ga0070698_100000965 Ga0070698_10000096531 81
441 3300005471 Ga0070698_100032415 Ga0070698_1000324155 81
442 3300005518 Ga0070699_100493970 Ga0070699_1004939702 81
443 3300005530 Ga0070679_100070634 Ga0070679_1000706342 81
444 3300005530 Ga0070679_100173865 Ga0070679_1001738653 81
445 3300005530 Ga0070679_100431741 Ga0070679_1004317412 81
446 3300005530 Ga0070679_100554943 Ga0070679_1005549431 81
447 3300005530 Ga0070679_100647417 Ga0070679_1006474173 81
448 3300005535 Ga0070684_100000134 Ga0070684_1000001343 81
449 3300005535 Ga0070684_101009235 Ga0070684_1010092352 81
450 3300005536 Ga0070697_101667294 Ga0070697_1016672941 81
451 3300005539 Ga0068853_100020543 Ga0068853_1000205435 81
452 3300005539 Ga0068853_100050862 Ga0068853_1000508623 81
453 3300005539 Ga0068853_100063424 Ga0068853_1000634244 81
454 3300005539 Ga0068853_100164165 Ga0068853_1001641653 81
455 3300005539 Ga0068853_100221850 Ga0068853_1002218502 81
456 3300005539 Ga0068853_100366338 Ga0068853_1003663382 81
457 3300005539 Ga0068853_100604829 Ga0068853_1006048292 81
458 3300005539 Ga0068853_100722012 Ga0068853_1007220121 81
459 3300005539 Ga0068853_101248095 Ga0068853_1012480952 81
460 3300005539 Ga0068853_101354105 Ga0068853_1013541052 81
461 3300005539 Ga0068853_101704560 Ga0068853_1017045602 81
462 3300005543 Ga0070672_100000891 Ga0070672_1000008918 81
463 3300005543 Ga0070672_100039214 Ga0070672_1000392142 81
464 3300005543 Ga0070672_100052704 Ga0070672_1000527043 81
465 3300005543 Ga0070672_100251835 Ga0070672_1002518352 81
466 3300005543 Ga0070672_100296308 Ga0070672_1002963083 81
467 3300005548 Ga0070665_100000717 Ga0070665_10000071732 81
468 3300005549 Ga0070704_100423900 Ga0070704_1004239002 81
469 3300005549 Ga0070704_101056900 Ga0070704_1010569002 81
470 3300005549 Ga0070704_101256592 Ga0070704_1012565922 81
471 3300005549 Ga0070704_101266160 Ga0070704_1012661601 81
472 3300005549 Ga0070704_101843798 Ga0070704_1018437982 81
473 3300005563 Ga0068855_100000210 Ga0068855_10000021038 81
474 3300005563 Ga0068855_100013494 Ga0068855_1000134945 81
475 3300005563 Ga0068855_100019662 Ga0068855_1000196624 81
476 3300005563 Ga0068855_100033420 Ga0068855_1000334204 81
477 3300005563 Ga0068855_100131020 Ga0068855_1001310202 81
478 3300005563 Ga0068855_100166003 Ga0068855_1001660032 81
479 3300005563 Ga0068855_100200676 Ga0068855_1002006763 81
480 3300005563 Ga0068855_100309054 Ga0068855_1003090542 81
481 3300005563 Ga0068855_100603126 Ga0068855_1006031262 81
482 3300005563 Ga0068855_100831639 Ga0068855_1008316393 81
483 3300005564 Ga0070664_100001395 Ga0070664_10000139519 81
484 3300005564 Ga0070664_100098645 Ga0070664_1000986453 81
485 3300005564 Ga0070664_101416906 Ga0070664_1014169062 81
486 3300005577 Ga0068857_100001139 Ga0068857_10000113922 81
487 3300005577 Ga0068857_100011514 Ga0068857_1000115145 81
488 3300005577 Ga0068857_100031961 Ga0068857_1000319614 81
489 3300005577 Ga0068857_100086847 Ga0068857_1000868474 81
490 3300005577 Ga0068857_100111973 Ga0068857_1001119733 81
491 3300005577 Ga0068857_100389855 Ga0068857_1003898552 81
492 3300005577 Ga0068857_100729726 Ga0068857_1007297261 81
493 3300005577 Ga0068857_102074695 Ga0068857_1020746951 81
494 3300005578 Ga0068854_100309677 Ga0068854_1003096772 81
495 3300005578 Ga0068854_101489163 Ga0068854_1014891631 81
496 3300005614 Ga0068856_100002822 Ga0068856_1000028228 81
497 3300005614 Ga0068856_100120763 Ga0068856_1001207633 81
498 3300005614 Ga0068856_100168942 Ga0068856_1001689423 81
499 3300005614 Ga0068856_101697243 Ga0068856_1016972431 81
500 3300005615 Ga0070702_100538398 Ga0070702_1005383982 81
501 3300005616 Ga0068852_100028064 Ga0068852_1000280642 81
502 3300005616 Ga0068852_100119828 Ga0068852_1001198282 81
503 3300005616 Ga0068852_100125468 Ga0068852_1001254683 81
504 3300005616 Ga0068852_100310763 Ga0068852_1003107633 81
505 3300005616 Ga0068852_100411446 Ga0068852_1004114463 81
506 3300005616 Ga0068852_101368399 Ga0068852_1013683992 81
507 3300005616 Ga0068852_102314564 Ga0068852_1023145641 81
508 3300005616 Ga0068852_102492543 Ga0068852_1024925432 81
509 3300005617 Ga0068859_100013947 Ga0068859_10001394710 81
510 3300005617 Ga0068859_100259173 Ga0068859_1002591732 81
511 3300005617 Ga0068859_100424214 Ga0068859_1004242142 81
512 3300005617 Ga0068859_100669199 Ga0068859_1006691992 81
513 3300005617 Ga0068859_100927488 Ga0068859_1009274881 81
514 3300005617 Ga0068859_101941512 Ga0068859_1019415121 81
515 3300005618 Ga0068864_100005533 Ga0068864_1000055339 81
516 3300005618 Ga0068864_100047444 Ga0068864_1000474443 81
517 3300005618 Ga0068864_100245303 Ga0068864_1002453032 81
518 3300005618 Ga0068864_100956887 Ga0068864_1009568872 81
519 3300005618 Ga0068864_101128055 Ga0068864_1011280552 81
520 3300005718 Ga0068866_10107701 Ga0068866_101077012 81
521 3300005718 Ga0068866_10135369 Ga0068866_101353692 81
522 3300005718 Ga0068866_10823681 Ga0068866_108236812 81
523 3300005719 Ga0068861_100089216 Ga0068861_1000892162 81
524 3300005719 Ga0068861_100100506 Ga0068861_1001005062 81
525 3300005719 Ga0068861_100174470 Ga0068861_1001744703 81
526 3300005719 Ga0068861_100657801 Ga0068861_1006578012 81
527 3300005719 Ga0068861_100893828 Ga0068861_1008938282 81
528 3300005719 Ga0068861_101067162 Ga0068861_1010671622 81
529 3300005719 Ga0068861_101640057 Ga0068861_1016400571 81
530 3300005834 Ga0068851_10007173 Ga0068851_100071735 81
531 3300005834 Ga0068851_10062218 Ga0068851_100622182 81
532 3300005834 Ga0068851_10110605 Ga0068851_101106052 81
533 3300005834 Ga0068851_10122130 Ga0068851_101221302 81
534 3300005840 Ga0068870_10025610 Ga0068870_100256103 81
535 3300005840 Ga0068870_10234500 Ga0068870_102345002 81
536 3300005841 Ga0068863_100007041 Ga0068863_1000070416 81
537 3300005841 Ga0068863_100045831 Ga0068863_1000458315 81
538 3300005841 Ga0068863_100101556 Ga0068863_1001015562 81
539 3300005841 Ga0068863_100510458 Ga0068863_1005104582 81
540 3300005841 Ga0068863_101197020 Ga0068863_1011970201 81
541 3300005842 Ga0068858_100015215 Ga0068858_1000152153 81
542 3300005842 Ga0068858_100108630 Ga0068858_1001086301 81
543 3300005842 Ga0068858_100240779 Ga0068858_1002407792 81
544 3300005842 Ga0068858_100406117 Ga0068858_1004061172 81
545 3300005842 Ga0068858_100502218 Ga0068858_1005022182 81
546 3300005842 Ga0068858_100599173 Ga0068858_1005991731 81
547 3300005843 Ga0068860_100000004 Ga0068860_100000004159 81
548 3300005843 Ga0068860_100007960 Ga0068860_1000079603 81
549 3300005843 Ga0068860_100020751 Ga0068860_1000207513 81
550 3300005843 Ga0068860_100233604 Ga0068860_1002336043 81
551 3300005843 Ga0068860_100506895 Ga0068860_1005068952 81
552 3300005843 Ga0068860_101326006 Ga0068860_1013260062 81
553 3300005844 Ga0068862_100158940 Ga0068862_1001589403 81
554 3300005844 Ga0068862_100197896 Ga0068862_1001978962 81
555 3300005844 Ga0068862_100341456 Ga0068862_1003414562 81
556 3300005844 Ga0068862_100408531 Ga0068862_1004085312 81
557 3300005844 Ga0068862_101069346 Ga0068862_1010693462 81
558 3300005844 Ga0068862_101666483 Ga0068862_1016664832 81
559 3300005983 Ga0081540_1229819 Ga0081540_12298192 81
560 3300005985 Ga0081539_10028019 Ga0081539_100280192 81
561 3300006173 Ga0070716_101598154 Ga0070716_1015981542 81
562 3300006195 Ga0075366_10023733 Ga0075366_100237334 81
563 3300006195 Ga0075366_10044341 Ga0075366_100443412 81
564 3300006195 Ga0075366_10057126 Ga0075366_100571263 81
565 3300006195 Ga0075366_10218143 Ga0075366_102181432 81
566 3300006195 Ga0075366_10235577 Ga0075366_102355772 81
567 3300006195 Ga0075366_10357496 Ga0075366_103574962 81
568 3300006195 Ga0075366_10542250 Ga0075366_105422502 81
569 3300006237 Ga0097621_100013926 Ga0097621_1000139263 81
570 3300006237 Ga0097621_100193560 Ga0097621_1001935602 81
571 3300006237 Ga0097621_100385504 Ga0097621_1003855043 81
572 3300006237 Ga0097621_100654672 Ga0097621_1006546722 81
573 3300006237 Ga0097621_100891584 Ga0097621_1008915842 81
574 3300006237 Ga0097621_101488749 Ga0097621_1014887492 81
575 3300006237 Ga0097621_101778565 Ga0097621_1017785652 81
576 3300006358 Ga0068871_100000076 Ga0068871_10000007617 81
577 3300006358 Ga0068871_100006134 Ga0068871_1000061349 81
578 3300006358 Ga0068871_101753233 Ga0068871_1017532332 81
579 3300006844 Ga0075428_100003531 Ga0075428_1000035318 81
580 3300006844 Ga0075428_100022783 Ga0075428_1000227833 81
581 3300006844 Ga0075428_100067391 Ga0075428_1000673911 81
582 3300006844 Ga0075428_100863557 Ga0075428_1008635572 81
583 3300006844 Ga0075428_102009797 Ga0075428_1020097972 81
584 3300006844 Ga0075428_102650439 Ga0075428_1026504392 81
585 3300006846 Ga0075430_100003285 Ga0075430_1000032852 81
586 3300006846 Ga0075430_100078318 Ga0075430_1000783184 81
587 3300006847 Ga0075431_100003484 Ga0075431_1000034844 81
588 3300006847 Ga0075431_100106799 Ga0075431_1001067992 81
589 3300006847 Ga0075431_100169083 Ga0075431_1001690832 81
590 3300006871 Ga0075434_100257710 Ga0075434_1002577102 81
591 3300006871 Ga0075434_102369302 Ga0075434_1023693022 81
592 3300006880 Ga0075429_100000539 Ga0075429_10000053917 81
593 3300006880 Ga0075429_100018881 Ga0075429_1000188812 81
594 3300006880 Ga0075429_100023645 Ga0075429_1000236454 81
595 3300006880 Ga0075429_101386936 Ga0075429_1013869362 81
596 3300006881 Ga0068865_100004770 Ga0068865_1000047705 81
597 3300006881 Ga0068865_100471839 Ga0068865_1004718392 81
598 3300006881 Ga0068865_101007712 Ga0068865_1010077122 81
599 3300006931 Ga0097620_100013947 Ga0097620_10001394710 81
600 3300006931 Ga0097620_100259160 Ga0097620_1002591603 81
601 3300006931 Ga0097620_100424215 Ga0097620_1004242152 81
602 3300006931 Ga0097620_100669149 Ga0097620_1006691492 81
603 3300006931 Ga0097620_100927408 Ga0097620_1009274082 81
604 3300006931 Ga0097620_101941053 Ga0097620_1019410531 81
605 3300007076 Ga0075435_100671700 Ga0075435_1006717002 81
606 3300009011 Ga0105251_10581992 Ga0105251_105819922 81
607 3300009093 Ga0105240_10002773 Ga0105240_100027733 81
608 3300009093 Ga0105240_10014724 Ga0105240_100147246 81
609 3300009093 Ga0105240_10078635 Ga0105240_100786354 81
610 3300009093 Ga0105240_10122116 Ga0105240_101221163 81
611 3300009093 Ga0105240_10268604 Ga0105240_102686042 81
612 3300009093 Ga0105240_10417752 Ga0105240_104177522 81
613 3300009093 Ga0105240_11676293 Ga0105240_116762932 81
614 3300009093 Ga0105240_12736745 Ga0105240_127367451 81
615 3300009094 Ga0111539_10022224 Ga0111539_100222246 81
616 3300009094 Ga0111539_10149801 Ga0111539_101498012 81
617 3300009094 Ga0111539_10434093 Ga0111539_104340932 81
618 3300009094 Ga0111539_10919964 Ga0111539_109199641 81
619 3300009094 Ga0111539_11018787 Ga0111539_110187872 81
620 3300009094 Ga0111539_11135765 Ga0111539_111357651 81
621 3300009094 Ga0111539_11544361 Ga0111539_115443612 81
622 3300009094 Ga0111539_12137950 Ga0111539_121379501 81
623 3300009094 Ga0111539_12372126 Ga0111539_123721261 81
624 3300009098 Ga0105245_11474491 Ga0105245_114744912 81
625 3300009101 Ga0105247_10684236 Ga0105247_106842361 81
626 3300009147 Ga0114129_10005173 Ga0114129_1000517316 81
627 3300009147 Ga0114129_10044760 Ga0114129_100447607 81
628 3300009147 Ga0114129_10135425 Ga0114129_101354253 81
629 3300009147 Ga0114129_10469584 Ga0114129_104695843 81
630 3300009148 Ga0105243_10258408 Ga0105243_102584082 81
631 3300009174 Ga0105241_10152728 Ga0105241_101527283 81
632 3300009174 Ga0105241_10183548 Ga0105241_101835482 81
633 3300009174 Ga0105241_10308399 Ga0105241_103083992 81
634 3300009174 Ga0105241_10611932 Ga0105241_106119322 81
635 3300009174 Ga0105241_10779213 Ga0105241_107792132 81
636 3300009174 Ga0105241_10841871 Ga0105241_108418712 81
637 3300009176 Ga0105242_10028757 Ga0105242_100287574 81
638 3300009176 Ga0105242_10032198 Ga0105242_100321983 81
639 3300009176 Ga0105242_10199971 Ga0105242_101999713 81
640 3300009176 Ga0105242_10205153 Ga0105242_102051531 81
641 3300009176 Ga0105242_10248027 Ga0105242_102480272 81
642 3300009176 Ga0105242_13039464 Ga0105242_130394641 81
643 3300009177 Ga0105248_10020088 Ga0105248_100200885 81
644 3300009177 Ga0105248_10348836 Ga0105248_103488362 81
645 3300009545 Ga0105237_10011361 Ga0105237_100113616 81
646 3300009545 Ga0105237_10035708 Ga0105237_100357084 81
647 3300009545 Ga0105237_10216508 Ga0105237_102165083 81
648 3300009545 Ga0105237_11291167 Ga0105237_112911672 81
649 3300009551 Ga0105238_10226021 Ga0105238_102260213 81
650 3300009551 Ga0105238_10636568 Ga0105238_106365682 81
651 3300009553 Ga0105249_10005610 Ga0105249_100056106 81
652 3300009553 Ga0105249_10077890 Ga0105249_100778905 81
653 3300009553 Ga0105249_10112450 Ga0105249_101124504 81
654 3300009553 Ga0105249_10118001 Ga0105249_101180012 81
655 3300009553 Ga0105249_10404191 Ga0105249_104041912 81
656 3300009553 Ga0105249_10421211 Ga0105249_104212112 81
657 3300009553 Ga0105249_10501367 Ga0105249_105013673 81
658 3300010159 Ga0099796_10220122 Ga0099796_102201221 81
659 3300010375 Ga0105239_10015012 Ga0105239_100150124 81
660 3300010375 Ga0105239_10017962 Ga0105239_100179626 81
661 3300010375 Ga0105239_10182821 Ga0105239_101828213 81
662 3300010375 Ga0105239_10358684 Ga0105239_103586842 81
663 3300010375 Ga0105239_10497244 Ga0105239_104972442 81
664 3300010375 Ga0105239_10753466 Ga0105239_107534662 81
665 3300010375 Ga0105239_11221869 Ga0105239_112218692 81
666 3300010375 Ga0105239_11537888 Ga0105239_115378882 81
667 3300010375 Ga0105239_12184380 Ga0105239_121843802 81
668 3300011119 Ga0105246_10072803 Ga0105246_100728033 81
669 3300011119 Ga0105246_10086311 Ga0105246_100863113 81
670 3300011119 Ga0105246_10618161 Ga0105246_106181612 81
671 3300013100 Ga0157373_10002704 Ga0157373_1000270411 81
672 3300013100 Ga0157373_10019662 Ga0157373_100196624 81
673 3300013100 Ga0157373_10021506 Ga0157373_100215065 81
674 3300013100 Ga0157373_10196220 Ga0157373_101962202 81
675 3300013100 Ga0157373_10228670 Ga0157373_102286703 81
676 3300013100 Ga0157373_10507577 Ga0157373_105075771 81
677 3300013100 Ga0157373_10963142 Ga0157373_109631421 81
678 3300013100 Ga0157373_11053689 Ga0157373_110536892 81
679 3300013100 Ga0157373_11108618 Ga0157373_111086182 81
680 3300013100 Ga0157373_11355229 Ga0157373_113552292 81
681 3300013102 Ga0157371_10001533 Ga0157371_100015334 81
682 3300013102 Ga0157371_10001693 Ga0157371_1000169320 81
683 3300013102 Ga0157371_10001829 Ga0157371_1000182911 81
684 3300013102 Ga0157371_10002330 Ga0157371_100023305 81
685 3300013102 Ga0157371_10011626 Ga0157371_100116265 81
686 3300013102 Ga0157371_10018324 Ga0157371_100183246 81
687 3300013102 Ga0157371_10021176 Ga0157371_100211765 81
688 3300013102 Ga0157371_10029612 Ga0157371_100296124 81
689 3300013102 Ga0157371_10038547 Ga0157371_100385473 81
690 3300013102 Ga0157371_10059402 Ga0157371_100594023 81
691 3300013102 Ga0157371_10119043 Ga0157371_101190433 81
692 3300013102 Ga0157371_10160572 Ga0157371_101605722 81
693 3300013102 Ga0157371_10184413 Ga0157371_101844132 81
694 3300013102 Ga0157371_10208722 Ga0157371_102087222 81
695 3300013102 Ga0157371_10210062 Ga0157371_102100624 81
696 3300013102 Ga0157371_10234254 Ga0157371_102342542 81
697 3300013102 Ga0157371_10362065 Ga0157371_103620652 81
698 3300013102 Ga0157371_10382135 Ga0157371_103821352 81
699 3300013102 Ga0157371_10440790 Ga0157371_104407902 81
700 3300013102 Ga0157371_10524347 Ga0157371_105243472 81
701 3300013102 Ga0157371_11227938 Ga0157371_112279382 81
702 3300013104 Ga0157370_10002958 Ga0157370_100029586 81
703 3300013104 Ga0157370_10046504 Ga0157370_100465043 81
704 3300013104 Ga0157370_10106933 Ga0157370_101069333 81
705 3300013104 Ga0157370_10348395 Ga0157370_103483952 81
706 3300013104 Ga0157370_10420745 Ga0157370_104207452 81
707 3300013104 Ga0157370_10542836 Ga0157370_105428362 81
708 3300013104 Ga0157370_10701646 Ga0157370_107016462 81
709 3300013104 Ga0157370_10804684 Ga0157370_108046842 81
710 3300013104 Ga0157370_11116168 Ga0157370_111161682 81
711 3300013104 Ga0157370_11250469 Ga0157370_112504691 81
712 3300013104 Ga0157370_11604159 Ga0157370_116041591 81
713 3300013105 Ga0157369_10027523 Ga0157369_100275234 81
714 3300013105 Ga0157369_10028011 Ga0157369_100280117 81
715 3300013105 Ga0157369_10052489 Ga0157369_100524895 81
716 3300013105 Ga0157369_10381472 Ga0157369_103814722 81
717 3300013105 Ga0157369_10916103 Ga0157369_109161032 81
718 3300013105 Ga0157369_11381018 Ga0157369_113810181 81
719 3300013105 Ga0157369_11499312 Ga0157369_114993122 81
720 3300013105 Ga0157369_11894447 Ga0157369_118944472 81
721 3300013105 Ga0157369_11946669 Ga0157369_119466692 81
722 3300013105 Ga0157369_12291957 Ga0157369_122919572 81
723 3300013296 Ga0157374_10005530 Ga0157374_100055309 81
724 3300013296 Ga0157374_10162410 Ga0157374_101624102 81
725 3300013296 Ga0157374_10371371 Ga0157374_103713712 81
726 3300013296 Ga0157374_10371449 Ga0157374_103714493 81
727 3300013296 Ga0157374_10885639 Ga0157374_108856392 81
728 3300013296 Ga0157374_10891286 Ga0157374_108912862 81
729 3300013296 Ga0157374_10933942 Ga0157374_109339422 81
730 3300013297 Ga0157378_10013114 Ga0157378_100131145 81
731 3300013297 Ga0157378_10066114 Ga0157378_100661143 81
732 3300013297 Ga0157378_10686741 Ga0157378_106867412 81
733 3300013297 Ga0157378_12267118 Ga0157378_122671181 81
734 3300013306 Ga0163162_10001306 Ga0163162_1000130615 81
735 3300013306 Ga0163162_10002620 Ga0163162_100026205 81
736 3300013306 Ga0163162_10003840 Ga0163162_100038407 81
737 3300013306 Ga0163162_10013381 Ga0163162_100133813 81
738 3300013306 Ga0163162_10022875 Ga0163162_100228753 81
739 3300013306 Ga0163162_10171390 Ga0163162_101713903 81
740 3300013306 Ga0163162_10220623 Ga0163162_102206232 81
741 3300013306 Ga0163162_10426408 Ga0163162_104264082 81
742 3300013306 Ga0163162_11173128 Ga0163162_111731282 81
743 3300013307 Ga0157372_10033742 Ga0157372_100337422 81
744 3300013307 Ga0157372_10036205 Ga0157372_100362052 81
745 3300013307 Ga0157372_10039132 Ga0157372_100391327 81
746 3300013307 Ga0157372_10062107 Ga0157372_100621073 81
747 3300013307 Ga0157372_10074457 Ga0157372_100744572 81
748 3300013307 Ga0157372_10108796 Ga0157372_101087962 81
749 3300013307 Ga0157372_10173771 Ga0157372_101737714 81
750 3300013307 Ga0157372_10228957 Ga0157372_102289573 81
751 3300013307 Ga0157372_10396117 Ga0157372_103961172 81
752 3300013307 Ga0157372_10545396 Ga0157372_105453961 81
753 3300013307 Ga0157372_10579821 Ga0157372_105798212 81
754 3300013307 Ga0157372_10725767 Ga0157372_107257672 81
755 3300013307 Ga0157372_10771811 Ga0157372_107718114 81
756 3300013307 Ga0157372_10842069 Ga0157372_108420692 81
757 3300013307 Ga0157372_10854859 Ga0157372_108548592 81
758 3300013307 Ga0157372_10857681 Ga0157372_108576814 81
759 3300013307 Ga0157372_10881933 Ga0157372_108819332 81
760 3300013307 Ga0157372_10951457 Ga0157372_109514571 81
761 3300013307 Ga0157372_11479885 Ga0157372_114798852 81
762 3300013307 Ga0157372_11774931 Ga0157372_117749312 81
763 3300013307 Ga0157372_12676452 Ga0157372_126764522 81
764 3300013307 Ga0157372_13212195 Ga0157372_132121952 81
765 3300013308 Ga0157375_10000754 Ga0157375_1000075417 81
766 3300013308 Ga0157375_10006460 Ga0157375_100064608 81
767 3300013308 Ga0157375_10054153 Ga0157375_100541534 81
768 3300013308 Ga0157375_10065453 Ga0157375_100654534 81
769 3300013308 Ga0157375_10438656 Ga0157375_104386562 81
770 3300013308 Ga0157375_10645273 Ga0157375_106452732 81
771 3300013308 Ga0157375_10689479 Ga0157375_106894791 81
772 3300013308 Ga0157375_12056566 Ga0157375_120565662 81
773 3300014325 Ga0163163_10001404 Ga0163163_1000140416 81
774 3300014325 Ga0163163_10008917 Ga0163163_100089173 81
775 3300014325 Ga0163163_10018486 Ga0163163_100184864 81
776 3300014325 Ga0163163_10133033 Ga0163163_101330331 81
777 3300014325 Ga0163163_10540540 Ga0163163_105405401 81
778 3300014325 Ga0163163_10652846 Ga0163163_106528461 81
779 3300014325 Ga0163163_10870936 Ga0163163_108709362 81
780 3300014325 Ga0163163_10985242 Ga0163163_109852422 81
781 3300014325 Ga0163163_12554492 Ga0163163_125544922 81
782 3300014326 Ga0157380_10094278 Ga0157380_100942784 81
783 3300014326 Ga0157380_10115010 Ga0157380_101150102 81
784 3300014326 Ga0157380_10195776 Ga0157380_101957762 81
785 3300014326 Ga0157380_10420825 Ga0157380_104208252 81
786 3300014326 Ga0157380_10470314 Ga0157380_104703142 81
787 3300014326 Ga0157380_10751118 Ga0157380_107511182 81
788 3300014326 Ga0157380_10894643 Ga0157380_108946432 81
789 3300014326 Ga0157380_11258074 Ga0157380_112580742 81
790 3300014326 Ga0157380_12537020 Ga0157380_125370201 81
791 3300014326 Ga0157380_12638680 Ga0157380_126386802 81
792 3300014326 Ga0157380_13135733 Ga0157380_131357332 81
793 3300014745 Ga0157377_10006129 Ga0157377_100061294 81
794 3300014745 Ga0157377_10069521 Ga0157377_100695212 81
795 3300014745 Ga0157377_10316267 Ga0157377_103162672 81
796 3300014745 Ga0157377_11640248 Ga0157377_116402481 81
797 3300014745 Ga0157377_11746041 Ga0157377_117460412 81
798 3300014968 Ga0157379_10013306 Ga0157379_100133066 81
799 3300014968 Ga0157379_10051382 Ga0157379_100513822 81
800 3300014968 Ga0157379_10560273 Ga0157379_105602732 81
801 3300014968 Ga0157379_10746417 Ga0157379_107464171 81
802 3300014968 Ga0157379_11547958 Ga0157379_115479581 81
803 3300014968 Ga0157379_11753436 Ga0157379_117534361 81
804 3300014969 Ga0157376_10002174 Ga0157376_100021745 81
805 3300014969 Ga0157376_10007024 Ga0157376_100070242 81
806 3300014969 Ga0157376_10156953 Ga0157376_101569532 81
807 3300014969 Ga0157376_10263235 Ga0157376_102632352 81
808 3300014969 Ga0157376_10550898 Ga0157376_105508982 81
809 3300014969 Ga0157376_11019699 Ga0157376_110196992 81
810 3300014969 Ga0157376_11031486 Ga0157376_110314862 81
811 3300014969 Ga0157376_11476542 Ga0157376_114765421 81
812 3300014969 Ga0157376_11498510 Ga0157376_114985102 81
813 3300015265 Ga0182005_1000040 Ga0182005_100004014 81
814 3300017792 Ga0163161_10002032 Ga0163161_100020325 81
815 3300017792 Ga0163161_10005284 Ga0163161_100052844 81
816 3300017792 Ga0163161_10836691 Ga0163161_108366912 81
817 3300017792 Ga0163161_10918078 Ga0163161_109180782 81
818 3300017792 Ga0163161_11213525 Ga0163161_112135252 81
819 3300025208 Ga0209436_101017 Ga0209436_1010179 81
820 3300025208 Ga0209436_103090 Ga0209436_1030902 81
821 3300025242 Ga0209258_100075 Ga0209258_100075169 81
822 3300025242 Ga0209258_118247 Ga0209258_1182472 81
823 3300025246 Ga0209646_1000025 Ga0209646_1000025319 81
824 3300025246 Ga0209646_1023538 Ga0209646_10235382 81
825 3300025250 Ga0209026_1000312 Ga0209026_100031218 81
826 3300025254 Ga0209148_1000085 Ga0209148_100008560 81
827 3300025258 Ga0209129_1040498 Ga0209129_10404982 81
828 3300025273 Ga0209673_1000197 Ga0209673_100019763 81
829 3300025284 Ga0209130_1001772 Ga0209130_100177210 81
830 3300025297 Ga0209758_1000742 Ga0209758_100074212 81
831 3300025297 Ga0209758_1020083 Ga0209758_10200833 81
832 3300025297 Ga0209758_1037270 Ga0209758_10372702 81
833 3300025298 Ga0209050_1000204 Ga0209050_1000204105 81
834 3300025302 Ga0207426_1000057 Ga0207426_1000057138 81
835 3300025302 Ga0207426_1000332 Ga0207426_100033268 81
836 3300025302 Ga0207426_1001542 Ga0207426_100154214 81
837 3300025302 Ga0207426_1003820 Ga0207426_10038204 81
838 3300025303 Ga0209051_1039742 Ga0209051_10397422 81
839 3300025304 Ga0209257_1000004 Ga0209257_10000041175 81
840 3300025304 Ga0209257_1007784 Ga0209257_10077843 81
841 3300025315 Ga0207697_10020826 Ga0207697_100208264 81
842 3300025315 Ga0207697_10118976 Ga0207697_101189762 81
843 3300025315 Ga0207697_10357642 Ga0207697_103576422 81
844 3300025321 Ga0207656_10023282 Ga0207656_100232823 81
845 3300025893 Ga0207682_10142181 Ga0207682_101421812 81
846 3300025893 Ga0207682_10153287 Ga0207682_101532872 81
847 3300025899 Ga0207642_10075607 Ga0207642_100756072 81
848 3300025899 Ga0207642_10128929 Ga0207642_101289292 81
849 3300025899 Ga0207642_10902622 Ga0207642_109026222 81
850 3300025903 Ga0207680_10005285 Ga0207680_100052853 81
851 3300025903 Ga0207680_10207005 Ga0207680_102070053 81
852 3300025903 Ga0207680_10807016 Ga0207680_108070162 81
853 3300025904 Ga0207647_10005350 Ga0207647_100053509 81
854 3300025904 Ga0207647_10087715 Ga0207647_100877152 81
855 3300025904 Ga0207647_10286589 Ga0207647_102865892 81
856 3300025905 Ga0207685_10107432 Ga0207685_101074322 81
857 3300025905 Ga0207685_10120795 Ga0207685_101207952 81
858 3300025907 Ga0207645_10008166 Ga0207645_100081667 81
859 3300025907 Ga0207645_10044413 Ga0207645_100444132 81
860 3300025907 Ga0207645_10068778 Ga0207645_100687783 81
861 3300025908 Ga0207643_10005497 Ga0207643_100054976 81
862 3300025908 Ga0207643_10341390 Ga0207643_103413902 81
863 3300025909 Ga0207705_10004610 Ga0207705_100046106 81
864 3300025909 Ga0207705_10040871 Ga0207705_100408713 81
865 3300025909 Ga0207705_10047164 Ga0207705_100471643 81
866 3300025909 Ga0207705_10058642 Ga0207705_100586422 81
867 3300025909 Ga0207705_10078637 Ga0207705_100786373 81
868 3300025909 Ga0207705_10258498 Ga0207705_102584982 81
869 3300025909 Ga0207705_10940187 Ga0207705_109401872 81
870 3300025910 Ga0207684_11625681 Ga0207684_116256812 81
871 3300025911 Ga0207654_10121539 Ga0207654_101215392 81
872 3300025911 Ga0207654_10164170 Ga0207654_101641702 81
873 3300025911 Ga0207654_10396069 Ga0207654_103960692 81
874 3300025912 Ga0207707_10213510 Ga0207707_102135102 81
875 3300025912 Ga0207707_10712946 Ga0207707_107129462 81
876 3300025912 Ga0207707_11215977 Ga0207707_112159772 81
877 3300025913 Ga0207695_10000568 Ga0207695_1000056839 81
878 3300025913 Ga0207695_10001216 Ga0207695_1000121622 81
879 3300025913 Ga0207695_10023739 Ga0207695_100237392 81
880 3300025913 Ga0207695_10145163 Ga0207695_101451632 81
881 3300025913 Ga0207695_10260665 Ga0207695_102606652 81
882 3300025914 Ga0207671_10002095 Ga0207671_1000209517 81
883 3300025914 Ga0207671_10006310 Ga0207671_100063105 81
884 3300025917 Ga0207660_10009646 Ga0207660_100096462 81
885 3300025917 Ga0207660_10089701 Ga0207660_100897012 81
886 3300025917 Ga0207660_10158337 Ga0207660_101583372 81
887 3300025917 Ga0207660_10227636 Ga0207660_102276362 81
888 3300025917 Ga0207660_11194969 Ga0207660_111949691 81
889 3300025918 Ga0207662_10340173 Ga0207662_103401731 81
890 3300025919 Ga0207657_10003942 Ga0207657_100039423 81
891 3300025919 Ga0207657_10021914 Ga0207657_100219143 81
892 3300025919 Ga0207657_10068979 Ga0207657_100689794 81
893 3300025919 Ga0207657_10074998 Ga0207657_100749984 81
894 3300025919 Ga0207657_10282099 Ga0207657_102820992 81
895 3300025919 Ga0207657_10593794 Ga0207657_105937941 81
896 3300025919 Ga0207657_10617524 Ga0207657_106175242 81
897 3300025919 Ga0207657_11032653 Ga0207657_110326532 81
898 3300025919 Ga0207657_11145477 Ga0207657_111454772 81
899 3300025920 Ga0207649_10000604 Ga0207649_100006045 81
900 3300025920 Ga0207649_10292252 Ga0207649_102922522 81
901 3300025921 Ga0207652_10001482 Ga0207652_100014823 81
902 3300025921 Ga0207652_10013784 Ga0207652_100137844 81
903 3300025921 Ga0207652_10053513 Ga0207652_100535132 81
904 3300025921 Ga0207652_10891400 Ga0207652_108914001 81
905 3300025922 Ga0207646_10296134 Ga0207646_102961343 81
906 3300025923 Ga0207681_10404124 Ga0207681_104041242 81
907 3300025923 Ga0207681_10766923 Ga0207681_107669231 81
908 3300025923 Ga0207681_10817193 Ga0207681_108171931 81
909 3300025923 Ga0207681_11320138 Ga0207681_113201382 81
910 3300025923 Ga0207681_11343887 Ga0207681_113438872 81
911 3300025924 Ga0207694_10208788 Ga0207694_102087882 81
912 3300025924 Ga0207694_10445343 Ga0207694_104453432 81
913 3300025925 Ga0207650_10005929 Ga0207650_100059291 81
914 3300025925 Ga0207650_10091924 Ga0207650_100919243 81
915 3300025925 Ga0207650_10105464 Ga0207650_101054642 81
916 3300025925 Ga0207650_10899888 Ga0207650_108998881 81
917 3300025926 Ga0207659_10081496 Ga0207659_100814962 81
918 3300025926 Ga0207659_10135126 Ga0207659_101351262 81
919 3300025926 Ga0207659_10380988 Ga0207659_103809882 81
920 3300025926 Ga0207659_10851863 Ga0207659_108518631 81
921 3300025927 Ga0207687_10857181 Ga0207687_108571812 81
922 3300025929 Ga0207664_10541691 Ga0207664_105416912 81
923 3300025931 Ga0207644_10023211 Ga0207644_100232113 81
924 3300025931 Ga0207644_11015997 Ga0207644_110159972 81
925 3300025931 Ga0207644_11154131 Ga0207644_111541311 81
926 3300025932 Ga0207690_10013425 Ga0207690_100134253 81
927 3300025932 Ga0207690_10198160 Ga0207690_101981602 81
928 3300025932 Ga0207690_11218847 Ga0207690_112188472 81
929 3300025932 Ga0207690_11373773 Ga0207690_113737731 81
930 3300025933 Ga0207706_10027858 Ga0207706_100278583 81
931 3300025933 Ga0207706_11107067 Ga0207706_111070672 81
932 3300025933 Ga0207706_11472575 Ga0207706_114725751 81
933 3300025934 Ga0207686_10011068 Ga0207686_100110683 81
934 3300025934 Ga0207686_10016489 Ga0207686_100164893 81
935 3300025934 Ga0207686_10259564 Ga0207686_102595642 81
936 3300025934 Ga0207686_10279836 Ga0207686_102798362 81
937 3300025934 Ga0207686_10653817 Ga0207686_106538171 81
938 3300025936 Ga0207670_10010649 Ga0207670_100106496 81
939 3300025936 Ga0207670_11675889 Ga0207670_116758891 81
940 3300025936 Ga0207670_11874235 Ga0207670_118742352 81
941 3300025937 Ga0207669_10105614 Ga0207669_101056143 81
942 3300025937 Ga0207669_10125710 Ga0207669_101257102 81
943 3300025937 Ga0207669_10513019 Ga0207669_105130192 81
944 3300025938 Ga0207704_10043459 Ga0207704_100434593 81
945 3300025938 Ga0207704_10052867 Ga0207704_100528673 81
946 3300025938 Ga0207704_11292938 Ga0207704_112929382 81
947 3300025940 Ga0207691_10001933 Ga0207691_1000193310 81
948 3300025940 Ga0207691_10002669 Ga0207691_1000266913 81
949 3300025940 Ga0207691_10043504 Ga0207691_100435043 81
950 3300025940 Ga0207691_10186296 Ga0207691_101862962 81
951 3300025940 Ga0207691_10219346 Ga0207691_102193463 81
952 3300025940 Ga0207691_10374474 Ga0207691_103744742 81
953 3300025940 Ga0207691_11603607 Ga0207691_116036072 81
954 3300025941 Ga0207711_10149875 Ga0207711_101498753 81
955 3300025941 Ga0207711_10335230 Ga0207711_103352302 81
956 3300025942 Ga0207689_10019949 Ga0207689_100199493 81
957 3300025942 Ga0207689_10023318 Ga0207689_100233183 81
958 3300025942 Ga0207689_10114930 Ga0207689_101149301 81
959 3300025942 Ga0207689_10129778 Ga0207689_101297783 81
960 3300025942 Ga0207689_10361012 Ga0207689_103610122 81
961 3300025942 Ga0207689_10383673 Ga0207689_103836732 81
962 3300025944 Ga0207661_10000092 Ga0207661_100000926 81
963 3300025944 Ga0207661_10001341 Ga0207661_100013419 81
964 3300025944 Ga0207661_10461270 Ga0207661_104612702 81
965 3300025944 Ga0207661_11752904 Ga0207661_117529042 81
966 3300025945 Ga0207679_10000146 Ga0207679_100001466 81
967 3300025945 Ga0207679_10138949 Ga0207679_101389492 81
968 3300025945 Ga0207679_11711839 Ga0207679_117118391 81
969 3300025949 Ga0207667_10000222 Ga0207667_1000022259 81
970 3300025949 Ga0207667_10000246 Ga0207667_1000024632 81
971 3300025949 Ga0207667_10020120 Ga0207667_100201206 81
972 3300025949 Ga0207667_10024382 Ga0207667_100243826 81
973 3300025949 Ga0207667_10164834 Ga0207667_101648343 81
974 3300025949 Ga0207667_10647540 Ga0207667_106475402 81
975 3300025949 Ga0207667_10915784 Ga0207667_109157841 81
976 3300025949 Ga0207667_11247751 Ga0207667_112477511 81
977 3300025949 Ga0207667_11890409 Ga0207667_118904091 81
978 3300025960 Ga0207651_10002602 Ga0207651_100026023 81
979 3300025960 Ga0207651_10027681 Ga0207651_100276812 81
980 3300025960 Ga0207651_10102009 Ga0207651_101020091 81
981 3300025960 Ga0207651_10167771 Ga0207651_101677712 81
982 3300025960 Ga0207651_10195603 Ga0207651_101956033 81
983 3300025960 Ga0207651_10795548 Ga0207651_107955482 81
984 3300025960 Ga0207651_11635950 Ga0207651_116359501 81
985 3300025961 Ga0207712_10001299 Ga0207712_100012997 81
986 3300025961 Ga0207712_10243116 Ga0207712_102431163 81
987 3300025961 Ga0207712_10661546 Ga0207712_106615462 81
988 3300025961 Ga0207712_10724864 Ga0207712_107248642 81
989 3300025961 Ga0207712_11258939 Ga0207712_112589391 81
990 3300025972 Ga0207668_10006124 Ga0207668_100061243 81
991 3300025972 Ga0207668_10058112 Ga0207668_100581122 81
992 3300025972 Ga0207668_10893661 Ga0207668_108936612 81
993 3300025981 Ga0207640_11068485 Ga0207640_110684852 81
994 3300025981 Ga0207640_11110265 Ga0207640_111102651 81
995 3300025986 Ga0207658_10014986 Ga0207658_100149865 81
996 3300025986 Ga0207658_10214441 Ga0207658_102144412 81
997 3300025986 Ga0207658_10397103 Ga0207658_103971032 81
998 3300025986 Ga0207658_10895555 Ga0207658_108955552 81
999 3300025986 Ga0207658_11169226 Ga0207658_111692261 81
1000 3300026023 Ga0207677_10022184 Ga0207677_100221843 81
1001 3300026023 Ga0207677_10186576 Ga0207677_101865762 81
1002 3300026023 Ga0207677_11490246 Ga0207677_114902461 81
1003 3300026035 Ga0207703_10038379 Ga0207703_100383793 81
1004 3300026035 Ga0207703_10424273 Ga0207703_104242732 81
1005 3300026035 Ga0207703_12299335 Ga0207703_122993352 81
1006 3300026041 Ga0207639_10000667 Ga0207639_100006675 81
1007 3300026041 Ga0207639_10008122 Ga0207639_100081223 81
1008 3300026041 Ga0207639_10037712 Ga0207639_100377123 81
1009 3300026041 Ga0207639_10073908 Ga0207639_100739083 81
1010 3300026041 Ga0207639_10093844 Ga0207639_100938442 81
1011 3300026041 Ga0207639_10147712 Ga0207639_101477122 81
1012 3300026041 Ga0207639_10213729 Ga0207639_102137292 81
1013 3300026041 Ga0207639_10782461 Ga0207639_107824612 81
1014 3300026041 Ga0207639_12178634 Ga0207639_121786342 81
1015 3300026067 Ga0207678_10069744 Ga0207678_100697441 81
1016 3300026067 Ga0207678_11060916 Ga0207678_110609162 81
1017 3300026075 Ga0207708_10142100 Ga0207708_101421003 81
1018 3300026075 Ga0207708_10429960 Ga0207708_104299602 81
1019 3300026078 Ga0207702_10069754 Ga0207702_100697543 81
1020 3300026078 Ga0207702_10083782 Ga0207702_100837823 81
1021 3300026078 Ga0207702_10294553 Ga0207702_102945532 81
1022 3300026078 Ga0207702_10336799 Ga0207702_103367992 81
1023 3300026088 Ga0207641_10005038 Ga0207641_100050383 81
1024 3300026088 Ga0207641_10015563 Ga0207641_100155633 81
1025 3300026088 Ga0207641_10083106 Ga0207641_100831061 81
1026 3300026088 Ga0207641_10194694 Ga0207641_101946943 81
1027 3300026088 Ga0207641_10231764 Ga0207641_102317642 81
1028 3300026088 Ga0207641_11471425 Ga0207641_114714251 81
1029 3300026088 Ga0207641_12160616 Ga0207641_121606162 81
1030 3300026089 Ga0207648_10003359 Ga0207648_1000335913 81
1031 3300026089 Ga0207648_10004904 Ga0207648_1000490412 81
1032 3300026089 Ga0207648_10030385 Ga0207648_100303854 81
1033 3300026089 Ga0207648_10043963 Ga0207648_100439634 81
1034 3300026089 Ga0207648_10076983 Ga0207648_100769832 81
1035 3300026089 Ga0207648_10701641 Ga0207648_107016412 81
1036 3300026089 Ga0207648_11183945 Ga0207648_111839452 81
1037 3300026089 Ga0207648_11254539 Ga0207648_112545391 81
1038 3300026089 Ga0207648_11308898 Ga0207648_113088982 81
1039 3300026089 Ga0207648_11406472 Ga0207648_114064721 81
1040 3300026089 Ga0207648_12247336 Ga0207648_122473362 81
1041 3300026095 Ga0207676_10036051 Ga0207676_100360513 81
1042 3300026095 Ga0207676_10187967 Ga0207676_101879672 81
1043 3300026095 Ga0207676_10262299 Ga0207676_102622992 81
1044 3300026095 Ga0207676_10440460 Ga0207676_104404602 81
1045 3300026095 Ga0207676_11116736 Ga0207676_111167362 81
1046 3300026116 Ga0207674_10002078 Ga0207674_1000207824 81
1047 3300026116 Ga0207674_10035180 Ga0207674_100351804 81
1048 3300026116 Ga0207674_10070058 Ga0207674_100700584 81
1049 3300026116 Ga0207674_10101422 Ga0207674_101014222 81
1050 3300026116 Ga0207674_10116690 Ga0207674_101166903 81
1051 3300026116 Ga0207674_10719347 Ga0207674_107193472 81
1052 3300026118 Ga0207675_100002256 Ga0207675_1000022563 81
1053 3300026118 Ga0207675_100013142 Ga0207675_1000131422 81
1054 3300026118 Ga0207675_100121228 Ga0207675_1001212282 81
1055 3300026118 Ga0207675_100389884 Ga0207675_1003898843 81
1056 3300026118 Ga0207675_100393048 Ga0207675_1003930482 81
1057 3300026118 Ga0207675_101727901 Ga0207675_1017279012 81
1058 3300026118 Ga0207675_102217728 Ga0207675_1022177282 81
1059 3300026118 Ga0207675_102423822 Ga0207675_1024238222 81
1060 3300026121 Ga0207683_10292863 Ga0207683_102928632 81
1061 3300026121 Ga0207683_10381191 Ga0207683_103811912 81
1062 3300026142 Ga0207698_10047492 Ga0207698_100474922 81
1063 3300026142 Ga0207698_10077766 Ga0207698_100777663 81
1064 3300026142 Ga0207698_10317547 Ga0207698_103175472 81
1065 3300026142 Ga0207698_10332725 Ga0207698_103327252 81
1066 3300026142 Ga0207698_10710915 Ga0207698_107109152 81
1067 3300026142 Ga0207698_11106263 Ga0207698_111062632 81
1068 3300026142 Ga0207698_11595902 Ga0207698_115959022 81
1069 3300027526 Ga0209968_1065681 Ga0209968_10656812 81
1070 3300027614 Ga0209970_1122154 Ga0209970_11221541 81
1071 3300027617 Ga0210002_1040614 Ga0210002_10406141 81
1072 3300027682 Ga0209971_1191907 Ga0209971_11919071 81
1073 3300027876 Ga0209974_10073162 Ga0209974_100731621 81
1074 3300027907 Ga0207428_10917966 Ga0207428_109179661 81
1075 3300028379 Ga0268266_10004126 Ga0268266_100041263 81
1076 3300028380 Ga0268265_10106667 Ga0268265_101066672 81
1077 3300028380 Ga0268265_10264384 Ga0268265_102643843 81
1078 3300028380 Ga0268265_10378264 Ga0268265_103782642 81
1079 3300028380 Ga0268265_10468515 Ga0268265_104685152 81
1080 3300028380 Ga0268265_10506190 Ga0268265_105061902 81
1081 3300028380 Ga0268265_10661564 Ga0268265_106615642 81
1082 3300028380 Ga0268265_10714630 Ga0268265_107146302 81
1083 3300028380 Ga0268265_12230135 Ga0268265_122301352 81
1084 3300028381 Ga0268264_10000011 Ga0268264_10000011208 81
1085 3300028381 Ga0268264_10006311 Ga0268264_100063113 81
1086 3300028381 Ga0268264_10011319 Ga0268264_100113192 81
1087 3300028381 Ga0268264_10058105 Ga0268264_100581052 81
1088 3300028381 Ga0268264_10216451 Ga0268264_102164513 81
1089 3300028381 Ga0268264_10231903 Ga0268264_102319032 81
1090 3300028381 Ga0268264_10544989 Ga0268264_105449892 81
1091 3300028381 Ga0268264_11327856 Ga0268264_113278562 81
1092 3300028381 Ga0268264_12214651 Ga0268264_122146512 81
1093 3300028794 Ga0307515_10646695 Ga0307515_106466952 81
1094 3300028794 Ga0307515_10783553 Ga0307515_107835532 81
1095 3300031456 Ga0307513_10063300 Ga0307513_100633004 81
1096 3300031456 Ga0307513_10289372 Ga0307513_102893722 81
1097 3300031456 Ga0307513_10554208 Ga0307513_105542081 81
1098 3300031507 Ga0307509_10060495 Ga0307509_100604954 81
1099 3300031507 Ga0307509_10351506 Ga0307509_103515062 81
1100 3300031548 Ga0307408_100038537 Ga0307408_1000385374 81
1101 3300031616 Ga0307508_10001362 Ga0307508_1000136210 81
1102 3300031616 Ga0307508_10137888 Ga0307508_101378883 81
1103 3300031730 Ga0307516_10707148 Ga0307516_107071482 81
1104 3300031824 Ga0307413_10116477 Ga0307413_101164772 81
1105 3300031838 Ga0307518_10442778 Ga0307518_104427782 81
1106 3300031852 Ga0307410_10030785 Ga0307410_100307852 81
1107 3300031901 Ga0307406_10064617 Ga0307406_100646171 81
1108 3300031901 Ga0307406_10321385 Ga0307406_103213852 81
1109 3300031901 Ga0307406_10871991 Ga0307406_108719911 81
1110 3300031903 Ga0307407_10123592 Ga0307407_101235922 81
1111 3300031903 Ga0307407_11624652 Ga0307407_116246521 81
1112 3300031995 Ga0307409_100246560 Ga0307409_1002465602 81
1113 3300032002 Ga0307416_100093911 Ga0307416_1000939112 81
1114 3300032002 Ga0307416_101008761 Ga0307416_1010087612 81
1115 3300032002 Ga0307416_101251816 Ga0307416_1012518161 81
1116 3300032004 Ga0307414_10215357 Ga0307414_102153571 81
1117 3300032005 Ga0307411_10058568 Ga0307411_100585683 81
1118 3300032005 Ga0307411_10685249 Ga0307411_106852492 81
1119 3300032126 Ga0307415_100081356 Ga0307415_1000813562 81
1120 3300032126 Ga0307415_101677341 Ga0307415_1016773411 81
1121 3300033180 Ga0307510_10008932 Ga0307510_1000893210 81
1122 3300033180 Ga0307510_10472157 Ga0307510_104721572 81
1123 3300035112 Ga0373932_0233507 Ga0373932_0233507_21_266 81
1124 3300035117 Ga0373953_0359902 Ga0373953_0359902_105_350 81
1125 3300035695 Ga0373927_0625674 Ga0373927_0625674_101_346 81
1126 3300036401 Ga0373937_0524033 Ga0373937_0524033_62_307 81
1127 3300036401 Ga0373937_1682663 Ga0373937_1682663_235_480 81
1128 3300037068 Ga0373925_0604446 Ga0373925_0604446_389_634 81
1129 3300037312 Ga0395899_0009188 Ga0395899_0009188_6737_6982 81
1130 3300037312 Ga0395899_0017005 Ga0395899_0017005_249_500 81
1131 3300037312 Ga0395899_0187985 Ga0395899_0187985_1157_1402 81
1132 3300037312 Ga0395899_0303192 Ga0395899_0303192_62_313 81
1133 3300037312 Ga0395899_0389418 Ga0395899_0389418_114_359 81
1134 3300037418 Ga0395900_0111932 Ga0395900_0111932_301_552 81
1135 3300037418 Ga0395900_0139848 Ga0395900_0139848_871_1116 81
1136 3300037418 Ga0395900_0156477 Ga0395900_0156477_1985_2230 81
1137 3300037418 Ga0395900_0259663 Ga0395900_0259663_656_901 81
1138 3300037418 Ga0395900_0475549 Ga0395900_0475549_818_1063 81
1139 3300037466 Ga0395898_0031201 Ga0395898_0031201_4295_4546 81
1140 3300037466 Ga0395898_0072494 Ga0395898_0072494_34_279 81
1141 3300037466 Ga0395898_0121784 Ga0395898_0121784_2223_2468 81
1142 3300037466 Ga0395898_0436478 Ga0395898_0436478_832_1077 81
1143 3300037466 Ga0395898_0790483 Ga0395898_0790483_572_823 81
1144 3300037471 Ga0395905_0015405 Ga0395905_0015405_3297_3542 81
1145 3300037471 Ga0395905_1201189 Ga0395905_1201189_373_618 81
1146 3300037471 Ga0395905_1246396 Ga0395905_1246396_331_579 81
1147 3300038443 Ga0395901_0011427 Ga0395901_0011427_2019_2264 81
1148 3300038443 Ga0395901_0090659 Ga0395901_0090659_2921_3166 81
1149 3300038443 Ga0395901_0318172 Ga0395901_0318172_534_779 81
1150 3300038443 Ga0395901_0960966 Ga0395901_0960966_557_808 81
1151 3300038443 Ga0395901_1310136 Ga0395901_1310136_23_268 81
1152 3300041404 Ga0439436_0043744 Ga0439436_0043744_704_949 81
1153 3300041413 Ga0439465_0025746 Ga0439465_0025746_537_782 81
1154 3300041443 Ga0451789_0028015 Ga0451789_0028015_141_386 81
1155 3300041443 Ga0451789_1329307 Ga0451789_1329307_165_422 81
1156 3300041451 Ga0451791_1712160 Ga0451791_1712160_652_897 81
1157 3300041452 Ga0451793_1160112 Ga0451793_1160112_262_507 81
1158 3300041452 Ga0451793_1897698 Ga0451793_1897698_335_580 81
1159 3300041453 Ga0451797_0660066 Ga0451797_0660066_220_465 81
1160 3300041458 Ga0451798_1113716 Ga0451798_1113716_240_485 81
1161 3300041460 Ga0451802_1455935 Ga0451802_1455935_535_780 81
1162 3300041463 Ga0451804_1150222 Ga0451804_1150222_224_469 81
1163 3300041486 Ga0451807_1268939 Ga0451807_1268939_262_510 81
1164 3300041486 Ga0451807_2475336 Ga0451807_2475336_107_355 81
1165 3300041486 Ga0451807_2595595 Ga0451807_2595595_408_653 81
1166 3300041491 Ga0451833_1283552 Ga0451833_1283552_284_529 81
1167 3300041498 Ga0451841_0560704 Ga0451841_0560704_317_562 81
1168 3300041505 Ga0451849_0397476 Ga0451849_0397476_59_304 81
1169 3300041509 Ga0451843_1127470 Ga0451843_1127470_118_363 81
1170 3300041512 Ga0451853_0968399 Ga0451853_0968399_398_643 81
1171 3300041997 Ga0439431_0056863 Ga0439431_0056863_710_955 81
1172 3300042001 Ga0439441_051664 Ga0439441_051664_212_457 81
1173 3300042003 Ga0439443_024232 Ga0439443_024232_676_921 81
1174 3300042004 Ga0439445_0066018 Ga0439445_0066018_552_797 81
1175 3300042004 Ga0439445_0084580 Ga0439445_0084580_291_536 81
1176 3300042004 Ga0439445_0175078 Ga0439445_0175078_257_502 81
1177 3300042005 Ga0439448_0318782 Ga0439448_0318782_177_425 81
1178 3300042007 Ga0439449_0068737 Ga0439449_0068737_898_1143 81
1179 3300042007 Ga0439449_0368677 Ga0439449_0368677_283_528 81
1180 3300042009 Ga0439451_137251 Ga0439451_137251_101_355 81
1181 3300042014 Ga0439457_018068 Ga0439457_018068_807_1052 81
1182 3300042437 Ga0439444_0126340 Ga0439444_0126340_128_385 81
1183 3300042530 Ga0450916_085541 Ga0450916_085541_104_349 81
1184 3300042532 Ga0450893_0133841 Ga0450893_0133841_262_507 81
1185 3300044656 Ga0466969_0000235 Ga0466969_0000235_18196_18444 81
1186 3300044656 Ga0466969_0065404 Ga0466969_0065404_790_1035 81
1187 3300044656 Ga0466969_0086440 Ga0466969_0086440_114_359 81
1188 3300044658 Ga0466972_0001764 Ga0466972_0001764_9351_9596 81
1189 3300044658 Ga0466972_0055927 Ga0466972_0055927_1486_1731 81
1190 3300044658 Ga0466972_0109777 Ga0466972_0109777_980_1225 81
1191 3300044671 Ga0466978_0544714 Ga0466978_0544714_269_514 81
1192 3300044673 Ga0453683_0978158 Ga0453683_0978158_69_314 81
1193 3300044683 Ga0466965_0153395 Ga0466965_0153395_398_646 81
1194 3300044684 Ga0466966_0000280 Ga0466966_0000280_28529_28777 81
1195 3300044693 Ga0466961_0120437 Ga0466961_0120437_241_489 81
1196 3300044706 Ga0466964_0111636 Ga0466964_0111636_388_636 81
1197 3300044712 Ga0453684_0032184 Ga0453684_0032184_2778_3023 81
1198 3300044719 Ga0466971_0372563 Ga0466971_0372563_385_633 81
1199 3300044765 Ga0466970_0536490 Ga0466970_0536490_416_664 81
1200 3300044842 Ga0466957_0001155 Ga0466957_0001155_9092_9340 81
1201 3300044842 Ga0466957_0438989 Ga0466957_0438989_623_868 81
1202 3300044842 Ga0466957_0791592 Ga0466957_0791592_128_373 81
1203 3300044842 Ga0466957_0976959 Ga0466957_0976959_299_544 81
1204 3300044901 Ga0466960_0139711 Ga0466960_0139711_423_671 81
1205 3300044901 Ga0466960_0143734 Ga0466960_0143734_772_1017 81
1206 3300045049 Ga0466959_0000015 Ga0466959_0000015_109372_109620 81
1207 3300045049 Ga0466959_0105693 Ga0466959_0105693_77_322 81
1208 3300045051 Ga0451576_2617267 Ga0451576_2617267_249_494 81
1209 3300045976 Ga0466967_1587308 Ga0466967_1587308_107_355 81
1210 3300046453 Ga0495627_016980 Ga0495627_016980_1672_1917 81
1211 3300046455 Ga0495603_0205907 Ga0495603_0205907_427_672 81
1212 3300046460 Ga0495638_0030292 Ga0495638_0030292_1244_1489 81
1213 3300046460 Ga0495638_0352633 Ga0495638_0352633_356_601 81
1214 3300046471 Ga0495650_0099742 Ga0495650_0099742_445_690 81
1215 3300046507 Ga0495606_0011729 Ga0495606_0011729_3128_3373 81
1216 3300046511 Ga0495608_0826026 Ga0495608_0826026_112_357 81
1217 3300046519 Ga0495632_0112362 Ga0495632_0112362_390_635 81
1218 3300046519 Ga0495632_0415810 Ga0495632_0415810_153_398 81
1219 3300046522 Ga0495643_0016526 Ga0495643_0016526_2106_2351 81
1220 3300046524 Ga0495648_0013272 Ga0495648_0013272_5522_5767 81
1221 3300046524 Ga0495648_0262033 Ga0495648_0262033_551_796 81
1222 3300046538 Ga0495609_0122795 Ga0495609_0122795_23_268 81
1223 3300046539 Ga0495621_0020971 Ga0495621_0020971_1738_1983 81
1224 3300046539 Ga0495621_0296441 Ga0495621_0296441_240_497 81
1225 3300046558 Ga0495633_0000017 Ga0495633_0000017_221100_221345 81
1226 3300046559 Ga0495667_0723166 Ga0495667_0723166_122_367 81
1227 3300046616 Ga0495668_0012757 Ga0495668_0012757_1385_1630 81
1228 3300046648 Ga0495611_0000021 Ga0495611_0000021_55441_55686 81
1229 3300046648 Ga0495611_0088697 Ga0495611_0088697_108_353 81
1230 3300046648 Ga0495611_0240602 Ga0495611_0240602_68_313 81
1231 3300046660 Ga0495625_0255807 Ga0495625_0255807_49_294 81
1232 3300046660 Ga0495625_0281155 Ga0495625_0281155_300_545 81
1233 3300046660 Ga0495625_0671050 Ga0495625_0671050_277_522 81
1234 3300046690 Ga0495624_0566236 Ga0495624_0566236_123_368 81
1235 3300047317 Ga0495604_1054134 Ga0495604_1054134_147_392 81
1236 3300047318 Ga0495636_0509208 Ga0495636_0509208_177_422 81
1237 3300047320 Ga0495672_0022271 Ga0495672_0022271_163_408 81
1238 3300047320 Ga0495672_0032365 Ga0495672_0032365_1493_1738 81
1239 3300047320 Ga0495672_0297014 Ga0495672_0297014_234_479 81
1240 3300047443 Ga0495687_000001 Ga0495687_000001_1185350_1185595 81
1241 3300047443 Ga0495687_152451 Ga0495687_152451_304_549 81
1242 3300048904 Ga0496101_0051422 Ga0496101_0051422_1594_1839 81
1243 3300048904 Ga0496101_0868937 Ga0496101_0868937_17_262 81
1244 3300048907 Ga0496104_1616706 Ga0496104_1616706_126_371 81
1245 3300048909 Ga0496106_1051563 Ga0496106_1051563_119_364 81
1246 3300048910 Ga0496107_0201612 Ga0496107_0201612_624_869 81
1247 3300048910 Ga0496107_0453325 Ga0496107_0453325_137_382 81
1248 3300048911 Ga0496108_0152255 Ga0496108_0152255_1017_1262 81
1249 3300048912 Ga0496109_0101587 Ga0496109_0101587_895_1140 81
1250 3300048913 Ga0496110_0663368 Ga0496110_0663368_667_912 81
1251 3300048913 Ga0496110_0870963 Ga0496110_0870963_490_735 81
1252 3300048917 Ga0496114_0855669 Ga0496114_0855669_524_769 81
1253 3300048924 Ga0496121_0000010 Ga0496121_0000010_287957_288202 81
1254 3300048924 Ga0496121_0909951 Ga0496121_0909951_192_437 81
1255 3300048928 Ga0496125_0295096 Ga0496125_0295096_248_493 81
1256 3300048929 Ga0496126_0127526 Ga0496126_0127526_772_1017 81
1257 3300049568 Ga0501031_0091768 Ga0501031_0091768_343_588 81
1258 3300049570 Ga0501033_0245184 Ga0501033_0245184_575_820 81
1259 3300049570 Ga0501033_0331835 Ga0501033_0331835_201_446 81
1260 3300049570 Ga0501033_0656424 Ga0501033_0656424_70_315 81
1261 3300049570 Ga0501033_1135677 Ga0501033_1135677_50_295 81
1262 3300049571 Ga0501034_0025021 Ga0501034_0025021_748_996 81
1263 3300049571 Ga0501034_0057903 Ga0501034_0057903_2397_2642 81
1264 3300049571 Ga0501034_0083010 Ga0501034_0083010_1533_1778 81
1265 3300049571 Ga0501034_0126766 Ga0501034_0126766_1367_1612 81
1266 3300049571 Ga0501034_0153853 Ga0501034_0153853_908_1156 81
1267 3300049571 Ga0501034_0265313 Ga0501034_0265313_913_1158 81
1268 3300049571 Ga0501034_0337833 Ga0501034_0337833_897_1142 81
1269 3300049572 Ga0501036_0180174 Ga0501036_0180174_757_1002 81
1270 3300049573 Ga0501037_0125473 Ga0501037_0125473_1374_1619 81
1271 3300049573 Ga0501037_0294920 Ga0501037_0294920_350_595 81
1272 3300049573 Ga0501037_0708837 Ga0501037_0708837_18_263 81
1273 3300049574 Ga0501038_0017298 Ga0501038_0017298_5888_6133 81
1274 3300049574 Ga0501038_0024630 Ga0501038_0024630_4497_4745 81
1275 3300049574 Ga0501038_0469715 Ga0501038_0469715_690_935 81
1276 3300049575 Ga0501039_0037675 Ga0501039_0037675_1403_1648 81
1277 3300049575 Ga0501039_0217942 Ga0501039_0217942_828_1073 81
1278 3300049579 Ga0501043_0017442 Ga0501043_0017442_4610_4855 81
1279 3300049579 Ga0501043_0032312 Ga0501043_0032312_3068_3316 81
1280 3300049579 Ga0501043_0347861 Ga0501043_0347861_677_922 81
1281 3300049580 Ga0501046_0048287 Ga0501046_0048287_1591_1836 81
1282 3300049581 Ga0501047_0011096 Ga0501047_0011096_212_457 81
1283 3300049581 Ga0501047_0021076 Ga0501047_0021076_1044_1289 81
1284 3300049581 Ga0501047_0400875 Ga0501047_0400875_791_1036 81
1285 3300049581 Ga0501047_0445493 Ga0501047_0445493_860_1105 81
1286 3300049581 Ga0501047_0512270 Ga0501047_0512270_763_1011 81
1287 3300049581 Ga0501047_0865609 Ga0501047_0865609_423_668 81
1288 3300049582 Ga0501048_0145226 Ga0501048_0145226_760_1005 81
1289 3300049584 Ga0501068_1003418 Ga0501068_1003418_201_446 81
1290 3300049586 Ga0501070_0313642 Ga0501070_0313642_12_257 81
1291 3300049586 Ga0501070_1013064 Ga0501070_1013064_44_289 81
1292 3300049588 Ga0501072_1156451 Ga0501072_1156451_281_526 81
1293 3300049589 Ga0501073_0110828 Ga0501073_0110828_471_716 81
1294 3300049649 Ga0501198_014607 Ga0501198_014607_63_308 81
1295 3300049650 Ga0501199_007699 Ga0501199_007699_319_564 81
1296 3300049651 Ga0501201_003567 Ga0501201_003567_791_1036 81
1297 3300049652 Ga0501202_003604 Ga0501202_003604_1381_1626 81
1298 3300049653 Ga0501206_022361 Ga0501206_022361_114_359 81
1299 3300049654 Ga0501207_006177 Ga0501207_006177_1058_1303 81
1300 3300049660 Ga0501216_006858 Ga0501216_006858_1374_1619 81
1301 3300049661 Ga0501217_024187 Ga0501217_024187_889_1134 81
1302 3300049663 Ga0501223_022442 Ga0501223_022442_888_1133 81
1303 3300049664 Ga0501224_003267 Ga0501224_003267_1837_2082 81
1304 3300049665 Ga0501227_042388 Ga0501227_042388_323_568 81
1305 3300049668 Ga0501233_238348 Ga0501233_238348_249_506 81
1306 3300049669 Ga0501235_004505 Ga0501235_004505_1578_1823 81
1307 3300049674 Ga0501242_028661 Ga0501242_028661_376_621 81
1308 3300049675 Ga0501243_004321 Ga0501243_004321_483_728 81
1309 3300049679 Ga0501249_213385 Ga0501249_213385_57_314 81
1310 3300049681 Ga0501251_038662 Ga0501251_038662_311_556 81
1311 3300049684 Ga0501255_009224 Ga0501255_009224_705_950 81
1312 3300049686 Ga0501257_128457 Ga0501257_128457_344_589 81
1313 3300049688 Ga0501259_101707 Ga0501259_101707_267_512 81
1314 3300049690 Ga0501261_028897 Ga0501261_028897_341_586 81
1315 3300049704 Ga0501221_044109 Ga0501221_044109_563_808 81
1316 3300049705 Ga0501225_0011878 Ga0501225_0011878_862_1107 81
1317 3300049707 Ga0501234_022465 Ga0501234_022465_522_767 81
1318 3300049708 Ga0501245_016785 Ga0501245_016785_698_943 81
1319 3300049742 Ga0501080_1807239 Ga0501080_1807239_171_416 81
1320 3300049744 Ga0501083_0069451 Ga0501083_0069451_434_688 81
1321 3300049744 Ga0501083_0242345 Ga0501083_0242345_681_926 81
1322 3300049763 Ga0501266_002586 Ga0501266_002586_849_1094 81
1323 3300049769 Ga0501272_035354 Ga0501272_035354_270_515 81
1324 3300049773 Ga0501276_001576 Ga0501276_001576_892_1137 81
1325 3300049775 Ga0501279_006140 Ga0501279_006140_1180_1425 81
1326 3300049776 Ga0501280_025068 Ga0501280_025068_135_380 81
1327 3300049776 Ga0501280_065303 Ga0501280_065303_273_518 81
1328 3300049778 Ga0501282_024731 Ga0501282_024731_199_444 81
1329 3300049822 Ga0501035_0024751 Ga0501035_0024751_1313_1558 81
1330 3300049822 Ga0501035_0160804 Ga0501035_0160804_1145_1390 81
1331 3300049822 Ga0501035_0451212 Ga0501035_0451212_679_924 81
1332 3300049822 Ga0501035_0469385 Ga0501035_0469385_91_336 81
1333 3300049822 Ga0501035_0532507 Ga0501035_0532507_643_888 81
1334 3300049822 Ga0501035_0565224 Ga0501035_0565224_326_571 81
1335 3300049823 Ga0501044_0030285 Ga0501044_0030285_925_1170 81
1336 3300049823 Ga0501044_0078463 Ga0501044_0078463_1348_1596 81
1337 3300049823 Ga0501044_0217087 Ga0501044_0217087_648_893 81
1338 3300049823 Ga0501044_0241441 Ga0501044_0241441_871_1116 81
1339 3300049823 Ga0501044_0398994 Ga0501044_0398994_76_321 81
1340 3300049823 Ga0501044_0434784 Ga0501044_0434784_448_693 81
1341 3300049823 Ga0501044_1544675 Ga0501044_1544675_81_326 81
1342 3300049849 Ga0501200_05772 Ga0501200_05772_161_406 81
1343 3300050005 Ga0501284_01154 Ga0501284_01154_708_956 81
1344 3300050493 nmdc:mga0k408_26435_c1 nmdc:mga0k408_26435_c1_2841_3086 81
1345 3300050493 nmdc:mga0k408_31349_c1 nmdc:mga0k408_31349_c1_615_860 81
1346 3300050493 nmdc:mga0k408_35150_c1 nmdc:mga0k408_35150_c1_2273_2518 81
1347 3300050493 nmdc:mga0k408_409679_c1 nmdc:mga0k408_409679_c1_308_553 81
1348 3300050493 nmdc:mga0k408_582779_c1 nmdc:mga0k408_582779_c1_95_340 81
1349 3300050493 nmdc:mga0k408_798772_c1 nmdc:mga0k408_798772_c1_176_421 81
1350 3300050507 nmdc:mga05p37_1231339_c1 nmdc:mga05p37_1231339_c1_265_513 81
1351 3300050507 nmdc:mga05p37_3235_c1 nmdc:mga05p37_3235_c1_16506_16751 81
1352 3300050507 nmdc:mga05p37_841675_c1 nmdc:mga05p37_841675_c1_484_729 81
1353 3300050508 nmdc:mga09592_1546_c1 nmdc:mga09592_1546_c1_2276_2521 81
1354 3300050508 nmdc:mga09592_321074_c1 nmdc:mga09592_321074_c1_233_481 81
1355 3300050508 nmdc:mga09592_75829_c1 nmdc:mga09592_75829_c1_1460_1705 81
1356 3300050509 nmdc:mga0qj67_153861_c1 nmdc:mga0qj67_153861_c1_810_1055 81
1357 3300050509 nmdc:mga0qj67_48198_c1 nmdc:mga0qj67_48198_c1_2637_2882 81
1358 3300050509 nmdc:mga0qj67_653831_c1 nmdc:mga0qj67_653831_c1_474_719 81
1359 3300050510 nmdc:mga06r32_225327_c1 nmdc:mga06r32_225327_c1_892_1137 81
1360 3300050510 nmdc:mga06r32_4303_c1 nmdc:mga06r32_4303_c1_731_979 81
1361 3300050510 nmdc:mga06r32_497226_c1 nmdc:mga06r32_497226_c1_287_532 81
1362 3300050511 nmdc:mga08y16_2006363_c1 nmdc:mga08y16_2006363_c1_40_297 81
1363 3300050511 nmdc:mga08y16_26379_c1 nmdc:mga08y16_26379_c1_2928_3176 81
1364 3300050511 nmdc:mga08y16_401679_c1 nmdc:mga08y16_401679_c1_581_826 81
1365 3300050511 nmdc:mga08y16_450759_c1 nmdc:mga08y16_450759_c1_979_1224 81
1366 3300050511 nmdc:mga08y16_622828_c1 nmdc:mga08y16_622828_c1_522_782 81
1367 3300050511 nmdc:mga08y16_638753_c1 nmdc:mga08y16_638753_c1_494_739 81
1368 3300053088 Ga0500644_0000233 Ga0500644_0000233_6765_7010 81
1369 3300053090 Ga0500646_0007401 Ga0500646_0007401_771_1016 81
1370 3300053090 Ga0500646_0163812 Ga0500646_0163812_319_564 81
1371 3300053090 Ga0500646_0290563 Ga0500646_0290563_81_326 81
1372 3300053092 Ga0500583_0000224 Ga0500583_0000224_3699_3944 81
1373 3300053092 Ga0500583_0036287 Ga0500583_0036287_1787_2032 81
1374 3300053092 Ga0500583_0068941 Ga0500583_0068941_929_1174 81
1375 3300053092 Ga0500583_0078304 Ga0500583_0078304_24_269 81
1376 3300053093 Ga0500651_0050349 Ga0500651_0050349_737_982 81
1377 3300053093 Ga0500651_0528375 Ga0500651_0528375_323_568 81
1378 3300053094 Ga0500566_0213081 Ga0500566_0213081_245_490 81
1379 3300053096 Ga0500641_0344789 Ga0500641_0344789_253_498 81
1380 3300053100 Ga0500660_088515 Ga0500660_088515_146_391 81
1381 3300053104 Ga0500556_0121013 Ga0500556_0121013_226_471 81
1382 3300053108 Ga0500562_136297 Ga0500562_136297_70_315 81
1383 3300053109 Ga0500569_001814 Ga0500569_001814_1855_2100 81
1384 3300053118 Ga0500594_0063931 Ga0500594_0063931_156_401 81
1385 3300053118 Ga0500594_0063962 Ga0500594_0063962_176_421 81
1386 3300053121 Ga0500607_065776 Ga0500607_065776_181_426 81
1387 3300053126 Ga0500621_200998 Ga0500621_200998_69_314 81
1388 3300053126 Ga0500621_206911 Ga0500621_206911_204_449 81
1389 3300053129 Ga0500628_131419 Ga0500628_131419_158_403 81
1390 3300053129 Ga0500628_167897 Ga0500628_167897_113_358 81
1391 3300053130 Ga0500642_0095309 Ga0500642_0095309_431_676 81
1392 3300053131 Ga0500652_019542 Ga0500652_019542_1094_1339 81
1393 3300053131 Ga0500652_033710 Ga0500652_033710_472_717 81
1394 3300053133 Ga0500655_064269 Ga0500655_064269_327_572 81
1395 3300053134 Ga0500658_0001405 Ga0500658_0001405_7081_7326 81
1396 3300053134 Ga0500658_0147556 Ga0500658_0147556_542_787 81
1397 3300053136 Ga0500559_0005888 Ga0500559_0005888_2780_3025 81
1398 3300053136 Ga0500559_0414681 Ga0500559_0414681_194_442 81
1399 3300053139 Ga0500568_0000593 Ga0500568_0000593_23537_23782 81
1400 3300053139 Ga0500568_0050331 Ga0500568_0050331_1168_1413 81
1401 3300053142 Ga0500577_0000924 Ga0500577_0000924_5635_5880 81
1402 3300053146 Ga0500588_0039894 Ga0500588_0039894_1001_1246 81
1403 3300053146 Ga0500588_0297885 Ga0500588_0297885_125_370 81
1404 3300053147 Ga0500589_064108 Ga0500589_064108_155_400 81
1405 3300053147 Ga0500589_074095 Ga0500589_074095_925_1170 81
1406 3300053148 Ga0500590_016384 Ga0500590_016384_2157_2402 81
1407 3300053150 Ga0500603_022140 Ga0500603_022140_85_330 81
1408 3300053153 Ga0500616_0050612 Ga0500616_0050612_116_361 81
1409 3300053153 Ga0500616_0149002 Ga0500616_0149002_140_385 81
1410 3300053153 Ga0500616_0438073 Ga0500616_0438073_171_416 81
1411 3300053154 Ga0500619_090429 Ga0500619_090429_528_773 81
1412 3300053156 Ga0500622_0000319 Ga0500622_0000319_23331_23576 81
1413 3300053156 Ga0500622_0002252 Ga0500622_0002252_8480_8725 81
1414 3300053160 Ga0500633_0051002 Ga0500633_0051002_39_284 81
1415 3300053161 Ga0500634_0369540 Ga0500634_0369540_99_344 81
1416 3300053177 Ga0500636_0049874 Ga0500636_0049874_1214_1459 81
1417 3300053177 Ga0500636_0145843 Ga0500636_0145843_349_594 81
1418 3300053178 Ga0500637_0252674 Ga0500637_0252674_525_770 81
1419 3300053727 Ga0500611_000061 Ga0500611_000061_28797_29042 81
1420 3300053730 Ga0500645_028526 Ga0500645_028526_498_743 81
1421 3300053739 Ga0500587_007289 Ga0500587_007289_375_620 81
1422 3300055283 Ga0500661_027845 Ga0500661_027845_597_842 81
1423 3300055283 Ga0500661_058724 Ga0500661_058724_105_350 81
1424 3300061719 Ga0466962_0242986 Ga0466962_0242986_80_328 81
1425 3300061719 Ga0466962_0518041 Ga0466962_0518041_231_479 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

4

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vq3-assembly1.cif.gz_C crystal structure of phosphoribosylformylglycinamidine synthase, purs subunit (ec 6.3.5.3) (tm1244) from thermotoga maritima at 1.90 a resolution 0.7778 1 81
1vq3-assembly1.cif.gz_C crystal structure of phosphoribosylformylglycinamidine synthase, purs subunit (ec 6.3.5.3) (tm1244) from thermotoga maritima at 1.90 a resolution 0.7698 1 81
3d54-assembly1.cif.gz_J structure of purlqs from thermotoga maritima 0.7583 1 81
3d54-assembly1.cif.gz_J structure of purlqs from thermotoga maritima 0.7505 1 81
2dgb-assembly1.cif.gz_D structure of thermus thermophilus purs in the p21 form 0.7463 1 79
ID Description Score Start End Superfamily
2dgbA00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.7996 1 81 3.30.1280.10
3d54J00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.7583 1 81 3.30.1280.10
3d54J00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.7505 1 81 3.30.1280.10
af_Q2FZJ2_1_81_3.30.1280.10 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.7305 3 81 3.30.1280.10
2zw2B00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.7204 1 81 3.30.1280.10
ID Description Score Start End GO Terms
AF-A0A3D3PB86-F1-model_v4 Phosphoribosylformylglycinamidine synthase 0.8382 1 59 GO:0004642
GO:0005524
GO:0005737
GO:0006164
AF-A0A1F8TPV3-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.825 1 81 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A1F7FYP8-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.8242 1 81 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A1Q8AAM7-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.8202 2 81 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A7V3YLU7-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS 0.8202 1 62 GO:0004642
GO:0005524
GO:0005737
GO:0009152

Feature Viewer

pLDDT pTM Quality
88.66 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map