F493765

General Info

Members Datasets Scaffolds Average Seq Length
1413 622 1335 163

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100585954|Ga0070670_1005859541
Length 190
Sequence MAWPDLGQTSGRPYNPAYVFGFPKRIDLMTAPVAIIMGSQSDWETMRHAADTLAALGIPCEKRIVSAHRTPDRLFAFARGAKAAGFKIIVAGAGGAAHLPGMVASLTELPVFGVPIESKALSGVDSLYSIVQMPAGVPVGTLAIGKPGAINAALLAASVLALNDPALSAGLAAWRKAQTEAIAERPEGSA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2516143018 Ensifer sp. BR816 Isolate Nodule
10 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
13 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
14 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
15 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
16 2643221618 Ensifer sp. Root231 Isolate Unclassified
17 2643221626 Ensifer sp. Root31 Isolate Unclassified
18 2643221651 Afipia sp. Root123D2 Isolate Unclassified
19 2643221655 Ensifer sp. Root1252 Isolate Unclassified
20 2643221659 Ensifer sp. Root127 Isolate Unclassified
21 2643221698 Ensifer sp. Root142 Isolate Unclassified
22 2643221712 Ensifer sp. Root258 Isolate Unclassified
23 2643221723 Ensifer sp. Root278 Isolate Unclassified
24 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
27 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
28 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
29 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
30 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
31 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
32 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2791355199
35 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
36 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
37 2844163670 Ensifer sp. 1H6 Isolate Unclassified
38 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
39 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
40 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
41 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
42 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
43 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
44 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
45 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
46 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
47 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
48 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
49 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
50 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
51 2906610324
52 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
53 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
54 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
55 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
56 2909042592 Labrys sp. LIt4 Isolate Nodule
57 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
58 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
59 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
60 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
61 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
62 2922425934
63 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
64 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
65 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
66 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
67 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
68 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
69 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
70 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
71 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
72 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
73 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
76 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
78 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
79 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
89 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
90 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
91 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
92 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
95 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
96 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
107 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
108 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
109 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
110 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
111 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
112 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
113 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
114 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
115 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
116 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
117 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
118 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
119 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
120 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
121 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
122 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
123 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
124 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
125 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
126 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
127 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
128 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
129 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
132 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
133 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
134 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
135 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
136 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
137 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
138 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
139 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
140 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
141 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
142 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
143 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
144 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
145 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
146 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
147 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
148 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
149 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
150 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
151 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
152 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
153 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
154 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
155 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
156 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
157 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
158 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
159 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
160 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
161 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
162 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
163 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
164 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
165 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
166 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
167 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
168 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
169 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
170 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
171 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
172 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
173 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
174 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
175 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
176 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
177 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
178 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
179 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
180 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
181 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
182 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
183 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
184 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
185 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
186 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
187 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
188 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
189 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
190 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
191 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
192 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
193 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
194 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
195 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
196 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
197 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
198 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
199 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
200 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
201 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
202 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
203 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
204 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
205 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
206 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
207 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
208 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
209 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
211 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
212 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
213 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
214 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
215 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
216 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
217 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
218 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
219 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
220 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
223 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
226 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
228 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
230 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
232 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
295 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
296 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
297 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
298 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
302 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
303 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
304 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
305 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
306 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
307 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
308 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
309 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
310 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
311 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
312 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
313 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
314 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
315 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
316 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
317 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
318 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
319 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
320 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
321 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
322 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
323 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
324 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
325 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
326 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
327 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
328 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
329 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
330 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
331 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
332 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
333 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
334 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
335 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
336 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
337 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
338 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
339 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
340 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
341 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
342 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
343 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
344 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
345 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
346 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
347 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
348 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
349 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
350 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
351 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
352 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
353 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
354 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
355 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
356 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
357 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
358 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
359 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
360 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
361 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
362 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
363 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
364 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
365 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
366 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
367 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
368 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
369 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
370 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
371 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
372 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
373 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
374 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
375 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
376 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
377 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
378 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
379 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
380 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
381 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
382 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
383 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
384 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
385 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
386 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
387 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
388 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
389 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
390 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
391 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
392 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
393 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
394 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
395 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
396 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
397 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
398 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
399 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
400 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
401 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
402 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
403 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
404 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
405 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
406 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
407 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
408 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
409 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
410 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
411 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
412 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
413 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
414 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
415 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
416 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
417 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
418 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
419 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
420 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
421 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
422 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
423 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
424 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
425 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
426 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
427 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
428 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
429 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
430 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
431 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
432 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
433 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
434 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
435 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
436 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
437 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
438 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
439 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
440 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
441 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
442 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
443 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
444 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
445 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
446 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
447 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
448 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
449 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
450 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
451 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
452 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
453 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
454 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
455 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
456 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
457 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
458 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
459 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
460 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
461 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
462 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
463 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
464 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
465 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
466 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
467 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
468 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
469 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
470 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
471 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
472 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
473 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
474 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
475 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
476 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
477 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
478 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
479 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
480 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
481 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
482 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
483 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
484 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
485 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
486 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
487 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
488 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
489 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
490 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
491 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
492 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
493 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
494 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
495 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
496 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
497 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
498 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
499 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
514 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
515 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
516 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
517 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
518 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
519 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
520 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
521 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
522 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
523 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
524 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
525 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
526 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
527 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
528 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
529 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
531 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
532 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
533 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
534 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
535 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
536 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
537 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
538 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
539 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
540 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
541 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
542 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
543 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
544 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
545 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
546 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
547 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
548 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
549 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
550 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
551 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
552 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
553 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
554 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
555 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
556 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
557 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
558 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
559 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
560 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
561 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
562 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
563 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
564 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
565 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
566 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
567 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
568 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
569 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
570 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
571 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
572 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
573 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
574 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
575 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
576 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
577 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
578 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
579 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
580 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
581 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
582 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
583 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
584 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
585 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
586 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
587 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
588 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
589 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
590 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
591 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
592 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
593 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
594 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
595 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
596 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
597 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
598 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
599 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
600 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
601 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
602 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
603 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
604 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
605 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
606 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
607 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
608 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
609 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
610 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
611 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
612 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
613 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
614 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
615 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
616 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
617 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
618 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
619 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
620 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
621 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
622 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0.21
Isolates 5.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.61
Nodule 3.75
Rhizoplane 4.81
Rhizosphere 70.84
Stem 0
Stem Tuber 0
Unclassified 8.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10013161 3300002244 Bacteria 1384
2 JGI25158J39367_1001328 3300002739 Bacteria 4382
3 JGI25159J45721_1000018 3300002987 Bacteria 132603
4 JGI25406J46586_10004829 3300003203 Bacteria 6266
5 JGI25406J46586_10119250 3300003203 Bacteria 777
6 JGI25160J50197_1000009 3300003354 Bacteria 282862
7 JGI25161J50226_1000920 3300003374 Bacteria 10556
8 JGI25404J52841_10006426 3300003659 Bacteria 2459
9 JGI25404J52841_10025723 3300003659 Bacteria 1267
10 JGI25404J52841_10055406 3300003659 Bacteria 832
11 Ga0055539_1007498 3300003752 Bacteria 1379
12 Ga0055526_1003070 3300003771 Bacteria 10856
13 Ga0055536_1000168 3300003781 Bacteria 54941
14 Ga0055530_10009693 3300003791 Bacteria 3664
15 Ga0055531_10001176 3300003794 Bacteria 20140
16 JGI25405J52794_10022829 3300003911 Bacteria 1271
17 Ga0055543_1000379 3300004625 Bacteria 29065
18 Ga0065165_1000020 3300005262 Bacteria 265570
19 Ga0070658_10282915 3300005327 Bacteria 1412
20 Ga0070676_10128819 3300005328 Bacteria 1598
21 Ga0070676_11332112 3300005328 Bacteria 549
22 Ga0070683_100005509 3300005329 Bacteria 10574
23 Ga0070683_100116045 3300005329 Bacteria 2528
24 Ga0070690_100283953 3300005330 Bacteria 1182
25 Ga0070690_100369537 3300005330 Bacteria 1046
26 Ga0070670_100585954 3300005331 Bacteria 997
27 Ga0070666_10551198 3300005335 Bacteria 839
28 Ga0070680_100032227 3300005336 Bacteria 4217
29 Ga0070680_100047062 3300005336 Bacteria 3511
30 Ga0070680_100059733 3300005336 Bacteria 3120
31 Ga0070680_100081160 3300005336 Bacteria 2676
32 Ga0070682_100062949 3300005337 Bacteria 2351
33 Ga0070682_100103296 3300005337 Bacteria 1885
34 Ga0070682_100467807 3300005337 Bacteria 969
35 Ga0068868_100062713 3300005338 Bacteria 2947
36 Ga0070660_100105470 3300005339 Bacteria 2237
37 Ga0070660_100129823 3300005339 Bacteria 2016
38 Ga0070660_100255057 3300005339 Bacteria 1431
39 Ga0070689_100141012 3300005340 Bacteria 1938
40 Ga0070691_10092184 3300005341 Bacteria 1495
41 Ga0070661_100059699 3300005344 Bacteria 2798
42 Ga0070661_100429771 3300005344 Bacteria 1048
43 Ga0070692_10460786 3300005345 Bacteria 816
44 Ga0070668_100000021 3300005347 Bacteria 96397
45 Ga0070668_100907068 3300005347 Bacteria 788
46 Ga0070675_101088589 3300005354 Bacteria 735
47 Ga0070671_100000114 3300005355 Bacteria 51983
48 Ga0070671_100007073 3300005355 Bacteria 8988
49 Ga0070671_100067271 3300005355 Bacteria 2987
50 Ga0070671_100150697 3300005355 Bacteria 1964
51 Ga0070674_100020438 3300005356 Bacteria 4231
52 Ga0070674_100582631 3300005356 Bacteria 943
53 Ga0070673_100517667 3300005364 Bacteria 1081
54 Ga0070659_100069240 3300005366 Bacteria 2800
55 Ga0070659_100179910 3300005366 Bacteria 1735
56 Ga0070659_100401918 3300005366 Bacteria 1156
57 Ga0070667_100254144 3300005367 Bacteria 1572
58 Ga0070667_100491344 3300005367 Bacteria 1124
59 Ga0070667_100861179 3300005367 Bacteria 843
60 Ga0070703_10011423 3300005406 Bacteria 2508
61 Ga0070709_10002522 3300005434 Bacteria 9912
62 Ga0070709_10073314 3300005434 Bacteria 2216
63 Ga0070709_10782322 3300005434 Bacteria 748
64 Ga0070709_11052826 3300005434 Bacteria 649
65 Ga0070714_100022715 3300005435 Bacteria 5146
66 Ga0070714_100048487 3300005435 Bacteria 3613
67 Ga0070714_100154234 3300005435 Bacteria 2072
68 Ga0070714_100301584 3300005435 Bacteria 1494
69 Ga0070714_100511644 3300005435 Bacteria 1146
70 Ga0070713_100010481 3300005436 Bacteria 6695
71 Ga0070713_100024458 3300005436 Bacteria 4705
72 Ga0070713_100186788 3300005436 Bacteria 1865
73 Ga0070713_100343902 3300005436 Bacteria 1383
74 Ga0070710_10002131 3300005437 Bacteria 9381
75 Ga0070710_10010042 3300005437 Bacteria 4641
76 Ga0070710_10033210 3300005437 Bacteria 2800
77 Ga0070711_100002112 3300005439 Bacteria 11240
78 Ga0070711_100010614 3300005439 Bacteria 5706
79 Ga0070711_100094377 3300005439 Bacteria 2162
80 Ga0070694_100296546 3300005444 Bacteria 1237
81 Ga0070708_100507479 3300005445 Bacteria 1138
82 Ga0070663_100014258 3300005455 Bacteria 5096
83 Ga0070663_100071097 3300005455 Bacteria 2531
84 Ga0070663_100403798 3300005455 Bacteria 1117
85 Ga0070678_100057001 3300005456 Bacteria 2860
86 Ga0070678_100114280 3300005456 Bacteria 2117
87 Ga0070678_100276809 3300005456 Bacteria 1417
88 Ga0070678_100391638 3300005456 Bacteria 1205
89 Ga0070662_100543948 3300005457 Bacteria 972
90 Ga0070681_10026470 3300005458 Bacteria 5828
91 Ga0070681_10218167 3300005458 Bacteria 1823
92 Ga0070681_10303321 3300005458 Bacteria 1506
93 Ga0068867_100185987 3300005459 Bacteria 1654
94 Ga0068867_100441120 3300005459 Bacteria 1107
95 Ga0070706_100290542 3300005467 Bacteria 1525
96 Ga0070706_101186902 3300005467 Bacteria 701
97 Ga0070699_100143795 3300005518 Bacteria 2107
98 Ga0070699_101548770 3300005518 Bacteria 607
99 Ga0070679_100052906 3300005530 Bacteria 4042
100 Ga0070679_100084151 3300005530 Bacteria 3169
101 Ga0070679_100149996 3300005530 Bacteria 2308
102 Ga0070679_100267529 3300005530 Bacteria 1664
103 Ga0070679_100610053 3300005530 Bacteria 1034
104 Ga0070679_101357562 3300005530 Bacteria 657
105 Ga0070684_100036017 3300005535 Bacteria 4239
106 Ga0070697_100305752 3300005536 Bacteria 1367
107 Ga0068853_100068543 3300005539 Bacteria 3084
108 Ga0068853_100185607 3300005539 Bacteria 1888
109 Ga0068853_100900210 3300005539 Bacteria 850
110 Ga0070672_100163221 3300005543 Bacteria 1850
111 Ga0070686_100315103 3300005544 Bacteria 1164
112 Ga0070686_100404931 3300005544 Bacteria 1038
113 Ga0070695_100879197 3300005545 Bacteria 722
114 Ga0070696_100938113 3300005546 Bacteria 720
115 Ga0070693_100108922 3300005547 Bacteria 1700
116 Ga0070693_100880423 3300005547 Bacteria 670
117 Ga0070665_100007112 3300005548 Bacteria 11373
118 Ga0070665_100036710 3300005548 Bacteria 4928
119 Ga0070665_100058806 3300005548 Bacteria 3853
120 Ga0070665_100185823 3300005548 Bacteria 2079
121 Ga0070665_100404859 3300005548 Bacteria 1372
122 Ga0070665_100477047 3300005548 Bacteria 1258
123 Ga0070665_101409716 3300005548 Bacteria 706
124 Ga0070704_100193939 3300005549 Bacteria 1635
125 Ga0068855_100015668 3300005563 Bacteria 9121
126 Ga0068855_100025571 3300005563 Bacteria 7061
127 Ga0068855_100188782 3300005563 Bacteria 2326
128 Ga0068855_100284931 3300005563 Bacteria 1833
129 Ga0068855_100338809 3300005563 Bacteria 1659
130 Ga0068855_101879947 3300005563 Bacteria 607
131 Ga0070664_100071249 3300005564 Bacteria 2978
132 Ga0068857_100062152 3300005577 Bacteria 3320
133 Ga0068857_100415707 3300005577 Bacteria 1253
134 Ga0068854_100118632 3300005578 Bacteria 2005
135 Ga0068854_100341037 3300005578 Bacteria 1224
136 Ga0068856_100000055 3300005614 Bacteria 104152
137 Ga0068856_100109014 3300005614 Bacteria 2765
138 Ga0068856_100132569 3300005614 Bacteria 2497
139 Ga0068856_100347992 3300005614 Bacteria 1501
140 Ga0070702_100245080 3300005615 Bacteria 1211
141 Ga0068852_100012401 3300005616 Bacteria 6470
142 Ga0068852_100085424 3300005616 Bacteria 2811
143 Ga0068852_100254822 3300005616 Bacteria 1683
144 Ga0068852_100394068 3300005616 Bacteria 1361
145 Ga0068852_100532961 3300005616 Bacteria 1173
146 Ga0068859_100016862 3300005617 Bacteria 7332
147 Ga0068859_101926464 3300005617 Bacteria 653
148 Ga0068864_100130417 3300005618 Bacteria 2257
149 Ga0068864_100625516 3300005618 Bacteria 1046
150 Ga0068866_10072331 3300005718 Bacteria 1826
151 Ga0068861_100058125 3300005719 Bacteria 2956
152 Ga0068861_100262215 3300005719 Bacteria 1480
153 Ga0068861_100391056 3300005719 Bacteria 1231
154 Ga0068863_100000043 3300005841 Bacteria 153935
155 Ga0068863_100112354 3300005841 Bacteria 2594
156 Ga0068863_101019888 3300005841 Bacteria 830
157 Ga0068858_100227226 3300005842 Bacteria 1769
158 Ga0068858_100479481 3300005842 Bacteria 1200
159 Ga0068858_100586125 3300005842 Bacteria 1081
160 Ga0068860_100112956 3300005843 Bacteria 2597
161 Ga0068860_100537885 3300005843 Bacteria 1169
162 Ga0068862_100183373 3300005844 Bacteria 1880
163 Ga0081455_10005648 3300005937 Bacteria 13662
164 Ga0081455_10032267 3300005937 Bacteria 4722
165 Ga0081455_10068600 3300005937 Bacteria 2951
166 Ga0081455_10487484 3300005937 Bacteria 832
167 Ga0081538_10001674 3300005981 Bacteria 22604
168 Ga0081538_10022689 3300005981 Bacteria 4540
169 Ga0081540_1001390 3300005983 Bacteria 20964
170 Ga0081540_1002001 3300005983 Bacteria 17007
171 Ga0081540_1007778 3300005983 Bacteria 7585
172 Ga0081540_1008054 3300005983 Bacteria 7413
173 Ga0081540_1009977 3300005983 Bacteria 6473
174 Ga0081540_1025849 3300005983 Bacteria 3367
175 Ga0081540_1061349 3300005983 Bacteria 1793
176 Ga0081540_1069601 3300005983 Bacteria 1634
177 Ga0081539_10001188 3300005985 Bacteria 46982
178 Ga0081539_10040716 3300005985 Bacteria 2725
179 Ga0070717_10233283 3300006028 Bacteria 1621
180 Ga0070717_10378248 3300006028 Bacteria 1269
181 Ga0075365_10036277 3300006038 Bacteria 3194
182 Ga0075365_10044545 3300006038 Bacteria 2908
183 Ga0075365_10154050 3300006038 Bacteria 1599
184 Ga0075365_10193886 3300006038 Bacteria 1422
185 Ga0075365_10406838 3300006038 Bacteria 960
186 Ga0075368_10031198 3300006042 Bacteria 2065
187 Ga0075363_100024437 3300006048 Bacteria 3071
188 Ga0075363_100042516 3300006048 Bacteria 2402
189 Ga0075363_100287711 3300006048 Bacteria 952
190 Ga0075363_100696742 3300006048 Bacteria 613
191 Ga0075364_10028092 3300006051 Bacteria 3599
192 Ga0075364_10109512 3300006051 Bacteria 1842
193 Ga0070715_10017492 3300006163 Bacteria 2714
194 Ga0070715_10047287 3300006163 Bacteria 1833
195 Ga0070716_100039631 3300006173 Bacteria 2616
196 Ga0070716_100094063 3300006173 Bacteria 1821
197 Ga0070716_100773824 3300006173 Bacteria 741
198 Ga0070716_101073402 3300006173 Bacteria 641
199 Ga0070712_100019951 3300006175 Bacteria 4383
200 Ga0070712_100022644 3300006175 Bacteria 4140
201 Ga0070712_100024690 3300006175 Bacteria 3986
202 Ga0070712_100054123 3300006175 Bacteria 2804
203 Ga0070712_100105334 3300006175 Bacteria 2094
204 Ga0070712_100232178 3300006175 Bacteria 1466
205 Ga0070712_100365845 3300006175 Bacteria 1184
206 Ga0075362_10165498 3300006177 Bacteria 1066
207 Ga0075367_10015243 3300006178 Bacteria 4172
208 Ga0075367_10025742 3300006178 Bacteria 3330
209 Ga0075367_10138147 3300006178 Bacteria 1508
210 Ga0075367_10313901 3300006178 Bacteria 987
211 Ga0075367_10380622 3300006178 Bacteria 892
212 Ga0075369_10067109 3300006186 Bacteria 1574
213 Ga0075369_10091981 3300006186 Bacteria 1354
214 Ga0075369_10183723 3300006186 Bacteria 962
215 Ga0075366_10296025 3300006195 Bacteria 990
216 Ga0097621_100071832 3300006237 Bacteria 2861
217 Ga0097621_101801221 3300006237 Bacteria 584
218 Ga0075370_10107531 3300006353 Bacteria 1618
219 Ga0075370_10348669 3300006353 Bacteria 884
220 Ga0068871_100263261 3300006358 Bacteria 1504
221 Ga0068871_100654333 3300006358 Bacteria 959
222 Ga0068871_100974776 3300006358 Bacteria 789
223 Ga0075428_100062853 3300006844 Bacteria 4064
224 Ga0075430_100079159 3300006846 Bacteria 2755
225 Ga0075431_100001907 3300006847 Bacteria 19804
226 Ga0075431_100472959 3300006847 Bacteria 1247
227 Ga0075433_10426323 3300006852 Bacteria 1170
228 Ga0075434_100042655 3300006871 Bacteria 4498
229 Ga0075434_100281484 3300006871 Bacteria 1683
230 Ga0075429_100005227 3300006880 Bacteria 11166
231 Ga0068865_100196452 3300006881 Bacteria 1563
232 Ga0068865_100297496 3300006881 Bacteria 1290
233 Ga0097620_100016862 3300006931 Bacteria 7332
234 Ga0097620_100284108 3300006931 Bacteria 1747
235 Ga0097620_101926151 3300006931 Bacteria 653
236 Ga0099824_1007275 3300006942 Bacteria 14758
237 Ga0099822_1013306 3300006943 Bacteria 9674
238 Ga0099823_1076226 3300006944 Bacteria 1383
239 Ga0075435_100084152 3300007076 Bacteria 2617
240 Ga0075435_100105362 3300007076 Bacteria 2341
241 Ga0075435_101115497 3300007076 Bacteria 690
242 Ga0099795_10089844 3300007788 Bacteria 1189
243 Ga0105251_10530976 3300009011 Bacteria 552
244 Ga0105240_10057119 3300009093 Bacteria 4879
245 Ga0111539_10000178 3300009094 Bacteria 73928
246 Ga0111539_10057625 3300009094 Bacteria 4612
247 Ga0111539_10069960 3300009094 Bacteria 4143
248 Ga0111539_10091704 3300009094 Bacteria 3570
249 Ga0105245_10782135 3300009098 Bacteria 992
250 Ga0105247_10047041 3300009101 Bacteria 2649
251 Ga0105247_10074777 3300009101 Bacteria 2125
252 Ga0105247_10127179 3300009101 Bacteria 1657
253 Ga0105247_10212662 3300009101 Bacteria 1305
254 Ga0114129_10001129 3300009147 Bacteria 35251
255 Ga0114129_10147099 3300009147 Bacteria 3227
256 Ga0114129_10263752 3300009147 Bacteria 2307
257 Ga0114129_11200066 3300009147 Bacteria 945
258 Ga0114129_11436707 3300009147 Bacteria 850
259 Ga0105243_10613798 3300009148 Bacteria 1049
260 Ga0105241_10194732 3300009174 Bacteria 1689
261 Ga0105241_10313467 3300009174 Bacteria 1350
262 Ga0105241_10660773 3300009174 Bacteria 950
263 Ga0105242_11469260 3300009176 Bacteria 711
264 Ga0105248_10048948 3300009177 Bacteria 4741
265 Ga0105248_10062199 3300009177 Bacteria 4192
266 Ga0105248_10461520 3300009177 Bacteria 1432
267 Ga0105237_10033693 3300009545 Bacteria 5188
268 Ga0105237_10157860 3300009545 Bacteria 2266
269 Ga0105237_10450674 3300009545 Bacteria 1293
270 Ga0105238_11454779 3300009551 Bacteria 713
271 Ga0105249_10003685 3300009553 Bacteria 13206
272 Ga0099796_10290222 3300010159 Bacteria 690
273 Ga0105239_10064277 3300010375 Bacteria 4029
274 Ga0105239_10115634 3300010375 Bacteria 2976
275 Ga0105239_10259389 3300010375 Bacteria 1953
276 Ga0105239_10408015 3300010375 Bacteria 1538
277 Ga0105239_11261989 3300010375 Bacteria 852
278 Ga0105239_11972325 3300010375 Bacteria 677
279 Ga0105246_10132355 3300011119 Bacteria 1864
280 Ga0105246_10257260 3300011119 Bacteria 1389
281 Ga0157370_10012374 3300013104 Bacteria 8851
282 Ga0157370_10018311 3300013104 Bacteria 7046
283 Ga0157370_10056509 3300013104 Bacteria 3735
284 Ga0157370_10222336 3300013104 Bacteria 1749
285 Ga0157369_10010958 3300013105 Bacteria 10320
286 Ga0157369_10223186 3300013105 Bacteria 1972
287 Ga0157369_10305195 3300013105 Bacteria 1655
288 Ga0157369_10601811 3300013105 Bacteria 1135
289 Ga0171463_1006 3300013249 Bacteria 336402
290 Ga0157374_10018619 3300013296 Bacteria 6132
291 Ga0157378_10048781 3300013297 Bacteria 3766
292 Ga0157378_10643001 3300013297 Bacteria 1076
293 Ga0157378_11616201 3300013297 Bacteria 694
294 Ga0163162_10889368 3300013306 Bacteria 1004
295 Ga0163162_12605797 3300013306 Bacteria 582
296 Ga0157372_10041439 3300013307 Bacteria 5092
297 Ga0157372_10294661 3300013307 Bacteria 1887
298 Ga0157372_11020285 3300013307 Bacteria 958
299 Ga0157372_12357385 3300013307 Bacteria 611
300 Ga0157375_10026458 3300013308 Bacteria 5407
301 Ga0157375_10156886 3300013308 Bacteria 2415
302 Ga0157375_10479866 3300013308 Bacteria 1408
303 Ga0157375_12404742 3300013308 Bacteria 629
304 Ga0163163_10493659 3300014325 Bacteria 1286
305 Ga0163163_10757124 3300014325 Bacteria 1035
306 Ga0163163_10846248 3300014325 Bacteria 978
307 Ga0157380_10462971 3300014326 Bacteria 1221
308 Ga0157379_10013008 3300014968 Bacteria 7284
309 Ga0157379_10721605 3300014968 Bacteria 937
310 Ga0157376_10069756 3300014969 Bacteria 2981
311 Ga0157376_11124189 3300014969 Bacteria 812
312 Ga0157376_11501603 3300014969 Bacteria 707
313 Ga0183363_1018 3300015690 Bacteria 62625
314 Ga0163161_10109321 3300017792 Bacteria 2065
315 Ga0206354_11535455 3300020081 Bacteria 719
316 Ga0206353_10607391 3300020082 Bacteria 1059
317 Ga0214544_1001241 3300021320 Bacteria 52071
318 Ga0214542_1000115 3300021321 Bacteria 109873
319 Ga0214542_1014437 3300021321 Bacteria 8813
320 Ga0214543_1000008 3300021327 Bacteria 385680
321 Ga0214543_1000098 3300021327 Bacteria 109894
322 Ga0213872_10111020 3300021361 Bacteria 1218
323 Ga0213874_10054570 3300021377 Bacteria 1236
324 Ga0213874_10088994 3300021377 Bacteria 1011
325 Ga0213876_10016738 3300021384 Bacteria 3873
326 Ga0213875_10024254 3300021388 Bacteria 2894
327 Ga0213875_10322147 3300021388 Bacteria 733
328 Ga0209436_104530 3300025208 Bacteria 3419
329 Ga0207425_1011774 3300025245 Bacteria 2072
330 Ga0209677_100264 3300025253 Bacteria 35560
331 Ga0209148_1013301 3300025254 Bacteria 1483
332 Ga0209233_1001365 3300025261 Bacteria 9696
333 Ga0209233_1004762 3300025261 Bacteria 4576
334 Ga0209565_1010490 3300025263 Bacteria 2295
335 Ga0209455_1004866 3300025272 Bacteria 4279
336 Ga0209455_1018854 3300025272 Bacteria 1407
337 Ga0209130_1000037 3300025284 Bacteria 284019
338 Ga0209676_1000239 3300025292 Bacteria 117696
339 Ga0209025_1000196 3300025294 Bacteria 147356
340 Ga0209564_1000086 3300025295 Bacteria 251385
341 Ga0209564_1009473 3300025295 Bacteria 4630
342 Ga0209758_1038909 3300025297 Bacteria 1817
343 Ga0209050_1001390 3300025298 Bacteria 26333
344 Ga0207426_1000048 3300025302 Bacteria 409127
345 Ga0209051_1001690 3300025303 Bacteria 17714
346 Ga0209257_1001192 3300025304 Bacteria 32713
347 Ga0207697_10079095 3300025315 Bacteria 1384
348 Ga0207697_10113864 3300025315 Bacteria 1159
349 Ga0207653_10005522 3300025885 Bacteria 3948
350 Ga0207682_10043080 3300025893 Bacteria 1846
351 Ga0207692_10002507 3300025898 Bacteria 7048
352 Ga0207692_10017119 3300025898 Bacteria 3225
353 Ga0207692_10119824 3300025898 Bacteria 1472
354 Ga0207692_10716662 3300025898 Bacteria 650
355 Ga0207642_10009209 3300025899 Bacteria 3426
356 Ga0207710_10032980 3300025900 Bacteria 2270
357 Ga0207710_10164795 3300025900 Bacteria 1081
358 Ga0207710_10223611 3300025900 Bacteria 935
359 Ga0207688_10246677 3300025901 Bacteria 1081
360 Ga0207688_10384606 3300025901 Bacteria 868
361 Ga0207647_10104124 3300025904 Bacteria 1682
362 Ga0207647_10266406 3300025904 Bacteria 980
363 Ga0207647_10499800 3300025904 Bacteria 678
364 Ga0207685_10037922 3300025905 Bacteria 1778
365 Ga0207685_10060377 3300025905 Bacteria 1499
366 Ga0207685_10063552 3300025905 Bacteria 1471
367 Ga0207699_10031457 3300025906 Bacteria 2979
368 Ga0207699_10033995 3300025906 Bacteria 2887
369 Ga0207699_10164847 3300025906 Bacteria 1478
370 Ga0207699_10165041 3300025906 Bacteria 1477
371 Ga0207699_10415613 3300025906 Bacteria 960
372 Ga0207699_10590914 3300025906 Bacteria 808
373 Ga0207645_10064188 3300025907 Bacteria 2346
374 Ga0207645_10107923 3300025907 Bacteria 1801
375 Ga0207645_10299138 3300025907 Bacteria 1071
376 Ga0207643_10645974 3300025908 Bacteria 682
377 Ga0207705_10421672 3300025909 Bacteria 1033
378 Ga0207684_10242111 3300025910 Bacteria 1556
379 Ga0207684_10312679 3300025910 Bacteria 1354
380 Ga0207684_10836184 3300025910 Bacteria 777
381 Ga0207654_10770809 3300025911 Bacteria 694
382 Ga0207707_10015807 3300025912 Bacteria 6580
383 Ga0207707_10037322 3300025912 Bacteria 4246
384 Ga0207707_10281258 3300025912 Bacteria 1441
385 Ga0207707_10491678 3300025912 Bacteria 1047
386 Ga0207707_10921718 3300025912 Bacteria 721
387 Ga0207707_11051478 3300025912 Bacteria 666
388 Ga0207695_10349049 3300025913 Bacteria 1367
389 Ga0207671_10020809 3300025914 Bacteria 4989
390 Ga0207671_10057575 3300025914 Bacteria 2881
391 Ga0207671_10129995 3300025914 Bacteria 1932
392 Ga0207671_10179245 3300025914 Bacteria 1648
393 Ga0207671_10239703 3300025914 Bacteria 1424
394 Ga0207671_10796407 3300025914 Bacteria 750
395 Ga0207693_10003443 3300025915 Bacteria 13501
396 Ga0207693_10034329 3300025915 Bacteria 4001
397 Ga0207693_10065210 3300025915 Bacteria 2852
398 Ga0207693_10066850 3300025915 Bacteria 2814
399 Ga0207693_10075789 3300025915 Bacteria 2634
400 Ga0207693_10080355 3300025915 Bacteria 2552
401 Ga0207693_10140313 3300025915 Bacteria 1900
402 Ga0207663_10002035 3300025916 Bacteria 9616
403 Ga0207663_10031403 3300025916 Bacteria 3144
404 Ga0207663_10031644 3300025916 Bacteria 3133
405 Ga0207663_10286262 3300025916 Bacteria 1226
406 Ga0207663_10574300 3300025916 Bacteria 884
407 Ga0207660_10061983 3300025917 Bacteria 2693
408 Ga0207660_10298987 3300025917 Bacteria 1281
409 Ga0207660_10940508 3300025917 Bacteria 705
410 Ga0207657_10009705 3300025919 Bacteria 9652
411 Ga0207657_10223318 3300025919 Bacteria 1508
412 Ga0207657_10223488 3300025919 Bacteria 1508
413 Ga0207657_10459632 3300025919 Bacteria 999
414 Ga0207649_10121706 3300025920 Bacteria 1760
415 Ga0207649_10133867 3300025920 Bacteria 1687
416 Ga0207649_10670281 3300025920 Bacteria 803
417 Ga0207652_10095355 3300025921 Bacteria 2620
418 Ga0207652_10240711 3300025921 Bacteria 1631
419 Ga0207652_10559937 3300025921 Bacteria 1027
420 Ga0207681_10107400 3300025923 Bacteria 2024
421 Ga0207681_10259799 3300025923 Bacteria 1359
422 Ga0207694_11205163 3300025924 Bacteria 641
423 Ga0207650_10184894 3300025925 Bacteria 1662
424 Ga0207650_10315235 3300025925 Bacteria 1280
425 Ga0207650_10781283 3300025925 Bacteria 809
426 Ga0207700_10007067 3300025928 Bacteria 6830
427 Ga0207700_10080515 3300025928 Bacteria 2540
428 Ga0207700_10139440 3300025928 Bacteria 1990
429 Ga0207700_10140903 3300025928 Bacteria 1981
430 Ga0207700_10360134 3300025928 Bacteria 1268
431 Ga0207664_10021207 3300025929 Bacteria 4827
432 Ga0207664_10028066 3300025929 Bacteria 4274
433 Ga0207664_10036418 3300025929 Bacteria 3803
434 Ga0207664_10773984 3300025929 Bacteria 863
435 Ga0207644_10000077 3300025931 Bacteria 72394
436 Ga0207644_10239399 3300025931 Bacteria 1444
437 Ga0207644_10305068 3300025931 Bacteria 1284
438 Ga0207690_10107512 3300025932 Bacteria 2004
439 Ga0207690_10155100 3300025932 Bacteria 1701
440 Ga0207690_10604848 3300025932 Bacteria 895
441 Ga0207706_10023157 3300025933 Bacteria 5579
442 Ga0207686_10377361 3300025934 Bacteria 1074
443 Ga0207709_10050550 3300025935 Bacteria 2543
444 Ga0207669_10018069 3300025937 Bacteria 3634
445 Ga0207669_10468097 3300025937 Bacteria 1002
446 Ga0207669_10539659 3300025937 Bacteria 939
447 Ga0207704_10476479 3300025938 Bacteria 1001
448 Ga0207665_10010412 3300025939 Bacteria 6108
449 Ga0207665_10054081 3300025939 Bacteria 2707
450 Ga0207665_10151020 3300025939 Bacteria 1664
451 Ga0207665_10719502 3300025939 Bacteria 785
452 Ga0207691_10144444 3300025940 Bacteria 2095
453 Ga0207691_10830352 3300025940 Bacteria 776
454 Ga0207711_10184139 3300025941 Bacteria 1900
455 Ga0207711_10363533 3300025941 Bacteria 1341
456 Ga0207711_10981675 3300025941 Bacteria 784
457 Ga0207689_10220943 3300025942 Bacteria 1565
458 Ga0207661_10015139 3300025944 Bacteria 5669
459 Ga0207661_10895380 3300025944 Bacteria 817
460 Ga0207679_11035552 3300025945 Bacteria 753
461 Ga0207667_10010515 3300025949 Bacteria 10813
462 Ga0207667_10012516 3300025949 Bacteria 9765
463 Ga0207667_10503559 3300025949 Bacteria 1228
464 Ga0207667_11155936 3300025949 Bacteria 755
465 Ga0207667_11597022 3300025949 Bacteria 621
466 Ga0207651_11429407 3300025960 Bacteria 623
467 Ga0207712_10016901 3300025961 Bacteria 4731
468 Ga0207668_10000068 3300025972 Bacteria 81202
469 Ga0207668_10677433 3300025972 Bacteria 905
470 Ga0207668_11297870 3300025972 Bacteria 655
471 Ga0207640_10166036 3300025981 Bacteria 1639
472 Ga0207640_10313821 3300025981 Bacteria 1245
473 Ga0207640_10326328 3300025981 Bacteria 1224
474 Ga0207658_10220840 3300025986 Bacteria 1594
475 Ga0207677_10240770 3300026023 Bacteria 1463
476 Ga0207703_10176674 3300026035 Bacteria 1882
477 Ga0207703_10541507 3300026035 Bacteria 1097
478 Ga0207703_11371736 3300026035 Bacteria 680
479 Ga0207703_11908406 3300026035 Bacteria 570
480 Ga0207639_10046533 3300026041 Bacteria 3274
481 Ga0207639_10344440 3300026041 Bacteria 1329
482 Ga0207639_10453430 3300026041 Bacteria 1165
483 Ga0207639_10793080 3300026041 Bacteria 882
484 Ga0207678_10036005 3300026067 Bacteria 4309
485 Ga0207678_10197973 3300026067 Bacteria 1717
486 Ga0207678_10199123 3300026067 Bacteria 1712
487 Ga0207678_11270392 3300026067 Bacteria 652
488 Ga0207702_10000287 3300026078 Bacteria 58488
489 Ga0207702_10082643 3300026078 Bacteria 2793
490 Ga0207702_10226868 3300026078 Bacteria 1743
491 Ga0207702_10469161 3300026078 Bacteria 1224
492 Ga0207702_11399887 3300026078 Bacteria 693
493 Ga0207641_10000031 3300026088 Bacteria 224320
494 Ga0207641_10118152 3300026088 Bacteria 2362
495 Ga0207641_10884774 3300026088 Bacteria 886
496 Ga0207648_10100216 3300026089 Bacteria 2537
497 Ga0207648_10123038 3300026089 Bacteria 2281
498 Ga0207676_10277842 3300026095 Bacteria 1519
499 Ga0207674_10068661 3300026116 Bacteria 3566
500 Ga0207674_10866228 3300026116 Bacteria 871
501 Ga0207674_11076227 3300026116 Bacteria 773
502 Ga0207675_100065722 3300026118 Bacteria 3390
503 Ga0207675_100785536 3300026118 Bacteria 965
504 Ga0207683_10077274 3300026121 Bacteria 2948
505 Ga0207683_10272055 3300026121 Bacteria 1547
506 Ga0207683_10291806 3300026121 Bacteria 1491
507 Ga0207683_10371043 3300026121 Bacteria 1315
508 Ga0207683_10455525 3300026121 Bacteria 1180
509 Ga0207683_10477914 3300026121 Bacteria 1150
510 Ga0207683_10810966 3300026121 Bacteria 869
511 Ga0207698_10010329 3300026142 Bacteria 5989
512 Ga0207698_10381493 3300026142 Bacteria 1341
513 Ga0207698_10911832 3300026142 Bacteria 886
514 Ga0207698_11024050 3300026142 Bacteria 837
515 Ga0209589_1000005 3300027357 Bacteria 530958
516 Ga0209489_100005 3300027361 Bacteria 530958
517 Ga0209700_100006 3300027363 Bacteria 530958
518 Ga0207428_10002929 3300027907 Bacteria 16912
519 Ga0207428_10160227 3300027907 Bacteria 1709
520 Ga0207428_10464316 3300027907 Bacteria 922
521 Ga0268266_10003479 3300028379 Bacteria 15692
522 Ga0268266_10007831 3300028379 Bacteria 9575
523 Ga0268266_10146697 3300028379 Bacteria 2122
524 Ga0268266_10425440 3300028379 Bacteria 1259
525 Ga0268266_11388549 3300028379 Bacteria 678
526 Ga0268265_10141140 3300028380 Bacteria 2017
527 Ga0268265_10153392 3300028380 Bacteria 1946
528 Ga0268265_10312183 3300028380 Bacteria 1420
529 Ga0268265_10534337 3300028380 Bacteria 1110
530 Ga0268264_10408066 3300028381 Bacteria 1307
531 Ga0265318_10069538 3300028577 Bacteria 1305
532 Ga0265318_10197676 3300028577 Bacteria 735
533 Ga0307517_10000098 3300028786 Bacteria 126044
534 Ga0307515_10164978 3300028794 Bacteria 2238
535 Ga0265338_10283522 3300028800 Bacteria 1209
536 Ga0265330_10052550 3300031235 Bacteria 1784
537 Ga0265332_10072809 3300031238 Bacteria 1463
538 Ga0265328_10000085 3300031239 Bacteria 48380
539 Ga0265328_10043394 3300031239 Bacteria 1654
540 Ga0265325_10003663 3300031241 Bacteria 9952
541 Ga0265329_10028176 3300031242 Bacteria 1843
542 Ga0265340_10023460 3300031247 Bacteria 3147
543 Ga0265340_10179736 3300031247 Bacteria 956
544 Ga0265339_10002699 3300031249 Bacteria 12623
545 Ga0265339_10012880 3300031249 Bacteria 5085
546 Ga0265339_10018045 3300031249 Bacteria 4168
547 Ga0265339_10061831 3300031249 Bacteria 2014
548 Ga0265331_10000007 3300031250 Bacteria 331074
549 Ga0265331_10007229 3300031250 Bacteria 6442
550 Ga0265331_10183401 3300031250 Bacteria 945
551 Ga0265331_10302707 3300031250 Bacteria 716
552 Ga0265316_10029606 3300031344 Bacteria 4499
553 Ga0265316_10148855 3300031344 Bacteria 1754
554 Ga0265316_10785473 3300031344 Bacteria 668
555 Ga0307513_10225523 3300031456 Bacteria 1691
556 Ga0307513_10423239 3300031456 Bacteria 1061
557 Ga0307513_10506529 3300031456 Bacteria 924
558 Ga0307509_10102974 3300031507 Bacteria 2884
559 Ga0307509_10279735 3300031507 Bacteria 1430
560 Ga0307509_10323496 3300031507 Bacteria 1277
561 Ga0307408_100086840 3300031548 Bacteria 2352
562 Ga0307408_100124425 3300031548 Bacteria 2003
563 Ga0265313_10002977 3300031595 Bacteria 14120
564 Ga0265313_10004093 3300031595 Bacteria 11354
565 Ga0265313_10011671 3300031595 Bacteria 5443
566 Ga0265313_10029352 3300031595 Bacteria 2846
567 Ga0307508_10000678 3300031616 Bacteria 40932
568 Ga0307508_10027524 3300031616 Bacteria 5144
569 Ga0307508_10115305 3300031616 Bacteria 2288
570 Ga0307508_10803174 3300031616 Bacteria 558
571 Ga0265314_10001099 3300031711 Bacteria 31235
572 Ga0265314_10006996 3300031711 Bacteria 9864
573 Ga0265314_10007614 3300031711 Bacteria 9375
574 Ga0265314_10063760 3300031711 Bacteria 2498
575 Ga0265314_10123984 3300031711 Bacteria 1621
576 Ga0265342_10039973 3300031712 Bacteria 2846
577 Ga0265342_10319551 3300031712 Bacteria 814
578 Ga0307516_10044194 3300031730 Bacteria 4409
579 Ga0307516_10054727 3300031730 Bacteria 3898
580 Ga0307516_10185848 3300031730 Bacteria 1808
581 Ga0307405_10225583 3300031731 Bacteria 1378
582 Ga0307405_10302810 3300031731 Bacteria 1213
583 Ga0307405_10340387 3300031731 Bacteria 1153
584 Ga0307413_10160948 3300031824 Bacteria 1577
585 Ga0307413_10363307 3300031824 Bacteria 1122
586 Ga0307413_10441353 3300031824 Bacteria 1031
587 Ga0307413_11542853 3300031824 Bacteria 588
588 Ga0307410_10460271 3300031852 Bacteria 1039
589 Ga0307412_10246753 3300031911 Bacteria 1384
590 Ga0307409_100310908 3300031995 Bacteria 1470
591 Ga0307416_100307599 3300032002 Bacteria 1579
592 Ga0307416_102498649 3300032002 Bacteria 615
593 Ga0307411_10195186 3300032005 Bacteria 1549
594 Ga0307411_10331018 3300032005 Bacteria 1234
595 Ga0307415_100977281 3300032126 Bacteria 785
596 Ga0307415_101680905 3300032126 Bacteria 612
597 Ga0307510_10005253 3300033180 Bacteria 15392
598 Ga0315911_1000022 3300033442 Bacteria 118114
599 Ga0316215_1006240 3300033544 Bacteria 1154
600 Ga0316216_1003343 3300033548 Bacteria 1152
601 Ga0373950_0012861 3300034818 Bacteria 1388
602 Ga0373938_0054638 3300034957 Bacteria 920
603 Ga0373926_0024385 3300035083 Bacteria 2106
604 Ga0373926_0138356 3300035083 Bacteria 924
605 Ga0373929_0024231 3300035085 Bacteria 1252
606 Ga0373949_0010439 3300035090 Bacteria 2036
607 Ga0373952_0089337 3300035092 Bacteria 798
608 Ga0373923_0007172 3300035111 Bacteria 3906
609 Ga0373923_0313601 3300035111 Bacteria 744
610 Ga0373932_0082230 3300035112 Bacteria 1019
611 Ga0373936_0038057 3300035113 Bacteria 1922
612 Ga0373936_0046065 3300035113 Bacteria 1758
613 Ga0373936_0075618 3300035113 Bacteria 1394
614 Ga0373936_0302135 3300035113 Bacteria 722
615 Ga0373945_0006472 3300035116 Bacteria 3780
616 Ga0373945_0260912 3300035116 Bacteria 734
617 Ga0373953_0049275 3300035117 Bacteria 1699
618 Ga0373960_0046468 3300035121 Bacteria 1274
619 Ga0373943_0127658 3300035170 Bacteria 1358
620 Ga0373943_0154842 3300035170 Bacteria 1244
621 Ga0373946_0200659 3300035171 Bacteria 955
622 Ga0373946_0366950 3300035171 Bacteria 722
623 Ga0373924_0264398 3300035410 Bacteria 762
624 Ga0373931_0000915 3300035691 Bacteria 12419
625 Ga0373931_0229891 3300035691 Bacteria 1120
626 Ga0373935_0009266 3300035692 Bacteria 5895
627 Ga0373935_0073599 3300035692 Bacteria 2207
628 Ga0373935_0151442 3300035692 Bacteria 1574
629 Ga0373935_0286650 3300035692 Bacteria 1160
630 Ga0373927_0003250 3300035695 Bacteria 11692
631 Ga0373927_0005961 3300035695 Bacteria 8346
632 Ga0373927_0032352 3300035695 Bacteria 3407
633 Ga0373927_0032748 3300035695 Bacteria 3385
634 Ga0373927_0074901 3300035695 Bacteria 2191
635 Ga0373927_0080688 3300035695 Bacteria 2108
636 Ga0373927_0083369 3300035695 Bacteria 2072
637 Ga0373927_0131012 3300035695 Bacteria 1638
638 Ga0373927_0485256 3300035695 Bacteria 816
639 Ga0373933_0000536 3300035724 Bacteria 23607
640 Ga0373933_0009887 3300035724 Bacteria 5223
641 Ga0373933_0579030 3300035724 Bacteria 737
642 Ga0373947_0078460 3300035725 Bacteria 2038
643 Ga0373947_0125529 3300035725 Bacteria 1634
644 Ga0373947_0283629 3300035725 Bacteria 1101
645 Ga0373947_0305050 3300035725 Bacteria 1062
646 Ga0373947_0307882 3300035725 Bacteria 1057
647 Ga0373937_0021969 3300036401 Bacteria 5730
648 Ga0372808_000838 3300036459 Bacteria 2818
649 Ga0373925_0027008 3300037068 Bacteria 4203
650 Ga0373925_0036358 3300037068 Bacteria 3634
651 Ga0373925_0173379 3300037068 Bacteria 1703
652 Ga0373925_0477839 3300037068 Bacteria 1022
653 Ga0395899_0018741 3300037312 Bacteria 5260
654 Ga0395900_0095404 3300037418 Bacteria 3056
655 Ga0395900_0317077 3300037418 Bacteria 1540
656 Ga0395900_0417097 3300037418 Bacteria 1304
657 Ga0395900_0561950 3300037418 Bacteria 1084
658 Ga0395900_0694941 3300037418 Bacteria 951
659 Ga0395898_0035381 3300037466 Bacteria 4967
660 Ga0395898_0054928 3300037466 Bacteria 3885
661 Ga0395898_0108406 3300037466 Bacteria 2663
662 Ga0395898_0744456 3300037466 Bacteria 921
663 Ga0395905_1096722 3300037471 Bacteria 699
664 Ga0436364_0005842 3300037853 Bacteria 1309
665 Ga0436364_0982560 3300037853 Bacteria 14460
666 Ga0436364_1034666 3300037853 Bacteria 1706
667 Ga0436364_1143755 3300037853 Bacteria 2044
668 Ga0436364_1324733 3300037853 Bacteria 1891
669 Ga0395901_0003860 3300038443 Bacteria 15077
670 Ga0436365_0205832 3300039437 Bacteria 15641
671 Ga0436365_0924470 3300039437 Bacteria 1935
672 Ga0436360_0179349 3300039438 Bacteria 1291
673 Ga0436360_0193747 3300039438 Bacteria 666
674 Ga0436360_1291396 3300039438 Bacteria 1139
675 Ga0436361_0028451 3300039447 Bacteria 785
676 Ga0436361_0086028 3300039447 Bacteria 2199
677 Ga0436361_0339604 3300039447 Bacteria 1798
678 Ga0436363_1083454 3300039450 Bacteria 1548
679 Ga0436363_1193054 3300039450 Bacteria 1552
680 Ga0436362_0088613 3300039453 Bacteria 9777
681 Ga0436362_0544940 3300039453 Bacteria 933
682 Ga0436362_0681126 3300039453 Bacteria 604
683 Ga0436362_0915997 3300039453 Bacteria 886
684 Ga0439436_0061893 3300041404 Bacteria 1047
685 Ga0439447_095373 3300041407 Bacteria 683
686 Ga0439465_0007899 3300041413 Bacteria 3371
687 Ga0451793_1853703 3300041452 Bacteria 1504
688 Ga0451795_0455491 3300041456 Bacteria 550
689 Ga0451802_0893213 3300041460 Bacteria 567
690 Ga0451835_0578077 3300041492 Bacteria 695
691 Ga0451853_0044773 3300041512 Bacteria 653
692 Ga0451853_1423910 3300041512 Bacteria 1048
693 Ga0439445_0074119 3300042004 Bacteria 945
694 Ga0439432_012787 3300042006 Bacteria 2863
695 Ga0439449_0030566 3300042007 Bacteria 2008
696 Ga0439449_0153962 3300042007 Bacteria 857
697 Ga0439455_0065262 3300042012 Bacteria 971
698 Ga0439440_0168658 3300042993 Bacteria 635
699 Ga0466969_0129919 3300044656 Bacteria 1168
700 Ga0466965_0076980 3300044683 Bacteria 1684
701 Ga0466961_0465244 3300044693 Bacteria 765
702 Ga0466968_0111699 3300044735 Bacteria 1229
703 Ga0466968_0156600 3300044735 Bacteria 1049
704 Ga0466970_0223633 3300044765 Bacteria 1051
705 Ga0466970_0250436 3300044765 Bacteria 992
706 Ga0466970_0416689 3300044765 Bacteria 767
707 Ga0466957_0587806 3300044842 Bacteria 779
708 Ga0466959_0102092 3300045049 Bacteria 2053
709 Ga0466959_0761497 3300045049 Bacteria 648
710 Ga0451576_0041218 3300045051 Bacteria 4883
711 Ga0466967_1372846 3300045976 Bacteria 704
712 Ga0495617_035898 3300046452 Bacteria 1663
713 Ga0495627_095052 3300046453 Bacteria 855
714 Ga0495592_0038026 3300046454 Bacteria 3622
715 Ga0495592_0127679 3300046454 Bacteria 1781
716 Ga0495603_0011165 3300046455 Bacteria 5446
717 Ga0495603_0022523 3300046455 Bacteria 3813
718 Ga0495603_0025847 3300046455 Bacteria 3549
719 Ga0495603_0138816 3300046455 Bacteria 1414
720 Ga0495603_0521846 3300046455 Bacteria 680
721 Ga0495590_0065417 3300046457 Bacteria 1273
722 Ga0495629_0182227 3300046459 Bacteria 1455
723 Ga0495629_0184168 3300046459 Bacteria 1447
724 Ga0495629_0567327 3300046459 Bacteria 761
725 Ga0495629_0868525 3300046459 Bacteria 592
726 Ga0495638_0024606 3300046460 Bacteria 3924
727 Ga0495638_0054657 3300046460 Bacteria 2481
728 Ga0495641_0044799 3300046461 Bacteria 2040
729 Ga0495641_0369729 3300046461 Bacteria 649
730 Ga0495651_0028221 3300046462 Bacteria 4374
731 Ga0495651_0113504 3300046462 Bacteria 2000
732 Ga0495651_0117170 3300046462 Bacteria 1961
733 Ga0495653_0046358 3300046463 Bacteria 3367
734 Ga0495580_0009940 3300046472 Bacteria 7446
735 Ga0495580_0530150 3300046472 Bacteria 784
736 Ga0495582_0007218 3300046473 Bacteria 6163
737 Ga0495582_0344184 3300046473 Bacteria 858
738 Ga0495605_0066802 3300046474 Bacteria 1707
739 Ga0495639_0014200 3300046475 Bacteria 3447
740 Ga0495639_0133759 3300046475 Bacteria 1188
741 Ga0495639_0312781 3300046475 Bacteria 784
742 Ga0495662_0205676 3300046476 Bacteria 970
743 Ga0495664_0015668 3300046477 Bacteria 4312
744 Ga0495664_0016768 3300046477 Bacteria 4179
745 Ga0495664_0071811 3300046477 Bacteria 2067
746 Ga0495664_0091152 3300046477 Bacteria 1832
747 Ga0495664_0147893 3300046477 Bacteria 1425
748 Ga0495664_0428084 3300046477 Bacteria 794
749 Ga0495584_0286735 3300046491 Bacteria 836
750 Ga0495584_0385134 3300046491 Bacteria 712
751 Ga0495585_0082648 3300046492 Bacteria 1738
752 Ga0495585_0087368 3300046492 Bacteria 1683
753 Ga0495585_0544216 3300046492 Bacteria 549
754 Ga0495596_0032426 3300046500 Bacteria 2083
755 Ga0495596_0145491 3300046500 Bacteria 921
756 Ga0495596_0273855 3300046500 Bacteria 655
757 Ga0495607_0244587 3300046501 Bacteria 866
758 Ga0495583_0048885 3300046506 Bacteria 1939
759 Ga0495583_0157240 3300046506 Bacteria 939
760 Ga0495606_0155528 3300046507 Bacteria 1338
761 Ga0495606_0302575 3300046507 Bacteria 866
762 Ga0495606_0554059 3300046507 Bacteria 571
763 Ga0495608_0017629 3300046511 Bacteria 4938
764 Ga0495608_0175709 3300046511 Bacteria 1357
765 Ga0495608_0316986 3300046511 Bacteria 964
766 Ga0495608_0692296 3300046511 Bacteria 607
767 Ga0495610_0401834 3300046512 Bacteria 505
768 Ga0495616_0059046 3300046513 Bacteria 1887
769 Ga0495616_0414348 3300046513 Bacteria 551
770 Ga0495618_0022470 3300046514 Bacteria 3896
771 Ga0495620_0078980 3300046515 Bacteria 1333
772 Ga0495628_0546390 3300046516 Bacteria 832
773 Ga0495628_0822976 3300046516 Bacteria 648
774 Ga0495630_0039214 3300046517 Bacteria 3543
775 Ga0495630_0040315 3300046517 Bacteria 3490
776 Ga0495630_0733223 3300046517 Bacteria 756
777 Ga0495631_0038572 3300046518 Bacteria 2123
778 Ga0495631_0068981 3300046518 Bacteria 1529
779 Ga0495631_0114158 3300046518 Bacteria 1161
780 Ga0495631_0130948 3300046518 Bacteria 1078
781 Ga0495631_0264148 3300046518 Bacteria 733
782 Ga0495632_0107100 3300046519 Bacteria 1314
783 Ga0495632_0142233 3300046519 Bacteria 1112
784 Ga0495637_0020908 3300046520 Bacteria 3003
785 Ga0495644_0216776 3300046523 Bacteria 739
786 Ga0495648_0067597 3300046524 Bacteria 2089
787 Ga0495652_0029766 3300046529 Bacteria 4793
788 Ga0495652_0264476 3300046529 Bacteria 1268
789 Ga0495652_0288021 3300046529 Bacteria 1200
790 Ga0495654_0126291 3300046530 Bacteria 1152
791 Ga0495654_0175175 3300046530 Bacteria 932
792 Ga0495586_0104521 3300046535 Bacteria 1574
793 Ga0495598_0048896 3300046537 Bacteria 1266
794 Ga0495597_0025983 3300046542 Bacteria 2692
795 Ga0495597_0095688 3300046542 Bacteria 1256
796 Ga0495645_0064136 3300046543 Bacteria 2659
797 Ga0495645_0135798 3300046543 Bacteria 1721
798 Ga0495622_0138326 3300046557 Bacteria 1106
799 Ga0495622_0240388 3300046557 Bacteria 798
800 Ga0495633_0195751 3300046558 Bacteria 928
801 Ga0495633_0333405 3300046558 Bacteria 688
802 Ga0495667_0007414 3300046559 Bacteria 7437
803 Ga0495667_0081398 3300046559 Bacteria 2105
804 Ga0495667_0301080 3300046559 Bacteria 1016
805 Ga0495656_0008259 3300046615 Bacteria 3712
806 Ga0495656_0215723 3300046615 Bacteria 958
807 Ga0495656_0255403 3300046615 Bacteria 886
808 Ga0495656_0312739 3300046615 Bacteria 807
809 Ga0495668_0017269 3300046616 Bacteria 4189
810 Ga0495668_0177892 3300046616 Bacteria 1165
811 Ga0495634_0065864 3300046642 Bacteria 2400
812 Ga0495634_0082039 3300046642 Bacteria 2108
813 Ga0495634_0113718 3300046642 Bacteria 1738
814 Ga0495634_0502189 3300046642 Bacteria 711
815 Ga0495611_0169521 3300046648 Bacteria 1020
816 Ga0495625_0242268 3300046660 Bacteria 1173
817 Ga0495625_0364230 3300046660 Bacteria 910
818 Ga0495635_0082927 3300046663 Bacteria 2194
819 Ga0495635_0098507 3300046663 Bacteria 1998
820 Ga0495635_0449267 3300046663 Bacteria 852
821 Ga0495661_0150860 3300046665 Bacteria 1255
822 Ga0495588_0036900 3300046674 Bacteria 2481
823 Ga0495588_0038457 3300046674 Bacteria 2434
824 Ga0495588_0153256 3300046674 Bacteria 1218
825 Ga0495588_0230927 3300046674 Bacteria 976
826 Ga0495657_0012557 3300046675 Bacteria 6288
827 Ga0495657_0051753 3300046675 Bacteria 2757
828 Ga0495599_0006131 3300046678 Bacteria 7240
829 Ga0495599_0221366 3300046678 Bacteria 1158
830 Ga0495599_0510830 3300046678 Bacteria 706
831 Ga0495623_0071781 3300046679 Bacteria 2153
832 Ga0495623_0090972 3300046679 Bacteria 1873
833 Ga0495646_0015482 3300046680 Bacteria 4839
834 Ga0495646_0288982 3300046680 Bacteria 869
835 Ga0495647_0026501 3300046681 Bacteria 2124
836 Ga0495647_0194729 3300046681 Bacteria 887
837 Ga0495658_0338535 3300046683 Bacteria 955
838 Ga0495658_0368767 3300046683 Bacteria 913
839 Ga0495658_0507078 3300046683 Bacteria 772
840 Ga0495669_0002775 3300046684 Bacteria 7179
841 Ga0495669_0019989 3300046684 Bacteria 2893
842 Ga0495669_0159387 3300046684 Bacteria 1071
843 Ga0495613_0053582 3300046689 Bacteria 2968
844 Ga0495613_0286885 3300046689 Bacteria 1142
845 Ga0495624_0050542 3300046690 Bacteria 2633
846 Ga0495624_0104170 3300046690 Bacteria 1746
847 Ga0495624_0183834 3300046690 Bacteria 1273
848 Ga0495670_0153058 3300046691 Bacteria 1210
849 Ga0495670_0561006 3300046691 Bacteria 621
850 Ga0495649_0224752 3300046694 Bacteria 970
851 Ga0495589_0247741 3300046794 Bacteria 833
852 Ga0495589_0345063 3300046794 Bacteria 686
853 Ga0495600_0027672 3300046809 Bacteria 3664
854 Ga0495600_0055460 3300046809 Bacteria 2588
855 Ga0495660_0070392 3300046810 Bacteria 1857
856 Ga0495660_0076497 3300046810 Bacteria 1763
857 Ga0495581_0018052 3300047315 Bacteria 4098
858 Ga0495581_0127362 3300047315 Bacteria 1483
859 Ga0495581_0324521 3300047315 Bacteria 899
860 Ga0495604_0012840 3300047317 Bacteria 6670
861 Ga0495604_0665217 3300047317 Bacteria 663
862 Ga0495604_0734151 3300047317 Bacteria 625
863 Ga0495636_0112816 3300047318 Bacteria 1197
864 Ga0495636_0203635 3300047318 Bacteria 904
865 Ga0495636_0258248 3300047318 Bacteria 807
866 Ga0495674_0012852 3300047319 Bacteria 7885
867 Ga0495674_0023420 3300047319 Bacteria 5691
868 Ga0495674_0142272 3300047319 Bacteria 2016
869 Ga0495672_0024770 3300047320 Bacteria 3859
870 Ga0495672_0052208 3300047320 Bacteria 2402
871 Ga0495672_0098193 3300047320 Bacteria 1593
872 Ga0495672_0100853 3300047320 Bacteria 1566
873 Ga0495676_0092919 3300047321 Bacteria 2251
874 Ga0495676_0781324 3300047321 Bacteria 615
875 Ga0495680_0004790 3300047322 Bacteria 12844
876 Ga0495680_0394090 3300047322 Bacteria 957
877 Ga0495687_035147 3300047443 Bacteria 2257
878 Ga0495675_0025592 3300047444 Bacteria 3761
879 Ga0495675_0255568 3300047444 Bacteria 1051
880 Ga0495677_0210766 3300047445 Bacteria 756
881 Ga0495677_0215538 3300047445 Bacteria 747
882 Ga0495679_076078 3300047446 Bacteria 960
883 Ga0495673_0184098 3300047469 Bacteria 789
884 Ga0495684_0105554 3300047471 Bacteria 2128
885 Ga0495686_0038202 3300047472 Bacteria 3072
886 Ga0495686_0045381 3300047472 Bacteria 2780
887 Ga0495602_0030319 3300048088 Bacteria 5132
888 Ga0495602_0232981 3300048088 Bacteria 1382
889 Ga0495602_0237796 3300048088 Bacteria 1364
890 Ga0495626_0061888 3300048091 Bacteria 1701
891 Ga0496100_0007336 3300048903 Bacteria 6073
892 Ga0496100_0209783 3300048903 Bacteria 1424
893 Ga0496100_0243050 3300048903 Bacteria 1329
894 Ga0496100_0406779 3300048903 Bacteria 1037
895 Ga0496100_0844897 3300048903 Bacteria 718
896 Ga0496100_0859312 3300048903 Bacteria 712
897 Ga0496101_0002063 3300048904 Bacteria 12220
898 Ga0496101_0006658 3300048904 Bacteria 7451
899 Ga0496101_0061032 3300048904 Bacteria 2737
900 Ga0496101_0546338 3300048904 Bacteria 916
901 Ga0496102_0002920 3300048905 Bacteria 14499
902 Ga0496102_0023415 3300048905 Bacteria 5485
903 Ga0496102_0157380 3300048905 Bacteria 2136
904 Ga0496102_0196308 3300048905 Bacteria 1902
905 Ga0496102_0300694 3300048905 Bacteria 1512
906 Ga0496103_0060499 3300048906 Bacteria 2354
907 Ga0496104_0044633 3300048907 Bacteria 4165
908 Ga0496104_0044919 3300048907 Bacteria 4152
909 Ga0496104_0174939 3300048907 Bacteria 2057
910 Ga0496105_0001825 3300048908 Bacteria 15255
911 Ga0496106_0000743 3300048909 Bacteria 23497
912 Ga0496106_0005280 3300048909 Bacteria 9570
913 Ga0496106_0029914 3300048909 Bacteria 4060
914 Ga0496106_0132630 3300048909 Bacteria 1954
915 Ga0496106_0716970 3300048909 Bacteria 796
916 Ga0496107_0013354 3300048910 Bacteria 5738
917 Ga0496107_0052957 3300048910 Bacteria 2927
918 Ga0496108_0001385 3300048911 Bacteria 19060
919 Ga0496108_0299562 3300048911 Bacteria 1400
920 Ga0496108_1084554 3300048911 Bacteria 681
921 Ga0496109_0018394 3300048912 Bacteria 6139
922 Ga0496109_0024523 3300048912 Bacteria 5363
923 Ga0496110_0041497 3300048913 Bacteria 4016
924 Ga0496110_0053691 3300048913 Bacteria 3543
925 Ga0496110_0075104 3300048913 Bacteria 3003
926 Ga0496110_0252065 3300048913 Bacteria 1606
927 Ga0496111_0063898 3300048914 Bacteria 2670
928 Ga0496111_0071123 3300048914 Bacteria 2532
929 Ga0496111_0228175 3300048914 Bacteria 1383
930 Ga0496111_0358751 3300048914 Bacteria 1079
931 Ga0496111_0366214 3300048914 Bacteria 1066
932 Ga0496112_0000023 3300048915 Bacteria 156144
933 Ga0496112_0002038 3300048915 Bacteria 16019
934 Ga0496112_0005113 3300048915 Bacteria 11271
935 Ga0496112_0115648 3300048915 Bacteria 2653
936 Ga0496112_0422591 3300048915 Bacteria 1272
937 Ga0496112_0452333 3300048915 Bacteria 1222
938 Ga0496112_0964275 3300048915 Bacteria 773
939 Ga0496112_1099666 3300048915 Bacteria 713
940 Ga0496113_0001405 3300048916 Bacteria 13404
941 Ga0496113_0014962 3300048916 Bacteria 5312
942 Ga0496113_0040253 3300048916 Bacteria 3443
943 Ga0496114_0014943 3300048917 Bacteria 6240
944 Ga0496114_0275580 3300048917 Bacteria 1482
945 Ga0496114_0554520 3300048917 Bacteria 1015
946 Ga0496114_0713976 3300048917 Bacteria 878
947 Ga0496114_0902272 3300048917 Bacteria 765
948 Ga0496115_0000800 3300048918 Bacteria 23066
949 Ga0496115_0024514 3300048918 Bacteria 4690
950 Ga0496115_0086214 3300048918 Bacteria 2562
951 Ga0496115_0263871 3300048918 Bacteria 1416
952 Ga0496115_0744485 3300048918 Bacteria 767
953 Ga0496116_0004324 3300048919 Bacteria 13589
954 Ga0496116_0072522 3300048919 Bacteria 2176
955 Ga0496116_0084975 3300048919 Bacteria 1947
956 Ga0496116_0267094 3300048919 Bacteria 839
957 Ga0496117_0009472 3300048920 Bacteria 9058
958 Ga0496117_0060686 3300048920 Bacteria 2604
959 Ga0496117_0061687 3300048920 Bacteria 2575
960 Ga0496117_0102981 3300048920 Bacteria 1800
961 Ga0496117_0340054 3300048920 Bacteria 779
962 Ga0496118_0002385 3300048921 Bacteria 25382
963 Ga0496118_0022944 3300048921 Bacteria 5437
964 Ga0496118_0040700 3300048921 Bacteria 3692
965 Ga0496118_0112935 3300048921 Bacteria 1796
966 Ga0496118_0232350 3300048921 Bacteria 1063
967 Ga0496119_0071155 3300048922 Bacteria 2037
968 Ga0496120_0014398 3300048923 Bacteria 5275
969 Ga0496120_0032697 3300048923 Bacteria 3134
970 Ga0496120_0423439 3300048923 Bacteria 584
971 Ga0496121_0000555 3300048924 Bacteria 70509
972 Ga0496121_0001104 3300048924 Bacteria 47564
973 Ga0496121_0004417 3300048924 Bacteria 18940
974 Ga0496121_0006145 3300048924 Bacteria 15075
975 Ga0496121_0008758 3300048924 Bacteria 11804
976 Ga0496121_0030175 3300048924 Bacteria 4986
977 Ga0496121_0088762 3300048924 Bacteria 2423
978 Ga0496121_0093652 3300048924 Bacteria 2338
979 Ga0496121_0101048 3300048924 Bacteria 2225
980 Ga0496121_0104189 3300048924 Bacteria 2180
981 Ga0496121_0111552 3300048924 Bacteria 2085
982 Ga0496121_0121837 3300048924 Bacteria 1968
983 Ga0496121_0135368 3300048924 Bacteria 1836
984 Ga0496121_0140641 3300048924 Bacteria 1791
985 Ga0496121_0185157 3300048924 Bacteria 1498
986 Ga0496121_0293576 3300048924 Bacteria 1106
987 Ga0496121_0411354 3300048924 Bacteria 883
988 Ga0496121_0468864 3300048924 Bacteria 807
989 Ga0496121_0571984 3300048924 Bacteria 703
990 Ga0496122_0093358 3300048925 Bacteria 2041
991 Ga0496122_0220033 3300048925 Bacteria 1090
992 Ga0496124_0003672 3300048927 Bacteria 18556
993 Ga0496124_0155574 3300048927 Bacteria 1788
994 Ga0496124_0210764 3300048927 Bacteria 1470
995 Ga0496124_0348767 3300048927 Bacteria 1048
996 Ga0496124_0444985 3300048927 Bacteria 885
997 Ga0496125_0008907 3300048928 Bacteria 10422
998 Ga0496125_0013241 3300048928 Bacteria 8120
999 Ga0496125_0044576 3300048928 Bacteria 3748
1000 Ga0496125_0397670 3300048928 Bacteria 806
1001 Ga0496126_0006275 3300048929 Bacteria 13277
1002 Ga0496126_0009900 3300048929 Bacteria 10072
1003 Ga0496126_0020393 3300048929 Bacteria 6500
1004 Ga0496126_0023944 3300048929 Bacteria 5904
1005 Ga0496126_0055111 3300048929 Bacteria 3598
1006 Ga0496126_0063893 3300048929 Bacteria 3298
1007 Ga0496126_0107344 3300048929 Bacteria 2435
1008 Ga0496126_0138204 3300048929 Bacteria 2099
1009 Ga0496126_0367815 3300048929 Bacteria 1173
1010 Ga0496126_0392351 3300048929 Bacteria 1128
1011 Ga0495678_052183 3300049459 Bacteria 1576
1012 Ga0495678_070390 3300049459 Bacteria 1284
1013 Ga0495682_0044230 3300049460 Bacteria 1629
1014 Ga0495682_0147443 3300049460 Bacteria 840
1015 Ga0501031_0000823 3300049568 Bacteria 18677
1016 Ga0501031_0008998 3300049568 Bacteria 6497
1017 Ga0501031_0088622 3300049568 Bacteria 2018
1018 Ga0501031_0119769 3300049568 Bacteria 1719
1019 Ga0501031_0361128 3300049568 Bacteria 940
1020 Ga0501032_0000030 3300049569 Bacteria 130405
1021 Ga0501032_0176280 3300049569 Bacteria 1400
1022 Ga0501032_0342406 3300049569 Bacteria 963
1023 Ga0501033_0000060 3300049570 Bacteria 103159
1024 Ga0501033_0034480 3300049570 Bacteria 3796
1025 Ga0501033_0206092 3300049570 Bacteria 1403
1026 Ga0501033_0294131 3300049570 Bacteria 1144
1027 Ga0501033_0298496 3300049570 Bacteria 1134
1028 Ga0501034_0000117 3300049571 Bacteria 144865
1029 Ga0501034_0042839 3300049571 Bacteria 4582
1030 Ga0501034_0141891 3300049571 Bacteria 2381
1031 Ga0501034_0149676 3300049571 Bacteria 2310
1032 Ga0501034_0176446 3300049571 Bacteria 2103
1033 Ga0501034_0180341 3300049571 Bacteria 2077
1034 Ga0501034_0214822 3300049571 Bacteria 1878
1035 Ga0501034_0225737 3300049571 Bacteria 1824
1036 Ga0501034_0229035 3300049571 Bacteria 1808
1037 Ga0501034_0632136 3300049571 Bacteria 973
1038 Ga0501034_0890012 3300049571 Bacteria 779
1039 Ga0501034_1147853 3300049571 Bacteria 657
1040 Ga0501036_0000148 3300049572 Bacteria 45613
1041 Ga0501036_0081074 3300049572 Bacteria 2742
1042 Ga0501036_0082295 3300049572 Bacteria 2720
1043 Ga0501036_0109857 3300049572 Bacteria 2330
1044 Ga0501036_0429129 3300049572 Bacteria 1102
1045 Ga0501036_0473214 3300049572 Bacteria 1043
1046 Ga0501036_0665530 3300049572 Bacteria 861
1047 Ga0501036_1090023 3300049572 Bacteria 652
1048 Ga0501037_0000090 3300049573 Bacteria 85021
1049 Ga0501037_0021843 3300049573 Bacteria 4736
1050 Ga0501037_0024322 3300049573 Bacteria 4479
1051 Ga0501037_0238013 3300049573 Bacteria 1276
1052 Ga0501037_0273468 3300049573 Bacteria 1178
1053 Ga0501037_0506433 3300049573 Bacteria 818
1054 Ga0501038_0000441 3300049574 Bacteria 36178
1055 Ga0501038_0017412 3300049574 Bacteria 6495
1056 Ga0501038_0080180 3300049574 Bacteria 2751
1057 Ga0501038_0139211 3300049574 Bacteria 1987
1058 Ga0501038_0481086 3300049574 Bacteria 951
1059 Ga0501038_0635107 3300049574 Bacteria 805
1060 Ga0501038_0892041 3300049574 Bacteria 657
1061 Ga0501039_0000443 3300049575 Bacteria 30068
1062 Ga0501039_0031373 3300049575 Bacteria 4096
1063 Ga0501039_0168611 3300049575 Bacteria 1721
1064 Ga0501039_0272219 3300049575 Bacteria 1331
1065 Ga0501040_0538541 3300049576 Bacteria 842
1066 Ga0501040_0753248 3300049576 Bacteria 704
1067 Ga0501041_0109087 3300049577 Bacteria 1717
1068 Ga0501042_0006690 3300049578 Bacteria 7509
1069 Ga0501042_0011206 3300049578 Bacteria 6041
1070 Ga0501042_0088649 3300049578 Bacteria 2220
1071 Ga0501042_0122191 3300049578 Bacteria 1875
1072 Ga0501042_0297606 3300049578 Bacteria 1166
1073 Ga0501043_0000919 3300049579 Bacteria 26107
1074 Ga0501043_0024179 3300049579 Bacteria 4767
1075 Ga0501043_0027132 3300049579 Bacteria 4496
1076 Ga0501043_0051850 3300049579 Bacteria 3224
1077 Ga0501043_0070998 3300049579 Bacteria 2735
1078 Ga0501046_0000214 3300049580 Bacteria 60379
1079 Ga0501046_0412349 3300049580 Bacteria 974
1080 Ga0501047_0000571 3300049581 Bacteria 39243
1081 Ga0501047_0008142 3300049581 Bacteria 9895
1082 Ga0501047_0054534 3300049581 Bacteria 3866
1083 Ga0501047_0143269 3300049581 Bacteria 2267
1084 Ga0501047_0339908 3300049581 Bacteria 1339
1085 Ga0501047_0364450 3300049581 Bacteria 1280
1086 Ga0501047_0407940 3300049581 Bacteria 1191
1087 Ga0501048_0000563 3300049582 Bacteria 26308
1088 Ga0501048_0077663 3300049582 Bacteria 2343
1089 Ga0501048_0089334 3300049582 Bacteria 2173
1090 Ga0501048_0378902 3300049582 Bacteria 1010
1091 Ga0501048_0605888 3300049582 Bacteria 786
1092 Ga0501048_0861283 3300049582 Bacteria 651
1093 Ga0501067_0001731 3300049583 Bacteria 12000
1094 Ga0501067_0002121 3300049583 Bacteria 10918
1095 Ga0501067_0044658 3300049583 Bacteria 2461
1096 Ga0501067_0064718 3300049583 Bacteria 2024
1097 Ga0501067_0065370 3300049583 Bacteria 2013
1098 Ga0501067_0068385 3300049583 Bacteria 1966
1099 Ga0501068_0002870 3300049584 Bacteria 9175
1100 Ga0501068_0012451 3300049584 Bacteria 4824
1101 Ga0501068_0324073 3300049584 Bacteria 988
1102 Ga0501068_0477906 3300049584 Bacteria 807
1103 Ga0501069_0013605 3300049585 Bacteria 4339
1104 Ga0501069_0033968 3300049585 Bacteria 2809
1105 Ga0501069_0211789 3300049585 Bacteria 1125
1106 Ga0501069_0452105 3300049585 Bacteria 763
1107 Ga0501070_0003380 3300049586 Bacteria 13841
1108 Ga0501070_0003669 3300049586 Bacteria 13268
1109 Ga0501070_0011392 3300049586 Bacteria 7515
1110 Ga0501070_0102800 3300049586 Bacteria 2363
1111 Ga0501070_0218363 3300049586 Bacteria 1564
1112 Ga0501070_0248133 3300049586 Bacteria 1456
1113 Ga0501070_0270857 3300049586 Bacteria 1387
1114 Ga0501070_0283144 3300049586 Bacteria 1352
1115 Ga0501070_0336040 3300049586 Bacteria 1227
1116 Ga0501070_0550640 3300049586 Bacteria 923
1117 Ga0501071_0009025 3300049587 Bacteria 6619
1118 Ga0501071_0035767 3300049587 Bacteria 3539
1119 Ga0501071_0079802 3300049587 Bacteria 2393
1120 Ga0501071_0167798 3300049587 Bacteria 1643
1121 Ga0501072_0003654 3300049588 Bacteria 11588
1122 Ga0501072_0011728 3300049588 Bacteria 6696
1123 Ga0501072_0180631 3300049588 Bacteria 1683
1124 Ga0501073_0000203 3300049589 Bacteria 39315
1125 Ga0501073_0011409 3300049589 Bacteria 6502
1126 Ga0501073_0026397 3300049589 Bacteria 4162
1127 Ga0501073_0038233 3300049589 Bacteria 3405
1128 Ga0501073_0128939 3300049589 Bacteria 1753
1129 Ga0501073_0145316 3300049589 Bacteria 1643
1130 Ga0501073_0510186 3300049589 Bacteria 831
1131 Ga0501073_0560138 3300049589 Bacteria 790
1132 Ga0501074_0011327 3300049590 Bacteria 6483
1133 Ga0501074_0017548 3300049590 Bacteria 5195
1134 Ga0501074_0070618 3300049590 Bacteria 2510
1135 Ga0501074_0257765 3300049590 Bacteria 1240
1136 Ga0501074_0289819 3300049590 Bacteria 1163
1137 Ga0501076_0029209 3300049592 Bacteria 4287
1138 Ga0501076_0040338 3300049592 Bacteria 3669
1139 Ga0501076_0093360 3300049592 Bacteria 2422
1140 Ga0501076_0201144 3300049592 Bacteria 1627
1141 Ga0501077_0018802 3300049593 Bacteria 4372
1142 Ga0501077_0036684 3300049593 Bacteria 3124
1143 Ga0501257_227293 3300049686 Bacteria 546
1144 Ga0501079_0001971 3300049741 Bacteria 14716
1145 Ga0501079_0071756 3300049741 Bacteria 2675
1146 Ga0501079_0395243 3300049741 Bacteria 1084
1147 Ga0501080_0002834 3300049742 Bacteria 15237
1148 Ga0501080_0004629 3300049742 Bacteria 12260
1149 Ga0501080_0040087 3300049742 Bacteria 4370
1150 Ga0501080_0093992 3300049742 Bacteria 2784
1151 Ga0501080_0121335 3300049742 Bacteria 2422
1152 Ga0501080_0133416 3300049742 Bacteria 2299
1153 Ga0501080_0161611 3300049742 Bacteria 2068
1154 Ga0501081_0566327 3300049743 Bacteria 849
1155 Ga0501083_0000539 3300049744 Bacteria 24199
1156 Ga0501083_0003563 3300049744 Bacteria 10910
1157 Ga0501083_0018195 3300049744 Bacteria 4897
1158 Ga0501083_0387532 3300049744 Bacteria 909
1159 Ga0501083_0636525 3300049744 Bacteria 694
1160 Ga0501083_0753101 3300049744 Bacteria 634
1161 Ga0501035_0000212 3300049822 Bacteria 69856
1162 Ga0501035_0043346 3300049822 Bacteria 4055
1163 Ga0501035_0086552 3300049822 Bacteria 2761
1164 Ga0501035_0120004 3300049822 Bacteria 2299
1165 Ga0501035_0958770 3300049822 Bacteria 674
1166 Ga0501044_0000304 3300049823 Bacteria 61877
1167 Ga0501044_0008608 3300049823 Bacteria 11172
1168 Ga0501044_0026748 3300049823 Bacteria 6104
1169 Ga0501044_0065215 3300049823 Bacteria 3714
1170 Ga0501044_0108222 3300049823 Bacteria 2790
1171 Ga0501044_0141992 3300049823 Bacteria 2389
1172 Ga0501044_0202168 3300049823 Bacteria 1944
1173 Ga0501044_0305203 3300049823 Bacteria 1519
1174 Ga0501044_0689653 3300049823 Bacteria 907
1175 Ga0501044_0689710 3300049823 Bacteria 907
1176 Ga0501044_1069585 3300049823 Bacteria 677
1177 Ga0501045_0006869 3300049824 Bacteria 7885
1178 Ga0501045_0055821 3300049824 Bacteria 2888
1179 Ga0501045_0132885 3300049824 Bacteria 1850
1180 nmdc:mga03n38_12816_c1 3300050490 Bacteria 3167
1181 nmdc:mga03n38_237305_c1 3300050490 Bacteria 958
1182 nmdc:mga00v17_256673_c1 3300050491 Bacteria 1134
1183 nmdc:mga00v17_36882_c1 3300050491 Bacteria 2529
1184 nmdc:mga0yw44_15471_c1 3300050492 Bacteria 4089
1185 nmdc:mga0yw44_158281_c1 3300050492 Bacteria 1482
1186 nmdc:mga0k408_142534_c1 3300050493 Bacteria 1426
1187 nmdc:mga0k408_255565_c1 3300050493 Bacteria 1046
1188 nmdc:mga0k408_282596_c1 3300050493 Bacteria 991
1189 nmdc:mga06z11_113072_c1 3300050494 Bacteria 1506
1190 nmdc:mga06z11_122364_c1 3300050494 Bacteria 1453
1191 nmdc:mga06z11_37411_c1 3300050494 Bacteria 2403
1192 nmdc:mga06z11_414367_c1 3300050494 Bacteria 812
1193 nmdc:mga06z11_93972_c1 3300050494 Bacteria 1633
1194 nmdc:mga07m45_314263_c1 3300050496 Bacteria 911
1195 nmdc:mga07m45_389335_c1 3300050496 Bacteria 809
1196 nmdc:mga05p37_120308_c1 3300050507 Bacteria 3226
1197 nmdc:mga05p37_1257441_c1 3300050507 Bacteria 759
1198 nmdc:mga05p37_148209_c1 3300050507 Bacteria 2872
1199 nmdc:mga05p37_743_c1 3300050507 Bacteria 36122
1200 nmdc:mga09592_229157_c1 3300050508 Bacteria 1609
1201 nmdc:mga09592_781_c1 3300050508 Bacteria 24612
1202 nmdc:mga0qj67_1023009_c1 3300050509 Bacteria 647
1203 nmdc:mga0qj67_72223_c1 3300050509 Bacteria 2755
1204 nmdc:mga06r32_19037_c1 3300050510 Bacteria 6295
1205 nmdc:mga06r32_42216_c1 3300050510 Bacteria 4335
1206 nmdc:mga06r32_56820_c1 3300050510 Bacteria 3757
1207 nmdc:mga08y16_121_c1 3300050511 Bacteria 67325
1208 nmdc:mga08y16_92319_c1 3300050511 Bacteria 3155
1209 nmdc:mga0n895_125054_c1 3300050512 Bacteria 2595
1210 nmdc:mga0n895_14611_c1 3300050512 Bacteria 7137
1211 nmdc:mga0n895_20587_c1 3300050512 Bacteria 6154
1212 nmdc:mga0rr50_394913_c1 3300050513 Bacteria 1168
1213 nmdc:mga0rr50_560776_c1 3300050513 Bacteria 973
1214 nmdc:mga0a205_172488_c1 3300050515 Bacteria 2059
1215 nmdc:mga0sz30_244485_c1 3300050516 Bacteria 799
1216 Ga0495601_0022366 3300053077 Bacteria 3880
1217 Ga0495601_0148848 3300053077 Bacteria 1528
1218 Ga0495601_0185190 3300053077 Bacteria 1361
1219 Ga0495612_0008523 3300053078 Bacteria 4159
1220 Ga0495612_0266555 3300053078 Bacteria 764
1221 Ga0500635_0008274 3300053080 Bacteria 2845
1222 Ga0500635_0037941 3300053080 Bacteria 1596
1223 Ga0495655_0147691 3300053083 Bacteria 737
1224 Ga0495595_0152806 3300053084 Bacteria 1136
1225 Ga0495619_0187299 3300053085 Bacteria 1432
1226 Ga0495619_0240422 3300053085 Bacteria 1255
1227 Ga0495619_0289653 3300053085 Bacteria 1134
1228 Ga0495619_0352108 3300053085 Bacteria 1019
1229 Ga0495619_0450690 3300053085 Bacteria 887
1230 Ga0500644_0203026 3300053088 Bacteria 820
1231 Ga0500581_120380 3300053089 Bacteria 1268
1232 Ga0500646_0180263 3300053090 Bacteria 715
1233 Ga0500647_0071120 3300053091 Bacteria 1672
1234 Ga0500583_0072186 3300053092 Bacteria 1652
1235 Ga0500651_0213026 3300053093 Bacteria 1135
1236 Ga0500566_0000197 3300053094 Bacteria 31582
1237 Ga0500566_0007746 3300053094 Bacteria 6369
1238 Ga0500566_0074079 3300053094 Bacteria 1907
1239 Ga0500566_0130342 3300053094 Bacteria 1346
1240 Ga0500640_000151 3300053095 Bacteria 13660
1241 Ga0500641_0037558 3300053096 Bacteria 1942
1242 Ga0500654_136382 3300053099 Bacteria 911
1243 Ga0500555_039672 3300053103 Bacteria 1314
1244 Ga0500556_0000045 3300053104 Bacteria 130653
1245 Ga0500556_0044468 3300053104 Bacteria 1580
1246 Ga0500562_091721 3300053108 Bacteria 824
1247 Ga0500569_019436 3300053109 Bacteria 1767
1248 Ga0500572_000154 3300053111 Bacteria 23771
1249 Ga0500572_000578 3300053111 Bacteria 12448
1250 Ga0500591_083881 3300053115 Bacteria 1409
1251 Ga0500592_000586 3300053116 Bacteria 5971
1252 Ga0500592_009040 3300053116 Bacteria 1582
1253 Ga0500593_003188 3300053117 Bacteria 6151
1254 Ga0500593_096486 3300053117 Bacteria 1241
1255 Ga0500594_0082810 3300053118 Bacteria 962
1256 Ga0500595_002082 3300053119 Bacteria 10231
1257 Ga0500595_002732 3300053119 Bacteria 8537
1258 Ga0500595_018178 3300053119 Bacteria 2576
1259 Ga0500597_115245 3300053120 Bacteria 1166
1260 Ga0500607_045000 3300053121 Bacteria 2371
1261 Ga0500608_007213 3300053122 Bacteria 4582
1262 Ga0500608_011405 3300053122 Bacteria 3858
1263 Ga0500614_001112 3300053123 Bacteria 6631
1264 Ga0500618_012229 3300053125 Bacteria 2251
1265 Ga0500621_104479 3300053126 Bacteria 1114
1266 Ga0500621_246260 3300053126 Bacteria 603
1267 Ga0500628_015616 3300053129 Bacteria 1455
1268 Ga0500642_0000024 3300053130 Bacteria 134373
1269 Ga0500642_0266028 3300053130 Bacteria 783
1270 Ga0500652_000356 3300053131 Bacteria 16417
1271 Ga0500658_0144026 3300053134 Bacteria 1070
1272 Ga0500658_0426328 3300053134 Bacteria 605
1273 Ga0500658_0447432 3300053134 Bacteria 588
1274 Ga0500559_0000051 3300053136 Bacteria 91468
1275 Ga0500559_0001682 3300053136 Bacteria 12198
1276 Ga0500559_0064120 3300053136 Bacteria 1643
1277 Ga0500559_0152765 3300053136 Bacteria 1084
1278 Ga0500559_0202067 3300053136 Bacteria 937
1279 Ga0500568_0000456 3300053139 Bacteria 30484
1280 Ga0500577_0000189 3300053142 Bacteria 16154
1281 Ga0500577_0057994 3300053142 Bacteria 1479
1282 Ga0500586_007803 3300053145 Bacteria 2877
1283 Ga0500588_0125490 3300053146 Bacteria 909
1284 Ga0500589_213218 3300053147 Bacteria 732
1285 Ga0500590_035413 3300053148 Bacteria 2584
1286 Ga0500590_229305 3300053148 Bacteria 758
1287 Ga0500603_000220 3300053150 Bacteria 15043
1288 Ga0500603_016023 3300053150 Bacteria 1773
1289 Ga0500603_030295 3300053150 Bacteria 1392
1290 Ga0500604_0066594 3300053151 Bacteria 1141
1291 Ga0500604_0183544 3300053151 Bacteria 717
1292 Ga0500616_0000048 3300053153 Bacteria 313108
1293 Ga0500616_0000054 3300053153 Bacteria 290186
1294 Ga0500619_003777 3300053154 Bacteria 3156
1295 Ga0500619_162516 3300053154 Bacteria 758
1296 Ga0500622_0000714 3300053156 Bacteria 29050
1297 Ga0500627_0064431 3300053158 Bacteria 1616
1298 Ga0500630_024760 3300053159 Bacteria 2964
1299 Ga0500634_0174604 3300053161 Bacteria 974
1300 Ga0500638_041577 3300053162 Bacteria 2232
1301 Ga0500638_093892 3300053162 Bacteria 1409
1302 Ga0500638_151176 3300053162 Bacteria 1032
1303 Ga0500639_000007 3300053163 Bacteria 152350
1304 Ga0500639_053902 3300053163 Bacteria 2091
1305 Ga0500636_0009096 3300053177 Bacteria 5772
1306 Ga0500636_0023576 3300053177 Bacteria 3638
1307 Ga0500637_0014529 3300053178 Bacteria 4153
1308 Ga0500637_0085137 3300053178 Bacteria 1828
1309 Ga0500637_0092471 3300053178 Bacteria 1752
1310 Ga0500637_0114303 3300053178 Bacteria 1565
1311 Ga0500567_040424 3300053723 Bacteria 2177
1312 Ga0500657_081540 3300053728 Bacteria 1388
1313 Ga0500645_027646 3300053730 Bacteria 1719
1314 Ga0500645_156789 3300053730 Bacteria 625
1315 Ga0500609_039019 3300053731 Bacteria 656
1316 Ga0500656_010517 3300053732 Bacteria 1013
1317 Ga0500552_008739 3300053733 Bacteria 1203
1318 Ga0500596_000345 3300053735 Bacteria 8331
1319 Ga0500596_005002 3300053735 Bacteria 2374
1320 Ga0500601_002395 3300053737 Bacteria 2015
1321 Ga0501084_0005904 3300054114 Bacteria 10082
1322 Ga0501084_0007519 3300054114 Bacteria 8982
1323 Ga0501084_0158623 3300054114 Bacteria 1909
1324 Ga0501084_0232542 3300054114 Bacteria 1556
1325 Ga0501084_0299553 3300054114 Bacteria 1358
1326 Ga0501084_0587127 3300054114 Bacteria 941
1327 Ga0501082_0006039 3300060353 Bacteria 10506
1328 Ga0501082_0018603 3300060353 Bacteria 5988
1329 Ga0501082_0078180 3300060353 Bacteria 2853
1330 Ga0501082_0089798 3300060353 Bacteria 2653
1331 Ga0501082_0105333 3300060353 Bacteria 2440
1332 Ga0501082_0118302 3300060353 Bacteria 2295
1333 Ga0501082_0570848 3300060353 Bacteria 990
1334 Ga0466962_0209875 3300061719 Bacteria 953
1335 Ga0530510_0219546 3300061734 Bacteria 1413

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_20587_c1 nmdc:mga0n895_20587_c1_1828_2316 139
2 3300007076 Ga0075435_100105362 Ga0075435_1001053623 140
3 3300050513 nmdc:mga0rr50_394913_c1 nmdc:mga0rr50_394913_c1_67_555 140
4 3300006944 Ga0099823_1076226 Ga0099823_10762262 147
5 3300005347 Ga0070668_100000021 Ga0070668_10000002149 148
6 3300005355 Ga0070671_100000114 Ga0070671_10000011411 148
7 3300005548 Ga0070665_100185823 Ga0070665_1001858232 148
8 3300005617 Ga0068859_100016862 Ga0068859_1000168624 148
9 3300005841 Ga0068863_100000043 Ga0068863_10000004350 148
10 3300005842 Ga0068858_100586125 Ga0068858_1005861251 148
11 3300005843 Ga0068860_100112956 Ga0068860_1001129563 148
12 3300005844 Ga0068862_100183373 Ga0068862_1001833732 148
13 3300006931 Ga0097620_100016862 Ga0097620_1000168624 148
14 3300009553 Ga0105249_10003685 Ga0105249_1000368512 148
15 3300025925 Ga0207650_10184894 Ga0207650_101848942 148
16 3300025931 Ga0207644_10000077 Ga0207644_1000007748 148
17 3300025961 Ga0207712_10016901 Ga0207712_100169012 148
18 3300025972 Ga0207668_10000068 Ga0207668_1000006849 148
19 3300026035 Ga0207703_10541507 Ga0207703_105415072 148
20 3300026088 Ga0207641_10000031 Ga0207641_1000003153 148
21 3300028379 Ga0268266_10146697 Ga0268266_101466972 148
22 3300028380 Ga0268265_10153392 Ga0268265_101533922 148
23 3300028381 Ga0268264_10408066 Ga0268264_104080662 148
24 3300044735 Ga0466968_0156600 Ga0466968_0156600_419_964 148
25 3300048918 Ga0496115_0263871 Ga0496115_0263871_104_625 149
26 3300013308 Ga0157375_10479866 Ga0157375_104798662 150
27 3300044683 Ga0466965_0076980 Ga0466965_0076980_91_657 151
28 3300044765 Ga0466970_0250436 Ga0466970_0250436_287_853 151
29 3300046454 Ga0495592_0127679 Ga0495592_0127679_219_785 151
30 3300046462 Ga0495651_0028221 Ga0495651_0028221_1002_1568 151
31 3300046463 Ga0495653_0046358 Ga0495653_0046358_1040_1606 151
32 3300046477 Ga0495664_0071811 Ga0495664_0071811_922_1488 151
33 3300046511 Ga0495608_0017629 Ga0495608_0017629_3249_3815 151
34 3300046529 Ga0495652_0029766 Ga0495652_0029766_2335_2901 151
35 3300046559 Ga0495667_0007414 Ga0495667_0007414_3355_3921 151
36 3300046642 Ga0495634_0082039 Ga0495634_0082039_876_1442 151
37 3300046663 Ga0495635_0082927 Ga0495635_0082927_649_1215 151
38 3300046675 Ga0495657_0012557 Ga0495657_0012557_1786_2352 151
39 3300046678 Ga0495599_0006131 Ga0495599_0006131_5060_5626 151
40 3300046679 Ga0495623_0071781 Ga0495623_0071781_864_1430 151
41 3300046680 Ga0495646_0288982 Ga0495646_0288982_208_774 151
42 3300046809 Ga0495600_0027672 Ga0495600_0027672_1796_2362 151
43 3300047317 Ga0495604_0012840 Ga0495604_0012840_4775_5341 151
44 3300047322 Ga0495680_0004790 Ga0495680_0004790_8849_9415 151
45 3300047444 Ga0495675_0025592 Ga0495675_0025592_167_733 151
46 3300048088 Ga0495602_0030319 Ga0495602_0030319_2328_2894 151
47 3300050491 nmdc:mga00v17_256673_c1 nmdc:mga00v17_256673_c1_51_617 151
48 3300053085 Ga0495619_0289653 Ga0495619_0289653_49_615 151
49 3300009011 Ga0105251_10530976 Ga0105251_105309761 152
50 3300031247 Ga0265340_10179736 Ga0265340_101797362 152
51 3300031249 Ga0265339_10018045 Ga0265339_100180454 152
52 3300031595 Ga0265313_10011671 Ga0265313_100116715 152
53 3300031712 Ga0265342_10319551 Ga0265342_103195511 152
54 3300039453 Ga0436362_0544940 Ga0436362_0544940_164_751 152
55 3300005983 Ga0081540_1069601 Ga0081540_10696012 153
56 3300026116 Ga0207674_10866228 Ga0207674_108662282 153
57 3300035092 Ga0373952_0089337 Ga0373952_0089337_134_622 153
58 3300005548 Ga0070665_101409716 Ga0070665_1014097162 154
59 3300005563 Ga0068855_100015668 Ga0068855_1000156682 154
60 3300005577 Ga0068857_100415707 Ga0068857_1004157072 154
61 3300005614 Ga0068856_100132569 Ga0068856_1001325692 154
62 3300025900 Ga0207710_10164795 Ga0207710_101647951 154
63 3300025916 Ga0207663_10286262 Ga0207663_102862622 154
64 3300025919 Ga0207657_10459632 Ga0207657_104596322 154
65 3300025949 Ga0207667_10012516 Ga0207667_100125167 154
66 3300026078 Ga0207702_10226868 Ga0207702_102268682 154
67 3300035410 Ga0373924_0264398 Ga0373924_0264398_12_476 154
68 3300035692 Ga0373935_0286650 Ga0373935_0286650_685_1149 154
69 3300037853 Ga0436364_1034666 Ga0436364_1034666_174_671 154
70 3300041460 Ga0451802_0893213 Ga0451802_0893213_92_556 154
71 3300046512 Ga0495610_0401834 Ga0495610_0401834_10_474 154
72 3300046530 Ga0495654_0175175 Ga0495654_0175175_21_485 154
73 3300046689 Ga0495613_0053582 Ga0495613_0053582_2490_2954 154
74 3300048903 Ga0496100_0844897 Ga0496100_0844897_20_484 154
75 3300048914 Ga0496111_0358751 Ga0496111_0358751_10_474 154
76 3300049460 Ga0495682_0044230 Ga0495682_0044230_23_487 154
77 3300049568 Ga0501031_0008998 Ga0501031_0008998_2519_3016 154
78 3300049578 Ga0501042_0122191 Ga0501042_0122191_1324_1821 154
79 3300049585 Ga0501069_0211789 Ga0501069_0211789_19_483 154
80 3300049742 Ga0501080_0133416 Ga0501080_0133416_202_699 154
81 3300049824 Ga0501045_0132885 Ga0501045_0132885_265_762 154
82 3300053108 Ga0500562_091721 Ga0500562_091721_11_475 154
83 3300060353 Ga0501082_0118302 Ga0501082_0118302_1115_1612 154
84 3300006048 Ga0075363_100696742 Ga0075363_1006967421 155
85 3300046477 Ga0495664_0147893 Ga0495664_0147893_34_522 155
86 3300050510 nmdc:mga06r32_42216_c1 nmdc:mga06r32_42216_c1_464_1006 155
87 3300053730 Ga0500645_156789 Ga0500645_156789_136_612 155
88 iso_pu_bacteria 2513237087 2513591701 155
89 iso_pu_bacteria 8056673599 8056675429 155
90 3300005937 Ga0081455_10487484 Ga0081455_104874842 156
91 3300009545 Ga0105237_10450674 Ga0105237_104506742 156
92 3300025914 Ga0207671_10239703 Ga0207671_102397032 156
93 3300005437 Ga0070710_10033210 Ga0070710_100332104 157
94 3300005439 Ga0070711_100094377 Ga0070711_1000943772 157
95 3300006173 Ga0070716_100039631 Ga0070716_1000396311 157
96 3300006175 Ga0070712_100054123 Ga0070712_1000541232 157
97 3300025898 Ga0207692_10017119 Ga0207692_100171195 157
98 3300025905 Ga0207685_10037922 Ga0207685_100379222 157
99 3300025906 Ga0207699_10033995 Ga0207699_100339954 157
100 3300025915 Ga0207693_10080355 Ga0207693_100803552 157
101 3300025916 Ga0207663_10031403 Ga0207663_100314032 157
102 3300025928 Ga0207700_10139440 Ga0207700_101394401 157
103 3300025939 Ga0207665_10054081 Ga0207665_100540815 157
104 3300037418 Ga0395900_0694941 Ga0395900_0694941_173_661 157
105 3300049573 Ga0501037_0021843 Ga0501037_0021843_1441_1929 157
106 3300049744 Ga0501083_0753101 Ga0501083_0753101_95_592 157
107 3300006175 Ga0070712_100024690 Ga0070712_1000246902 158
108 3300013297 Ga0157378_11616201 Ga0157378_116162011 158
109 3300014325 Ga0163163_10846248 Ga0163163_108462482 158
110 3300025915 Ga0207693_10034329 Ga0207693_100343293 158
111 3300025929 Ga0207664_10028066 Ga0207664_100280665 158
112 3300026142 Ga0207698_11024050 Ga0207698_110240501 158
113 3300037312 Ga0395899_0018741 Ga0395899_0018741_4090_4566 158
114 3300037418 Ga0395900_0561950 Ga0395900_0561950_469_945 158
115 3300037466 Ga0395898_0744456 Ga0395898_0744456_257_733 158
116 3300038443 Ga0395901_0003860 Ga0395901_0003860_7830_8306 158
117 3300039438 Ga0436360_0193747 Ga0436360_0193747_45_521 158
118 3300049569 Ga0501032_0176280 Ga0501032_0176280_440_916 158
119 3300049570 Ga0501033_0298496 Ga0501033_0298496_197_673 158
120 3300049571 Ga0501034_0042839 Ga0501034_0042839_3335_3811 158
121 3300049572 Ga0501036_0665530 Ga0501036_0665530_357_833 158
122 3300049573 Ga0501037_0273468 Ga0501037_0273468_591_1067 158
123 3300049574 Ga0501038_0481086 Ga0501038_0481086_153_629 158
124 3300049582 Ga0501048_0077663 Ga0501048_0077663_436_912 158
125 3300049586 Ga0501070_0550640 Ga0501070_0550640_368_844 158
126 3300049589 Ga0501073_0560138 Ga0501073_0560138_178_654 158
127 3300049822 Ga0501035_0120004 Ga0501035_0120004_1770_2246 158
128 3300049823 Ga0501044_0689653 Ga0501044_0689653_254_730 158
129 iso_pu_bacteria 2513237096 2513659150 158
130 iso_pu_bacteria 2513237101 2513697181 158
131 iso_pu_bacteria 2513237137 2513859127 158
132 iso_pu_bacteria 2513237141 2513893042 158
133 iso_pu_bacteria 2513237145 2513920522 158
134 iso_pu_bacteria 2517572143 2517887390 158
135 iso_pu_bacteria 2524023228 2524539268 158
136 iso_pu_bacteria 2602042107 2603860518 158
137 iso_pu_bacteria 2643221651 2644287166 158
138 iso_pu_bacteria 2667528175 2671120871 158
139 iso_pu_bacteria 2721755755 2723848771 158
140 iso_pu_bacteria 2791355197 2793073822 158
141 iso_pu_bacteria 2791355199 2793078786 158
142 iso_pu_bacteria 2857524615 2857525471 158
143 iso_pu_bacteria 2874604998 2874606096 158
144 iso_pu_bacteria 2876808645 2876815271 158
145 iso_pu_bacteria 2879110137 2879116741 158
146 iso_pu_bacteria 2889033259 2889034404 158
147 iso_pu_bacteria 2893066018 2893070878 158
148 iso_pu_bacteria 2903748898 2903751064 158
149 iso_pu_bacteria 2904690495 2904691683 158
150 iso_pu_bacteria 2906610324 2906612596 158
151 iso_pu_bacteria 2906635258 2906643145 158
152 iso_pu_bacteria 2906660503 2906664841 158
153 iso_pu_bacteria 2908739725 2908745806 158
154 iso_pu_bacteria 2908756301 2908763802 158
155 iso_pu_bacteria 2919073203 2919074719 158
156 iso_pu_bacteria 2922361189 2922363479 158
157 iso_pu_bacteria 2922425934 2922433093 158
158 iso_pu_bacteria 2935630451 2935630673 158
159 iso_pu_bacteria 2941507105 2941507325 158
160 iso_pu_bacteria 2941515067 2941515752 158
161 iso_pu_bacteria 2941523033 2941523540 158
162 iso_pu_bacteria 3005594810 3005596110 158
163 iso_pu_bacteria 3005718088 3005719295 158
164 iso_pu_bacteria 8006964411 8006970081 158
165 iso_pu_bacteria 8006984368 8006986293 158
166 iso_pu_bacteria 8006994254 8006998966 158
167 iso_pu_bacteria 8019555841 8019563686 158
168 iso_pu_bacteria 8019565922 8019573753 158
169 3300005330 Ga0070690_100369537 Ga0070690_1003695372 159
170 3300005355 Ga0070671_100007073 Ga0070671_1000070739 159
171 3300005548 Ga0070665_100058806 Ga0070665_1000588062 159
172 3300005563 Ga0068855_101879947 Ga0068855_1018799471 159
173 3300005981 Ga0081538_10022689 Ga0081538_100226894 159
174 3300025908 Ga0207643_10645974 Ga0207643_106459741 159
175 3300025925 Ga0207650_10781283 Ga0207650_107812831 159
176 3300025931 Ga0207644_10239399 Ga0207644_102393991 159
177 3300031548 Ga0307408_100086840 Ga0307408_1000868402 159
178 3300031824 Ga0307413_11542853 Ga0307413_115428531 159
179 3300035691 Ga0373931_0229891 Ga0373931_0229891_599_1090 159
180 3300049578 Ga0501042_0297606 Ga0501042_0297606_412_891 159
181 3300060353 Ga0501082_0570848 Ga0501082_0570848_315_794 159
182 3300021361 Ga0213872_10111020 Ga0213872_101110202 160
183 3300031250 Ga0265331_10007229 Ga0265331_100072293 160
184 3300031711 Ga0265314_10001099 Ga0265314_1000109916 160
185 3300031711 Ga0265314_10123984 Ga0265314_101239842 160
186 3300039447 Ga0436361_0086028 Ga0436361_0086028_1170_1652 160
187 3300041456 Ga0451795_0455491 Ga0451795_0455491_43_525 160
188 3300046460 Ga0495638_0024606 Ga0495638_0024606_40_522 160
189 3300049586 Ga0501070_0218363 Ga0501070_0218363_734_1240 160
190 iso_pu_bacteria 2643221564 2643837023 160
191 3300005336 Ga0070680_100047062 Ga0070680_1000470622 161
192 3300005339 Ga0070660_100105470 Ga0070660_1001054702 161
193 3300005458 Ga0070681_10218167 Ga0070681_102181672 161
194 3300005530 Ga0070679_100610053 Ga0070679_1006100532 161
195 3300005546 Ga0070696_100938113 Ga0070696_1009381131 161
196 3300005614 Ga0068856_100347992 Ga0068856_1003479922 161
197 3300006175 Ga0070712_100019951 Ga0070712_1000199512 161
198 3300010375 Ga0105239_11972325 Ga0105239_119723251 161
199 3300013104 Ga0157370_10018311 Ga0157370_100183119 161
200 3300013105 Ga0157369_10223186 Ga0157369_102231862 161
201 3300025912 Ga0207707_10281258 Ga0207707_102812582 161
202 3300025915 Ga0207693_10003443 Ga0207693_100034432 161
203 3300028800 Ga0265338_10283522 Ga0265338_102835222 161
204 3300031235 Ga0265330_10052550 Ga0265330_100525502 161
205 3300031249 Ga0265339_10012880 Ga0265339_100128805 161
206 3300035695 Ga0373927_0083369 Ga0373927_0083369_463_948 161
207 3300046455 Ga0495603_0011165 Ga0495603_0011165_177_662 161
208 3300046455 Ga0495603_0138816 Ga0495603_0138816_843_1328 161
209 3300046674 Ga0495588_0230927 Ga0495588_0230927_461_946 161
210 3300046683 Ga0495658_0368767 Ga0495658_0368767_278_763 161
211 3300046684 Ga0495669_0159387 Ga0495669_0159387_120_605 161
212 3300049571 Ga0501034_0176446 Ga0501034_0176446_1465_1950 161
213 3300049571 Ga0501034_0890012 Ga0501034_0890012_211_708 161
214 3300049581 Ga0501047_0339908 Ga0501047_0339908_493_990 161
215 3300049589 Ga0501073_0011409 Ga0501073_0011409_1833_2330 161
216 3300049744 Ga0501083_0387532 Ga0501083_0387532_191_688 161
217 iso_pu_bacteria 8055431914 8055432095 161
218 3300003203 JGI25406J46586_10004829 JGI25406J46586_100048293 162
219 3300003203 JGI25406J46586_10119250 JGI25406J46586_101192502 162
220 3300003659 JGI25404J52841_10006426 JGI25404J52841_100064262 162
221 3300003659 JGI25404J52841_10025723 JGI25404J52841_100257232 162
222 3300003659 JGI25404J52841_10055406 JGI25404J52841_100554062 162
223 3300003752 Ga0055539_1007498 Ga0055539_10074982 162
224 3300003911 JGI25405J52794_10022829 JGI25405J52794_100228292 162
225 3300005327 Ga0070658_10282915 Ga0070658_102829152 162
226 3300005328 Ga0070676_11332112 Ga0070676_113321121 162
227 3300005329 Ga0070683_100005509 Ga0070683_1000055095 162
228 3300005329 Ga0070683_100116045 Ga0070683_1001160452 162
229 3300005335 Ga0070666_10551198 Ga0070666_105511981 162
230 3300005336 Ga0070680_100032227 Ga0070680_1000322271 162
231 3300005336 Ga0070680_100059733 Ga0070680_1000597332 162
232 3300005336 Ga0070680_100081160 Ga0070680_1000811603 162
233 3300005337 Ga0070682_100062949 Ga0070682_1000629493 162
234 3300005337 Ga0070682_100467807 Ga0070682_1004678072 162
235 3300005338 Ga0068868_100062713 Ga0068868_1000627132 162
236 3300005339 Ga0070660_100129823 Ga0070660_1001298232 162
237 3300005339 Ga0070660_100255057 Ga0070660_1002550572 162
238 3300005341 Ga0070691_10092184 Ga0070691_100921842 162
239 3300005344 Ga0070661_100059699 Ga0070661_1000596994 162
240 3300005344 Ga0070661_100429771 Ga0070661_1004297711 162
241 3300005345 Ga0070692_10460786 Ga0070692_104607861 162
242 3300005347 Ga0070668_100907068 Ga0070668_1009070682 162
243 3300005354 Ga0070675_101088589 Ga0070675_1010885891 162
244 3300005355 Ga0070671_100067271 Ga0070671_1000672713 162
245 3300005355 Ga0070671_100150697 Ga0070671_1001506972 162
246 3300005356 Ga0070674_100582631 Ga0070674_1005826312 162
247 3300005364 Ga0070673_100517667 Ga0070673_1005176672 162
248 3300005366 Ga0070659_100069240 Ga0070659_1000692403 162
249 3300005366 Ga0070659_100179910 Ga0070659_1001799102 162
250 3300005366 Ga0070659_100401918 Ga0070659_1004019182 162
251 3300005367 Ga0070667_100254144 Ga0070667_1002541441 162
252 3300005367 Ga0070667_100861179 Ga0070667_1008611792 162
253 3300005434 Ga0070709_10002522 Ga0070709_100025225 162
254 3300005434 Ga0070709_10073314 Ga0070709_100733143 162
255 3300005434 Ga0070709_10782322 Ga0070709_107823221 162
256 3300005434 Ga0070709_11052826 Ga0070709_110528261 162
257 3300005435 Ga0070714_100022715 Ga0070714_1000227156 162
258 3300005435 Ga0070714_100048487 Ga0070714_1000484872 162
259 3300005435 Ga0070714_100511644 Ga0070714_1005116441 162
260 3300005436 Ga0070713_100010481 Ga0070713_1000104818 162
261 3300005436 Ga0070713_100024458 Ga0070713_1000244586 162
262 3300005436 Ga0070713_100186788 Ga0070713_1001867882 162
263 3300005437 Ga0070710_10002131 Ga0070710_100021315 162
264 3300005437 Ga0070710_10010042 Ga0070710_100100427 162
265 3300005439 Ga0070711_100002112 Ga0070711_1000021126 162
266 3300005439 Ga0070711_100010614 Ga0070711_1000106144 162
267 3300005444 Ga0070694_100296546 Ga0070694_1002965462 162
268 3300005445 Ga0070708_100507479 Ga0070708_1005074791 162
269 3300005455 Ga0070663_100014258 Ga0070663_1000142584 162
270 3300005455 Ga0070663_100071097 Ga0070663_1000710971 162
271 3300005455 Ga0070663_100403798 Ga0070663_1004037982 162
272 3300005456 Ga0070678_100057001 Ga0070678_1000570013 162
273 3300005456 Ga0070678_100114280 Ga0070678_1001142802 162
274 3300005456 Ga0070678_100276809 Ga0070678_1002768092 162
275 3300005457 Ga0070662_100543948 Ga0070662_1005439482 162
276 3300005458 Ga0070681_10026470 Ga0070681_100264702 162
277 3300005458 Ga0070681_10303321 Ga0070681_103033212 162
278 3300005459 Ga0068867_100441120 Ga0068867_1004411201 162
279 3300005467 Ga0070706_100290542 Ga0070706_1002905422 162
280 3300005530 Ga0070679_100052906 Ga0070679_1000529065 162
281 3300005530 Ga0070679_100084151 Ga0070679_1000841514 162
282 3300005530 Ga0070679_100149996 Ga0070679_1001499963 162
283 3300005530 Ga0070679_100267529 Ga0070679_1002675292 162
284 3300005530 Ga0070679_101357562 Ga0070679_1013575621 162
285 3300005535 Ga0070684_100036017 Ga0070684_1000360175 162
286 3300005539 Ga0068853_100068543 Ga0068853_1000685434 162
287 3300005539 Ga0068853_100185607 Ga0068853_1001856072 162
288 3300005539 Ga0068853_100900210 Ga0068853_1009002101 162
289 3300005544 Ga0070686_100404931 Ga0070686_1004049312 162
290 3300005545 Ga0070695_100879197 Ga0070695_1008791971 162
291 3300005547 Ga0070693_100108922 Ga0070693_1001089221 162
292 3300005547 Ga0070693_100880423 Ga0070693_1008804231 162
293 3300005548 Ga0070665_100007112 Ga0070665_1000071128 162
294 3300005548 Ga0070665_100036710 Ga0070665_1000367103 162
295 3300005548 Ga0070665_100404859 Ga0070665_1004048592 162
296 3300005548 Ga0070665_100477047 Ga0070665_1004770472 162
297 3300005563 Ga0068855_100025571 Ga0068855_1000255715 162
298 3300005563 Ga0068855_100188782 Ga0068855_1001887824 162
299 3300005563 Ga0068855_100284931 Ga0068855_1002849312 162
300 3300005563 Ga0068855_100338809 Ga0068855_1003388092 162
301 3300005564 Ga0070664_100071249 Ga0070664_1000712492 162
302 3300005577 Ga0068857_100062152 Ga0068857_1000621527 162
303 3300005578 Ga0068854_100118632 Ga0068854_1001186324 162
304 3300005614 Ga0068856_100000055 Ga0068856_10000005586 162
305 3300005614 Ga0068856_100109014 Ga0068856_1001090142 162
306 3300005616 Ga0068852_100012401 Ga0068852_1000124017 162
307 3300005616 Ga0068852_100085424 Ga0068852_1000854246 162
308 3300005616 Ga0068852_100254822 Ga0068852_1002548222 162
309 3300005616 Ga0068852_100394068 Ga0068852_1003940682 162
310 3300005616 Ga0068852_100532961 Ga0068852_1005329612 162
311 3300005617 Ga0068859_101926464 Ga0068859_1019264642 162
312 3300005618 Ga0068864_100130417 Ga0068864_1001304172 162
313 3300005618 Ga0068864_100625516 Ga0068864_1006255162 162
314 3300005718 Ga0068866_10072331 Ga0068866_100723312 162
315 3300005719 Ga0068861_100058125 Ga0068861_1000581252 162
316 3300005719 Ga0068861_100262215 Ga0068861_1002622151 162
317 3300005719 Ga0068861_100391056 Ga0068861_1003910562 162
318 3300005841 Ga0068863_100112354 Ga0068863_1001123545 162
319 3300005841 Ga0068863_101019888 Ga0068863_1010198882 162
320 3300005842 Ga0068858_100227226 Ga0068858_1002272262 162
321 3300005843 Ga0068860_100537885 Ga0068860_1005378851 162
322 3300005937 Ga0081455_10005648 Ga0081455_100056489 162
323 3300005937 Ga0081455_10032267 Ga0081455_100322674 162
324 3300005937 Ga0081455_10068600 Ga0081455_100686004 162
325 3300005983 Ga0081540_1001390 Ga0081540_100139015 162
326 3300005983 Ga0081540_1002001 Ga0081540_100200120 162
327 3300005983 Ga0081540_1008054 Ga0081540_10080541 162
328 3300005983 Ga0081540_1009977 Ga0081540_10099774 162
329 3300005983 Ga0081540_1025849 Ga0081540_10258492 162
330 3300005983 Ga0081540_1061349 Ga0081540_10613492 162
331 3300005985 Ga0081539_10001188 Ga0081539_1000118818 162
332 3300005985 Ga0081539_10040716 Ga0081539_100407162 162
333 3300006028 Ga0070717_10233283 Ga0070717_102332832 162
334 3300006038 Ga0075365_10036277 Ga0075365_100362774 162
335 3300006038 Ga0075365_10044545 Ga0075365_100445452 162
336 3300006038 Ga0075365_10154050 Ga0075365_101540502 162
337 3300006038 Ga0075365_10193886 Ga0075365_101938862 162
338 3300006038 Ga0075365_10406838 Ga0075365_104068382 162
339 3300006042 Ga0075368_10031198 Ga0075368_100311983 162
340 3300006048 Ga0075363_100024437 Ga0075363_1000244372 162
341 3300006048 Ga0075363_100042516 Ga0075363_1000425162 162
342 3300006048 Ga0075363_100287711 Ga0075363_1002877112 162
343 3300006051 Ga0075364_10028092 Ga0075364_100280922 162
344 3300006051 Ga0075364_10109512 Ga0075364_101095122 162
345 3300006163 Ga0070715_10047287 Ga0070715_100472872 162
346 3300006173 Ga0070716_100094063 Ga0070716_1000940634 162
347 3300006173 Ga0070716_100773824 Ga0070716_1007738241 162
348 3300006175 Ga0070712_100022644 Ga0070712_1000226447 162
349 3300006175 Ga0070712_100232178 Ga0070712_1002321782 162
350 3300006175 Ga0070712_100365845 Ga0070712_1003658452 162
351 3300006177 Ga0075362_10165498 Ga0075362_101654983 162
352 3300006178 Ga0075367_10015243 Ga0075367_100152432 162
353 3300006178 Ga0075367_10025742 Ga0075367_100257422 162
354 3300006178 Ga0075367_10138147 Ga0075367_101381472 162
355 3300006178 Ga0075367_10313901 Ga0075367_103139011 162
356 3300006178 Ga0075367_10380622 Ga0075367_103806222 162
357 3300006186 Ga0075369_10067109 Ga0075369_100671093 162
358 3300006186 Ga0075369_10091981 Ga0075369_100919811 162
359 3300006186 Ga0075369_10183723 Ga0075369_101837232 162
360 3300006195 Ga0075366_10296025 Ga0075366_102960251 162
361 3300006237 Ga0097621_100071832 Ga0097621_1000718323 162
362 3300006237 Ga0097621_101801221 Ga0097621_1018012211 162
363 3300006353 Ga0075370_10107531 Ga0075370_101075312 162
364 3300006353 Ga0075370_10348669 Ga0075370_103486692 162
365 3300006358 Ga0068871_100263261 Ga0068871_1002632612 162
366 3300006358 Ga0068871_100654333 Ga0068871_1006543331 162
367 3300006358 Ga0068871_100974776 Ga0068871_1009747762 162
368 3300006844 Ga0075428_100062853 Ga0075428_1000628533 162
369 3300006871 Ga0075434_100042655 Ga0075434_1000426557 162
370 3300006881 Ga0068865_100196452 Ga0068865_1001964521 162
371 3300006881 Ga0068865_100297496 Ga0068865_1002974962 162
372 3300006931 Ga0097620_100284108 Ga0097620_1002841082 162
373 3300006931 Ga0097620_101926151 Ga0097620_1019261512 162
374 3300006942 Ga0099824_1007275 Ga0099824_100727511 162
375 3300006943 Ga0099822_1013306 Ga0099822_101330610 162
376 3300007076 Ga0075435_101115497 Ga0075435_1011154971 162
377 3300007788 Ga0099795_10089844 Ga0099795_100898441 162
378 3300009093 Ga0105240_10057119 Ga0105240_100571191 162
379 3300009094 Ga0111539_10069960 Ga0111539_100699603 162
380 3300009098 Ga0105245_10782135 Ga0105245_107821352 162
381 3300009101 Ga0105247_10047041 Ga0105247_100470412 162
382 3300009101 Ga0105247_10074777 Ga0105247_100747774 162
383 3300009101 Ga0105247_10127179 Ga0105247_101271792 162
384 3300009101 Ga0105247_10212662 Ga0105247_102126622 162
385 3300009147 Ga0114129_10263752 Ga0114129_102637522 162
386 3300009147 Ga0114129_11200066 Ga0114129_112000662 162
387 3300009148 Ga0105243_10613798 Ga0105243_106137981 162
388 3300009174 Ga0105241_10194732 Ga0105241_101947322 162
389 3300009174 Ga0105241_10313467 Ga0105241_103134672 162
390 3300009174 Ga0105241_10660773 Ga0105241_106607732 162
391 3300009176 Ga0105242_11469260 Ga0105242_114692602 162
392 3300009177 Ga0105248_10048948 Ga0105248_100489484 162
393 3300009177 Ga0105248_10062199 Ga0105248_100621994 162
394 3300009177 Ga0105248_10461520 Ga0105248_104615202 162
395 3300009545 Ga0105237_10033693 Ga0105237_100336934 162
396 3300009545 Ga0105237_10157860 Ga0105237_101578603 162
397 3300009551 Ga0105238_11454779 Ga0105238_114547791 162
398 3300010159 Ga0099796_10290222 Ga0099796_102902222 162
399 3300010375 Ga0105239_10064277 Ga0105239_100642776 162
400 3300010375 Ga0105239_10115634 Ga0105239_101156343 162
401 3300010375 Ga0105239_10408015 Ga0105239_104080152 162
402 3300010375 Ga0105239_11261989 Ga0105239_112619892 162
403 3300011119 Ga0105246_10132355 Ga0105246_101323552 162
404 3300011119 Ga0105246_10257260 Ga0105246_102572602 162
405 3300013104 Ga0157370_10012374 Ga0157370_100123743 162
406 3300013104 Ga0157370_10056509 Ga0157370_100565093 162
407 3300013104 Ga0157370_10222336 Ga0157370_102223362 162
408 3300013105 Ga0157369_10010958 Ga0157369_100109582 162
409 3300013105 Ga0157369_10305195 Ga0157369_103051952 162
410 3300013105 Ga0157369_10601811 Ga0157369_106018112 162
411 3300013296 Ga0157374_10018619 Ga0157374_100186196 162
412 3300013297 Ga0157378_10048781 Ga0157378_100487814 162
413 3300013297 Ga0157378_10643001 Ga0157378_106430011 162
414 3300013306 Ga0163162_10889368 Ga0163162_108893682 162
415 3300013306 Ga0163162_12605797 Ga0163162_126057971 162
416 3300013307 Ga0157372_10041439 Ga0157372_100414392 162
417 3300013307 Ga0157372_10294661 Ga0157372_102946611 162
418 3300013307 Ga0157372_11020285 Ga0157372_110202852 162
419 3300013307 Ga0157372_12357385 Ga0157372_123573851 162
420 3300013308 Ga0157375_10026458 Ga0157375_100264586 162
421 3300013308 Ga0157375_10156886 Ga0157375_101568862 162
422 3300013308 Ga0157375_12404742 Ga0157375_124047421 162
423 3300014325 Ga0163163_10493659 Ga0163163_104936591 162
424 3300014325 Ga0163163_10757124 Ga0163163_107571242 162
425 3300014326 Ga0157380_10462971 Ga0157380_104629712 162
426 3300014968 Ga0157379_10013008 Ga0157379_1001300810 162
427 3300014968 Ga0157379_10721605 Ga0157379_107216052 162
428 3300014969 Ga0157376_10069756 Ga0157376_100697562 162
429 3300014969 Ga0157376_11124189 Ga0157376_111241892 162
430 3300014969 Ga0157376_11501603 Ga0157376_115016031 162
431 3300020081 Ga0206354_11535455 Ga0206354_115354552 162
432 3300020082 Ga0206353_10607391 Ga0206353_106073912 162
433 3300021377 Ga0213874_10054570 Ga0213874_100545702 162
434 3300021377 Ga0213874_10088994 Ga0213874_100889942 162
435 3300021384 Ga0213876_10016738 Ga0213876_100167382 162
436 3300021388 Ga0213875_10024254 Ga0213875_100242542 162
437 3300025253 Ga0209677_100264 Ga0209677_10026418 162
438 3300025254 Ga0209148_1013301 Ga0209148_10133012 162
439 3300025261 Ga0209233_1001365 Ga0209233_100136510 162
440 3300025261 Ga0209233_1004762 Ga0209233_10047622 162
441 3300025272 Ga0209455_1004866 Ga0209455_10048667 162
442 3300025272 Ga0209455_1018854 Ga0209455_10188542 162
443 3300025295 Ga0209564_1009473 Ga0209564_10094738 162
444 3300025297 Ga0209758_1038909 Ga0209758_10389093 162
445 3300025315 Ga0207697_10079095 Ga0207697_100790952 162
446 3300025315 Ga0207697_10113864 Ga0207697_101138642 162
447 3300025885 Ga0207653_10005522 Ga0207653_100055225 162
448 3300025893 Ga0207682_10043080 Ga0207682_100430802 162
449 3300025898 Ga0207692_10002507 Ga0207692_100025074 162
450 3300025898 Ga0207692_10119824 Ga0207692_101198242 162
451 3300025898 Ga0207692_10716662 Ga0207692_107166621 162
452 3300025899 Ga0207642_10009209 Ga0207642_100092093 162
453 3300025900 Ga0207710_10032980 Ga0207710_100329801 162
454 3300025900 Ga0207710_10223611 Ga0207710_102236112 162
455 3300025901 Ga0207688_10246677 Ga0207688_102466771 162
456 3300025901 Ga0207688_10384606 Ga0207688_103846062 162
457 3300025904 Ga0207647_10104124 Ga0207647_101041242 162
458 3300025904 Ga0207647_10266406 Ga0207647_102664061 162
459 3300025904 Ga0207647_10499800 Ga0207647_104998002 162
460 3300025905 Ga0207685_10060377 Ga0207685_100603772 162
461 3300025906 Ga0207699_10031457 Ga0207699_100314576 162
462 3300025906 Ga0207699_10164847 Ga0207699_101648471 162
463 3300025906 Ga0207699_10415613 Ga0207699_104156132 162
464 3300025906 Ga0207699_10590914 Ga0207699_105909142 162
465 3300025907 Ga0207645_10107923 Ga0207645_101079234 162
466 3300025907 Ga0207645_10299138 Ga0207645_102991382 162
467 3300025909 Ga0207705_10421672 Ga0207705_104216722 162
468 3300025910 Ga0207684_10242111 Ga0207684_102421112 162
469 3300025910 Ga0207684_10836184 Ga0207684_108361842 162
470 3300025911 Ga0207654_10770809 Ga0207654_107708092 162
471 3300025912 Ga0207707_10015807 Ga0207707_100158075 162
472 3300025912 Ga0207707_10037322 Ga0207707_100373226 162
473 3300025912 Ga0207707_10491678 Ga0207707_104916782 162
474 3300025912 Ga0207707_10921718 Ga0207707_109217181 162
475 3300025912 Ga0207707_11051478 Ga0207707_110514781 162
476 3300025913 Ga0207695_10349049 Ga0207695_103490492 162
477 3300025914 Ga0207671_10020809 Ga0207671_100208095 162
478 3300025914 Ga0207671_10057575 Ga0207671_100575753 162
479 3300025914 Ga0207671_10129995 Ga0207671_101299952 162
480 3300025914 Ga0207671_10179245 Ga0207671_101792452 162
481 3300025914 Ga0207671_10796407 Ga0207671_107964071 162
482 3300025915 Ga0207693_10066850 Ga0207693_100668502 162
483 3300025915 Ga0207693_10075789 Ga0207693_100757892 162
484 3300025915 Ga0207693_10140313 Ga0207693_101403132 162
485 3300025916 Ga0207663_10002035 Ga0207663_100020352 162
486 3300025916 Ga0207663_10031644 Ga0207663_100316442 162
487 3300025917 Ga0207660_10061983 Ga0207660_100619832 162
488 3300025917 Ga0207660_10298987 Ga0207660_102989872 162
489 3300025917 Ga0207660_10940508 Ga0207660_109405082 162
490 3300025919 Ga0207657_10009705 Ga0207657_100097053 162
491 3300025919 Ga0207657_10223318 Ga0207657_102233181 162
492 3300025919 Ga0207657_10223488 Ga0207657_102234882 162
493 3300025920 Ga0207649_10121706 Ga0207649_101217061 162
494 3300025920 Ga0207649_10133867 Ga0207649_101338672 162
495 3300025920 Ga0207649_10670281 Ga0207649_106702811 162
496 3300025921 Ga0207652_10095355 Ga0207652_100953553 162
497 3300025921 Ga0207652_10240711 Ga0207652_102407112 162
498 3300025921 Ga0207652_10559937 Ga0207652_105599372 162
499 3300025923 Ga0207681_10107400 Ga0207681_101074001 162
500 3300025923 Ga0207681_10259799 Ga0207681_102597992 162
501 3300025924 Ga0207694_11205163 Ga0207694_112051631 162
502 3300025928 Ga0207700_10007067 Ga0207700_100070675 162
503 3300025928 Ga0207700_10080515 Ga0207700_100805152 162
504 3300025928 Ga0207700_10140903 Ga0207700_101409032 162
505 3300025928 Ga0207700_10360134 Ga0207700_103601342 162
506 3300025929 Ga0207664_10021207 Ga0207664_100212074 162
507 3300025929 Ga0207664_10036418 Ga0207664_100364187 162
508 3300025931 Ga0207644_10305068 Ga0207644_103050681 162
509 3300025932 Ga0207690_10107512 Ga0207690_101075121 162
510 3300025932 Ga0207690_10155100 Ga0207690_101551001 162
511 3300025932 Ga0207690_10604848 Ga0207690_106048482 162
512 3300025933 Ga0207706_10023157 Ga0207706_100231577 162
513 3300025937 Ga0207669_10539659 Ga0207669_105396592 162
514 3300025939 Ga0207665_10010412 Ga0207665_100104122 162
515 3300025939 Ga0207665_10719502 Ga0207665_107195021 162
516 3300025941 Ga0207711_10184139 Ga0207711_101841393 162
517 3300025941 Ga0207711_10363533 Ga0207711_103635332 162
518 3300025942 Ga0207689_10220943 Ga0207689_102209432 162
519 3300025944 Ga0207661_10015139 Ga0207661_100151393 162
520 3300025944 Ga0207661_10895380 Ga0207661_108953801 162
521 3300025945 Ga0207679_11035552 Ga0207679_110355522 162
522 3300025949 Ga0207667_10010515 Ga0207667_100105152 162
523 3300025949 Ga0207667_10503559 Ga0207667_105035592 162
524 3300025949 Ga0207667_11155936 Ga0207667_111559362 162
525 3300025949 Ga0207667_11597022 Ga0207667_115970221 162
526 3300025960 Ga0207651_11429407 Ga0207651_114294071 162
527 3300025972 Ga0207668_10677433 Ga0207668_106774331 162
528 3300025972 Ga0207668_11297870 Ga0207668_112978701 162
529 3300025981 Ga0207640_10166036 Ga0207640_101660363 162
530 3300025981 Ga0207640_10313821 Ga0207640_103138212 162
531 3300025981 Ga0207640_10326328 Ga0207640_103263282 162
532 3300025986 Ga0207658_10220840 Ga0207658_102208401 162
533 3300026023 Ga0207677_10240770 Ga0207677_102407702 162
534 3300026035 Ga0207703_10176674 Ga0207703_101766742 162
535 3300026035 Ga0207703_11371736 Ga0207703_113717361 162
536 3300026035 Ga0207703_11908406 Ga0207703_119084061 162
537 3300026041 Ga0207639_10046533 Ga0207639_100465333 162
538 3300026041 Ga0207639_10344440 Ga0207639_103444401 162
539 3300026041 Ga0207639_10453430 Ga0207639_104534302 162
540 3300026041 Ga0207639_10793080 Ga0207639_107930802 162
541 3300026067 Ga0207678_10036005 Ga0207678_100360052 162
542 3300026067 Ga0207678_10197973 Ga0207678_101979732 162
543 3300026067 Ga0207678_10199123 Ga0207678_101991233 162
544 3300026067 Ga0207678_11270392 Ga0207678_112703921 162
545 3300026078 Ga0207702_10000287 Ga0207702_1000028754 162
546 3300026078 Ga0207702_10082643 Ga0207702_100826433 162
547 3300026078 Ga0207702_10469161 Ga0207702_104691612 162
548 3300026078 Ga0207702_11399887 Ga0207702_113998871 162
549 3300026088 Ga0207641_10118152 Ga0207641_101181525 162
550 3300026088 Ga0207641_10884774 Ga0207641_108847742 162
551 3300026089 Ga0207648_10123038 Ga0207648_101230382 162
552 3300026095 Ga0207676_10277842 Ga0207676_102778422 162
553 3300026116 Ga0207674_10068661 Ga0207674_100686612 162
554 3300026116 Ga0207674_11076227 Ga0207674_110762272 162
555 3300026118 Ga0207675_100065722 Ga0207675_1000657222 162
556 3300026118 Ga0207675_100785536 Ga0207675_1007855362 162
557 3300026121 Ga0207683_10077274 Ga0207683_100772743 162
558 3300026121 Ga0207683_10272055 Ga0207683_102720553 162
559 3300026121 Ga0207683_10291806 Ga0207683_102918062 162
560 3300026121 Ga0207683_10371043 Ga0207683_103710432 162
561 3300026121 Ga0207683_10477914 Ga0207683_104779142 162
562 3300026121 Ga0207683_10810966 Ga0207683_108109661 162
563 3300026142 Ga0207698_10010329 Ga0207698_100103299 162
564 3300026142 Ga0207698_10381493 Ga0207698_103814932 162
565 3300026142 Ga0207698_10911832 Ga0207698_109118321 162
566 3300027357 Ga0209589_1000005 Ga0209589_100000578 162
567 3300027361 Ga0209489_100005 Ga0209489_10000578 162
568 3300027363 Ga0209700_100006 Ga0209700_10000678 162
569 3300027907 Ga0207428_10464316 Ga0207428_104643161 162
570 3300028379 Ga0268266_10003479 Ga0268266_1000347910 162
571 3300028379 Ga0268266_10007831 Ga0268266_100078312 162
572 3300028379 Ga0268266_10425440 Ga0268266_104254402 162
573 3300028380 Ga0268265_10534337 Ga0268265_105343372 162
574 3300028786 Ga0307517_10000098 Ga0307517_1000009857 162
575 3300028794 Ga0307515_10164978 Ga0307515_101649785 162
576 3300031239 Ga0265328_10043394 Ga0265328_100433943 162
577 3300031249 Ga0265339_10061831 Ga0265339_100618312 162
578 3300031456 Ga0307513_10225523 Ga0307513_102255232 162
579 3300031456 Ga0307513_10423239 Ga0307513_104232391 162
580 3300031456 Ga0307513_10506529 Ga0307513_105065292 162
581 3300031507 Ga0307509_10102974 Ga0307509_101029743 162
582 3300031507 Ga0307509_10279735 Ga0307509_102797352 162
583 3300031507 Ga0307509_10323496 Ga0307509_103234962 162
584 3300031548 Ga0307408_100124425 Ga0307408_1001244253 162
585 3300031616 Ga0307508_10000678 Ga0307508_1000067832 162
586 3300031616 Ga0307508_10027524 Ga0307508_100275242 162
587 3300031616 Ga0307508_10115305 Ga0307508_101153052 162
588 3300031616 Ga0307508_10803174 Ga0307508_108031741 162
589 3300031711 Ga0265314_10007614 Ga0265314_1000761412 162
590 3300031711 Ga0265314_10063760 Ga0265314_100637603 162
591 3300031712 Ga0265342_10039973 Ga0265342_100399732 162
592 3300031730 Ga0307516_10044194 Ga0307516_100441946 162
593 3300031730 Ga0307516_10054727 Ga0307516_100547275 162
594 3300031730 Ga0307516_10185848 Ga0307516_101858482 162
595 3300031731 Ga0307405_10225583 Ga0307405_102255831 162
596 3300031731 Ga0307405_10302810 Ga0307405_103028102 162
597 3300031731 Ga0307405_10340387 Ga0307405_103403872 162
598 3300031824 Ga0307413_10160948 Ga0307413_101609481 162
599 3300031824 Ga0307413_10363307 Ga0307413_103633072 162
600 3300031824 Ga0307413_10441353 Ga0307413_104413532 162
601 3300031852 Ga0307410_10460271 Ga0307410_104602712 162
602 3300031911 Ga0307412_10246753 Ga0307412_102467531 162
603 3300031995 Ga0307409_100310908 Ga0307409_1003109083 162
604 3300032002 Ga0307416_100307599 Ga0307416_1003075992 162
605 3300032002 Ga0307416_102498649 Ga0307416_1024986491 162
606 3300032005 Ga0307411_10195186 Ga0307411_101951862 162
607 3300032005 Ga0307411_10331018 Ga0307411_103310182 162
608 3300032126 Ga0307415_100977281 Ga0307415_1009772812 162
609 3300033180 Ga0307510_10005253 Ga0307510_100052538 162
610 3300033442 Ga0315911_1000022 Ga0315911_100002286 162
611 3300033544 Ga0316215_1006240 Ga0316215_10062401 162
612 3300033548 Ga0316216_1003343 Ga0316216_10033431 162
613 3300034818 Ga0373950_0012861 Ga0373950_0012861_201_689 162
614 3300034957 Ga0373938_0054638 Ga0373938_0054638_266_754 162
615 3300035083 Ga0373926_0024385 Ga0373926_0024385_978_1466 162
616 3300035083 Ga0373926_0138356 Ga0373926_0138356_280_768 162
617 3300035085 Ga0373929_0024231 Ga0373929_0024231_611_1099 162
618 3300035090 Ga0373949_0010439 Ga0373949_0010439_159_647 162
619 3300035111 Ga0373923_0007172 Ga0373923_0007172_1735_2223 162
620 3300035112 Ga0373932_0082230 Ga0373932_0082230_287_775 162
621 3300035113 Ga0373936_0038057 Ga0373936_0038057_185_673 162
622 3300035113 Ga0373936_0046065 Ga0373936_0046065_1141_1629 162
623 3300035113 Ga0373936_0075618 Ga0373936_0075618_664_1152 162
624 3300035113 Ga0373936_0302135 Ga0373936_0302135_109_597 162
625 3300035116 Ga0373945_0006472 Ga0373945_0006472_3060_3548 162
626 3300035116 Ga0373945_0260912 Ga0373945_0260912_133_621 162
627 3300035117 Ga0373953_0049275 Ga0373953_0049275_19_507 162
628 3300035121 Ga0373960_0046468 Ga0373960_0046468_651_1139 162
629 3300035170 Ga0373943_0127658 Ga0373943_0127658_249_737 162
630 3300035171 Ga0373946_0200659 Ga0373946_0200659_174_662 162
631 3300035171 Ga0373946_0366950 Ga0373946_0366950_106_594 162
632 3300035691 Ga0373931_0000915 Ga0373931_0000915_6864_7352 162
633 3300035692 Ga0373935_0073599 Ga0373935_0073599_501_989 162
634 3300035692 Ga0373935_0151442 Ga0373935_0151442_141_629 162
635 3300035695 Ga0373927_0003250 Ga0373927_0003250_2458_2946 162
636 3300035695 Ga0373927_0005961 Ga0373927_0005961_4779_5267 162
637 3300035695 Ga0373927_0032352 Ga0373927_0032352_484_972 162
638 3300035695 Ga0373927_0074901 Ga0373927_0074901_1684_2172 162
639 3300035695 Ga0373927_0080688 Ga0373927_0080688_823_1311 162
640 3300035695 Ga0373927_0131012 Ga0373927_0131012_113_601 162
641 3300035695 Ga0373927_0485256 Ga0373927_0485256_20_508 162
642 3300035724 Ga0373933_0000536 Ga0373933_0000536_21355_21843 162
643 3300035724 Ga0373933_0009887 Ga0373933_0009887_3195_3683 162
644 3300035724 Ga0373933_0579030 Ga0373933_0579030_40_528 162
645 3300035725 Ga0373947_0078460 Ga0373947_0078460_1167_1655 162
646 3300035725 Ga0373947_0125529 Ga0373947_0125529_355_843 162
647 3300035725 Ga0373947_0305050 Ga0373947_0305050_532_1020 162
648 3300035725 Ga0373947_0307882 Ga0373947_0307882_60_548 162
649 3300036401 Ga0373937_0021969 Ga0373937_0021969_642_1130 162
650 3300036459 Ga0372808_000838 Ga0372808_000838_1143_1631 162
651 3300037068 Ga0373925_0036358 Ga0373925_0036358_1812_2300 162
652 3300037068 Ga0373925_0173379 Ga0373925_0173379_521_1009 162
653 3300037068 Ga0373925_0477839 Ga0373925_0477839_402_890 162
654 3300037418 Ga0395900_0095404 Ga0395900_0095404_28_516 162
655 3300037418 Ga0395900_0417097 Ga0395900_0417097_182_676 162
656 3300037466 Ga0395898_0035381 Ga0395898_0035381_282_770 162
657 3300037466 Ga0395898_0054928 Ga0395898_0054928_2739_3227 162
658 3300037466 Ga0395898_0108406 Ga0395898_0108406_1244_1738 162
659 3300037471 Ga0395905_1096722 Ga0395905_1096722_70_558 162
660 3300037853 Ga0436364_0982560 Ga0436364_0982560_5018_5506 162
661 3300037853 Ga0436364_1143755 Ga0436364_1143755_795_1283 162
662 3300039437 Ga0436365_0205832 Ga0436365_0205832_6097_6585 162
663 3300039437 Ga0436365_0924470 Ga0436365_0924470_1133_1621 162
664 3300039438 Ga0436360_0179349 Ga0436360_0179349_94_582 162
665 3300039438 Ga0436360_1291396 Ga0436360_1291396_496_984 162
666 3300039447 Ga0436361_0028451 Ga0436361_0028451_255_743 162
667 3300039447 Ga0436361_0339604 Ga0436361_0339604_986_1474 162
668 3300039450 Ga0436363_1083454 Ga0436363_1083454_671_1159 162
669 3300039450 Ga0436363_1193054 Ga0436363_1193054_827_1315 162
670 3300039453 Ga0436362_0088613 Ga0436362_0088613_5715_6203 162
671 3300039453 Ga0436362_0915997 Ga0436362_0915997_240_830 162
672 3300041452 Ga0451793_1853703 Ga0451793_1853703_303_815 162
673 3300041492 Ga0451835_0578077 Ga0451835_0578077_145_633 162
674 3300041512 Ga0451853_0044773 Ga0451853_0044773_124_612 162
675 3300041512 Ga0451853_1423910 Ga0451853_1423910_169_657 162
676 3300042012 Ga0439455_0065262 Ga0439455_0065262_207_695 162
677 3300044656 Ga0466969_0129919 Ga0466969_0129919_53_541 162
678 3300044693 Ga0466961_0465244 Ga0466961_0465244_172_660 162
679 3300044735 Ga0466968_0111699 Ga0466968_0111699_680_1168 162
680 3300044765 Ga0466970_0223633 Ga0466970_0223633_205_693 162
681 3300044765 Ga0466970_0416689 Ga0466970_0416689_182_670 162
682 3300044842 Ga0466957_0587806 Ga0466957_0587806_279_767 162
683 3300045049 Ga0466959_0102092 Ga0466959_0102092_1276_1764 162
684 3300045049 Ga0466959_0761497 Ga0466959_0761497_97_585 162
685 3300045976 Ga0466967_1372846 Ga0466967_1372846_104_592 162
686 3300046452 Ga0495617_035898 Ga0495617_035898_61_549 162
687 3300046453 Ga0495627_095052 Ga0495627_095052_327_815 162
688 3300046454 Ga0495592_0038026 Ga0495592_0038026_2422_2910 162
689 3300046455 Ga0495603_0022523 Ga0495603_0022523_2280_2768 162
690 3300046455 Ga0495603_0025847 Ga0495603_0025847_728_1216 162
691 3300046455 Ga0495603_0521846 Ga0495603_0521846_43_531 162
692 3300046457 Ga0495590_0065417 Ga0495590_0065417_626_1114 162
693 3300046459 Ga0495629_0182227 Ga0495629_0182227_927_1415 162
694 3300046459 Ga0495629_0184168 Ga0495629_0184168_723_1211 162
695 3300046459 Ga0495629_0567327 Ga0495629_0567327_158_646 162
696 3300046459 Ga0495629_0868525 Ga0495629_0868525_87_575 162
697 3300046460 Ga0495638_0054657 Ga0495638_0054657_757_1245 162
698 3300046461 Ga0495641_0044799 Ga0495641_0044799_620_1108 162
699 3300046461 Ga0495641_0369729 Ga0495641_0369729_88_576 162
700 3300046462 Ga0495651_0113504 Ga0495651_0113504_375_863 162
701 3300046462 Ga0495651_0117170 Ga0495651_0117170_770_1258 162
702 3300046472 Ga0495580_0009940 Ga0495580_0009940_3805_4293 162
703 3300046472 Ga0495580_0530150 Ga0495580_0530150_187_675 162
704 3300046473 Ga0495582_0007218 Ga0495582_0007218_5433_5921 162
705 3300046473 Ga0495582_0344184 Ga0495582_0344184_238_726 162
706 3300046474 Ga0495605_0066802 Ga0495605_0066802_1201_1689 162
707 3300046475 Ga0495639_0014200 Ga0495639_0014200_2117_2605 162
708 3300046475 Ga0495639_0133759 Ga0495639_0133759_595_1083 162
709 3300046475 Ga0495639_0312781 Ga0495639_0312781_278_766 162
710 3300046476 Ga0495662_0205676 Ga0495662_0205676_228_716 162
711 3300046477 Ga0495664_0015668 Ga0495664_0015668_2279_2767 162
712 3300046477 Ga0495664_0016768 Ga0495664_0016768_3065_3553 162
713 3300046477 Ga0495664_0091152 Ga0495664_0091152_137_625 162
714 3300046477 Ga0495664_0428084 Ga0495664_0428084_214_702 162
715 3300046491 Ga0495584_0286735 Ga0495584_0286735_53_541 162
716 3300046491 Ga0495584_0385134 Ga0495584_0385134_62_550 162
717 3300046492 Ga0495585_0082648 Ga0495585_0082648_1099_1587 162
718 3300046492 Ga0495585_0087368 Ga0495585_0087368_1027_1515 162
719 3300046492 Ga0495585_0544216 Ga0495585_0544216_36_524 162
720 3300046500 Ga0495596_0032426 Ga0495596_0032426_1335_1823 162
721 3300046500 Ga0495596_0145491 Ga0495596_0145491_54_542 162
722 3300046500 Ga0495596_0273855 Ga0495596_0273855_122_610 162
723 3300046501 Ga0495607_0244587 Ga0495607_0244587_42_530 162
724 3300046506 Ga0495583_0048885 Ga0495583_0048885_1121_1609 162
725 3300046506 Ga0495583_0157240 Ga0495583_0157240_251_739 162
726 3300046507 Ga0495606_0155528 Ga0495606_0155528_398_886 162
727 3300046507 Ga0495606_0302575 Ga0495606_0302575_335_823 162
728 3300046507 Ga0495606_0554059 Ga0495606_0554059_17_505 162
729 3300046511 Ga0495608_0175709 Ga0495608_0175709_564_1052 162
730 3300046511 Ga0495608_0316986 Ga0495608_0316986_170_658 162
731 3300046511 Ga0495608_0692296 Ga0495608_0692296_88_576 162
732 3300046513 Ga0495616_0059046 Ga0495616_0059046_390_878 162
733 3300046513 Ga0495616_0414348 Ga0495616_0414348_18_506 162
734 3300046514 Ga0495618_0022470 Ga0495618_0022470_748_1236 162
735 3300046515 Ga0495620_0078980 Ga0495620_0078980_324_812 162
736 3300046516 Ga0495628_0546390 Ga0495628_0546390_35_523 162
737 3300046516 Ga0495628_0822976 Ga0495628_0822976_71_559 162
738 3300046517 Ga0495630_0040315 Ga0495630_0040315_2991_3479 162
739 3300046517 Ga0495630_0733223 Ga0495630_0733223_89_577 162
740 3300046518 Ga0495631_0038572 Ga0495631_0038572_1037_1525 162
741 3300046518 Ga0495631_0068981 Ga0495631_0068981_89_577 162
742 3300046518 Ga0495631_0114158 Ga0495631_0114158_208_696 162
743 3300046518 Ga0495631_0130948 Ga0495631_0130948_174_662 162
744 3300046518 Ga0495631_0264148 Ga0495631_0264148_38_526 162
745 3300046519 Ga0495632_0107100 Ga0495632_0107100_48_536 162
746 3300046519 Ga0495632_0142233 Ga0495632_0142233_165_653 162
747 3300046520 Ga0495637_0020908 Ga0495637_0020908_2458_2946 162
748 3300046523 Ga0495644_0216776 Ga0495644_0216776_40_528 162
749 3300046524 Ga0495648_0067597 Ga0495648_0067597_523_1011 162
750 3300046529 Ga0495652_0264476 Ga0495652_0264476_531_1019 162
751 3300046529 Ga0495652_0288021 Ga0495652_0288021_39_527 162
752 3300046530 Ga0495654_0126291 Ga0495654_0126291_486_974 162
753 3300046535 Ga0495586_0104521 Ga0495586_0104521_222_710 162
754 3300046537 Ga0495598_0048896 Ga0495598_0048896_132_620 162
755 3300046542 Ga0495597_0025983 Ga0495597_0025983_1908_2396 162
756 3300046542 Ga0495597_0095688 Ga0495597_0095688_663_1151 162
757 3300046543 Ga0495645_0064136 Ga0495645_0064136_1402_1890 162
758 3300046543 Ga0495645_0135798 Ga0495645_0135798_139_627 162
759 3300046557 Ga0495622_0138326 Ga0495622_0138326_53_541 162
760 3300046557 Ga0495622_0240388 Ga0495622_0240388_95_583 162
761 3300046558 Ga0495633_0195751 Ga0495633_0195751_391_879 162
762 3300046558 Ga0495633_0333405 Ga0495633_0333405_151_639 162
763 3300046559 Ga0495667_0081398 Ga0495667_0081398_664_1152 162
764 3300046559 Ga0495667_0301080 Ga0495667_0301080_207_695 162
765 3300046615 Ga0495656_0008259 Ga0495656_0008259_2371_2859 162
766 3300046615 Ga0495656_0215723 Ga0495656_0215723_202_690 162
767 3300046615 Ga0495656_0255403 Ga0495656_0255403_204_692 162
768 3300046615 Ga0495656_0312739 Ga0495656_0312739_219_707 162
769 3300046616 Ga0495668_0017269 Ga0495668_0017269_2826_3314 162
770 3300046616 Ga0495668_0177892 Ga0495668_0177892_261_749 162
771 3300046642 Ga0495634_0065864 Ga0495634_0065864_1881_2369 162
772 3300046642 Ga0495634_0502189 Ga0495634_0502189_40_528 162
773 3300046648 Ga0495611_0169521 Ga0495611_0169521_489_977 162
774 3300046660 Ga0495625_0242268 Ga0495625_0242268_488_976 162
775 3300046660 Ga0495625_0364230 Ga0495625_0364230_384_872 162
776 3300046663 Ga0495635_0098507 Ga0495635_0098507_373_861 162
777 3300046663 Ga0495635_0449267 Ga0495635_0449267_222_710 162
778 3300046665 Ga0495661_0150860 Ga0495661_0150860_234_722 162
779 3300046674 Ga0495588_0036900 Ga0495588_0036900_25_513 162
780 3300046674 Ga0495588_0038457 Ga0495588_0038457_1613_2101 162
781 3300046674 Ga0495588_0153256 Ga0495588_0153256_248_736 162
782 3300046675 Ga0495657_0051753 Ga0495657_0051753_907_1395 162
783 3300046678 Ga0495599_0221366 Ga0495599_0221366_333_821 162
784 3300046678 Ga0495599_0510830 Ga0495599_0510830_175_663 162
785 3300046679 Ga0495623_0090972 Ga0495623_0090972_581_1069 162
786 3300046680 Ga0495646_0015482 Ga0495646_0015482_1683_2171 162
787 3300046681 Ga0495647_0026501 Ga0495647_0026501_650_1138 162
788 3300046681 Ga0495647_0194729 Ga0495647_0194729_70_558 162
789 3300046683 Ga0495658_0338535 Ga0495658_0338535_439_927 162
790 3300046683 Ga0495658_0507078 Ga0495658_0507078_65_553 162
791 3300046684 Ga0495669_0002775 Ga0495669_0002775_1167_1655 162
792 3300046684 Ga0495669_0019989 Ga0495669_0019989_1304_1792 162
793 3300046689 Ga0495613_0286885 Ga0495613_0286885_519_1007 162
794 3300046690 Ga0495624_0050542 Ga0495624_0050542_1306_1794 162
795 3300046690 Ga0495624_0183834 Ga0495624_0183834_100_588 162
796 3300046691 Ga0495670_0153058 Ga0495670_0153058_232_720 162
797 3300046691 Ga0495670_0561006 Ga0495670_0561006_46_534 162
798 3300046694 Ga0495649_0224752 Ga0495649_0224752_91_579 162
799 3300046794 Ga0495589_0247741 Ga0495589_0247741_21_509 162
800 3300046794 Ga0495589_0345063 Ga0495589_0345063_29_517 162
801 3300046809 Ga0495600_0055460 Ga0495600_0055460_1196_1684 162
802 3300046810 Ga0495660_0070392 Ga0495660_0070392_980_1468 162
803 3300046810 Ga0495660_0076497 Ga0495660_0076497_1102_1590 162
804 3300047315 Ga0495581_0018052 Ga0495581_0018052_3427_3915 162
805 3300047315 Ga0495581_0324521 Ga0495581_0324521_372_860 162
806 3300047317 Ga0495604_0665217 Ga0495604_0665217_33_521 162
807 3300047317 Ga0495604_0734151 Ga0495604_0734151_40_528 162
808 3300047318 Ga0495636_0112816 Ga0495636_0112816_395_883 162
809 3300047318 Ga0495636_0203635 Ga0495636_0203635_136_624 162
810 3300047318 Ga0495636_0258248 Ga0495636_0258248_127_615 162
811 3300047319 Ga0495674_0012852 Ga0495674_0012852_3825_4313 162
812 3300047319 Ga0495674_0142272 Ga0495674_0142272_173_661 162
813 3300047320 Ga0495672_0024770 Ga0495672_0024770_1920_2408 162
814 3300047320 Ga0495672_0052208 Ga0495672_0052208_1679_2167 162
815 3300047320 Ga0495672_0098193 Ga0495672_0098193_559_1047 162
816 3300047320 Ga0495672_0100853 Ga0495672_0100853_483_971 162
817 3300047321 Ga0495676_0092919 Ga0495676_0092919_1751_2239 162
818 3300047321 Ga0495676_0781324 Ga0495676_0781324_33_521 162
819 3300047322 Ga0495680_0394090 Ga0495680_0394090_343_831 162
820 3300047443 Ga0495687_035147 Ga0495687_035147_1072_1560 162
821 3300047444 Ga0495675_0255568 Ga0495675_0255568_479_967 162
822 3300047445 Ga0495677_0210766 Ga0495677_0210766_190_678 162
823 3300047445 Ga0495677_0215538 Ga0495677_0215538_46_534 162
824 3300047446 Ga0495679_076078 Ga0495679_076078_255_743 162
825 3300047469 Ga0495673_0184098 Ga0495673_0184098_53_541 162
826 3300047471 Ga0495684_0105554 Ga0495684_0105554_1538_2026 162
827 3300047472 Ga0495686_0038202 Ga0495686_0038202_2088_2576 162
828 3300047472 Ga0495686_0045381 Ga0495686_0045381_1575_2063 162
829 3300048088 Ga0495602_0232981 Ga0495602_0232981_626_1114 162
830 3300048088 Ga0495602_0237796 Ga0495602_0237796_866_1354 162
831 3300048091 Ga0495626_0061888 Ga0495626_0061888_1008_1496 162
832 3300048903 Ga0496100_0007336 Ga0496100_0007336_4474_4962 162
833 3300048903 Ga0496100_0209783 Ga0496100_0209783_877_1365 162
834 3300048903 Ga0496100_0243050 Ga0496100_0243050_650_1138 162
835 3300048903 Ga0496100_0406779 Ga0496100_0406779_136_624 162
836 3300048903 Ga0496100_0859312 Ga0496100_0859312_17_505 162
837 3300048904 Ga0496101_0002063 Ga0496101_0002063_8586_9074 162
838 3300048904 Ga0496101_0006658 Ga0496101_0006658_6222_6710 162
839 3300048904 Ga0496101_0061032 Ga0496101_0061032_1304_1792 162
840 3300048904 Ga0496101_0546338 Ga0496101_0546338_304_792 162
841 3300048905 Ga0496102_0002920 Ga0496102_0002920_10481_10969 162
842 3300048905 Ga0496102_0023415 Ga0496102_0023415_1617_2105 162
843 3300048905 Ga0496102_0157380 Ga0496102_0157380_712_1200 162
844 3300048905 Ga0496102_0196308 Ga0496102_0196308_266_754 162
845 3300048905 Ga0496102_0300694 Ga0496102_0300694_203_691 162
846 3300048906 Ga0496103_0060499 Ga0496103_0060499_335_823 162
847 3300048907 Ga0496104_0044633 Ga0496104_0044633_2925_3413 162
848 3300048907 Ga0496104_0044919 Ga0496104_0044919_1808_2296 162
849 3300048907 Ga0496104_0174939 Ga0496104_0174939_1159_1647 162
850 3300048908 Ga0496105_0001825 Ga0496105_0001825_12597_13085 162
851 3300048909 Ga0496106_0000743 Ga0496106_0000743_7878_8366 162
852 3300048909 Ga0496106_0005280 Ga0496106_0005280_6948_7436 162
853 3300048909 Ga0496106_0029914 Ga0496106_0029914_2166_2654 162
854 3300048909 Ga0496106_0132630 Ga0496106_0132630_534_1022 162
855 3300048909 Ga0496106_0716970 Ga0496106_0716970_29_517 162
856 3300048910 Ga0496107_0013354 Ga0496107_0013354_3276_3764 162
857 3300048910 Ga0496107_0052957 Ga0496107_0052957_413_901 162
858 3300048911 Ga0496108_0001385 Ga0496108_0001385_1163_1651 162
859 3300048911 Ga0496108_0299562 Ga0496108_0299562_411_899 162
860 3300048911 Ga0496108_1084554 Ga0496108_1084554_115_603 162
861 3300048912 Ga0496109_0018394 Ga0496109_0018394_2814_3302 162
862 3300048912 Ga0496109_0024523 Ga0496109_0024523_2935_3423 162
863 3300048913 Ga0496110_0041497 Ga0496110_0041497_1387_1875 162
864 3300048913 Ga0496110_0053691 Ga0496110_0053691_3021_3509 162
865 3300048913 Ga0496110_0252065 Ga0496110_0252065_186_674 162
866 3300048914 Ga0496111_0063898 Ga0496111_0063898_530_1018 162
867 3300048914 Ga0496111_0228175 Ga0496111_0228175_707_1195 162
868 3300048914 Ga0496111_0366214 Ga0496111_0366214_147_635 162
869 3300048915 Ga0496112_0000023 Ga0496112_0000023_144427_144915 162
870 3300048915 Ga0496112_0002038 Ga0496112_0002038_12842_13330 162
871 3300048915 Ga0496112_0005113 Ga0496112_0005113_2179_2667 162
872 3300048915 Ga0496112_0115648 Ga0496112_0115648_1080_1568 162
873 3300048915 Ga0496112_0422591 Ga0496112_0422591_651_1139 162
874 3300048915 Ga0496112_0452333 Ga0496112_0452333_258_746 162
875 3300048915 Ga0496112_0964275 Ga0496112_0964275_93_581 162
876 3300048915 Ga0496112_1099666 Ga0496112_1099666_100_588 162
877 3300048916 Ga0496113_0001405 Ga0496113_0001405_1812_2300 162
878 3300048916 Ga0496113_0014962 Ga0496113_0014962_2877_3365 162
879 3300048916 Ga0496113_0040253 Ga0496113_0040253_925_1413 162
880 3300048917 Ga0496114_0014943 Ga0496114_0014943_1517_2005 162
881 3300048917 Ga0496114_0275580 Ga0496114_0275580_62_550 162
882 3300048917 Ga0496114_0554520 Ga0496114_0554520_249_737 162
883 3300048917 Ga0496114_0713976 Ga0496114_0713976_169_657 162
884 3300048917 Ga0496114_0902272 Ga0496114_0902272_36_524 162
885 3300048918 Ga0496115_0000800 Ga0496115_0000800_9867_10355 162
886 3300048918 Ga0496115_0024514 Ga0496115_0024514_2128_2616 162
887 3300048918 Ga0496115_0086214 Ga0496115_0086214_1736_2224 162
888 3300048918 Ga0496115_0744485 Ga0496115_0744485_39_527 162
889 3300048919 Ga0496116_0004324 Ga0496116_0004324_679_1167 162
890 3300048919 Ga0496116_0072522 Ga0496116_0072522_191_679 162
891 3300048919 Ga0496116_0084975 Ga0496116_0084975_351_839 162
892 3300048919 Ga0496116_0267094 Ga0496116_0267094_195_683 162
893 3300048920 Ga0496117_0009472 Ga0496117_0009472_1517_2005 162
894 3300048920 Ga0496117_0060686 Ga0496117_0060686_2027_2515 162
895 3300048920 Ga0496117_0061687 Ga0496117_0061687_1405_1893 162
896 3300048920 Ga0496117_0102981 Ga0496117_0102981_866_1354 162
897 3300048921 Ga0496118_0002385 Ga0496118_0002385_17863_18351 162
898 3300048921 Ga0496118_0022944 Ga0496118_0022944_1180_1668 162
899 3300048921 Ga0496118_0040700 Ga0496118_0040700_2702_3190 162
900 3300048921 Ga0496118_0112935 Ga0496118_0112935_456_944 162
901 3300048921 Ga0496118_0232350 Ga0496118_0232350_342_830 162
902 3300048922 Ga0496119_0071155 Ga0496119_0071155_550_1038 162
903 3300048923 Ga0496120_0014398 Ga0496120_0014398_3829_4317 162
904 3300048923 Ga0496120_0032697 Ga0496120_0032697_775_1263 162
905 3300048923 Ga0496120_0423439 Ga0496120_0423439_10_498 162
906 3300048924 Ga0496121_0000555 Ga0496121_0000555_27621_28109 162
907 3300048924 Ga0496121_0001104 Ga0496121_0001104_16546_17034 162
908 3300048924 Ga0496121_0004417 Ga0496121_0004417_15970_16458 162
909 3300048924 Ga0496121_0006145 Ga0496121_0006145_4161_4649 162
910 3300048924 Ga0496121_0008758 Ga0496121_0008758_8049_8537 162
911 3300048924 Ga0496121_0030175 Ga0496121_0030175_184_672 162
912 3300048924 Ga0496121_0088762 Ga0496121_0088762_1470_1958 162
913 3300048924 Ga0496121_0093652 Ga0496121_0093652_1122_1610 162
914 3300048924 Ga0496121_0101048 Ga0496121_0101048_1725_2213 162
915 3300048924 Ga0496121_0104189 Ga0496121_0104189_1474_1962 162
916 3300048924 Ga0496121_0111552 Ga0496121_0111552_1181_1669 162
917 3300048924 Ga0496121_0121837 Ga0496121_0121837_626_1114 162
918 3300048924 Ga0496121_0135368 Ga0496121_0135368_383_871 162
919 3300048924 Ga0496121_0140641 Ga0496121_0140641_359_847 162
920 3300048924 Ga0496121_0185157 Ga0496121_0185157_203_691 162
921 3300048924 Ga0496121_0293576 Ga0496121_0293576_401_889 162
922 3300048924 Ga0496121_0411354 Ga0496121_0411354_59_547 162
923 3300048924 Ga0496121_0571984 Ga0496121_0571984_70_558 162
924 3300048925 Ga0496122_0093358 Ga0496122_0093358_493_981 162
925 3300048925 Ga0496122_0220033 Ga0496122_0220033_68_556 162
926 3300048927 Ga0496124_0003672 Ga0496124_0003672_16020_16508 162
927 3300048927 Ga0496124_0155574 Ga0496124_0155574_801_1289 162
928 3300048927 Ga0496124_0210764 Ga0496124_0210764_853_1341 162
929 3300048927 Ga0496124_0348767 Ga0496124_0348767_153_641 162
930 3300048927 Ga0496124_0444985 Ga0496124_0444985_357_845 162
931 3300048928 Ga0496125_0008907 Ga0496125_0008907_2763_3251 162
932 3300048928 Ga0496125_0013241 Ga0496125_0013241_1903_2391 162
933 3300048928 Ga0496125_0044576 Ga0496125_0044576_1810_2298 162
934 3300048928 Ga0496125_0397670 Ga0496125_0397670_213_701 162
935 3300048929 Ga0496126_0006275 Ga0496126_0006275_6423_6911 162
936 3300048929 Ga0496126_0009900 Ga0496126_0009900_2122_2610 162
937 3300048929 Ga0496126_0020393 Ga0496126_0020393_216_704 162
938 3300048929 Ga0496126_0023944 Ga0496126_0023944_3294_3782 162
939 3300048929 Ga0496126_0055111 Ga0496126_0055111_340_828 162
940 3300048929 Ga0496126_0063893 Ga0496126_0063893_924_1412 162
941 3300048929 Ga0496126_0107344 Ga0496126_0107344_137_625 162
942 3300048929 Ga0496126_0138204 Ga0496126_0138204_299_787 162
943 3300048929 Ga0496126_0367815 Ga0496126_0367815_164_652 162
944 3300048929 Ga0496126_0392351 Ga0496126_0392351_444_932 162
945 3300049459 Ga0495678_052183 Ga0495678_052183_952_1440 162
946 3300049459 Ga0495678_070390 Ga0495678_070390_538_1026 162
947 3300049460 Ga0495682_0147443 Ga0495682_0147443_147_635 162
948 3300049568 Ga0501031_0000823 Ga0501031_0000823_924_1412 162
949 3300049568 Ga0501031_0088622 Ga0501031_0088622_1445_1933 162
950 3300049568 Ga0501031_0119769 Ga0501031_0119769_834_1322 162
951 3300049568 Ga0501031_0361128 Ga0501031_0361128_97_585 162
952 3300049569 Ga0501032_0000030 Ga0501032_0000030_94270_94758 162
953 3300049569 Ga0501032_0342406 Ga0501032_0342406_436_924 162
954 3300049570 Ga0501033_0000060 Ga0501033_0000060_15754_16242 162
955 3300049570 Ga0501033_0034480 Ga0501033_0034480_2935_3423 162
956 3300049570 Ga0501033_0294131 Ga0501033_0294131_607_1095 162
957 3300049571 Ga0501034_0000117 Ga0501034_0000117_50418_50906 162
958 3300049571 Ga0501034_0141891 Ga0501034_0141891_1845_2333 162
959 3300049571 Ga0501034_0149676 Ga0501034_0149676_1144_1632 162
960 3300049571 Ga0501034_0214822 Ga0501034_0214822_10_498 162
961 3300049571 Ga0501034_0225737 Ga0501034_0225737_44_532 162
962 3300049571 Ga0501034_0229035 Ga0501034_0229035_75_563 162
963 3300049571 Ga0501034_1147853 Ga0501034_1147853_22_516 162
964 3300049572 Ga0501036_0000148 Ga0501036_0000148_23941_24429 162
965 3300049572 Ga0501036_0081074 Ga0501036_0081074_1347_1835 162
966 3300049572 Ga0501036_0082295 Ga0501036_0082295_1371_1859 162
967 3300049572 Ga0501036_0473214 Ga0501036_0473214_104_592 162
968 3300049572 Ga0501036_1090023 Ga0501036_1090023_119_607 162
969 3300049573 Ga0501037_0000090 Ga0501037_0000090_72195_72683 162
970 3300049573 Ga0501037_0024322 Ga0501037_0024322_2238_2726 162
971 3300049573 Ga0501037_0506433 Ga0501037_0506433_143_631 162
972 3300049574 Ga0501038_0000441 Ga0501038_0000441_16920_17408 162
973 3300049574 Ga0501038_0080180 Ga0501038_0080180_987_1475 162
974 3300049574 Ga0501038_0139211 Ga0501038_0139211_206_694 162
975 3300049574 Ga0501038_0635107 Ga0501038_0635107_115_603 162
976 3300049574 Ga0501038_0892041 Ga0501038_0892041_85_573 162
977 3300049575 Ga0501039_0000443 Ga0501039_0000443_23175_23663 162
978 3300049575 Ga0501039_0031373 Ga0501039_0031373_2496_2984 162
979 3300049575 Ga0501039_0168611 Ga0501039_0168611_1158_1646 162
980 3300049575 Ga0501039_0272219 Ga0501039_0272219_616_1104 162
981 3300049576 Ga0501040_0538541 Ga0501040_0538541_245_733 162
982 3300049576 Ga0501040_0753248 Ga0501040_0753248_168_656 162
983 3300049577 Ga0501041_0109087 Ga0501041_0109087_692_1180 162
984 3300049578 Ga0501042_0006690 Ga0501042_0006690_2421_2909 162
985 3300049578 Ga0501042_0011206 Ga0501042_0011206_3233_3721 162
986 3300049578 Ga0501042_0088649 Ga0501042_0088649_1260_1748 162
987 3300049579 Ga0501043_0000919 Ga0501043_0000919_15293_15781 162
988 3300049579 Ga0501043_0024179 Ga0501043_0024179_1239_1727 162
989 3300049579 Ga0501043_0027132 Ga0501043_0027132_2578_3066 162
990 3300049579 Ga0501043_0070998 Ga0501043_0070998_814_1302 162
991 3300049580 Ga0501046_0000214 Ga0501046_0000214_59437_59925 162
992 3300049580 Ga0501046_0412349 Ga0501046_0412349_428_916 162
993 3300049581 Ga0501047_0000571 Ga0501047_0000571_29653_30141 162
994 3300049581 Ga0501047_0008142 Ga0501047_0008142_1270_1758 162
995 3300049581 Ga0501047_0364450 Ga0501047_0364450_186_674 162
996 3300049581 Ga0501047_0407940 Ga0501047_0407940_303_791 162
997 3300049582 Ga0501048_0000563 Ga0501048_0000563_9025_9513 162
998 3300049582 Ga0501048_0089334 Ga0501048_0089334_1627_2115 162
999 3300049582 Ga0501048_0378902 Ga0501048_0378902_189_677 162
1000 3300049582 Ga0501048_0861283 Ga0501048_0861283_67_555 162
1001 3300049583 Ga0501067_0001731 Ga0501067_0001731_953_1441 162
1002 3300049583 Ga0501067_0044658 Ga0501067_0044658_1366_1854 162
1003 3300049583 Ga0501067_0064718 Ga0501067_0064718_1302_1790 162
1004 3300049583 Ga0501067_0068385 Ga0501067_0068385_1075_1563 162
1005 3300049584 Ga0501068_0002870 Ga0501068_0002870_2704_3192 162
1006 3300049584 Ga0501068_0012451 Ga0501068_0012451_1506_1994 162
1007 3300049584 Ga0501068_0477906 Ga0501068_0477906_221_709 162
1008 3300049585 Ga0501069_0013605 Ga0501069_0013605_2650_3138 162
1009 3300049585 Ga0501069_0033968 Ga0501069_0033968_1086_1574 162
1010 3300049585 Ga0501069_0452105 Ga0501069_0452105_198_686 162
1011 3300049586 Ga0501070_0003669 Ga0501070_0003669_9098_9586 162
1012 3300049586 Ga0501070_0011392 Ga0501070_0011392_4799_5287 162
1013 3300049586 Ga0501070_0102800 Ga0501070_0102800_1662_2150 162
1014 3300049586 Ga0501070_0248133 Ga0501070_0248133_319_807 162
1015 3300049586 Ga0501070_0283144 Ga0501070_0283144_46_534 162
1016 3300049586 Ga0501070_0336040 Ga0501070_0336040_536_1024 162
1017 3300049587 Ga0501071_0009025 Ga0501071_0009025_1272_1760 162
1018 3300049587 Ga0501071_0035767 Ga0501071_0035767_2017_2505 162
1019 3300049587 Ga0501071_0167798 Ga0501071_0167798_1049_1537 162
1020 3300049588 Ga0501072_0003654 Ga0501072_0003654_10294_10782 162
1021 3300049588 Ga0501072_0011728 Ga0501072_0011728_5602_6090 162
1022 3300049589 Ga0501073_0000203 Ga0501073_0000203_36350_36838 162
1023 3300049589 Ga0501073_0038233 Ga0501073_0038233_735_1223 162
1024 3300049589 Ga0501073_0128939 Ga0501073_0128939_1052_1540 162
1025 3300049589 Ga0501073_0145316 Ga0501073_0145316_235_723 162
1026 3300049590 Ga0501074_0011327 Ga0501074_0011327_5198_5686 162
1027 3300049590 Ga0501074_0017548 Ga0501074_0017548_3226_3714 162
1028 3300049590 Ga0501074_0070618 Ga0501074_0070618_412_900 162
1029 3300049592 Ga0501076_0029209 Ga0501076_0029209_561_1049 162
1030 3300049592 Ga0501076_0093360 Ga0501076_0093360_709_1197 162
1031 3300049592 Ga0501076_0201144 Ga0501076_0201144_933_1421 162
1032 3300049593 Ga0501077_0036684 Ga0501077_0036684_186_674 162
1033 3300049686 Ga0501257_227293 Ga0501257_227293_12_500 162
1034 3300049741 Ga0501079_0001971 Ga0501079_0001971_5717_6205 162
1035 3300049741 Ga0501079_0071756 Ga0501079_0071756_1473_1961 162
1036 3300049741 Ga0501079_0395243 Ga0501079_0395243_26_514 162
1037 3300049742 Ga0501080_0004629 Ga0501080_0004629_8362_8850 162
1038 3300049742 Ga0501080_0040087 Ga0501080_0040087_2408_2896 162
1039 3300049742 Ga0501080_0093992 Ga0501080_0093992_2238_2726 162
1040 3300049743 Ga0501081_0566327 Ga0501081_0566327_345_833 162
1041 3300049744 Ga0501083_0000539 Ga0501083_0000539_10315_10803 162
1042 3300049744 Ga0501083_0018195 Ga0501083_0018195_431_919 162
1043 3300049744 Ga0501083_0636525 Ga0501083_0636525_130_618 162
1044 3300049822 Ga0501035_0000212 Ga0501035_0000212_43370_43858 162
1045 3300049822 Ga0501035_0086552 Ga0501035_0086552_1622_2110 162
1046 3300049822 Ga0501035_0958770 Ga0501035_0958770_146_634 162
1047 3300049823 Ga0501044_0000304 Ga0501044_0000304_10972_11460 162
1048 3300049823 Ga0501044_0026748 Ga0501044_0026748_979_1467 162
1049 3300049823 Ga0501044_0065215 Ga0501044_0065215_2248_2736 162
1050 3300049823 Ga0501044_0141992 Ga0501044_0141992_267_755 162
1051 3300049823 Ga0501044_0202168 Ga0501044_0202168_604_1092 162
1052 3300049823 Ga0501044_0305203 Ga0501044_0305203_258_746 162
1053 3300049823 Ga0501044_0689710 Ga0501044_0689710_238_726 162
1054 3300049824 Ga0501045_0006869 Ga0501045_0006869_6089_6577 162
1055 3300049824 Ga0501045_0055821 Ga0501045_0055821_1152_1640 162
1056 3300050490 nmdc:mga03n38_12816_c1 nmdc:mga03n38_12816_c1_474_962 162
1057 3300050490 nmdc:mga03n38_237305_c1 nmdc:mga03n38_237305_c1_152_640 162
1058 3300050491 nmdc:mga00v17_36882_c1 nmdc:mga00v17_36882_c1_872_1360 162
1059 3300050492 nmdc:mga0yw44_15471_c1 nmdc:mga0yw44_15471_c1_3229_3717 162
1060 3300050492 nmdc:mga0yw44_158281_c1 nmdc:mga0yw44_158281_c1_800_1288 162
1061 3300050493 nmdc:mga0k408_142534_c1 nmdc:mga0k408_142534_c1_516_1004 162
1062 3300050493 nmdc:mga0k408_255565_c1 nmdc:mga0k408_255565_c1_168_656 162
1063 3300050493 nmdc:mga0k408_282596_c1 nmdc:mga0k408_282596_c1_23_511 162
1064 3300050494 nmdc:mga06z11_113072_c1 nmdc:mga06z11_113072_c1_390_878 162
1065 3300050494 nmdc:mga06z11_122364_c1 nmdc:mga06z11_122364_c1_401_889 162
1066 3300050494 nmdc:mga06z11_37411_c1 nmdc:mga06z11_37411_c1_1866_2354 162
1067 3300050494 nmdc:mga06z11_414367_c1 nmdc:mga06z11_414367_c1_51_539 162
1068 3300050494 nmdc:mga06z11_93972_c1 nmdc:mga06z11_93972_c1_15_503 162
1069 3300050496 nmdc:mga07m45_314263_c1 nmdc:mga07m45_314263_c1_11_499 162
1070 3300050496 nmdc:mga07m45_389335_c1 nmdc:mga07m45_389335_c1_109_597 162
1071 3300050507 nmdc:mga05p37_120308_c1 nmdc:mga05p37_120308_c1_2253_2741 162
1072 3300050508 nmdc:mga09592_229157_c1 nmdc:mga09592_229157_c1_1109_1597 162
1073 3300050509 nmdc:mga0qj67_1023009_c1 nmdc:mga0qj67_1023009_c1_52_540 162
1074 3300050511 nmdc:mga08y16_92319_c1 nmdc:mga08y16_92319_c1_402_890 162
1075 3300050512 nmdc:mga0n895_125054_c1 nmdc:mga0n895_125054_c1_772_1260 162
1076 3300050516 nmdc:mga0sz30_244485_c1 nmdc:mga0sz30_244485_c1_97_585 162
1077 3300053077 Ga0495601_0022366 Ga0495601_0022366_1692_2180 162
1078 3300053077 Ga0495601_0148848 Ga0495601_0148848_985_1473 162
1079 3300053077 Ga0495601_0185190 Ga0495601_0185190_161_649 162
1080 3300053078 Ga0495612_0008523 Ga0495612_0008523_3327_3815 162
1081 3300053078 Ga0495612_0266555 Ga0495612_0266555_191_679 162
1082 3300053080 Ga0500635_0008274 Ga0500635_0008274_1202_1690 162
1083 3300053080 Ga0500635_0037941 Ga0500635_0037941_185_673 162
1084 3300053083 Ga0495655_0147691 Ga0495655_0147691_143_631 162
1085 3300053084 Ga0495595_0152806 Ga0495595_0152806_602_1090 162
1086 3300053085 Ga0495619_0187299 Ga0495619_0187299_483_971 162
1087 3300053085 Ga0495619_0240422 Ga0495619_0240422_69_557 162
1088 3300053085 Ga0495619_0352108 Ga0495619_0352108_177_665 162
1089 3300053085 Ga0495619_0450690 Ga0495619_0450690_327_815 162
1090 3300053088 Ga0500644_0203026 Ga0500644_0203026_31_519 162
1091 3300053089 Ga0500581_120380 Ga0500581_120380_743_1231 162
1092 3300053090 Ga0500646_0180263 Ga0500646_0180263_188_676 162
1093 3300053091 Ga0500647_0071120 Ga0500647_0071120_471_959 162
1094 3300053092 Ga0500583_0072186 Ga0500583_0072186_829_1317 162
1095 3300053093 Ga0500651_0213026 Ga0500651_0213026_317_805 162
1096 3300053094 Ga0500566_0000197 Ga0500566_0000197_10297_10785 162
1097 3300053094 Ga0500566_0007746 Ga0500566_0007746_3641_4129 162
1098 3300053094 Ga0500566_0074079 Ga0500566_0074079_913_1401 162
1099 3300053094 Ga0500566_0130342 Ga0500566_0130342_407_895 162
1100 3300053095 Ga0500640_000151 Ga0500640_000151_1440_1928 162
1101 3300053096 Ga0500641_0037558 Ga0500641_0037558_897_1385 162
1102 3300053099 Ga0500654_136382 Ga0500654_136382_185_673 162
1103 3300053103 Ga0500555_039672 Ga0500555_039672_188_676 162
1104 3300053104 Ga0500556_0000045 Ga0500556_0000045_84328_84816 162
1105 3300053104 Ga0500556_0044468 Ga0500556_0044468_201_689 162
1106 3300053109 Ga0500569_019436 Ga0500569_019436_1221_1709 162
1107 3300053111 Ga0500572_000154 Ga0500572_000154_21548_22036 162
1108 3300053111 Ga0500572_000578 Ga0500572_000578_10437_10925 162
1109 3300053115 Ga0500591_083881 Ga0500591_083881_259_747 162
1110 3300053116 Ga0500592_000586 Ga0500592_000586_1098_1586 162
1111 3300053116 Ga0500592_009040 Ga0500592_009040_378_866 162
1112 3300053117 Ga0500593_096486 Ga0500593_096486_58_546 162
1113 3300053118 Ga0500594_0082810 Ga0500594_0082810_102_590 162
1114 3300053119 Ga0500595_002082 Ga0500595_002082_6702_7190 162
1115 3300053119 Ga0500595_002732 Ga0500595_002732_2377_2865 162
1116 3300053119 Ga0500595_018178 Ga0500595_018178_489_977 162
1117 3300053120 Ga0500597_115245 Ga0500597_115245_107_595 162
1118 3300053121 Ga0500607_045000 Ga0500607_045000_1014_1502 162
1119 3300053122 Ga0500608_007213 Ga0500608_007213_3033_3521 162
1120 3300053122 Ga0500608_011405 Ga0500608_011405_2465_2953 162
1121 3300053123 Ga0500614_001112 Ga0500614_001112_3971_4459 162
1122 3300053125 Ga0500618_012229 Ga0500618_012229_528_1016 162
1123 3300053126 Ga0500621_104479 Ga0500621_104479_62_550 162
1124 3300053126 Ga0500621_246260 Ga0500621_246260_67_555 162
1125 3300053129 Ga0500628_015616 Ga0500628_015616_577_1065 162
1126 3300053130 Ga0500642_0000024 Ga0500642_0000024_88236_88724 162
1127 3300053130 Ga0500642_0266028 Ga0500642_0266028_40_528 162
1128 3300053131 Ga0500652_000356 Ga0500652_000356_13525_14013 162
1129 3300053134 Ga0500658_0144026 Ga0500658_0144026_140_628 162
1130 3300053134 Ga0500658_0426328 Ga0500658_0426328_26_514 162
1131 3300053134 Ga0500658_0447432 Ga0500658_0447432_83_571 162
1132 3300053136 Ga0500559_0000051 Ga0500559_0000051_4479_4967 162
1133 3300053136 Ga0500559_0001682 Ga0500559_0001682_9878_10366 162
1134 3300053136 Ga0500559_0064120 Ga0500559_0064120_594_1082 162
1135 3300053136 Ga0500559_0152765 Ga0500559_0152765_396_884 162
1136 3300053136 Ga0500559_0202067 Ga0500559_0202067_69_557 162
1137 3300053139 Ga0500568_0000456 Ga0500568_0000456_8202_8690 162
1138 3300053142 Ga0500577_0000189 Ga0500577_0000189_8514_9002 162
1139 3300053142 Ga0500577_0057994 Ga0500577_0057994_589_1077 162
1140 3300053145 Ga0500586_007803 Ga0500586_007803_327_815 162
1141 3300053146 Ga0500588_0125490 Ga0500588_0125490_219_707 162
1142 3300053147 Ga0500589_213218 Ga0500589_213218_141_629 162
1143 3300053148 Ga0500590_035413 Ga0500590_035413_2072_2560 162
1144 3300053148 Ga0500590_229305 Ga0500590_229305_86_574 162
1145 3300053150 Ga0500603_000220 Ga0500603_000220_7847_8335 162
1146 3300053150 Ga0500603_016023 Ga0500603_016023_1137_1625 162
1147 3300053150 Ga0500603_030295 Ga0500603_030295_892_1380 162
1148 3300053151 Ga0500604_0066594 Ga0500604_0066594_162_650 162
1149 3300053151 Ga0500604_0183544 Ga0500604_0183544_187_675 162
1150 3300053153 Ga0500616_0000048 Ga0500616_0000048_243237_243725 162
1151 3300053153 Ga0500616_0000054 Ga0500616_0000054_87245_87733 162
1152 3300053154 Ga0500619_003777 Ga0500619_003777_2094_2582 162
1153 3300053154 Ga0500619_162516 Ga0500619_162516_22_510 162
1154 3300053156 Ga0500622_0000714 Ga0500622_0000714_23800_24288 162
1155 3300053158 Ga0500627_0064431 Ga0500627_0064431_820_1308 162
1156 3300053159 Ga0500630_024760 Ga0500630_024760_2375_2863 162
1157 3300053161 Ga0500634_0174604 Ga0500634_0174604_420_908 162
1158 3300053162 Ga0500638_041577 Ga0500638_041577_1540_2028 162
1159 3300053162 Ga0500638_093892 Ga0500638_093892_398_886 162
1160 3300053162 Ga0500638_151176 Ga0500638_151176_532_1020 162
1161 3300053163 Ga0500639_000007 Ga0500639_000007_44832_45320 162
1162 3300053163 Ga0500639_053902 Ga0500639_053902_929_1417 162
1163 3300053177 Ga0500636_0009096 Ga0500636_0009096_3841_4329 162
1164 3300053177 Ga0500636_0023576 Ga0500636_0023576_2990_3478 162
1165 3300053178 Ga0500637_0014529 Ga0500637_0014529_2494_2982 162
1166 3300053178 Ga0500637_0085137 Ga0500637_0085137_960_1448 162
1167 3300053178 Ga0500637_0092471 Ga0500637_0092471_767_1255 162
1168 3300053178 Ga0500637_0114303 Ga0500637_0114303_1032_1520 162
1169 3300053723 Ga0500567_040424 Ga0500567_040424_1108_1596 162
1170 3300053728 Ga0500657_081540 Ga0500657_081540_363_851 162
1171 3300053730 Ga0500645_027646 Ga0500645_027646_1021_1509 162
1172 3300053731 Ga0500609_039019 Ga0500609_039019_70_558 162
1173 3300053732 Ga0500656_010517 Ga0500656_010517_281_769 162
1174 3300053733 Ga0500552_008739 Ga0500552_008739_217_705 162
1175 3300053735 Ga0500596_000345 Ga0500596_000345_54_542 162
1176 3300053735 Ga0500596_005002 Ga0500596_005002_1090_1578 162
1177 3300053737 Ga0500601_002395 Ga0500601_002395_496_984 162
1178 3300054114 Ga0501084_0007519 Ga0501084_0007519_3937_4425 162
1179 3300054114 Ga0501084_0158623 Ga0501084_0158623_35_523 162
1180 3300060353 Ga0501082_0006039 Ga0501082_0006039_8831_9319 162
1181 3300060353 Ga0501082_0018603 Ga0501082_0018603_5466_5954 162
1182 3300061719 Ga0466962_0209875 Ga0466962_0209875_291_779 162
1183 3300061734 Ga0530510_0219546 Ga0530510_0219546_203_691 162
1184 iso_pu_bacteria 2508501122 2509109779 162
1185 iso_pu_bacteria 2509276019 2509379069 162
1186 iso_pu_bacteria 2516143018 2516205173 162
1187 iso_pu_bacteria 2558860100 2558860353 162
1188 iso_pu_bacteria 2599185352 2600194612 162
1189 iso_pu_bacteria 2643221618 2644108547 162
1190 iso_pu_bacteria 2643221626 2644145593 162
1191 iso_pu_bacteria 2643221655 2644312330 162
1192 iso_pu_bacteria 2643221659 2644335959 162
1193 iso_pu_bacteria 2643221698 2644546815 162
1194 iso_pu_bacteria 2643221712 2644618013 162
1195 iso_pu_bacteria 2643221723 2644676808 162
1196 iso_pu_bacteria 2657244999 2657684043 162
1197 iso_pu_bacteria 2690316117 2692314569 162
1198 iso_pu_bacteria 2751185821 2753458675 162
1199 iso_pu_bacteria 2791355082 2792582606 162
1200 iso_pu_bacteria 2791355091 2792622935 162
1201 iso_pu_bacteria 2791355092 2792629189 162
1202 iso_pu_bacteria 2791355094 2792640459 162
1203 iso_pu_bacteria 2802429268 2804753267 162
1204 iso_pu_bacteria 2838074704 2838077374 162
1205 iso_pu_bacteria 2844163670 2844169181 162
1206 iso_pu_bacteria 2847417321 2847420379 162
1207 iso_pu_bacteria 2848992105 2848995185 162
1208 iso_pu_bacteria 2850079185 2850082251 162
1209 iso_pu_bacteria 2855872281 2855878494 162
1210 iso_pu_bacteria 2896384573 2896386387 162
1211 iso_pu_bacteria 2913295892 2913299785 162
1212 iso_pu_bacteria 2920760137 2920760837 162
1213 iso_pu_bacteria 2920822456 2920828551 162
1214 iso_pu_bacteria 2941499720 2941501759 162
1215 iso_pu_bacteria 643692032 643827022 162
1216 iso_pu_bacteria 8049293176 8049295880 162
1217 3300005406 Ga0070703_10011423 Ga0070703_100114232 163
1218 3300005435 Ga0070714_100154234 Ga0070714_1001542342 163
1219 3300005435 Ga0070714_100301584 Ga0070714_1003015842 163
1220 3300005436 Ga0070713_100343902 Ga0070713_1003439022 163
1221 3300005467 Ga0070706_101186902 Ga0070706_1011869021 163
1222 3300005518 Ga0070699_100143795 Ga0070699_1001437953 163
1223 3300005518 Ga0070699_101548770 Ga0070699_1015487701 163
1224 3300005536 Ga0070697_100305752 Ga0070697_1003057522 163
1225 3300005549 Ga0070704_100193939 Ga0070704_1001939391 163
1226 3300005578 Ga0068854_100341037 Ga0068854_1003410372 163
1227 3300005981 Ga0081538_10001674 Ga0081538_100016746 163
1228 3300005983 Ga0081540_1007778 Ga0081540_10077787 163
1229 3300006028 Ga0070717_10378248 Ga0070717_103782482 163
1230 3300006163 Ga0070715_10017492 Ga0070715_100174922 163
1231 3300006173 Ga0070716_101073402 Ga0070716_1010734021 163
1232 3300006175 Ga0070712_100105334 Ga0070712_1001053341 163
1233 3300006846 Ga0075430_100079159 Ga0075430_1000791595 163
1234 3300006847 Ga0075431_100001907 Ga0075431_1000019075 163
1235 3300006852 Ga0075433_10426323 Ga0075433_104263232 163
1236 3300006871 Ga0075434_100281484 Ga0075434_1002814841 163
1237 3300006880 Ga0075429_100005227 Ga0075429_1000052278 163
1238 3300007076 Ga0075435_100084152 Ga0075435_1000841524 163
1239 3300009094 Ga0111539_10000178 Ga0111539_1000017811 163
1240 3300009147 Ga0114129_10001129 Ga0114129_1000112910 163
1241 3300009147 Ga0114129_10147099 Ga0114129_101470994 163
1242 3300010375 Ga0105239_10259389 Ga0105239_102593893 163
1243 3300021388 Ga0213875_10322147 Ga0213875_103221471 163
1244 3300025905 Ga0207685_10063552 Ga0207685_100635522 163
1245 3300025906 Ga0207699_10165041 Ga0207699_101650413 163
1246 3300025910 Ga0207684_10312679 Ga0207684_103126792 163
1247 3300025915 Ga0207693_10065210 Ga0207693_100652102 163
1248 3300025916 Ga0207663_10574300 Ga0207663_105743002 163
1249 3300025929 Ga0207664_10773984 Ga0207664_107739842 163
1250 3300025939 Ga0207665_10151020 Ga0207665_101510202 163
1251 3300027907 Ga0207428_10002929 Ga0207428_100029297 163
1252 3300028577 Ga0265318_10197676 Ga0265318_101976761 163
1253 3300031344 Ga0265316_10785473 Ga0265316_107854731 163
1254 3300032126 Ga0307415_101680905 Ga0307415_1016809051 163
1255 3300035111 Ga0373923_0313601 Ga0373923_0313601_170_667 163
1256 3300035170 Ga0373943_0154842 Ga0373943_0154842_588_1085 163
1257 3300035692 Ga0373935_0009266 Ga0373935_0009266_2547_3044 163
1258 3300035695 Ga0373927_0032748 Ga0373927_0032748_2028_2525 163
1259 3300035725 Ga0373947_0283629 Ga0373947_0283629_272_769 163
1260 3300037068 Ga0373925_0027008 Ga0373925_0027008_436_933 163
1261 3300037853 Ga0436364_0005842 Ga0436364_0005842_32_529 163
1262 3300037853 Ga0436364_1324733 Ga0436364_1324733_805_1302 163
1263 3300039453 Ga0436362_0681126 Ga0436362_0681126_52_546 163
1264 3300041407 Ga0439447_095373 Ga0439447_095373_122_619 163
1265 3300041413 Ga0439465_0007899 Ga0439465_0007899_371_868 163
1266 3300042004 Ga0439445_0074119 Ga0439445_0074119_53_550 163
1267 3300042006 Ga0439432_012787 Ga0439432_012787_831_1328 163
1268 3300042007 Ga0439449_0030566 Ga0439449_0030566_1079_1576 163
1269 3300042993 Ga0439440_0168658 Ga0439440_0168658_63_560 163
1270 3300046517 Ga0495630_0039214 Ga0495630_0039214_223_720 163
1271 3300046642 Ga0495634_0113718 Ga0495634_0113718_1123_1620 163
1272 3300046690 Ga0495624_0104170 Ga0495624_0104170_976_1473 163
1273 3300047315 Ga0495581_0127362 Ga0495581_0127362_272_769 163
1274 3300047319 Ga0495674_0023420 Ga0495674_0023420_4213_4710 163
1275 3300048913 Ga0496110_0075104 Ga0496110_0075104_293_787 163
1276 3300048914 Ga0496111_0071123 Ga0496111_0071123_1641_2135 163
1277 3300049570 Ga0501033_0206092 Ga0501033_0206092_489_983 163
1278 3300049572 Ga0501036_0429129 Ga0501036_0429129_504_998 163
1279 3300049574 Ga0501038_0017412 Ga0501038_0017412_5369_5863 163
1280 3300049579 Ga0501043_0051850 Ga0501043_0051850_1463_1957 163
1281 3300049581 Ga0501047_0054534 Ga0501047_0054534_504_998 163
1282 3300049582 Ga0501048_0605888 Ga0501048_0605888_125_619 163
1283 3300049586 Ga0501070_0003380 Ga0501070_0003380_12937_13431 163
1284 3300049590 Ga0501074_0257765 Ga0501074_0257765_596_1090 163
1285 3300049742 Ga0501080_0121335 Ga0501080_0121335_411_905 163
1286 3300049822 Ga0501035_0043346 Ga0501035_0043346_1582_2076 163
1287 3300049823 Ga0501044_0008608 Ga0501044_0008608_5577_6071 163
1288 3300050507 nmdc:mga05p37_148209_c1 nmdc:mga05p37_148209_c1_1664_2158 163
1289 3300050507 nmdc:mga05p37_743_c1 nmdc:mga05p37_743_c1_27276_27773 163
1290 3300050508 nmdc:mga09592_781_c1 nmdc:mga09592_781_c1_13109_13606 163
1291 3300050509 nmdc:mga0qj67_72223_c1 nmdc:mga0qj67_72223_c1_223_720 163
1292 3300050510 nmdc:mga06r32_19037_c1 nmdc:mga06r32_19037_c1_3198_3695 163
1293 3300050511 nmdc:mga08y16_121_c1 nmdc:mga08y16_121_c1_8245_8742 163
1294 3300050513 nmdc:mga0rr50_560776_c1 nmdc:mga0rr50_560776_c1_34_528 163
1295 3300053117 Ga0500593_003188 Ga0500593_003188_2900_3403 163
1296 3300031239 Ga0265328_10000085 Ga0265328_1000008517 165
1297 3300031241 Ga0265325_10003663 Ga0265325_100036636 165
1298 3300031250 Ga0265331_10000007 Ga0265331_1000000788 165
1299 3300049571 Ga0501034_0180341 Ga0501034_0180341_1385_1903 165
1300 3300049572 Ga0501036_0109857 Ga0501036_0109857_1087_1632 165
1301 3300049583 Ga0501067_0002121 Ga0501067_0002121_6923_7441 165
1302 3300049588 Ga0501072_0180631 Ga0501072_0180631_865_1383 165
1303 3300049589 Ga0501073_0026397 Ga0501073_0026397_2224_2742 165
1304 3300049590 Ga0501074_0289819 Ga0501074_0289819_105_623 165
1305 3300049592 Ga0501076_0040338 Ga0501076_0040338_2075_2593 165
1306 3300049742 Ga0501080_0002834 Ga0501080_0002834_3081_3599 165
1307 3300049744 Ga0501083_0003563 Ga0501083_0003563_1432_1950 165
1308 3300049823 Ga0501044_1069585 Ga0501044_1069585_67_573 165
1309 3300054114 Ga0501084_0005904 Ga0501084_0005904_5495_6013 165
1310 3300054114 Ga0501084_0587127 Ga0501084_0587127_156_674 165
1311 3300060353 Ga0501082_0078180 Ga0501082_0078180_2156_2674 165
1312 3300002739 JGI25158J39367_1001328 JGI25158J39367_10013287 166
1313 3300002987 JGI25159J45721_1000018 JGI25159J45721_100001886 166
1314 3300003354 JGI25160J50197_1000009 JGI25160J50197_1000009122 166
1315 3300003374 JGI25161J50226_1000920 JGI25161J50226_10009202 166
1316 3300003771 Ga0055526_1003070 Ga0055526_100307010 166
1317 3300003781 Ga0055536_1000168 Ga0055536_100016841 166
1318 3300003791 Ga0055530_10009693 Ga0055530_100096932 166
1319 3300003794 Ga0055531_10001176 Ga0055531_1000117615 166
1320 3300004625 Ga0055543_1000379 Ga0055543_100037920 166
1321 3300005262 Ga0065165_1000020 Ga0065165_1000020148 166
1322 3300006847 Ga0075431_100472959 Ga0075431_1004729592 166
1323 3300009094 Ga0111539_10091704 Ga0111539_100917044 166
1324 3300009147 Ga0114129_11436707 Ga0114129_114367072 166
1325 3300013249 Ga0171463_1006 Ga0171463_1006201 166
1326 3300015690 Ga0183363_1018 Ga0183363_101830 166
1327 3300021320 Ga0214544_1001241 Ga0214544_100124125 166
1328 3300021321 Ga0214542_1000115 Ga0214542_100011526 166
1329 3300021321 Ga0214542_1014437 Ga0214542_101443710 166
1330 3300021327 Ga0214543_1000008 Ga0214543_1000008168 166
1331 3300021327 Ga0214543_1000098 Ga0214543_100009826 166
1332 3300025208 Ga0209436_104530 Ga0209436_1045302 166
1333 3300025245 Ga0207425_1011774 Ga0207425_10117744 166
1334 3300025263 Ga0209565_1010490 Ga0209565_10104901 166
1335 3300025284 Ga0209130_1000037 Ga0209130_1000037148 166
1336 3300025292 Ga0209676_1000239 Ga0209676_100023921 166
1337 3300025294 Ga0209025_1000196 Ga0209025_100019629 166
1338 3300025295 Ga0209564_1000086 Ga0209564_1000086122 166
1339 3300025298 Ga0209050_1001390 Ga0209050_100139013 166
1340 3300025302 Ga0207426_1000048 Ga0207426_1000048188 166
1341 3300025303 Ga0209051_1001690 Ga0209051_100169014 166
1342 3300025304 Ga0209257_1001192 Ga0209257_100119215 166
1343 3300028379 Ga0268266_11388549 Ga0268266_113885492 166
1344 3300041404 Ga0439436_0061893 Ga0439436_0061893_31_531 166
1345 3300042007 Ga0439449_0153962 Ga0439449_0153962_229_729 166
1346 3300045051 Ga0451576_0041218 Ga0451576_0041218_883_1386 166
1347 3300048920 Ga0496117_0340054 Ga0496117_0340054_221_730 166
1348 3300049589 Ga0501073_0510186 Ga0501073_0510186_210_731 166
1349 3300050507 nmdc:mga05p37_1257441_c1 nmdc:mga05p37_1257441_c1_137_637 166
1350 3300050510 nmdc:mga06r32_56820_c1 nmdc:mga06r32_56820_c1_2726_3226 166
1351 3300054114 Ga0501084_0232542 Ga0501084_0232542_858_1379 166
1352 3300060353 Ga0501082_0105333 Ga0501082_0105333_487_1008 166
1353 iso_pu_bacteria 2909042592 2909046495 166
1354 3300049587 Ga0501071_0079802 Ga0501071_0079802_986_1522 167
1355 3300049583 Ga0501067_0065370 Ga0501067_0065370_735_1265 169
1356 3300049593 Ga0501077_0018802 Ga0501077_0018802_1160_1690 169
1357 3300054114 Ga0501084_0299553 Ga0501084_0299553_763_1293 169
1358 3300060353 Ga0501082_0089798 Ga0501082_0089798_1773_2303 169
1359 3300009094 Ga0111539_10057625 Ga0111539_100576253 170
1360 3300028577 Ga0265318_10069538 Ga0265318_100695381 170
1361 3300031238 Ga0265332_10072809 Ga0265332_100728091 170
1362 3300031242 Ga0265329_10028176 Ga0265329_100281762 170
1363 3300031247 Ga0265340_10023460 Ga0265340_100234606 170
1364 3300031249 Ga0265339_10002699 Ga0265339_100026991 170
1365 3300031250 Ga0265331_10183401 Ga0265331_101834012 170
1366 3300031250 Ga0265331_10302707 Ga0265331_103027072 170
1367 3300031344 Ga0265316_10029606 Ga0265316_100296065 170
1368 3300031344 Ga0265316_10148855 Ga0265316_101488552 170
1369 3300031595 Ga0265313_10002977 Ga0265313_100029777 170
1370 3300031595 Ga0265313_10004093 Ga0265313_1000409313 170
1371 3300031595 Ga0265313_10029352 Ga0265313_100293524 170
1372 3300031711 Ga0265314_10006996 Ga0265314_100069962 170
1373 3300048924 Ga0496121_0468864 Ga0496121_0468864_237_761 170
1374 3300049571 Ga0501034_0632136 Ga0501034_0632136_394_927 170
1375 3300049573 Ga0501037_0238013 Ga0501037_0238013_115_648 170
1376 3300049581 Ga0501047_0143269 Ga0501047_0143269_63_596 170
1377 3300049584 Ga0501068_0324073 Ga0501068_0324073_141_674 170
1378 3300049586 Ga0501070_0270857 Ga0501070_0270857_719_1252 170
1379 3300049742 Ga0501080_0161611 Ga0501080_0161611_400_933 170
1380 3300049823 Ga0501044_0108222 Ga0501044_0108222_2196_2729 170
1381 3300050512 nmdc:mga0n895_14611_c1 nmdc:mga0n895_14611_c1_2061_2576 170
1382 3300050515 nmdc:mga0a205_172488_c1 nmdc:mga0a205_172488_c1_404_919 170
1383 3300002244 JGI24742J22300_10013161 JGI24742J22300_100131611 183
1384 3300005328 Ga0070676_10128819 Ga0070676_101288191 183
1385 3300005330 Ga0070690_100283953 Ga0070690_1002839532 183
1386 3300005331 Ga0070670_100585954 Ga0070670_1005859541 183
1387 3300005337 Ga0070682_100103296 Ga0070682_1001032963 183
1388 3300005340 Ga0070689_100141012 Ga0070689_1001410121 183
1389 3300005356 Ga0070674_100020438 Ga0070674_1000204387 183
1390 3300005367 Ga0070667_100491344 Ga0070667_1004913442 183
1391 3300005456 Ga0070678_100391638 Ga0070678_1003916382 183
1392 3300005459 Ga0068867_100185987 Ga0068867_1001859871 183
1393 3300005543 Ga0070672_100163221 Ga0070672_1001632212 183
1394 3300005544 Ga0070686_100315103 Ga0070686_1003151032 183
1395 3300005615 Ga0070702_100245080 Ga0070702_1002450801 183
1396 3300005842 Ga0068858_100479481 Ga0068858_1004794812 183
1397 3300017792 Ga0163161_10109321 Ga0163161_101093212 183
1398 3300025907 Ga0207645_10064188 Ga0207645_100641882 183
1399 3300025925 Ga0207650_10315235 Ga0207650_103152352 183
1400 3300025934 Ga0207686_10377361 Ga0207686_103773612 183
1401 3300025935 Ga0207709_10050550 Ga0207709_100505505 183
1402 3300025937 Ga0207669_10018069 Ga0207669_100180692 183
1403 3300025937 Ga0207669_10468097 Ga0207669_104680972 183
1404 3300025938 Ga0207704_10476479 Ga0207704_104764791 183
1405 3300025940 Ga0207691_10144444 Ga0207691_101444442 183
1406 3300025940 Ga0207691_10830352 Ga0207691_108303522 183
1407 3300025941 Ga0207711_10981675 Ga0207711_109816751 183
1408 3300026089 Ga0207648_10100216 Ga0207648_101002162 183
1409 3300026121 Ga0207683_10455525 Ga0207683_104555252 183
1410 3300027907 Ga0207428_10160227 Ga0207428_101602272 183
1411 3300028380 Ga0268265_10141140 Ga0268265_101411404 183
1412 3300028380 Ga0268265_10312183 Ga0268265_103121832 183
1413 3300037418 Ga0395900_0317077 Ga0395900_0317077_219_848 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

32

181

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5clh-assembly1.cif.gz_A structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, at ph 8 0.9925 23 180
4zc8-assembly1.cif.gz_A structure of acetobacter aceti pure-s57t 0.991 23 178
2fw9-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9895 23 180
2fw8-assembly1.cif.gz_A structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89g from the acidophilic bacterium acetobacter aceti, at ph 8 0.986 23 178
5bor-assembly1.cif.gz_A structure of acetobacter aceti pure-s57c, sulfonate form 0.9856 23 180
ID Description Score Start End Superfamily
af_Q2FZJ5_1_139_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.985 46 172 3.40.50.1970
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9717 30 172 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9712 23 182 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9594 23 182 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9552 26 172 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A357KZ10-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase 0.9945 30 163 GO:0006189
GO:0016853
AF-A0A6P1UC75-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9938 30 174 GO:0006189
GO:0016829
GO:0034023
AF-A0A099DE03-F1-model_v4 deleted 0.9935 30 172
AF-A0A517NX97-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9932 24 172 GO:0006189
GO:0034023
AF-A0A258C9D1-F1-model_v4 deleted 0.993 23 141

Feature Viewer

pLDDT pTM Quality
87.82 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map