F493765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1413 | 622 | 1335 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100585954|Ga0070670_1005859541 |
| Length | 190 |
| Sequence | MAWPDLGQTSGRPYNPAYVFGFPKRIDLMTAPVAIIMGSQSDWETMRHAADTLAALGIPCEKRIVSAHRTPDRLFAFARGAKAAGFKIIVAGAGGAAHLPGMVASLTELPVFGVPIESKALSGVDSLYSIVQMPAGVPVGTLAIGKPGAINAALLAASVLALNDPALSAGLAAWRKAQTEAIAERPEGSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 8 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 9 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 10 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 11 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 12 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 13 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 14 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 15 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 16 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 17 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 18 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 19 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 20 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 21 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 22 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 23 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 24 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 25 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 26 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 27 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 28 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 29 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 30 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 31 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 32 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 33 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 34 | 2791355199 | |||
| 35 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 36 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 37 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 38 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 39 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 40 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 41 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 42 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 43 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 44 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 45 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 46 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 47 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 48 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 49 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 50 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 51 | 2906610324 | |||
| 52 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 53 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 54 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 55 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 56 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 57 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 58 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 59 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 60 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 61 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 62 | 2922425934 | |||
| 63 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 64 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 65 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 66 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 67 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 68 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 69 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 70 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 71 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 72 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 73 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 75 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 76 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 85 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 89 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 94 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 119 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 122 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 123 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 125 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 128 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 133 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 135 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 136 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 137 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 139 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 140 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 141 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 142 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 143 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 144 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 145 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 146 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 147 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 148 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 149 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 150 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 151 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 153 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 154 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 155 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 156 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 157 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 158 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 160 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 161 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 162 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 163 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 165 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 166 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 167 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 168 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 169 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 170 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 171 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 172 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 173 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 175 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 176 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 177 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 178 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 179 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 193 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 198 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 208 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 210 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 211 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 212 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 213 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 214 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 215 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 216 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 217 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 218 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 224 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 295 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 296 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 297 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 298 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 302 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 303 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 304 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 305 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 306 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 307 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 308 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 309 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 310 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 311 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 312 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 313 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 314 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 315 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 316 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 317 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 318 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 319 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 320 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 321 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 322 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 323 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 324 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 325 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 326 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 327 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 328 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 329 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 330 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 331 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 332 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 333 | 3300033548 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 | Metagenome | Unclassified |
| 334 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 335 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 336 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 337 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 338 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 339 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 340 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 341 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 342 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 343 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 344 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 345 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 346 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 347 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 348 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 349 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 350 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 351 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 352 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 353 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 354 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 355 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 356 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 357 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 358 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 359 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 360 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 361 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 362 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 363 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 364 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 365 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 366 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 367 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 368 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 369 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 370 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 371 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 373 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 374 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 375 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 376 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 377 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 378 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 379 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 380 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 381 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 382 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 383 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 384 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 385 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 386 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 387 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 388 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 389 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 390 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 472 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 474 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 475 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 476 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 477 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 478 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 479 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 480 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 481 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 482 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 483 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 484 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 485 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 486 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 487 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 488 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 489 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 490 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 491 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 492 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 493 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 494 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 495 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 496 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 497 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 525 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 527 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 528 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 533 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 534 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 535 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 536 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 537 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 538 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 547 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 550 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 554 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 555 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 556 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 557 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 558 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 559 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 560 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 561 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 562 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 563 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 564 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 565 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 566 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 567 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 568 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 569 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 570 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 571 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 572 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 573 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 574 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 575 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 576 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 577 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 578 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 579 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 580 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 581 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 582 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 583 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 584 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 585 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 586 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 587 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 588 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 589 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 590 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 591 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 592 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 593 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 594 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 595 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 596 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 597 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 598 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 599 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 600 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 601 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 602 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 603 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 604 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 605 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 606 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 607 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 608 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 609 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 610 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 611 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 612 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 613 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 614 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 615 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 616 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 617 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 618 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 619 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 620 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 621 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 622 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.47 |
| Metatranscriptomes | 0.21 |
| Isolates | 5.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.61 |
| Nodule | 3.75 |
| Rhizoplane | 4.81 |
| Rhizosphere | 70.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10013161 | 3300002244 | Bacteria | 1384 |
| 2 | JGI25158J39367_1001328 | 3300002739 | Bacteria | 4382 |
| 3 | JGI25159J45721_1000018 | 3300002987 | Bacteria | 132603 |
| 4 | JGI25406J46586_10004829 | 3300003203 | Bacteria | 6266 |
| 5 | JGI25406J46586_10119250 | 3300003203 | Bacteria | 777 |
| 6 | JGI25160J50197_1000009 | 3300003354 | Bacteria | 282862 |
| 7 | JGI25161J50226_1000920 | 3300003374 | Bacteria | 10556 |
| 8 | JGI25404J52841_10006426 | 3300003659 | Bacteria | 2459 |
| 9 | JGI25404J52841_10025723 | 3300003659 | Bacteria | 1267 |
| 10 | JGI25404J52841_10055406 | 3300003659 | Bacteria | 832 |
| 11 | Ga0055539_1007498 | 3300003752 | Bacteria | 1379 |
| 12 | Ga0055526_1003070 | 3300003771 | Bacteria | 10856 |
| 13 | Ga0055536_1000168 | 3300003781 | Bacteria | 54941 |
| 14 | Ga0055530_10009693 | 3300003791 | Bacteria | 3664 |
| 15 | Ga0055531_10001176 | 3300003794 | Bacteria | 20140 |
| 16 | JGI25405J52794_10022829 | 3300003911 | Bacteria | 1271 |
| 17 | Ga0055543_1000379 | 3300004625 | Bacteria | 29065 |
| 18 | Ga0065165_1000020 | 3300005262 | Bacteria | 265570 |
| 19 | Ga0070658_10282915 | 3300005327 | Bacteria | 1412 |
| 20 | Ga0070676_10128819 | 3300005328 | Bacteria | 1598 |
| 21 | Ga0070676_11332112 | 3300005328 | Bacteria | 549 |
| 22 | Ga0070683_100005509 | 3300005329 | Bacteria | 10574 |
| 23 | Ga0070683_100116045 | 3300005329 | Bacteria | 2528 |
| 24 | Ga0070690_100283953 | 3300005330 | Bacteria | 1182 |
| 25 | Ga0070690_100369537 | 3300005330 | Bacteria | 1046 |
| 26 | Ga0070670_100585954 | 3300005331 | Bacteria | 997 |
| 27 | Ga0070666_10551198 | 3300005335 | Bacteria | 839 |
| 28 | Ga0070680_100032227 | 3300005336 | Bacteria | 4217 |
| 29 | Ga0070680_100047062 | 3300005336 | Bacteria | 3511 |
| 30 | Ga0070680_100059733 | 3300005336 | Bacteria | 3120 |
| 31 | Ga0070680_100081160 | 3300005336 | Bacteria | 2676 |
| 32 | Ga0070682_100062949 | 3300005337 | Bacteria | 2351 |
| 33 | Ga0070682_100103296 | 3300005337 | Bacteria | 1885 |
| 34 | Ga0070682_100467807 | 3300005337 | Bacteria | 969 |
| 35 | Ga0068868_100062713 | 3300005338 | Bacteria | 2947 |
| 36 | Ga0070660_100105470 | 3300005339 | Bacteria | 2237 |
| 37 | Ga0070660_100129823 | 3300005339 | Bacteria | 2016 |
| 38 | Ga0070660_100255057 | 3300005339 | Bacteria | 1431 |
| 39 | Ga0070689_100141012 | 3300005340 | Bacteria | 1938 |
| 40 | Ga0070691_10092184 | 3300005341 | Bacteria | 1495 |
| 41 | Ga0070661_100059699 | 3300005344 | Bacteria | 2798 |
| 42 | Ga0070661_100429771 | 3300005344 | Bacteria | 1048 |
| 43 | Ga0070692_10460786 | 3300005345 | Bacteria | 816 |
| 44 | Ga0070668_100000021 | 3300005347 | Bacteria | 96397 |
| 45 | Ga0070668_100907068 | 3300005347 | Bacteria | 788 |
| 46 | Ga0070675_101088589 | 3300005354 | Bacteria | 735 |
| 47 | Ga0070671_100000114 | 3300005355 | Bacteria | 51983 |
| 48 | Ga0070671_100007073 | 3300005355 | Bacteria | 8988 |
| 49 | Ga0070671_100067271 | 3300005355 | Bacteria | 2987 |
| 50 | Ga0070671_100150697 | 3300005355 | Bacteria | 1964 |
| 51 | Ga0070674_100020438 | 3300005356 | Bacteria | 4231 |
| 52 | Ga0070674_100582631 | 3300005356 | Bacteria | 943 |
| 53 | Ga0070673_100517667 | 3300005364 | Bacteria | 1081 |
| 54 | Ga0070659_100069240 | 3300005366 | Bacteria | 2800 |
| 55 | Ga0070659_100179910 | 3300005366 | Bacteria | 1735 |
| 56 | Ga0070659_100401918 | 3300005366 | Bacteria | 1156 |
| 57 | Ga0070667_100254144 | 3300005367 | Bacteria | 1572 |
| 58 | Ga0070667_100491344 | 3300005367 | Bacteria | 1124 |
| 59 | Ga0070667_100861179 | 3300005367 | Bacteria | 843 |
| 60 | Ga0070703_10011423 | 3300005406 | Bacteria | 2508 |
| 61 | Ga0070709_10002522 | 3300005434 | Bacteria | 9912 |
| 62 | Ga0070709_10073314 | 3300005434 | Bacteria | 2216 |
| 63 | Ga0070709_10782322 | 3300005434 | Bacteria | 748 |
| 64 | Ga0070709_11052826 | 3300005434 | Bacteria | 649 |
| 65 | Ga0070714_100022715 | 3300005435 | Bacteria | 5146 |
| 66 | Ga0070714_100048487 | 3300005435 | Bacteria | 3613 |
| 67 | Ga0070714_100154234 | 3300005435 | Bacteria | 2072 |
| 68 | Ga0070714_100301584 | 3300005435 | Bacteria | 1494 |
| 69 | Ga0070714_100511644 | 3300005435 | Bacteria | 1146 |
| 70 | Ga0070713_100010481 | 3300005436 | Bacteria | 6695 |
| 71 | Ga0070713_100024458 | 3300005436 | Bacteria | 4705 |
| 72 | Ga0070713_100186788 | 3300005436 | Bacteria | 1865 |
| 73 | Ga0070713_100343902 | 3300005436 | Bacteria | 1383 |
| 74 | Ga0070710_10002131 | 3300005437 | Bacteria | 9381 |
| 75 | Ga0070710_10010042 | 3300005437 | Bacteria | 4641 |
| 76 | Ga0070710_10033210 | 3300005437 | Bacteria | 2800 |
| 77 | Ga0070711_100002112 | 3300005439 | Bacteria | 11240 |
| 78 | Ga0070711_100010614 | 3300005439 | Bacteria | 5706 |
| 79 | Ga0070711_100094377 | 3300005439 | Bacteria | 2162 |
| 80 | Ga0070694_100296546 | 3300005444 | Bacteria | 1237 |
| 81 | Ga0070708_100507479 | 3300005445 | Bacteria | 1138 |
| 82 | Ga0070663_100014258 | 3300005455 | Bacteria | 5096 |
| 83 | Ga0070663_100071097 | 3300005455 | Bacteria | 2531 |
| 84 | Ga0070663_100403798 | 3300005455 | Bacteria | 1117 |
| 85 | Ga0070678_100057001 | 3300005456 | Bacteria | 2860 |
| 86 | Ga0070678_100114280 | 3300005456 | Bacteria | 2117 |
| 87 | Ga0070678_100276809 | 3300005456 | Bacteria | 1417 |
| 88 | Ga0070678_100391638 | 3300005456 | Bacteria | 1205 |
| 89 | Ga0070662_100543948 | 3300005457 | Bacteria | 972 |
| 90 | Ga0070681_10026470 | 3300005458 | Bacteria | 5828 |
| 91 | Ga0070681_10218167 | 3300005458 | Bacteria | 1823 |
| 92 | Ga0070681_10303321 | 3300005458 | Bacteria | 1506 |
| 93 | Ga0068867_100185987 | 3300005459 | Bacteria | 1654 |
| 94 | Ga0068867_100441120 | 3300005459 | Bacteria | 1107 |
| 95 | Ga0070706_100290542 | 3300005467 | Bacteria | 1525 |
| 96 | Ga0070706_101186902 | 3300005467 | Bacteria | 701 |
| 97 | Ga0070699_100143795 | 3300005518 | Bacteria | 2107 |
| 98 | Ga0070699_101548770 | 3300005518 | Bacteria | 607 |
| 99 | Ga0070679_100052906 | 3300005530 | Bacteria | 4042 |
| 100 | Ga0070679_100084151 | 3300005530 | Bacteria | 3169 |
| 101 | Ga0070679_100149996 | 3300005530 | Bacteria | 2308 |
| 102 | Ga0070679_100267529 | 3300005530 | Bacteria | 1664 |
| 103 | Ga0070679_100610053 | 3300005530 | Bacteria | 1034 |
| 104 | Ga0070679_101357562 | 3300005530 | Bacteria | 657 |
| 105 | Ga0070684_100036017 | 3300005535 | Bacteria | 4239 |
| 106 | Ga0070697_100305752 | 3300005536 | Bacteria | 1367 |
| 107 | Ga0068853_100068543 | 3300005539 | Bacteria | 3084 |
| 108 | Ga0068853_100185607 | 3300005539 | Bacteria | 1888 |
| 109 | Ga0068853_100900210 | 3300005539 | Bacteria | 850 |
| 110 | Ga0070672_100163221 | 3300005543 | Bacteria | 1850 |
| 111 | Ga0070686_100315103 | 3300005544 | Bacteria | 1164 |
| 112 | Ga0070686_100404931 | 3300005544 | Bacteria | 1038 |
| 113 | Ga0070695_100879197 | 3300005545 | Bacteria | 722 |
| 114 | Ga0070696_100938113 | 3300005546 | Bacteria | 720 |
| 115 | Ga0070693_100108922 | 3300005547 | Bacteria | 1700 |
| 116 | Ga0070693_100880423 | 3300005547 | Bacteria | 670 |
| 117 | Ga0070665_100007112 | 3300005548 | Bacteria | 11373 |
| 118 | Ga0070665_100036710 | 3300005548 | Bacteria | 4928 |
| 119 | Ga0070665_100058806 | 3300005548 | Bacteria | 3853 |
| 120 | Ga0070665_100185823 | 3300005548 | Bacteria | 2079 |
| 121 | Ga0070665_100404859 | 3300005548 | Bacteria | 1372 |
| 122 | Ga0070665_100477047 | 3300005548 | Bacteria | 1258 |
| 123 | Ga0070665_101409716 | 3300005548 | Bacteria | 706 |
| 124 | Ga0070704_100193939 | 3300005549 | Bacteria | 1635 |
| 125 | Ga0068855_100015668 | 3300005563 | Bacteria | 9121 |
| 126 | Ga0068855_100025571 | 3300005563 | Bacteria | 7061 |
| 127 | Ga0068855_100188782 | 3300005563 | Bacteria | 2326 |
| 128 | Ga0068855_100284931 | 3300005563 | Bacteria | 1833 |
| 129 | Ga0068855_100338809 | 3300005563 | Bacteria | 1659 |
| 130 | Ga0068855_101879947 | 3300005563 | Bacteria | 607 |
| 131 | Ga0070664_100071249 | 3300005564 | Bacteria | 2978 |
| 132 | Ga0068857_100062152 | 3300005577 | Bacteria | 3320 |
| 133 | Ga0068857_100415707 | 3300005577 | Bacteria | 1253 |
| 134 | Ga0068854_100118632 | 3300005578 | Bacteria | 2005 |
| 135 | Ga0068854_100341037 | 3300005578 | Bacteria | 1224 |
| 136 | Ga0068856_100000055 | 3300005614 | Bacteria | 104152 |
| 137 | Ga0068856_100109014 | 3300005614 | Bacteria | 2765 |
| 138 | Ga0068856_100132569 | 3300005614 | Bacteria | 2497 |
| 139 | Ga0068856_100347992 | 3300005614 | Bacteria | 1501 |
| 140 | Ga0070702_100245080 | 3300005615 | Bacteria | 1211 |
| 141 | Ga0068852_100012401 | 3300005616 | Bacteria | 6470 |
| 142 | Ga0068852_100085424 | 3300005616 | Bacteria | 2811 |
| 143 | Ga0068852_100254822 | 3300005616 | Bacteria | 1683 |
| 144 | Ga0068852_100394068 | 3300005616 | Bacteria | 1361 |
| 145 | Ga0068852_100532961 | 3300005616 | Bacteria | 1173 |
| 146 | Ga0068859_100016862 | 3300005617 | Bacteria | 7332 |
| 147 | Ga0068859_101926464 | 3300005617 | Bacteria | 653 |
| 148 | Ga0068864_100130417 | 3300005618 | Bacteria | 2257 |
| 149 | Ga0068864_100625516 | 3300005618 | Bacteria | 1046 |
| 150 | Ga0068866_10072331 | 3300005718 | Bacteria | 1826 |
| 151 | Ga0068861_100058125 | 3300005719 | Bacteria | 2956 |
| 152 | Ga0068861_100262215 | 3300005719 | Bacteria | 1480 |
| 153 | Ga0068861_100391056 | 3300005719 | Bacteria | 1231 |
| 154 | Ga0068863_100000043 | 3300005841 | Bacteria | 153935 |
| 155 | Ga0068863_100112354 | 3300005841 | Bacteria | 2594 |
| 156 | Ga0068863_101019888 | 3300005841 | Bacteria | 830 |
| 157 | Ga0068858_100227226 | 3300005842 | Bacteria | 1769 |
| 158 | Ga0068858_100479481 | 3300005842 | Bacteria | 1200 |
| 159 | Ga0068858_100586125 | 3300005842 | Bacteria | 1081 |
| 160 | Ga0068860_100112956 | 3300005843 | Bacteria | 2597 |
| 161 | Ga0068860_100537885 | 3300005843 | Bacteria | 1169 |
| 162 | Ga0068862_100183373 | 3300005844 | Bacteria | 1880 |
| 163 | Ga0081455_10005648 | 3300005937 | Bacteria | 13662 |
| 164 | Ga0081455_10032267 | 3300005937 | Bacteria | 4722 |
| 165 | Ga0081455_10068600 | 3300005937 | Bacteria | 2951 |
| 166 | Ga0081455_10487484 | 3300005937 | Bacteria | 832 |
| 167 | Ga0081538_10001674 | 3300005981 | Bacteria | 22604 |
| 168 | Ga0081538_10022689 | 3300005981 | Bacteria | 4540 |
| 169 | Ga0081540_1001390 | 3300005983 | Bacteria | 20964 |
| 170 | Ga0081540_1002001 | 3300005983 | Bacteria | 17007 |
| 171 | Ga0081540_1007778 | 3300005983 | Bacteria | 7585 |
| 172 | Ga0081540_1008054 | 3300005983 | Bacteria | 7413 |
| 173 | Ga0081540_1009977 | 3300005983 | Bacteria | 6473 |
| 174 | Ga0081540_1025849 | 3300005983 | Bacteria | 3367 |
| 175 | Ga0081540_1061349 | 3300005983 | Bacteria | 1793 |
| 176 | Ga0081540_1069601 | 3300005983 | Bacteria | 1634 |
| 177 | Ga0081539_10001188 | 3300005985 | Bacteria | 46982 |
| 178 | Ga0081539_10040716 | 3300005985 | Bacteria | 2725 |
| 179 | Ga0070717_10233283 | 3300006028 | Bacteria | 1621 |
| 180 | Ga0070717_10378248 | 3300006028 | Bacteria | 1269 |
| 181 | Ga0075365_10036277 | 3300006038 | Bacteria | 3194 |
| 182 | Ga0075365_10044545 | 3300006038 | Bacteria | 2908 |
| 183 | Ga0075365_10154050 | 3300006038 | Bacteria | 1599 |
| 184 | Ga0075365_10193886 | 3300006038 | Bacteria | 1422 |
| 185 | Ga0075365_10406838 | 3300006038 | Bacteria | 960 |
| 186 | Ga0075368_10031198 | 3300006042 | Bacteria | 2065 |
| 187 | Ga0075363_100024437 | 3300006048 | Bacteria | 3071 |
| 188 | Ga0075363_100042516 | 3300006048 | Bacteria | 2402 |
| 189 | Ga0075363_100287711 | 3300006048 | Bacteria | 952 |
| 190 | Ga0075363_100696742 | 3300006048 | Bacteria | 613 |
| 191 | Ga0075364_10028092 | 3300006051 | Bacteria | 3599 |
| 192 | Ga0075364_10109512 | 3300006051 | Bacteria | 1842 |
| 193 | Ga0070715_10017492 | 3300006163 | Bacteria | 2714 |
| 194 | Ga0070715_10047287 | 3300006163 | Bacteria | 1833 |
| 195 | Ga0070716_100039631 | 3300006173 | Bacteria | 2616 |
| 196 | Ga0070716_100094063 | 3300006173 | Bacteria | 1821 |
| 197 | Ga0070716_100773824 | 3300006173 | Bacteria | 741 |
| 198 | Ga0070716_101073402 | 3300006173 | Bacteria | 641 |
| 199 | Ga0070712_100019951 | 3300006175 | Bacteria | 4383 |
| 200 | Ga0070712_100022644 | 3300006175 | Bacteria | 4140 |
| 201 | Ga0070712_100024690 | 3300006175 | Bacteria | 3986 |
| 202 | Ga0070712_100054123 | 3300006175 | Bacteria | 2804 |
| 203 | Ga0070712_100105334 | 3300006175 | Bacteria | 2094 |
| 204 | Ga0070712_100232178 | 3300006175 | Bacteria | 1466 |
| 205 | Ga0070712_100365845 | 3300006175 | Bacteria | 1184 |
| 206 | Ga0075362_10165498 | 3300006177 | Bacteria | 1066 |
| 207 | Ga0075367_10015243 | 3300006178 | Bacteria | 4172 |
| 208 | Ga0075367_10025742 | 3300006178 | Bacteria | 3330 |
| 209 | Ga0075367_10138147 | 3300006178 | Bacteria | 1508 |
| 210 | Ga0075367_10313901 | 3300006178 | Bacteria | 987 |
| 211 | Ga0075367_10380622 | 3300006178 | Bacteria | 892 |
| 212 | Ga0075369_10067109 | 3300006186 | Bacteria | 1574 |
| 213 | Ga0075369_10091981 | 3300006186 | Bacteria | 1354 |
| 214 | Ga0075369_10183723 | 3300006186 | Bacteria | 962 |
| 215 | Ga0075366_10296025 | 3300006195 | Bacteria | 990 |
| 216 | Ga0097621_100071832 | 3300006237 | Bacteria | 2861 |
| 217 | Ga0097621_101801221 | 3300006237 | Bacteria | 584 |
| 218 | Ga0075370_10107531 | 3300006353 | Bacteria | 1618 |
| 219 | Ga0075370_10348669 | 3300006353 | Bacteria | 884 |
| 220 | Ga0068871_100263261 | 3300006358 | Bacteria | 1504 |
| 221 | Ga0068871_100654333 | 3300006358 | Bacteria | 959 |
| 222 | Ga0068871_100974776 | 3300006358 | Bacteria | 789 |
| 223 | Ga0075428_100062853 | 3300006844 | Bacteria | 4064 |
| 224 | Ga0075430_100079159 | 3300006846 | Bacteria | 2755 |
| 225 | Ga0075431_100001907 | 3300006847 | Bacteria | 19804 |
| 226 | Ga0075431_100472959 | 3300006847 | Bacteria | 1247 |
| 227 | Ga0075433_10426323 | 3300006852 | Bacteria | 1170 |
| 228 | Ga0075434_100042655 | 3300006871 | Bacteria | 4498 |
| 229 | Ga0075434_100281484 | 3300006871 | Bacteria | 1683 |
| 230 | Ga0075429_100005227 | 3300006880 | Bacteria | 11166 |
| 231 | Ga0068865_100196452 | 3300006881 | Bacteria | 1563 |
| 232 | Ga0068865_100297496 | 3300006881 | Bacteria | 1290 |
| 233 | Ga0097620_100016862 | 3300006931 | Bacteria | 7332 |
| 234 | Ga0097620_100284108 | 3300006931 | Bacteria | 1747 |
| 235 | Ga0097620_101926151 | 3300006931 | Bacteria | 653 |
| 236 | Ga0099824_1007275 | 3300006942 | Bacteria | 14758 |
| 237 | Ga0099822_1013306 | 3300006943 | Bacteria | 9674 |
| 238 | Ga0099823_1076226 | 3300006944 | Bacteria | 1383 |
| 239 | Ga0075435_100084152 | 3300007076 | Bacteria | 2617 |
| 240 | Ga0075435_100105362 | 3300007076 | Bacteria | 2341 |
| 241 | Ga0075435_101115497 | 3300007076 | Bacteria | 690 |
| 242 | Ga0099795_10089844 | 3300007788 | Bacteria | 1189 |
| 243 | Ga0105251_10530976 | 3300009011 | Bacteria | 552 |
| 244 | Ga0105240_10057119 | 3300009093 | Bacteria | 4879 |
| 245 | Ga0111539_10000178 | 3300009094 | Bacteria | 73928 |
| 246 | Ga0111539_10057625 | 3300009094 | Bacteria | 4612 |
| 247 | Ga0111539_10069960 | 3300009094 | Bacteria | 4143 |
| 248 | Ga0111539_10091704 | 3300009094 | Bacteria | 3570 |
| 249 | Ga0105245_10782135 | 3300009098 | Bacteria | 992 |
| 250 | Ga0105247_10047041 | 3300009101 | Bacteria | 2649 |
| 251 | Ga0105247_10074777 | 3300009101 | Bacteria | 2125 |
| 252 | Ga0105247_10127179 | 3300009101 | Bacteria | 1657 |
| 253 | Ga0105247_10212662 | 3300009101 | Bacteria | 1305 |
| 254 | Ga0114129_10001129 | 3300009147 | Bacteria | 35251 |
| 255 | Ga0114129_10147099 | 3300009147 | Bacteria | 3227 |
| 256 | Ga0114129_10263752 | 3300009147 | Bacteria | 2307 |
| 257 | Ga0114129_11200066 | 3300009147 | Bacteria | 945 |
| 258 | Ga0114129_11436707 | 3300009147 | Bacteria | 850 |
| 259 | Ga0105243_10613798 | 3300009148 | Bacteria | 1049 |
| 260 | Ga0105241_10194732 | 3300009174 | Bacteria | 1689 |
| 261 | Ga0105241_10313467 | 3300009174 | Bacteria | 1350 |
| 262 | Ga0105241_10660773 | 3300009174 | Bacteria | 950 |
| 263 | Ga0105242_11469260 | 3300009176 | Bacteria | 711 |
| 264 | Ga0105248_10048948 | 3300009177 | Bacteria | 4741 |
| 265 | Ga0105248_10062199 | 3300009177 | Bacteria | 4192 |
| 266 | Ga0105248_10461520 | 3300009177 | Bacteria | 1432 |
| 267 | Ga0105237_10033693 | 3300009545 | Bacteria | 5188 |
| 268 | Ga0105237_10157860 | 3300009545 | Bacteria | 2266 |
| 269 | Ga0105237_10450674 | 3300009545 | Bacteria | 1293 |
| 270 | Ga0105238_11454779 | 3300009551 | Bacteria | 713 |
| 271 | Ga0105249_10003685 | 3300009553 | Bacteria | 13206 |
| 272 | Ga0099796_10290222 | 3300010159 | Bacteria | 690 |
| 273 | Ga0105239_10064277 | 3300010375 | Bacteria | 4029 |
| 274 | Ga0105239_10115634 | 3300010375 | Bacteria | 2976 |
| 275 | Ga0105239_10259389 | 3300010375 | Bacteria | 1953 |
| 276 | Ga0105239_10408015 | 3300010375 | Bacteria | 1538 |
| 277 | Ga0105239_11261989 | 3300010375 | Bacteria | 852 |
| 278 | Ga0105239_11972325 | 3300010375 | Bacteria | 677 |
| 279 | Ga0105246_10132355 | 3300011119 | Bacteria | 1864 |
| 280 | Ga0105246_10257260 | 3300011119 | Bacteria | 1389 |
| 281 | Ga0157370_10012374 | 3300013104 | Bacteria | 8851 |
| 282 | Ga0157370_10018311 | 3300013104 | Bacteria | 7046 |
| 283 | Ga0157370_10056509 | 3300013104 | Bacteria | 3735 |
| 284 | Ga0157370_10222336 | 3300013104 | Bacteria | 1749 |
| 285 | Ga0157369_10010958 | 3300013105 | Bacteria | 10320 |
| 286 | Ga0157369_10223186 | 3300013105 | Bacteria | 1972 |
| 287 | Ga0157369_10305195 | 3300013105 | Bacteria | 1655 |
| 288 | Ga0157369_10601811 | 3300013105 | Bacteria | 1135 |
| 289 | Ga0171463_1006 | 3300013249 | Bacteria | 336402 |
| 290 | Ga0157374_10018619 | 3300013296 | Bacteria | 6132 |
| 291 | Ga0157378_10048781 | 3300013297 | Bacteria | 3766 |
| 292 | Ga0157378_10643001 | 3300013297 | Bacteria | 1076 |
| 293 | Ga0157378_11616201 | 3300013297 | Bacteria | 694 |
| 294 | Ga0163162_10889368 | 3300013306 | Bacteria | 1004 |
| 295 | Ga0163162_12605797 | 3300013306 | Bacteria | 582 |
| 296 | Ga0157372_10041439 | 3300013307 | Bacteria | 5092 |
| 297 | Ga0157372_10294661 | 3300013307 | Bacteria | 1887 |
| 298 | Ga0157372_11020285 | 3300013307 | Bacteria | 958 |
| 299 | Ga0157372_12357385 | 3300013307 | Bacteria | 611 |
| 300 | Ga0157375_10026458 | 3300013308 | Bacteria | 5407 |
| 301 | Ga0157375_10156886 | 3300013308 | Bacteria | 2415 |
| 302 | Ga0157375_10479866 | 3300013308 | Bacteria | 1408 |
| 303 | Ga0157375_12404742 | 3300013308 | Bacteria | 629 |
| 304 | Ga0163163_10493659 | 3300014325 | Bacteria | 1286 |
| 305 | Ga0163163_10757124 | 3300014325 | Bacteria | 1035 |
| 306 | Ga0163163_10846248 | 3300014325 | Bacteria | 978 |
| 307 | Ga0157380_10462971 | 3300014326 | Bacteria | 1221 |
| 308 | Ga0157379_10013008 | 3300014968 | Bacteria | 7284 |
| 309 | Ga0157379_10721605 | 3300014968 | Bacteria | 937 |
| 310 | Ga0157376_10069756 | 3300014969 | Bacteria | 2981 |
| 311 | Ga0157376_11124189 | 3300014969 | Bacteria | 812 |
| 312 | Ga0157376_11501603 | 3300014969 | Bacteria | 707 |
| 313 | Ga0183363_1018 | 3300015690 | Bacteria | 62625 |
| 314 | Ga0163161_10109321 | 3300017792 | Bacteria | 2065 |
| 315 | Ga0206354_11535455 | 3300020081 | Bacteria | 719 |
| 316 | Ga0206353_10607391 | 3300020082 | Bacteria | 1059 |
| 317 | Ga0214544_1001241 | 3300021320 | Bacteria | 52071 |
| 318 | Ga0214542_1000115 | 3300021321 | Bacteria | 109873 |
| 319 | Ga0214542_1014437 | 3300021321 | Bacteria | 8813 |
| 320 | Ga0214543_1000008 | 3300021327 | Bacteria | 385680 |
| 321 | Ga0214543_1000098 | 3300021327 | Bacteria | 109894 |
| 322 | Ga0213872_10111020 | 3300021361 | Bacteria | 1218 |
| 323 | Ga0213874_10054570 | 3300021377 | Bacteria | 1236 |
| 324 | Ga0213874_10088994 | 3300021377 | Bacteria | 1011 |
| 325 | Ga0213876_10016738 | 3300021384 | Bacteria | 3873 |
| 326 | Ga0213875_10024254 | 3300021388 | Bacteria | 2894 |
| 327 | Ga0213875_10322147 | 3300021388 | Bacteria | 733 |
| 328 | Ga0209436_104530 | 3300025208 | Bacteria | 3419 |
| 329 | Ga0207425_1011774 | 3300025245 | Bacteria | 2072 |
| 330 | Ga0209677_100264 | 3300025253 | Bacteria | 35560 |
| 331 | Ga0209148_1013301 | 3300025254 | Bacteria | 1483 |
| 332 | Ga0209233_1001365 | 3300025261 | Bacteria | 9696 |
| 333 | Ga0209233_1004762 | 3300025261 | Bacteria | 4576 |
| 334 | Ga0209565_1010490 | 3300025263 | Bacteria | 2295 |
| 335 | Ga0209455_1004866 | 3300025272 | Bacteria | 4279 |
| 336 | Ga0209455_1018854 | 3300025272 | Bacteria | 1407 |
| 337 | Ga0209130_1000037 | 3300025284 | Bacteria | 284019 |
| 338 | Ga0209676_1000239 | 3300025292 | Bacteria | 117696 |
| 339 | Ga0209025_1000196 | 3300025294 | Bacteria | 147356 |
| 340 | Ga0209564_1000086 | 3300025295 | Bacteria | 251385 |
| 341 | Ga0209564_1009473 | 3300025295 | Bacteria | 4630 |
| 342 | Ga0209758_1038909 | 3300025297 | Bacteria | 1817 |
| 343 | Ga0209050_1001390 | 3300025298 | Bacteria | 26333 |
| 344 | Ga0207426_1000048 | 3300025302 | Bacteria | 409127 |
| 345 | Ga0209051_1001690 | 3300025303 | Bacteria | 17714 |
| 346 | Ga0209257_1001192 | 3300025304 | Bacteria | 32713 |
| 347 | Ga0207697_10079095 | 3300025315 | Bacteria | 1384 |
| 348 | Ga0207697_10113864 | 3300025315 | Bacteria | 1159 |
| 349 | Ga0207653_10005522 | 3300025885 | Bacteria | 3948 |
| 350 | Ga0207682_10043080 | 3300025893 | Bacteria | 1846 |
| 351 | Ga0207692_10002507 | 3300025898 | Bacteria | 7048 |
| 352 | Ga0207692_10017119 | 3300025898 | Bacteria | 3225 |
| 353 | Ga0207692_10119824 | 3300025898 | Bacteria | 1472 |
| 354 | Ga0207692_10716662 | 3300025898 | Bacteria | 650 |
| 355 | Ga0207642_10009209 | 3300025899 | Bacteria | 3426 |
| 356 | Ga0207710_10032980 | 3300025900 | Bacteria | 2270 |
| 357 | Ga0207710_10164795 | 3300025900 | Bacteria | 1081 |
| 358 | Ga0207710_10223611 | 3300025900 | Bacteria | 935 |
| 359 | Ga0207688_10246677 | 3300025901 | Bacteria | 1081 |
| 360 | Ga0207688_10384606 | 3300025901 | Bacteria | 868 |
| 361 | Ga0207647_10104124 | 3300025904 | Bacteria | 1682 |
| 362 | Ga0207647_10266406 | 3300025904 | Bacteria | 980 |
| 363 | Ga0207647_10499800 | 3300025904 | Bacteria | 678 |
| 364 | Ga0207685_10037922 | 3300025905 | Bacteria | 1778 |
| 365 | Ga0207685_10060377 | 3300025905 | Bacteria | 1499 |
| 366 | Ga0207685_10063552 | 3300025905 | Bacteria | 1471 |
| 367 | Ga0207699_10031457 | 3300025906 | Bacteria | 2979 |
| 368 | Ga0207699_10033995 | 3300025906 | Bacteria | 2887 |
| 369 | Ga0207699_10164847 | 3300025906 | Bacteria | 1478 |
| 370 | Ga0207699_10165041 | 3300025906 | Bacteria | 1477 |
| 371 | Ga0207699_10415613 | 3300025906 | Bacteria | 960 |
| 372 | Ga0207699_10590914 | 3300025906 | Bacteria | 808 |
| 373 | Ga0207645_10064188 | 3300025907 | Bacteria | 2346 |
| 374 | Ga0207645_10107923 | 3300025907 | Bacteria | 1801 |
| 375 | Ga0207645_10299138 | 3300025907 | Bacteria | 1071 |
| 376 | Ga0207643_10645974 | 3300025908 | Bacteria | 682 |
| 377 | Ga0207705_10421672 | 3300025909 | Bacteria | 1033 |
| 378 | Ga0207684_10242111 | 3300025910 | Bacteria | 1556 |
| 379 | Ga0207684_10312679 | 3300025910 | Bacteria | 1354 |
| 380 | Ga0207684_10836184 | 3300025910 | Bacteria | 777 |
| 381 | Ga0207654_10770809 | 3300025911 | Bacteria | 694 |
| 382 | Ga0207707_10015807 | 3300025912 | Bacteria | 6580 |
| 383 | Ga0207707_10037322 | 3300025912 | Bacteria | 4246 |
| 384 | Ga0207707_10281258 | 3300025912 | Bacteria | 1441 |
| 385 | Ga0207707_10491678 | 3300025912 | Bacteria | 1047 |
| 386 | Ga0207707_10921718 | 3300025912 | Bacteria | 721 |
| 387 | Ga0207707_11051478 | 3300025912 | Bacteria | 666 |
| 388 | Ga0207695_10349049 | 3300025913 | Bacteria | 1367 |
| 389 | Ga0207671_10020809 | 3300025914 | Bacteria | 4989 |
| 390 | Ga0207671_10057575 | 3300025914 | Bacteria | 2881 |
| 391 | Ga0207671_10129995 | 3300025914 | Bacteria | 1932 |
| 392 | Ga0207671_10179245 | 3300025914 | Bacteria | 1648 |
| 393 | Ga0207671_10239703 | 3300025914 | Bacteria | 1424 |
| 394 | Ga0207671_10796407 | 3300025914 | Bacteria | 750 |
| 395 | Ga0207693_10003443 | 3300025915 | Bacteria | 13501 |
| 396 | Ga0207693_10034329 | 3300025915 | Bacteria | 4001 |
| 397 | Ga0207693_10065210 | 3300025915 | Bacteria | 2852 |
| 398 | Ga0207693_10066850 | 3300025915 | Bacteria | 2814 |
| 399 | Ga0207693_10075789 | 3300025915 | Bacteria | 2634 |
| 400 | Ga0207693_10080355 | 3300025915 | Bacteria | 2552 |
| 401 | Ga0207693_10140313 | 3300025915 | Bacteria | 1900 |
| 402 | Ga0207663_10002035 | 3300025916 | Bacteria | 9616 |
| 403 | Ga0207663_10031403 | 3300025916 | Bacteria | 3144 |
| 404 | Ga0207663_10031644 | 3300025916 | Bacteria | 3133 |
| 405 | Ga0207663_10286262 | 3300025916 | Bacteria | 1226 |
| 406 | Ga0207663_10574300 | 3300025916 | Bacteria | 884 |
| 407 | Ga0207660_10061983 | 3300025917 | Bacteria | 2693 |
| 408 | Ga0207660_10298987 | 3300025917 | Bacteria | 1281 |
| 409 | Ga0207660_10940508 | 3300025917 | Bacteria | 705 |
| 410 | Ga0207657_10009705 | 3300025919 | Bacteria | 9652 |
| 411 | Ga0207657_10223318 | 3300025919 | Bacteria | 1508 |
| 412 | Ga0207657_10223488 | 3300025919 | Bacteria | 1508 |
| 413 | Ga0207657_10459632 | 3300025919 | Bacteria | 999 |
| 414 | Ga0207649_10121706 | 3300025920 | Bacteria | 1760 |
| 415 | Ga0207649_10133867 | 3300025920 | Bacteria | 1687 |
| 416 | Ga0207649_10670281 | 3300025920 | Bacteria | 803 |
| 417 | Ga0207652_10095355 | 3300025921 | Bacteria | 2620 |
| 418 | Ga0207652_10240711 | 3300025921 | Bacteria | 1631 |
| 419 | Ga0207652_10559937 | 3300025921 | Bacteria | 1027 |
| 420 | Ga0207681_10107400 | 3300025923 | Bacteria | 2024 |
| 421 | Ga0207681_10259799 | 3300025923 | Bacteria | 1359 |
| 422 | Ga0207694_11205163 | 3300025924 | Bacteria | 641 |
| 423 | Ga0207650_10184894 | 3300025925 | Bacteria | 1662 |
| 424 | Ga0207650_10315235 | 3300025925 | Bacteria | 1280 |
| 425 | Ga0207650_10781283 | 3300025925 | Bacteria | 809 |
| 426 | Ga0207700_10007067 | 3300025928 | Bacteria | 6830 |
| 427 | Ga0207700_10080515 | 3300025928 | Bacteria | 2540 |
| 428 | Ga0207700_10139440 | 3300025928 | Bacteria | 1990 |
| 429 | Ga0207700_10140903 | 3300025928 | Bacteria | 1981 |
| 430 | Ga0207700_10360134 | 3300025928 | Bacteria | 1268 |
| 431 | Ga0207664_10021207 | 3300025929 | Bacteria | 4827 |
| 432 | Ga0207664_10028066 | 3300025929 | Bacteria | 4274 |
| 433 | Ga0207664_10036418 | 3300025929 | Bacteria | 3803 |
| 434 | Ga0207664_10773984 | 3300025929 | Bacteria | 863 |
| 435 | Ga0207644_10000077 | 3300025931 | Bacteria | 72394 |
| 436 | Ga0207644_10239399 | 3300025931 | Bacteria | 1444 |
| 437 | Ga0207644_10305068 | 3300025931 | Bacteria | 1284 |
| 438 | Ga0207690_10107512 | 3300025932 | Bacteria | 2004 |
| 439 | Ga0207690_10155100 | 3300025932 | Bacteria | 1701 |
| 440 | Ga0207690_10604848 | 3300025932 | Bacteria | 895 |
| 441 | Ga0207706_10023157 | 3300025933 | Bacteria | 5579 |
| 442 | Ga0207686_10377361 | 3300025934 | Bacteria | 1074 |
| 443 | Ga0207709_10050550 | 3300025935 | Bacteria | 2543 |
| 444 | Ga0207669_10018069 | 3300025937 | Bacteria | 3634 |
| 445 | Ga0207669_10468097 | 3300025937 | Bacteria | 1002 |
| 446 | Ga0207669_10539659 | 3300025937 | Bacteria | 939 |
| 447 | Ga0207704_10476479 | 3300025938 | Bacteria | 1001 |
| 448 | Ga0207665_10010412 | 3300025939 | Bacteria | 6108 |
| 449 | Ga0207665_10054081 | 3300025939 | Bacteria | 2707 |
| 450 | Ga0207665_10151020 | 3300025939 | Bacteria | 1664 |
| 451 | Ga0207665_10719502 | 3300025939 | Bacteria | 785 |
| 452 | Ga0207691_10144444 | 3300025940 | Bacteria | 2095 |
| 453 | Ga0207691_10830352 | 3300025940 | Bacteria | 776 |
| 454 | Ga0207711_10184139 | 3300025941 | Bacteria | 1900 |
| 455 | Ga0207711_10363533 | 3300025941 | Bacteria | 1341 |
| 456 | Ga0207711_10981675 | 3300025941 | Bacteria | 784 |
| 457 | Ga0207689_10220943 | 3300025942 | Bacteria | 1565 |
| 458 | Ga0207661_10015139 | 3300025944 | Bacteria | 5669 |
| 459 | Ga0207661_10895380 | 3300025944 | Bacteria | 817 |
| 460 | Ga0207679_11035552 | 3300025945 | Bacteria | 753 |
| 461 | Ga0207667_10010515 | 3300025949 | Bacteria | 10813 |
| 462 | Ga0207667_10012516 | 3300025949 | Bacteria | 9765 |
| 463 | Ga0207667_10503559 | 3300025949 | Bacteria | 1228 |
| 464 | Ga0207667_11155936 | 3300025949 | Bacteria | 755 |
| 465 | Ga0207667_11597022 | 3300025949 | Bacteria | 621 |
| 466 | Ga0207651_11429407 | 3300025960 | Bacteria | 623 |
| 467 | Ga0207712_10016901 | 3300025961 | Bacteria | 4731 |
| 468 | Ga0207668_10000068 | 3300025972 | Bacteria | 81202 |
| 469 | Ga0207668_10677433 | 3300025972 | Bacteria | 905 |
| 470 | Ga0207668_11297870 | 3300025972 | Bacteria | 655 |
| 471 | Ga0207640_10166036 | 3300025981 | Bacteria | 1639 |
| 472 | Ga0207640_10313821 | 3300025981 | Bacteria | 1245 |
| 473 | Ga0207640_10326328 | 3300025981 | Bacteria | 1224 |
| 474 | Ga0207658_10220840 | 3300025986 | Bacteria | 1594 |
| 475 | Ga0207677_10240770 | 3300026023 | Bacteria | 1463 |
| 476 | Ga0207703_10176674 | 3300026035 | Bacteria | 1882 |
| 477 | Ga0207703_10541507 | 3300026035 | Bacteria | 1097 |
| 478 | Ga0207703_11371736 | 3300026035 | Bacteria | 680 |
| 479 | Ga0207703_11908406 | 3300026035 | Bacteria | 570 |
| 480 | Ga0207639_10046533 | 3300026041 | Bacteria | 3274 |
| 481 | Ga0207639_10344440 | 3300026041 | Bacteria | 1329 |
| 482 | Ga0207639_10453430 | 3300026041 | Bacteria | 1165 |
| 483 | Ga0207639_10793080 | 3300026041 | Bacteria | 882 |
| 484 | Ga0207678_10036005 | 3300026067 | Bacteria | 4309 |
| 485 | Ga0207678_10197973 | 3300026067 | Bacteria | 1717 |
| 486 | Ga0207678_10199123 | 3300026067 | Bacteria | 1712 |
| 487 | Ga0207678_11270392 | 3300026067 | Bacteria | 652 |
| 488 | Ga0207702_10000287 | 3300026078 | Bacteria | 58488 |
| 489 | Ga0207702_10082643 | 3300026078 | Bacteria | 2793 |
| 490 | Ga0207702_10226868 | 3300026078 | Bacteria | 1743 |
| 491 | Ga0207702_10469161 | 3300026078 | Bacteria | 1224 |
| 492 | Ga0207702_11399887 | 3300026078 | Bacteria | 693 |
| 493 | Ga0207641_10000031 | 3300026088 | Bacteria | 224320 |
| 494 | Ga0207641_10118152 | 3300026088 | Bacteria | 2362 |
| 495 | Ga0207641_10884774 | 3300026088 | Bacteria | 886 |
| 496 | Ga0207648_10100216 | 3300026089 | Bacteria | 2537 |
| 497 | Ga0207648_10123038 | 3300026089 | Bacteria | 2281 |
| 498 | Ga0207676_10277842 | 3300026095 | Bacteria | 1519 |
| 499 | Ga0207674_10068661 | 3300026116 | Bacteria | 3566 |
| 500 | Ga0207674_10866228 | 3300026116 | Bacteria | 871 |
| 501 | Ga0207674_11076227 | 3300026116 | Bacteria | 773 |
| 502 | Ga0207675_100065722 | 3300026118 | Bacteria | 3390 |
| 503 | Ga0207675_100785536 | 3300026118 | Bacteria | 965 |
| 504 | Ga0207683_10077274 | 3300026121 | Bacteria | 2948 |
| 505 | Ga0207683_10272055 | 3300026121 | Bacteria | 1547 |
| 506 | Ga0207683_10291806 | 3300026121 | Bacteria | 1491 |
| 507 | Ga0207683_10371043 | 3300026121 | Bacteria | 1315 |
| 508 | Ga0207683_10455525 | 3300026121 | Bacteria | 1180 |
| 509 | Ga0207683_10477914 | 3300026121 | Bacteria | 1150 |
| 510 | Ga0207683_10810966 | 3300026121 | Bacteria | 869 |
| 511 | Ga0207698_10010329 | 3300026142 | Bacteria | 5989 |
| 512 | Ga0207698_10381493 | 3300026142 | Bacteria | 1341 |
| 513 | Ga0207698_10911832 | 3300026142 | Bacteria | 886 |
| 514 | Ga0207698_11024050 | 3300026142 | Bacteria | 837 |
| 515 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 516 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 517 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 518 | Ga0207428_10002929 | 3300027907 | Bacteria | 16912 |
| 519 | Ga0207428_10160227 | 3300027907 | Bacteria | 1709 |
| 520 | Ga0207428_10464316 | 3300027907 | Bacteria | 922 |
| 521 | Ga0268266_10003479 | 3300028379 | Bacteria | 15692 |
| 522 | Ga0268266_10007831 | 3300028379 | Bacteria | 9575 |
| 523 | Ga0268266_10146697 | 3300028379 | Bacteria | 2122 |
| 524 | Ga0268266_10425440 | 3300028379 | Bacteria | 1259 |
| 525 | Ga0268266_11388549 | 3300028379 | Bacteria | 678 |
| 526 | Ga0268265_10141140 | 3300028380 | Bacteria | 2017 |
| 527 | Ga0268265_10153392 | 3300028380 | Bacteria | 1946 |
| 528 | Ga0268265_10312183 | 3300028380 | Bacteria | 1420 |
| 529 | Ga0268265_10534337 | 3300028380 | Bacteria | 1110 |
| 530 | Ga0268264_10408066 | 3300028381 | Bacteria | 1307 |
| 531 | Ga0265318_10069538 | 3300028577 | Bacteria | 1305 |
| 532 | Ga0265318_10197676 | 3300028577 | Bacteria | 735 |
| 533 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 534 | Ga0307515_10164978 | 3300028794 | Bacteria | 2238 |
| 535 | Ga0265338_10283522 | 3300028800 | Bacteria | 1209 |
| 536 | Ga0265330_10052550 | 3300031235 | Bacteria | 1784 |
| 537 | Ga0265332_10072809 | 3300031238 | Bacteria | 1463 |
| 538 | Ga0265328_10000085 | 3300031239 | Bacteria | 48380 |
| 539 | Ga0265328_10043394 | 3300031239 | Bacteria | 1654 |
| 540 | Ga0265325_10003663 | 3300031241 | Bacteria | 9952 |
| 541 | Ga0265329_10028176 | 3300031242 | Bacteria | 1843 |
| 542 | Ga0265340_10023460 | 3300031247 | Bacteria | 3147 |
| 543 | Ga0265340_10179736 | 3300031247 | Bacteria | 956 |
| 544 | Ga0265339_10002699 | 3300031249 | Bacteria | 12623 |
| 545 | Ga0265339_10012880 | 3300031249 | Bacteria | 5085 |
| 546 | Ga0265339_10018045 | 3300031249 | Bacteria | 4168 |
| 547 | Ga0265339_10061831 | 3300031249 | Bacteria | 2014 |
| 548 | Ga0265331_10000007 | 3300031250 | Bacteria | 331074 |
| 549 | Ga0265331_10007229 | 3300031250 | Bacteria | 6442 |
| 550 | Ga0265331_10183401 | 3300031250 | Bacteria | 945 |
| 551 | Ga0265331_10302707 | 3300031250 | Bacteria | 716 |
| 552 | Ga0265316_10029606 | 3300031344 | Bacteria | 4499 |
| 553 | Ga0265316_10148855 | 3300031344 | Bacteria | 1754 |
| 554 | Ga0265316_10785473 | 3300031344 | Bacteria | 668 |
| 555 | Ga0307513_10225523 | 3300031456 | Bacteria | 1691 |
| 556 | Ga0307513_10423239 | 3300031456 | Bacteria | 1061 |
| 557 | Ga0307513_10506529 | 3300031456 | Bacteria | 924 |
| 558 | Ga0307509_10102974 | 3300031507 | Bacteria | 2884 |
| 559 | Ga0307509_10279735 | 3300031507 | Bacteria | 1430 |
| 560 | Ga0307509_10323496 | 3300031507 | Bacteria | 1277 |
| 561 | Ga0307408_100086840 | 3300031548 | Bacteria | 2352 |
| 562 | Ga0307408_100124425 | 3300031548 | Bacteria | 2003 |
| 563 | Ga0265313_10002977 | 3300031595 | Bacteria | 14120 |
| 564 | Ga0265313_10004093 | 3300031595 | Bacteria | 11354 |
| 565 | Ga0265313_10011671 | 3300031595 | Bacteria | 5443 |
| 566 | Ga0265313_10029352 | 3300031595 | Bacteria | 2846 |
| 567 | Ga0307508_10000678 | 3300031616 | Bacteria | 40932 |
| 568 | Ga0307508_10027524 | 3300031616 | Bacteria | 5144 |
| 569 | Ga0307508_10115305 | 3300031616 | Bacteria | 2288 |
| 570 | Ga0307508_10803174 | 3300031616 | Bacteria | 558 |
| 571 | Ga0265314_10001099 | 3300031711 | Bacteria | 31235 |
| 572 | Ga0265314_10006996 | 3300031711 | Bacteria | 9864 |
| 573 | Ga0265314_10007614 | 3300031711 | Bacteria | 9375 |
| 574 | Ga0265314_10063760 | 3300031711 | Bacteria | 2498 |
| 575 | Ga0265314_10123984 | 3300031711 | Bacteria | 1621 |
| 576 | Ga0265342_10039973 | 3300031712 | Bacteria | 2846 |
| 577 | Ga0265342_10319551 | 3300031712 | Bacteria | 814 |
| 578 | Ga0307516_10044194 | 3300031730 | Bacteria | 4409 |
| 579 | Ga0307516_10054727 | 3300031730 | Bacteria | 3898 |
| 580 | Ga0307516_10185848 | 3300031730 | Bacteria | 1808 |
| 581 | Ga0307405_10225583 | 3300031731 | Bacteria | 1378 |
| 582 | Ga0307405_10302810 | 3300031731 | Bacteria | 1213 |
| 583 | Ga0307405_10340387 | 3300031731 | Bacteria | 1153 |
| 584 | Ga0307413_10160948 | 3300031824 | Bacteria | 1577 |
| 585 | Ga0307413_10363307 | 3300031824 | Bacteria | 1122 |
| 586 | Ga0307413_10441353 | 3300031824 | Bacteria | 1031 |
| 587 | Ga0307413_11542853 | 3300031824 | Bacteria | 588 |
| 588 | Ga0307410_10460271 | 3300031852 | Bacteria | 1039 |
| 589 | Ga0307412_10246753 | 3300031911 | Bacteria | 1384 |
| 590 | Ga0307409_100310908 | 3300031995 | Bacteria | 1470 |
| 591 | Ga0307416_100307599 | 3300032002 | Bacteria | 1579 |
| 592 | Ga0307416_102498649 | 3300032002 | Bacteria | 615 |
| 593 | Ga0307411_10195186 | 3300032005 | Bacteria | 1549 |
| 594 | Ga0307411_10331018 | 3300032005 | Bacteria | 1234 |
| 595 | Ga0307415_100977281 | 3300032126 | Bacteria | 785 |
| 596 | Ga0307415_101680905 | 3300032126 | Bacteria | 612 |
| 597 | Ga0307510_10005253 | 3300033180 | Bacteria | 15392 |
| 598 | Ga0315911_1000022 | 3300033442 | Bacteria | 118114 |
| 599 | Ga0316215_1006240 | 3300033544 | Bacteria | 1154 |
| 600 | Ga0316216_1003343 | 3300033548 | Bacteria | 1152 |
| 601 | Ga0373950_0012861 | 3300034818 | Bacteria | 1388 |
| 602 | Ga0373938_0054638 | 3300034957 | Bacteria | 920 |
| 603 | Ga0373926_0024385 | 3300035083 | Bacteria | 2106 |
| 604 | Ga0373926_0138356 | 3300035083 | Bacteria | 924 |
| 605 | Ga0373929_0024231 | 3300035085 | Bacteria | 1252 |
| 606 | Ga0373949_0010439 | 3300035090 | Bacteria | 2036 |
| 607 | Ga0373952_0089337 | 3300035092 | Bacteria | 798 |
| 608 | Ga0373923_0007172 | 3300035111 | Bacteria | 3906 |
| 609 | Ga0373923_0313601 | 3300035111 | Bacteria | 744 |
| 610 | Ga0373932_0082230 | 3300035112 | Bacteria | 1019 |
| 611 | Ga0373936_0038057 | 3300035113 | Bacteria | 1922 |
| 612 | Ga0373936_0046065 | 3300035113 | Bacteria | 1758 |
| 613 | Ga0373936_0075618 | 3300035113 | Bacteria | 1394 |
| 614 | Ga0373936_0302135 | 3300035113 | Bacteria | 722 |
| 615 | Ga0373945_0006472 | 3300035116 | Bacteria | 3780 |
| 616 | Ga0373945_0260912 | 3300035116 | Bacteria | 734 |
| 617 | Ga0373953_0049275 | 3300035117 | Bacteria | 1699 |
| 618 | Ga0373960_0046468 | 3300035121 | Bacteria | 1274 |
| 619 | Ga0373943_0127658 | 3300035170 | Bacteria | 1358 |
| 620 | Ga0373943_0154842 | 3300035170 | Bacteria | 1244 |
| 621 | Ga0373946_0200659 | 3300035171 | Bacteria | 955 |
| 622 | Ga0373946_0366950 | 3300035171 | Bacteria | 722 |
| 623 | Ga0373924_0264398 | 3300035410 | Bacteria | 762 |
| 624 | Ga0373931_0000915 | 3300035691 | Bacteria | 12419 |
| 625 | Ga0373931_0229891 | 3300035691 | Bacteria | 1120 |
| 626 | Ga0373935_0009266 | 3300035692 | Bacteria | 5895 |
| 627 | Ga0373935_0073599 | 3300035692 | Bacteria | 2207 |
| 628 | Ga0373935_0151442 | 3300035692 | Bacteria | 1574 |
| 629 | Ga0373935_0286650 | 3300035692 | Bacteria | 1160 |
| 630 | Ga0373927_0003250 | 3300035695 | Bacteria | 11692 |
| 631 | Ga0373927_0005961 | 3300035695 | Bacteria | 8346 |
| 632 | Ga0373927_0032352 | 3300035695 | Bacteria | 3407 |
| 633 | Ga0373927_0032748 | 3300035695 | Bacteria | 3385 |
| 634 | Ga0373927_0074901 | 3300035695 | Bacteria | 2191 |
| 635 | Ga0373927_0080688 | 3300035695 | Bacteria | 2108 |
| 636 | Ga0373927_0083369 | 3300035695 | Bacteria | 2072 |
| 637 | Ga0373927_0131012 | 3300035695 | Bacteria | 1638 |
| 638 | Ga0373927_0485256 | 3300035695 | Bacteria | 816 |
| 639 | Ga0373933_0000536 | 3300035724 | Bacteria | 23607 |
| 640 | Ga0373933_0009887 | 3300035724 | Bacteria | 5223 |
| 641 | Ga0373933_0579030 | 3300035724 | Bacteria | 737 |
| 642 | Ga0373947_0078460 | 3300035725 | Bacteria | 2038 |
| 643 | Ga0373947_0125529 | 3300035725 | Bacteria | 1634 |
| 644 | Ga0373947_0283629 | 3300035725 | Bacteria | 1101 |
| 645 | Ga0373947_0305050 | 3300035725 | Bacteria | 1062 |
| 646 | Ga0373947_0307882 | 3300035725 | Bacteria | 1057 |
| 647 | Ga0373937_0021969 | 3300036401 | Bacteria | 5730 |
| 648 | Ga0372808_000838 | 3300036459 | Bacteria | 2818 |
| 649 | Ga0373925_0027008 | 3300037068 | Bacteria | 4203 |
| 650 | Ga0373925_0036358 | 3300037068 | Bacteria | 3634 |
| 651 | Ga0373925_0173379 | 3300037068 | Bacteria | 1703 |
| 652 | Ga0373925_0477839 | 3300037068 | Bacteria | 1022 |
| 653 | Ga0395899_0018741 | 3300037312 | Bacteria | 5260 |
| 654 | Ga0395900_0095404 | 3300037418 | Bacteria | 3056 |
| 655 | Ga0395900_0317077 | 3300037418 | Bacteria | 1540 |
| 656 | Ga0395900_0417097 | 3300037418 | Bacteria | 1304 |
| 657 | Ga0395900_0561950 | 3300037418 | Bacteria | 1084 |
| 658 | Ga0395900_0694941 | 3300037418 | Bacteria | 951 |
| 659 | Ga0395898_0035381 | 3300037466 | Bacteria | 4967 |
| 660 | Ga0395898_0054928 | 3300037466 | Bacteria | 3885 |
| 661 | Ga0395898_0108406 | 3300037466 | Bacteria | 2663 |
| 662 | Ga0395898_0744456 | 3300037466 | Bacteria | 921 |
| 663 | Ga0395905_1096722 | 3300037471 | Bacteria | 699 |
| 664 | Ga0436364_0005842 | 3300037853 | Bacteria | 1309 |
| 665 | Ga0436364_0982560 | 3300037853 | Bacteria | 14460 |
| 666 | Ga0436364_1034666 | 3300037853 | Bacteria | 1706 |
| 667 | Ga0436364_1143755 | 3300037853 | Bacteria | 2044 |
| 668 | Ga0436364_1324733 | 3300037853 | Bacteria | 1891 |
| 669 | Ga0395901_0003860 | 3300038443 | Bacteria | 15077 |
| 670 | Ga0436365_0205832 | 3300039437 | Bacteria | 15641 |
| 671 | Ga0436365_0924470 | 3300039437 | Bacteria | 1935 |
| 672 | Ga0436360_0179349 | 3300039438 | Bacteria | 1291 |
| 673 | Ga0436360_0193747 | 3300039438 | Bacteria | 666 |
| 674 | Ga0436360_1291396 | 3300039438 | Bacteria | 1139 |
| 675 | Ga0436361_0028451 | 3300039447 | Bacteria | 785 |
| 676 | Ga0436361_0086028 | 3300039447 | Bacteria | 2199 |
| 677 | Ga0436361_0339604 | 3300039447 | Bacteria | 1798 |
| 678 | Ga0436363_1083454 | 3300039450 | Bacteria | 1548 |
| 679 | Ga0436363_1193054 | 3300039450 | Bacteria | 1552 |
| 680 | Ga0436362_0088613 | 3300039453 | Bacteria | 9777 |
| 681 | Ga0436362_0544940 | 3300039453 | Bacteria | 933 |
| 682 | Ga0436362_0681126 | 3300039453 | Bacteria | 604 |
| 683 | Ga0436362_0915997 | 3300039453 | Bacteria | 886 |
| 684 | Ga0439436_0061893 | 3300041404 | Bacteria | 1047 |
| 685 | Ga0439447_095373 | 3300041407 | Bacteria | 683 |
| 686 | Ga0439465_0007899 | 3300041413 | Bacteria | 3371 |
| 687 | Ga0451793_1853703 | 3300041452 | Bacteria | 1504 |
| 688 | Ga0451795_0455491 | 3300041456 | Bacteria | 550 |
| 689 | Ga0451802_0893213 | 3300041460 | Bacteria | 567 |
| 690 | Ga0451835_0578077 | 3300041492 | Bacteria | 695 |
| 691 | Ga0451853_0044773 | 3300041512 | Bacteria | 653 |
| 692 | Ga0451853_1423910 | 3300041512 | Bacteria | 1048 |
| 693 | Ga0439445_0074119 | 3300042004 | Bacteria | 945 |
| 694 | Ga0439432_012787 | 3300042006 | Bacteria | 2863 |
| 695 | Ga0439449_0030566 | 3300042007 | Bacteria | 2008 |
| 696 | Ga0439449_0153962 | 3300042007 | Bacteria | 857 |
| 697 | Ga0439455_0065262 | 3300042012 | Bacteria | 971 |
| 698 | Ga0439440_0168658 | 3300042993 | Bacteria | 635 |
| 699 | Ga0466969_0129919 | 3300044656 | Bacteria | 1168 |
| 700 | Ga0466965_0076980 | 3300044683 | Bacteria | 1684 |
| 701 | Ga0466961_0465244 | 3300044693 | Bacteria | 765 |
| 702 | Ga0466968_0111699 | 3300044735 | Bacteria | 1229 |
| 703 | Ga0466968_0156600 | 3300044735 | Bacteria | 1049 |
| 704 | Ga0466970_0223633 | 3300044765 | Bacteria | 1051 |
| 705 | Ga0466970_0250436 | 3300044765 | Bacteria | 992 |
| 706 | Ga0466970_0416689 | 3300044765 | Bacteria | 767 |
| 707 | Ga0466957_0587806 | 3300044842 | Bacteria | 779 |
| 708 | Ga0466959_0102092 | 3300045049 | Bacteria | 2053 |
| 709 | Ga0466959_0761497 | 3300045049 | Bacteria | 648 |
| 710 | Ga0451576_0041218 | 3300045051 | Bacteria | 4883 |
| 711 | Ga0466967_1372846 | 3300045976 | Bacteria | 704 |
| 712 | Ga0495617_035898 | 3300046452 | Bacteria | 1663 |
| 713 | Ga0495627_095052 | 3300046453 | Bacteria | 855 |
| 714 | Ga0495592_0038026 | 3300046454 | Bacteria | 3622 |
| 715 | Ga0495592_0127679 | 3300046454 | Bacteria | 1781 |
| 716 | Ga0495603_0011165 | 3300046455 | Bacteria | 5446 |
| 717 | Ga0495603_0022523 | 3300046455 | Bacteria | 3813 |
| 718 | Ga0495603_0025847 | 3300046455 | Bacteria | 3549 |
| 719 | Ga0495603_0138816 | 3300046455 | Bacteria | 1414 |
| 720 | Ga0495603_0521846 | 3300046455 | Bacteria | 680 |
| 721 | Ga0495590_0065417 | 3300046457 | Bacteria | 1273 |
| 722 | Ga0495629_0182227 | 3300046459 | Bacteria | 1455 |
| 723 | Ga0495629_0184168 | 3300046459 | Bacteria | 1447 |
| 724 | Ga0495629_0567327 | 3300046459 | Bacteria | 761 |
| 725 | Ga0495629_0868525 | 3300046459 | Bacteria | 592 |
| 726 | Ga0495638_0024606 | 3300046460 | Bacteria | 3924 |
| 727 | Ga0495638_0054657 | 3300046460 | Bacteria | 2481 |
| 728 | Ga0495641_0044799 | 3300046461 | Bacteria | 2040 |
| 729 | Ga0495641_0369729 | 3300046461 | Bacteria | 649 |
| 730 | Ga0495651_0028221 | 3300046462 | Bacteria | 4374 |
| 731 | Ga0495651_0113504 | 3300046462 | Bacteria | 2000 |
| 732 | Ga0495651_0117170 | 3300046462 | Bacteria | 1961 |
| 733 | Ga0495653_0046358 | 3300046463 | Bacteria | 3367 |
| 734 | Ga0495580_0009940 | 3300046472 | Bacteria | 7446 |
| 735 | Ga0495580_0530150 | 3300046472 | Bacteria | 784 |
| 736 | Ga0495582_0007218 | 3300046473 | Bacteria | 6163 |
| 737 | Ga0495582_0344184 | 3300046473 | Bacteria | 858 |
| 738 | Ga0495605_0066802 | 3300046474 | Bacteria | 1707 |
| 739 | Ga0495639_0014200 | 3300046475 | Bacteria | 3447 |
| 740 | Ga0495639_0133759 | 3300046475 | Bacteria | 1188 |
| 741 | Ga0495639_0312781 | 3300046475 | Bacteria | 784 |
| 742 | Ga0495662_0205676 | 3300046476 | Bacteria | 970 |
| 743 | Ga0495664_0015668 | 3300046477 | Bacteria | 4312 |
| 744 | Ga0495664_0016768 | 3300046477 | Bacteria | 4179 |
| 745 | Ga0495664_0071811 | 3300046477 | Bacteria | 2067 |
| 746 | Ga0495664_0091152 | 3300046477 | Bacteria | 1832 |
| 747 | Ga0495664_0147893 | 3300046477 | Bacteria | 1425 |
| 748 | Ga0495664_0428084 | 3300046477 | Bacteria | 794 |
| 749 | Ga0495584_0286735 | 3300046491 | Bacteria | 836 |
| 750 | Ga0495584_0385134 | 3300046491 | Bacteria | 712 |
| 751 | Ga0495585_0082648 | 3300046492 | Bacteria | 1738 |
| 752 | Ga0495585_0087368 | 3300046492 | Bacteria | 1683 |
| 753 | Ga0495585_0544216 | 3300046492 | Bacteria | 549 |
| 754 | Ga0495596_0032426 | 3300046500 | Bacteria | 2083 |
| 755 | Ga0495596_0145491 | 3300046500 | Bacteria | 921 |
| 756 | Ga0495596_0273855 | 3300046500 | Bacteria | 655 |
| 757 | Ga0495607_0244587 | 3300046501 | Bacteria | 866 |
| 758 | Ga0495583_0048885 | 3300046506 | Bacteria | 1939 |
| 759 | Ga0495583_0157240 | 3300046506 | Bacteria | 939 |
| 760 | Ga0495606_0155528 | 3300046507 | Bacteria | 1338 |
| 761 | Ga0495606_0302575 | 3300046507 | Bacteria | 866 |
| 762 | Ga0495606_0554059 | 3300046507 | Bacteria | 571 |
| 763 | Ga0495608_0017629 | 3300046511 | Bacteria | 4938 |
| 764 | Ga0495608_0175709 | 3300046511 | Bacteria | 1357 |
| 765 | Ga0495608_0316986 | 3300046511 | Bacteria | 964 |
| 766 | Ga0495608_0692296 | 3300046511 | Bacteria | 607 |
| 767 | Ga0495610_0401834 | 3300046512 | Bacteria | 505 |
| 768 | Ga0495616_0059046 | 3300046513 | Bacteria | 1887 |
| 769 | Ga0495616_0414348 | 3300046513 | Bacteria | 551 |
| 770 | Ga0495618_0022470 | 3300046514 | Bacteria | 3896 |
| 771 | Ga0495620_0078980 | 3300046515 | Bacteria | 1333 |
| 772 | Ga0495628_0546390 | 3300046516 | Bacteria | 832 |
| 773 | Ga0495628_0822976 | 3300046516 | Bacteria | 648 |
| 774 | Ga0495630_0039214 | 3300046517 | Bacteria | 3543 |
| 775 | Ga0495630_0040315 | 3300046517 | Bacteria | 3490 |
| 776 | Ga0495630_0733223 | 3300046517 | Bacteria | 756 |
| 777 | Ga0495631_0038572 | 3300046518 | Bacteria | 2123 |
| 778 | Ga0495631_0068981 | 3300046518 | Bacteria | 1529 |
| 779 | Ga0495631_0114158 | 3300046518 | Bacteria | 1161 |
| 780 | Ga0495631_0130948 | 3300046518 | Bacteria | 1078 |
| 781 | Ga0495631_0264148 | 3300046518 | Bacteria | 733 |
| 782 | Ga0495632_0107100 | 3300046519 | Bacteria | 1314 |
| 783 | Ga0495632_0142233 | 3300046519 | Bacteria | 1112 |
| 784 | Ga0495637_0020908 | 3300046520 | Bacteria | 3003 |
| 785 | Ga0495644_0216776 | 3300046523 | Bacteria | 739 |
| 786 | Ga0495648_0067597 | 3300046524 | Bacteria | 2089 |
| 787 | Ga0495652_0029766 | 3300046529 | Bacteria | 4793 |
| 788 | Ga0495652_0264476 | 3300046529 | Bacteria | 1268 |
| 789 | Ga0495652_0288021 | 3300046529 | Bacteria | 1200 |
| 790 | Ga0495654_0126291 | 3300046530 | Bacteria | 1152 |
| 791 | Ga0495654_0175175 | 3300046530 | Bacteria | 932 |
| 792 | Ga0495586_0104521 | 3300046535 | Bacteria | 1574 |
| 793 | Ga0495598_0048896 | 3300046537 | Bacteria | 1266 |
| 794 | Ga0495597_0025983 | 3300046542 | Bacteria | 2692 |
| 795 | Ga0495597_0095688 | 3300046542 | Bacteria | 1256 |
| 796 | Ga0495645_0064136 | 3300046543 | Bacteria | 2659 |
| 797 | Ga0495645_0135798 | 3300046543 | Bacteria | 1721 |
| 798 | Ga0495622_0138326 | 3300046557 | Bacteria | 1106 |
| 799 | Ga0495622_0240388 | 3300046557 | Bacteria | 798 |
| 800 | Ga0495633_0195751 | 3300046558 | Bacteria | 928 |
| 801 | Ga0495633_0333405 | 3300046558 | Bacteria | 688 |
| 802 | Ga0495667_0007414 | 3300046559 | Bacteria | 7437 |
| 803 | Ga0495667_0081398 | 3300046559 | Bacteria | 2105 |
| 804 | Ga0495667_0301080 | 3300046559 | Bacteria | 1016 |
| 805 | Ga0495656_0008259 | 3300046615 | Bacteria | 3712 |
| 806 | Ga0495656_0215723 | 3300046615 | Bacteria | 958 |
| 807 | Ga0495656_0255403 | 3300046615 | Bacteria | 886 |
| 808 | Ga0495656_0312739 | 3300046615 | Bacteria | 807 |
| 809 | Ga0495668_0017269 | 3300046616 | Bacteria | 4189 |
| 810 | Ga0495668_0177892 | 3300046616 | Bacteria | 1165 |
| 811 | Ga0495634_0065864 | 3300046642 | Bacteria | 2400 |
| 812 | Ga0495634_0082039 | 3300046642 | Bacteria | 2108 |
| 813 | Ga0495634_0113718 | 3300046642 | Bacteria | 1738 |
| 814 | Ga0495634_0502189 | 3300046642 | Bacteria | 711 |
| 815 | Ga0495611_0169521 | 3300046648 | Bacteria | 1020 |
| 816 | Ga0495625_0242268 | 3300046660 | Bacteria | 1173 |
| 817 | Ga0495625_0364230 | 3300046660 | Bacteria | 910 |
| 818 | Ga0495635_0082927 | 3300046663 | Bacteria | 2194 |
| 819 | Ga0495635_0098507 | 3300046663 | Bacteria | 1998 |
| 820 | Ga0495635_0449267 | 3300046663 | Bacteria | 852 |
| 821 | Ga0495661_0150860 | 3300046665 | Bacteria | 1255 |
| 822 | Ga0495588_0036900 | 3300046674 | Bacteria | 2481 |
| 823 | Ga0495588_0038457 | 3300046674 | Bacteria | 2434 |
| 824 | Ga0495588_0153256 | 3300046674 | Bacteria | 1218 |
| 825 | Ga0495588_0230927 | 3300046674 | Bacteria | 976 |
| 826 | Ga0495657_0012557 | 3300046675 | Bacteria | 6288 |
| 827 | Ga0495657_0051753 | 3300046675 | Bacteria | 2757 |
| 828 | Ga0495599_0006131 | 3300046678 | Bacteria | 7240 |
| 829 | Ga0495599_0221366 | 3300046678 | Bacteria | 1158 |
| 830 | Ga0495599_0510830 | 3300046678 | Bacteria | 706 |
| 831 | Ga0495623_0071781 | 3300046679 | Bacteria | 2153 |
| 832 | Ga0495623_0090972 | 3300046679 | Bacteria | 1873 |
| 833 | Ga0495646_0015482 | 3300046680 | Bacteria | 4839 |
| 834 | Ga0495646_0288982 | 3300046680 | Bacteria | 869 |
| 835 | Ga0495647_0026501 | 3300046681 | Bacteria | 2124 |
| 836 | Ga0495647_0194729 | 3300046681 | Bacteria | 887 |
| 837 | Ga0495658_0338535 | 3300046683 | Bacteria | 955 |
| 838 | Ga0495658_0368767 | 3300046683 | Bacteria | 913 |
| 839 | Ga0495658_0507078 | 3300046683 | Bacteria | 772 |
| 840 | Ga0495669_0002775 | 3300046684 | Bacteria | 7179 |
| 841 | Ga0495669_0019989 | 3300046684 | Bacteria | 2893 |
| 842 | Ga0495669_0159387 | 3300046684 | Bacteria | 1071 |
| 843 | Ga0495613_0053582 | 3300046689 | Bacteria | 2968 |
| 844 | Ga0495613_0286885 | 3300046689 | Bacteria | 1142 |
| 845 | Ga0495624_0050542 | 3300046690 | Bacteria | 2633 |
| 846 | Ga0495624_0104170 | 3300046690 | Bacteria | 1746 |
| 847 | Ga0495624_0183834 | 3300046690 | Bacteria | 1273 |
| 848 | Ga0495670_0153058 | 3300046691 | Bacteria | 1210 |
| 849 | Ga0495670_0561006 | 3300046691 | Bacteria | 621 |
| 850 | Ga0495649_0224752 | 3300046694 | Bacteria | 970 |
| 851 | Ga0495589_0247741 | 3300046794 | Bacteria | 833 |
| 852 | Ga0495589_0345063 | 3300046794 | Bacteria | 686 |
| 853 | Ga0495600_0027672 | 3300046809 | Bacteria | 3664 |
| 854 | Ga0495600_0055460 | 3300046809 | Bacteria | 2588 |
| 855 | Ga0495660_0070392 | 3300046810 | Bacteria | 1857 |
| 856 | Ga0495660_0076497 | 3300046810 | Bacteria | 1763 |
| 857 | Ga0495581_0018052 | 3300047315 | Bacteria | 4098 |
| 858 | Ga0495581_0127362 | 3300047315 | Bacteria | 1483 |
| 859 | Ga0495581_0324521 | 3300047315 | Bacteria | 899 |
| 860 | Ga0495604_0012840 | 3300047317 | Bacteria | 6670 |
| 861 | Ga0495604_0665217 | 3300047317 | Bacteria | 663 |
| 862 | Ga0495604_0734151 | 3300047317 | Bacteria | 625 |
| 863 | Ga0495636_0112816 | 3300047318 | Bacteria | 1197 |
| 864 | Ga0495636_0203635 | 3300047318 | Bacteria | 904 |
| 865 | Ga0495636_0258248 | 3300047318 | Bacteria | 807 |
| 866 | Ga0495674_0012852 | 3300047319 | Bacteria | 7885 |
| 867 | Ga0495674_0023420 | 3300047319 | Bacteria | 5691 |
| 868 | Ga0495674_0142272 | 3300047319 | Bacteria | 2016 |
| 869 | Ga0495672_0024770 | 3300047320 | Bacteria | 3859 |
| 870 | Ga0495672_0052208 | 3300047320 | Bacteria | 2402 |
| 871 | Ga0495672_0098193 | 3300047320 | Bacteria | 1593 |
| 872 | Ga0495672_0100853 | 3300047320 | Bacteria | 1566 |
| 873 | Ga0495676_0092919 | 3300047321 | Bacteria | 2251 |
| 874 | Ga0495676_0781324 | 3300047321 | Bacteria | 615 |
| 875 | Ga0495680_0004790 | 3300047322 | Bacteria | 12844 |
| 876 | Ga0495680_0394090 | 3300047322 | Bacteria | 957 |
| 877 | Ga0495687_035147 | 3300047443 | Bacteria | 2257 |
| 878 | Ga0495675_0025592 | 3300047444 | Bacteria | 3761 |
| 879 | Ga0495675_0255568 | 3300047444 | Bacteria | 1051 |
| 880 | Ga0495677_0210766 | 3300047445 | Bacteria | 756 |
| 881 | Ga0495677_0215538 | 3300047445 | Bacteria | 747 |
| 882 | Ga0495679_076078 | 3300047446 | Bacteria | 960 |
| 883 | Ga0495673_0184098 | 3300047469 | Bacteria | 789 |
| 884 | Ga0495684_0105554 | 3300047471 | Bacteria | 2128 |
| 885 | Ga0495686_0038202 | 3300047472 | Bacteria | 3072 |
| 886 | Ga0495686_0045381 | 3300047472 | Bacteria | 2780 |
| 887 | Ga0495602_0030319 | 3300048088 | Bacteria | 5132 |
| 888 | Ga0495602_0232981 | 3300048088 | Bacteria | 1382 |
| 889 | Ga0495602_0237796 | 3300048088 | Bacteria | 1364 |
| 890 | Ga0495626_0061888 | 3300048091 | Bacteria | 1701 |
| 891 | Ga0496100_0007336 | 3300048903 | Bacteria | 6073 |
| 892 | Ga0496100_0209783 | 3300048903 | Bacteria | 1424 |
| 893 | Ga0496100_0243050 | 3300048903 | Bacteria | 1329 |
| 894 | Ga0496100_0406779 | 3300048903 | Bacteria | 1037 |
| 895 | Ga0496100_0844897 | 3300048903 | Bacteria | 718 |
| 896 | Ga0496100_0859312 | 3300048903 | Bacteria | 712 |
| 897 | Ga0496101_0002063 | 3300048904 | Bacteria | 12220 |
| 898 | Ga0496101_0006658 | 3300048904 | Bacteria | 7451 |
| 899 | Ga0496101_0061032 | 3300048904 | Bacteria | 2737 |
| 900 | Ga0496101_0546338 | 3300048904 | Bacteria | 916 |
| 901 | Ga0496102_0002920 | 3300048905 | Bacteria | 14499 |
| 902 | Ga0496102_0023415 | 3300048905 | Bacteria | 5485 |
| 903 | Ga0496102_0157380 | 3300048905 | Bacteria | 2136 |
| 904 | Ga0496102_0196308 | 3300048905 | Bacteria | 1902 |
| 905 | Ga0496102_0300694 | 3300048905 | Bacteria | 1512 |
| 906 | Ga0496103_0060499 | 3300048906 | Bacteria | 2354 |
| 907 | Ga0496104_0044633 | 3300048907 | Bacteria | 4165 |
| 908 | Ga0496104_0044919 | 3300048907 | Bacteria | 4152 |
| 909 | Ga0496104_0174939 | 3300048907 | Bacteria | 2057 |
| 910 | Ga0496105_0001825 | 3300048908 | Bacteria | 15255 |
| 911 | Ga0496106_0000743 | 3300048909 | Bacteria | 23497 |
| 912 | Ga0496106_0005280 | 3300048909 | Bacteria | 9570 |
| 913 | Ga0496106_0029914 | 3300048909 | Bacteria | 4060 |
| 914 | Ga0496106_0132630 | 3300048909 | Bacteria | 1954 |
| 915 | Ga0496106_0716970 | 3300048909 | Bacteria | 796 |
| 916 | Ga0496107_0013354 | 3300048910 | Bacteria | 5738 |
| 917 | Ga0496107_0052957 | 3300048910 | Bacteria | 2927 |
| 918 | Ga0496108_0001385 | 3300048911 | Bacteria | 19060 |
| 919 | Ga0496108_0299562 | 3300048911 | Bacteria | 1400 |
| 920 | Ga0496108_1084554 | 3300048911 | Bacteria | 681 |
| 921 | Ga0496109_0018394 | 3300048912 | Bacteria | 6139 |
| 922 | Ga0496109_0024523 | 3300048912 | Bacteria | 5363 |
| 923 | Ga0496110_0041497 | 3300048913 | Bacteria | 4016 |
| 924 | Ga0496110_0053691 | 3300048913 | Bacteria | 3543 |
| 925 | Ga0496110_0075104 | 3300048913 | Bacteria | 3003 |
| 926 | Ga0496110_0252065 | 3300048913 | Bacteria | 1606 |
| 927 | Ga0496111_0063898 | 3300048914 | Bacteria | 2670 |
| 928 | Ga0496111_0071123 | 3300048914 | Bacteria | 2532 |
| 929 | Ga0496111_0228175 | 3300048914 | Bacteria | 1383 |
| 930 | Ga0496111_0358751 | 3300048914 | Bacteria | 1079 |
| 931 | Ga0496111_0366214 | 3300048914 | Bacteria | 1066 |
| 932 | Ga0496112_0000023 | 3300048915 | Bacteria | 156144 |
| 933 | Ga0496112_0002038 | 3300048915 | Bacteria | 16019 |
| 934 | Ga0496112_0005113 | 3300048915 | Bacteria | 11271 |
| 935 | Ga0496112_0115648 | 3300048915 | Bacteria | 2653 |
| 936 | Ga0496112_0422591 | 3300048915 | Bacteria | 1272 |
| 937 | Ga0496112_0452333 | 3300048915 | Bacteria | 1222 |
| 938 | Ga0496112_0964275 | 3300048915 | Bacteria | 773 |
| 939 | Ga0496112_1099666 | 3300048915 | Bacteria | 713 |
| 940 | Ga0496113_0001405 | 3300048916 | Bacteria | 13404 |
| 941 | Ga0496113_0014962 | 3300048916 | Bacteria | 5312 |
| 942 | Ga0496113_0040253 | 3300048916 | Bacteria | 3443 |
| 943 | Ga0496114_0014943 | 3300048917 | Bacteria | 6240 |
| 944 | Ga0496114_0275580 | 3300048917 | Bacteria | 1482 |
| 945 | Ga0496114_0554520 | 3300048917 | Bacteria | 1015 |
| 946 | Ga0496114_0713976 | 3300048917 | Bacteria | 878 |
| 947 | Ga0496114_0902272 | 3300048917 | Bacteria | 765 |
| 948 | Ga0496115_0000800 | 3300048918 | Bacteria | 23066 |
| 949 | Ga0496115_0024514 | 3300048918 | Bacteria | 4690 |
| 950 | Ga0496115_0086214 | 3300048918 | Bacteria | 2562 |
| 951 | Ga0496115_0263871 | 3300048918 | Bacteria | 1416 |
| 952 | Ga0496115_0744485 | 3300048918 | Bacteria | 767 |
| 953 | Ga0496116_0004324 | 3300048919 | Bacteria | 13589 |
| 954 | Ga0496116_0072522 | 3300048919 | Bacteria | 2176 |
| 955 | Ga0496116_0084975 | 3300048919 | Bacteria | 1947 |
| 956 | Ga0496116_0267094 | 3300048919 | Bacteria | 839 |
| 957 | Ga0496117_0009472 | 3300048920 | Bacteria | 9058 |
| 958 | Ga0496117_0060686 | 3300048920 | Bacteria | 2604 |
| 959 | Ga0496117_0061687 | 3300048920 | Bacteria | 2575 |
| 960 | Ga0496117_0102981 | 3300048920 | Bacteria | 1800 |
| 961 | Ga0496117_0340054 | 3300048920 | Bacteria | 779 |
| 962 | Ga0496118_0002385 | 3300048921 | Bacteria | 25382 |
| 963 | Ga0496118_0022944 | 3300048921 | Bacteria | 5437 |
| 964 | Ga0496118_0040700 | 3300048921 | Bacteria | 3692 |
| 965 | Ga0496118_0112935 | 3300048921 | Bacteria | 1796 |
| 966 | Ga0496118_0232350 | 3300048921 | Bacteria | 1063 |
| 967 | Ga0496119_0071155 | 3300048922 | Bacteria | 2037 |
| 968 | Ga0496120_0014398 | 3300048923 | Bacteria | 5275 |
| 969 | Ga0496120_0032697 | 3300048923 | Bacteria | 3134 |
| 970 | Ga0496120_0423439 | 3300048923 | Bacteria | 584 |
| 971 | Ga0496121_0000555 | 3300048924 | Bacteria | 70509 |
| 972 | Ga0496121_0001104 | 3300048924 | Bacteria | 47564 |
| 973 | Ga0496121_0004417 | 3300048924 | Bacteria | 18940 |
| 974 | Ga0496121_0006145 | 3300048924 | Bacteria | 15075 |
| 975 | Ga0496121_0008758 | 3300048924 | Bacteria | 11804 |
| 976 | Ga0496121_0030175 | 3300048924 | Bacteria | 4986 |
| 977 | Ga0496121_0088762 | 3300048924 | Bacteria | 2423 |
| 978 | Ga0496121_0093652 | 3300048924 | Bacteria | 2338 |
| 979 | Ga0496121_0101048 | 3300048924 | Bacteria | 2225 |
| 980 | Ga0496121_0104189 | 3300048924 | Bacteria | 2180 |
| 981 | Ga0496121_0111552 | 3300048924 | Bacteria | 2085 |
| 982 | Ga0496121_0121837 | 3300048924 | Bacteria | 1968 |
| 983 | Ga0496121_0135368 | 3300048924 | Bacteria | 1836 |
| 984 | Ga0496121_0140641 | 3300048924 | Bacteria | 1791 |
| 985 | Ga0496121_0185157 | 3300048924 | Bacteria | 1498 |
| 986 | Ga0496121_0293576 | 3300048924 | Bacteria | 1106 |
| 987 | Ga0496121_0411354 | 3300048924 | Bacteria | 883 |
| 988 | Ga0496121_0468864 | 3300048924 | Bacteria | 807 |
| 989 | Ga0496121_0571984 | 3300048924 | Bacteria | 703 |
| 990 | Ga0496122_0093358 | 3300048925 | Bacteria | 2041 |
| 991 | Ga0496122_0220033 | 3300048925 | Bacteria | 1090 |
| 992 | Ga0496124_0003672 | 3300048927 | Bacteria | 18556 |
| 993 | Ga0496124_0155574 | 3300048927 | Bacteria | 1788 |
| 994 | Ga0496124_0210764 | 3300048927 | Bacteria | 1470 |
| 995 | Ga0496124_0348767 | 3300048927 | Bacteria | 1048 |
| 996 | Ga0496124_0444985 | 3300048927 | Bacteria | 885 |
| 997 | Ga0496125_0008907 | 3300048928 | Bacteria | 10422 |
| 998 | Ga0496125_0013241 | 3300048928 | Bacteria | 8120 |
| 999 | Ga0496125_0044576 | 3300048928 | Bacteria | 3748 |
| 1000 | Ga0496125_0397670 | 3300048928 | Bacteria | 806 |
| 1001 | Ga0496126_0006275 | 3300048929 | Bacteria | 13277 |
| 1002 | Ga0496126_0009900 | 3300048929 | Bacteria | 10072 |
| 1003 | Ga0496126_0020393 | 3300048929 | Bacteria | 6500 |
| 1004 | Ga0496126_0023944 | 3300048929 | Bacteria | 5904 |
| 1005 | Ga0496126_0055111 | 3300048929 | Bacteria | 3598 |
| 1006 | Ga0496126_0063893 | 3300048929 | Bacteria | 3298 |
| 1007 | Ga0496126_0107344 | 3300048929 | Bacteria | 2435 |
| 1008 | Ga0496126_0138204 | 3300048929 | Bacteria | 2099 |
| 1009 | Ga0496126_0367815 | 3300048929 | Bacteria | 1173 |
| 1010 | Ga0496126_0392351 | 3300048929 | Bacteria | 1128 |
| 1011 | Ga0495678_052183 | 3300049459 | Bacteria | 1576 |
| 1012 | Ga0495678_070390 | 3300049459 | Bacteria | 1284 |
| 1013 | Ga0495682_0044230 | 3300049460 | Bacteria | 1629 |
| 1014 | Ga0495682_0147443 | 3300049460 | Bacteria | 840 |
| 1015 | Ga0501031_0000823 | 3300049568 | Bacteria | 18677 |
| 1016 | Ga0501031_0008998 | 3300049568 | Bacteria | 6497 |
| 1017 | Ga0501031_0088622 | 3300049568 | Bacteria | 2018 |
| 1018 | Ga0501031_0119769 | 3300049568 | Bacteria | 1719 |
| 1019 | Ga0501031_0361128 | 3300049568 | Bacteria | 940 |
| 1020 | Ga0501032_0000030 | 3300049569 | Bacteria | 130405 |
| 1021 | Ga0501032_0176280 | 3300049569 | Bacteria | 1400 |
| 1022 | Ga0501032_0342406 | 3300049569 | Bacteria | 963 |
| 1023 | Ga0501033_0000060 | 3300049570 | Bacteria | 103159 |
| 1024 | Ga0501033_0034480 | 3300049570 | Bacteria | 3796 |
| 1025 | Ga0501033_0206092 | 3300049570 | Bacteria | 1403 |
| 1026 | Ga0501033_0294131 | 3300049570 | Bacteria | 1144 |
| 1027 | Ga0501033_0298496 | 3300049570 | Bacteria | 1134 |
| 1028 | Ga0501034_0000117 | 3300049571 | Bacteria | 144865 |
| 1029 | Ga0501034_0042839 | 3300049571 | Bacteria | 4582 |
| 1030 | Ga0501034_0141891 | 3300049571 | Bacteria | 2381 |
| 1031 | Ga0501034_0149676 | 3300049571 | Bacteria | 2310 |
| 1032 | Ga0501034_0176446 | 3300049571 | Bacteria | 2103 |
| 1033 | Ga0501034_0180341 | 3300049571 | Bacteria | 2077 |
| 1034 | Ga0501034_0214822 | 3300049571 | Bacteria | 1878 |
| 1035 | Ga0501034_0225737 | 3300049571 | Bacteria | 1824 |
| 1036 | Ga0501034_0229035 | 3300049571 | Bacteria | 1808 |
| 1037 | Ga0501034_0632136 | 3300049571 | Bacteria | 973 |
| 1038 | Ga0501034_0890012 | 3300049571 | Bacteria | 779 |
| 1039 | Ga0501034_1147853 | 3300049571 | Bacteria | 657 |
| 1040 | Ga0501036_0000148 | 3300049572 | Bacteria | 45613 |
| 1041 | Ga0501036_0081074 | 3300049572 | Bacteria | 2742 |
| 1042 | Ga0501036_0082295 | 3300049572 | Bacteria | 2720 |
| 1043 | Ga0501036_0109857 | 3300049572 | Bacteria | 2330 |
| 1044 | Ga0501036_0429129 | 3300049572 | Bacteria | 1102 |
| 1045 | Ga0501036_0473214 | 3300049572 | Bacteria | 1043 |
| 1046 | Ga0501036_0665530 | 3300049572 | Bacteria | 861 |
| 1047 | Ga0501036_1090023 | 3300049572 | Bacteria | 652 |
| 1048 | Ga0501037_0000090 | 3300049573 | Bacteria | 85021 |
| 1049 | Ga0501037_0021843 | 3300049573 | Bacteria | 4736 |
| 1050 | Ga0501037_0024322 | 3300049573 | Bacteria | 4479 |
| 1051 | Ga0501037_0238013 | 3300049573 | Bacteria | 1276 |
| 1052 | Ga0501037_0273468 | 3300049573 | Bacteria | 1178 |
| 1053 | Ga0501037_0506433 | 3300049573 | Bacteria | 818 |
| 1054 | Ga0501038_0000441 | 3300049574 | Bacteria | 36178 |
| 1055 | Ga0501038_0017412 | 3300049574 | Bacteria | 6495 |
| 1056 | Ga0501038_0080180 | 3300049574 | Bacteria | 2751 |
| 1057 | Ga0501038_0139211 | 3300049574 | Bacteria | 1987 |
| 1058 | Ga0501038_0481086 | 3300049574 | Bacteria | 951 |
| 1059 | Ga0501038_0635107 | 3300049574 | Bacteria | 805 |
| 1060 | Ga0501038_0892041 | 3300049574 | Bacteria | 657 |
| 1061 | Ga0501039_0000443 | 3300049575 | Bacteria | 30068 |
| 1062 | Ga0501039_0031373 | 3300049575 | Bacteria | 4096 |
| 1063 | Ga0501039_0168611 | 3300049575 | Bacteria | 1721 |
| 1064 | Ga0501039_0272219 | 3300049575 | Bacteria | 1331 |
| 1065 | Ga0501040_0538541 | 3300049576 | Bacteria | 842 |
| 1066 | Ga0501040_0753248 | 3300049576 | Bacteria | 704 |
| 1067 | Ga0501041_0109087 | 3300049577 | Bacteria | 1717 |
| 1068 | Ga0501042_0006690 | 3300049578 | Bacteria | 7509 |
| 1069 | Ga0501042_0011206 | 3300049578 | Bacteria | 6041 |
| 1070 | Ga0501042_0088649 | 3300049578 | Bacteria | 2220 |
| 1071 | Ga0501042_0122191 | 3300049578 | Bacteria | 1875 |
| 1072 | Ga0501042_0297606 | 3300049578 | Bacteria | 1166 |
| 1073 | Ga0501043_0000919 | 3300049579 | Bacteria | 26107 |
| 1074 | Ga0501043_0024179 | 3300049579 | Bacteria | 4767 |
| 1075 | Ga0501043_0027132 | 3300049579 | Bacteria | 4496 |
| 1076 | Ga0501043_0051850 | 3300049579 | Bacteria | 3224 |
| 1077 | Ga0501043_0070998 | 3300049579 | Bacteria | 2735 |
| 1078 | Ga0501046_0000214 | 3300049580 | Bacteria | 60379 |
| 1079 | Ga0501046_0412349 | 3300049580 | Bacteria | 974 |
| 1080 | Ga0501047_0000571 | 3300049581 | Bacteria | 39243 |
| 1081 | Ga0501047_0008142 | 3300049581 | Bacteria | 9895 |
| 1082 | Ga0501047_0054534 | 3300049581 | Bacteria | 3866 |
| 1083 | Ga0501047_0143269 | 3300049581 | Bacteria | 2267 |
| 1084 | Ga0501047_0339908 | 3300049581 | Bacteria | 1339 |
| 1085 | Ga0501047_0364450 | 3300049581 | Bacteria | 1280 |
| 1086 | Ga0501047_0407940 | 3300049581 | Bacteria | 1191 |
| 1087 | Ga0501048_0000563 | 3300049582 | Bacteria | 26308 |
| 1088 | Ga0501048_0077663 | 3300049582 | Bacteria | 2343 |
| 1089 | Ga0501048_0089334 | 3300049582 | Bacteria | 2173 |
| 1090 | Ga0501048_0378902 | 3300049582 | Bacteria | 1010 |
| 1091 | Ga0501048_0605888 | 3300049582 | Bacteria | 786 |
| 1092 | Ga0501048_0861283 | 3300049582 | Bacteria | 651 |
| 1093 | Ga0501067_0001731 | 3300049583 | Bacteria | 12000 |
| 1094 | Ga0501067_0002121 | 3300049583 | Bacteria | 10918 |
| 1095 | Ga0501067_0044658 | 3300049583 | Bacteria | 2461 |
| 1096 | Ga0501067_0064718 | 3300049583 | Bacteria | 2024 |
| 1097 | Ga0501067_0065370 | 3300049583 | Bacteria | 2013 |
| 1098 | Ga0501067_0068385 | 3300049583 | Bacteria | 1966 |
| 1099 | Ga0501068_0002870 | 3300049584 | Bacteria | 9175 |
| 1100 | Ga0501068_0012451 | 3300049584 | Bacteria | 4824 |
| 1101 | Ga0501068_0324073 | 3300049584 | Bacteria | 988 |
| 1102 | Ga0501068_0477906 | 3300049584 | Bacteria | 807 |
| 1103 | Ga0501069_0013605 | 3300049585 | Bacteria | 4339 |
| 1104 | Ga0501069_0033968 | 3300049585 | Bacteria | 2809 |
| 1105 | Ga0501069_0211789 | 3300049585 | Bacteria | 1125 |
| 1106 | Ga0501069_0452105 | 3300049585 | Bacteria | 763 |
| 1107 | Ga0501070_0003380 | 3300049586 | Bacteria | 13841 |
| 1108 | Ga0501070_0003669 | 3300049586 | Bacteria | 13268 |
| 1109 | Ga0501070_0011392 | 3300049586 | Bacteria | 7515 |
| 1110 | Ga0501070_0102800 | 3300049586 | Bacteria | 2363 |
| 1111 | Ga0501070_0218363 | 3300049586 | Bacteria | 1564 |
| 1112 | Ga0501070_0248133 | 3300049586 | Bacteria | 1456 |
| 1113 | Ga0501070_0270857 | 3300049586 | Bacteria | 1387 |
| 1114 | Ga0501070_0283144 | 3300049586 | Bacteria | 1352 |
| 1115 | Ga0501070_0336040 | 3300049586 | Bacteria | 1227 |
| 1116 | Ga0501070_0550640 | 3300049586 | Bacteria | 923 |
| 1117 | Ga0501071_0009025 | 3300049587 | Bacteria | 6619 |
| 1118 | Ga0501071_0035767 | 3300049587 | Bacteria | 3539 |
| 1119 | Ga0501071_0079802 | 3300049587 | Bacteria | 2393 |
| 1120 | Ga0501071_0167798 | 3300049587 | Bacteria | 1643 |
| 1121 | Ga0501072_0003654 | 3300049588 | Bacteria | 11588 |
| 1122 | Ga0501072_0011728 | 3300049588 | Bacteria | 6696 |
| 1123 | Ga0501072_0180631 | 3300049588 | Bacteria | 1683 |
| 1124 | Ga0501073_0000203 | 3300049589 | Bacteria | 39315 |
| 1125 | Ga0501073_0011409 | 3300049589 | Bacteria | 6502 |
| 1126 | Ga0501073_0026397 | 3300049589 | Bacteria | 4162 |
| 1127 | Ga0501073_0038233 | 3300049589 | Bacteria | 3405 |
| 1128 | Ga0501073_0128939 | 3300049589 | Bacteria | 1753 |
| 1129 | Ga0501073_0145316 | 3300049589 | Bacteria | 1643 |
| 1130 | Ga0501073_0510186 | 3300049589 | Bacteria | 831 |
| 1131 | Ga0501073_0560138 | 3300049589 | Bacteria | 790 |
| 1132 | Ga0501074_0011327 | 3300049590 | Bacteria | 6483 |
| 1133 | Ga0501074_0017548 | 3300049590 | Bacteria | 5195 |
| 1134 | Ga0501074_0070618 | 3300049590 | Bacteria | 2510 |
| 1135 | Ga0501074_0257765 | 3300049590 | Bacteria | 1240 |
| 1136 | Ga0501074_0289819 | 3300049590 | Bacteria | 1163 |
| 1137 | Ga0501076_0029209 | 3300049592 | Bacteria | 4287 |
| 1138 | Ga0501076_0040338 | 3300049592 | Bacteria | 3669 |
| 1139 | Ga0501076_0093360 | 3300049592 | Bacteria | 2422 |
| 1140 | Ga0501076_0201144 | 3300049592 | Bacteria | 1627 |
| 1141 | Ga0501077_0018802 | 3300049593 | Bacteria | 4372 |
| 1142 | Ga0501077_0036684 | 3300049593 | Bacteria | 3124 |
| 1143 | Ga0501257_227293 | 3300049686 | Bacteria | 546 |
| 1144 | Ga0501079_0001971 | 3300049741 | Bacteria | 14716 |
| 1145 | Ga0501079_0071756 | 3300049741 | Bacteria | 2675 |
| 1146 | Ga0501079_0395243 | 3300049741 | Bacteria | 1084 |
| 1147 | Ga0501080_0002834 | 3300049742 | Bacteria | 15237 |
| 1148 | Ga0501080_0004629 | 3300049742 | Bacteria | 12260 |
| 1149 | Ga0501080_0040087 | 3300049742 | Bacteria | 4370 |
| 1150 | Ga0501080_0093992 | 3300049742 | Bacteria | 2784 |
| 1151 | Ga0501080_0121335 | 3300049742 | Bacteria | 2422 |
| 1152 | Ga0501080_0133416 | 3300049742 | Bacteria | 2299 |
| 1153 | Ga0501080_0161611 | 3300049742 | Bacteria | 2068 |
| 1154 | Ga0501081_0566327 | 3300049743 | Bacteria | 849 |
| 1155 | Ga0501083_0000539 | 3300049744 | Bacteria | 24199 |
| 1156 | Ga0501083_0003563 | 3300049744 | Bacteria | 10910 |
| 1157 | Ga0501083_0018195 | 3300049744 | Bacteria | 4897 |
| 1158 | Ga0501083_0387532 | 3300049744 | Bacteria | 909 |
| 1159 | Ga0501083_0636525 | 3300049744 | Bacteria | 694 |
| 1160 | Ga0501083_0753101 | 3300049744 | Bacteria | 634 |
| 1161 | Ga0501035_0000212 | 3300049822 | Bacteria | 69856 |
| 1162 | Ga0501035_0043346 | 3300049822 | Bacteria | 4055 |
| 1163 | Ga0501035_0086552 | 3300049822 | Bacteria | 2761 |
| 1164 | Ga0501035_0120004 | 3300049822 | Bacteria | 2299 |
| 1165 | Ga0501035_0958770 | 3300049822 | Bacteria | 674 |
| 1166 | Ga0501044_0000304 | 3300049823 | Bacteria | 61877 |
| 1167 | Ga0501044_0008608 | 3300049823 | Bacteria | 11172 |
| 1168 | Ga0501044_0026748 | 3300049823 | Bacteria | 6104 |
| 1169 | Ga0501044_0065215 | 3300049823 | Bacteria | 3714 |
| 1170 | Ga0501044_0108222 | 3300049823 | Bacteria | 2790 |
| 1171 | Ga0501044_0141992 | 3300049823 | Bacteria | 2389 |
| 1172 | Ga0501044_0202168 | 3300049823 | Bacteria | 1944 |
| 1173 | Ga0501044_0305203 | 3300049823 | Bacteria | 1519 |
| 1174 | Ga0501044_0689653 | 3300049823 | Bacteria | 907 |
| 1175 | Ga0501044_0689710 | 3300049823 | Bacteria | 907 |
| 1176 | Ga0501044_1069585 | 3300049823 | Bacteria | 677 |
| 1177 | Ga0501045_0006869 | 3300049824 | Bacteria | 7885 |
| 1178 | Ga0501045_0055821 | 3300049824 | Bacteria | 2888 |
| 1179 | Ga0501045_0132885 | 3300049824 | Bacteria | 1850 |
| 1180 | nmdc:mga03n38_12816_c1 | 3300050490 | Bacteria | 3167 |
| 1181 | nmdc:mga03n38_237305_c1 | 3300050490 | Bacteria | 958 |
| 1182 | nmdc:mga00v17_256673_c1 | 3300050491 | Bacteria | 1134 |
| 1183 | nmdc:mga00v17_36882_c1 | 3300050491 | Bacteria | 2529 |
| 1184 | nmdc:mga0yw44_15471_c1 | 3300050492 | Bacteria | 4089 |
| 1185 | nmdc:mga0yw44_158281_c1 | 3300050492 | Bacteria | 1482 |
| 1186 | nmdc:mga0k408_142534_c1 | 3300050493 | Bacteria | 1426 |
| 1187 | nmdc:mga0k408_255565_c1 | 3300050493 | Bacteria | 1046 |
| 1188 | nmdc:mga0k408_282596_c1 | 3300050493 | Bacteria | 991 |
| 1189 | nmdc:mga06z11_113072_c1 | 3300050494 | Bacteria | 1506 |
| 1190 | nmdc:mga06z11_122364_c1 | 3300050494 | Bacteria | 1453 |
| 1191 | nmdc:mga06z11_37411_c1 | 3300050494 | Bacteria | 2403 |
| 1192 | nmdc:mga06z11_414367_c1 | 3300050494 | Bacteria | 812 |
| 1193 | nmdc:mga06z11_93972_c1 | 3300050494 | Bacteria | 1633 |
| 1194 | nmdc:mga07m45_314263_c1 | 3300050496 | Bacteria | 911 |
| 1195 | nmdc:mga07m45_389335_c1 | 3300050496 | Bacteria | 809 |
| 1196 | nmdc:mga05p37_120308_c1 | 3300050507 | Bacteria | 3226 |
| 1197 | nmdc:mga05p37_1257441_c1 | 3300050507 | Bacteria | 759 |
| 1198 | nmdc:mga05p37_148209_c1 | 3300050507 | Bacteria | 2872 |
| 1199 | nmdc:mga05p37_743_c1 | 3300050507 | Bacteria | 36122 |
| 1200 | nmdc:mga09592_229157_c1 | 3300050508 | Bacteria | 1609 |
| 1201 | nmdc:mga09592_781_c1 | 3300050508 | Bacteria | 24612 |
| 1202 | nmdc:mga0qj67_1023009_c1 | 3300050509 | Bacteria | 647 |
| 1203 | nmdc:mga0qj67_72223_c1 | 3300050509 | Bacteria | 2755 |
| 1204 | nmdc:mga06r32_19037_c1 | 3300050510 | Bacteria | 6295 |
| 1205 | nmdc:mga06r32_42216_c1 | 3300050510 | Bacteria | 4335 |
| 1206 | nmdc:mga06r32_56820_c1 | 3300050510 | Bacteria | 3757 |
| 1207 | nmdc:mga08y16_121_c1 | 3300050511 | Bacteria | 67325 |
| 1208 | nmdc:mga08y16_92319_c1 | 3300050511 | Bacteria | 3155 |
| 1209 | nmdc:mga0n895_125054_c1 | 3300050512 | Bacteria | 2595 |
| 1210 | nmdc:mga0n895_14611_c1 | 3300050512 | Bacteria | 7137 |
| 1211 | nmdc:mga0n895_20587_c1 | 3300050512 | Bacteria | 6154 |
| 1212 | nmdc:mga0rr50_394913_c1 | 3300050513 | Bacteria | 1168 |
| 1213 | nmdc:mga0rr50_560776_c1 | 3300050513 | Bacteria | 973 |
| 1214 | nmdc:mga0a205_172488_c1 | 3300050515 | Bacteria | 2059 |
| 1215 | nmdc:mga0sz30_244485_c1 | 3300050516 | Bacteria | 799 |
| 1216 | Ga0495601_0022366 | 3300053077 | Bacteria | 3880 |
| 1217 | Ga0495601_0148848 | 3300053077 | Bacteria | 1528 |
| 1218 | Ga0495601_0185190 | 3300053077 | Bacteria | 1361 |
| 1219 | Ga0495612_0008523 | 3300053078 | Bacteria | 4159 |
| 1220 | Ga0495612_0266555 | 3300053078 | Bacteria | 764 |
| 1221 | Ga0500635_0008274 | 3300053080 | Bacteria | 2845 |
| 1222 | Ga0500635_0037941 | 3300053080 | Bacteria | 1596 |
| 1223 | Ga0495655_0147691 | 3300053083 | Bacteria | 737 |
| 1224 | Ga0495595_0152806 | 3300053084 | Bacteria | 1136 |
| 1225 | Ga0495619_0187299 | 3300053085 | Bacteria | 1432 |
| 1226 | Ga0495619_0240422 | 3300053085 | Bacteria | 1255 |
| 1227 | Ga0495619_0289653 | 3300053085 | Bacteria | 1134 |
| 1228 | Ga0495619_0352108 | 3300053085 | Bacteria | 1019 |
| 1229 | Ga0495619_0450690 | 3300053085 | Bacteria | 887 |
| 1230 | Ga0500644_0203026 | 3300053088 | Bacteria | 820 |
| 1231 | Ga0500581_120380 | 3300053089 | Bacteria | 1268 |
| 1232 | Ga0500646_0180263 | 3300053090 | Bacteria | 715 |
| 1233 | Ga0500647_0071120 | 3300053091 | Bacteria | 1672 |
| 1234 | Ga0500583_0072186 | 3300053092 | Bacteria | 1652 |
| 1235 | Ga0500651_0213026 | 3300053093 | Bacteria | 1135 |
| 1236 | Ga0500566_0000197 | 3300053094 | Bacteria | 31582 |
| 1237 | Ga0500566_0007746 | 3300053094 | Bacteria | 6369 |
| 1238 | Ga0500566_0074079 | 3300053094 | Bacteria | 1907 |
| 1239 | Ga0500566_0130342 | 3300053094 | Bacteria | 1346 |
| 1240 | Ga0500640_000151 | 3300053095 | Bacteria | 13660 |
| 1241 | Ga0500641_0037558 | 3300053096 | Bacteria | 1942 |
| 1242 | Ga0500654_136382 | 3300053099 | Bacteria | 911 |
| 1243 | Ga0500555_039672 | 3300053103 | Bacteria | 1314 |
| 1244 | Ga0500556_0000045 | 3300053104 | Bacteria | 130653 |
| 1245 | Ga0500556_0044468 | 3300053104 | Bacteria | 1580 |
| 1246 | Ga0500562_091721 | 3300053108 | Bacteria | 824 |
| 1247 | Ga0500569_019436 | 3300053109 | Bacteria | 1767 |
| 1248 | Ga0500572_000154 | 3300053111 | Bacteria | 23771 |
| 1249 | Ga0500572_000578 | 3300053111 | Bacteria | 12448 |
| 1250 | Ga0500591_083881 | 3300053115 | Bacteria | 1409 |
| 1251 | Ga0500592_000586 | 3300053116 | Bacteria | 5971 |
| 1252 | Ga0500592_009040 | 3300053116 | Bacteria | 1582 |
| 1253 | Ga0500593_003188 | 3300053117 | Bacteria | 6151 |
| 1254 | Ga0500593_096486 | 3300053117 | Bacteria | 1241 |
| 1255 | Ga0500594_0082810 | 3300053118 | Bacteria | 962 |
| 1256 | Ga0500595_002082 | 3300053119 | Bacteria | 10231 |
| 1257 | Ga0500595_002732 | 3300053119 | Bacteria | 8537 |
| 1258 | Ga0500595_018178 | 3300053119 | Bacteria | 2576 |
| 1259 | Ga0500597_115245 | 3300053120 | Bacteria | 1166 |
| 1260 | Ga0500607_045000 | 3300053121 | Bacteria | 2371 |
| 1261 | Ga0500608_007213 | 3300053122 | Bacteria | 4582 |
| 1262 | Ga0500608_011405 | 3300053122 | Bacteria | 3858 |
| 1263 | Ga0500614_001112 | 3300053123 | Bacteria | 6631 |
| 1264 | Ga0500618_012229 | 3300053125 | Bacteria | 2251 |
| 1265 | Ga0500621_104479 | 3300053126 | Bacteria | 1114 |
| 1266 | Ga0500621_246260 | 3300053126 | Bacteria | 603 |
| 1267 | Ga0500628_015616 | 3300053129 | Bacteria | 1455 |
| 1268 | Ga0500642_0000024 | 3300053130 | Bacteria | 134373 |
| 1269 | Ga0500642_0266028 | 3300053130 | Bacteria | 783 |
| 1270 | Ga0500652_000356 | 3300053131 | Bacteria | 16417 |
| 1271 | Ga0500658_0144026 | 3300053134 | Bacteria | 1070 |
| 1272 | Ga0500658_0426328 | 3300053134 | Bacteria | 605 |
| 1273 | Ga0500658_0447432 | 3300053134 | Bacteria | 588 |
| 1274 | Ga0500559_0000051 | 3300053136 | Bacteria | 91468 |
| 1275 | Ga0500559_0001682 | 3300053136 | Bacteria | 12198 |
| 1276 | Ga0500559_0064120 | 3300053136 | Bacteria | 1643 |
| 1277 | Ga0500559_0152765 | 3300053136 | Bacteria | 1084 |
| 1278 | Ga0500559_0202067 | 3300053136 | Bacteria | 937 |
| 1279 | Ga0500568_0000456 | 3300053139 | Bacteria | 30484 |
| 1280 | Ga0500577_0000189 | 3300053142 | Bacteria | 16154 |
| 1281 | Ga0500577_0057994 | 3300053142 | Bacteria | 1479 |
| 1282 | Ga0500586_007803 | 3300053145 | Bacteria | 2877 |
| 1283 | Ga0500588_0125490 | 3300053146 | Bacteria | 909 |
| 1284 | Ga0500589_213218 | 3300053147 | Bacteria | 732 |
| 1285 | Ga0500590_035413 | 3300053148 | Bacteria | 2584 |
| 1286 | Ga0500590_229305 | 3300053148 | Bacteria | 758 |
| 1287 | Ga0500603_000220 | 3300053150 | Bacteria | 15043 |
| 1288 | Ga0500603_016023 | 3300053150 | Bacteria | 1773 |
| 1289 | Ga0500603_030295 | 3300053150 | Bacteria | 1392 |
| 1290 | Ga0500604_0066594 | 3300053151 | Bacteria | 1141 |
| 1291 | Ga0500604_0183544 | 3300053151 | Bacteria | 717 |
| 1292 | Ga0500616_0000048 | 3300053153 | Bacteria | 313108 |
| 1293 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 1294 | Ga0500619_003777 | 3300053154 | Bacteria | 3156 |
| 1295 | Ga0500619_162516 | 3300053154 | Bacteria | 758 |
| 1296 | Ga0500622_0000714 | 3300053156 | Bacteria | 29050 |
| 1297 | Ga0500627_0064431 | 3300053158 | Bacteria | 1616 |
| 1298 | Ga0500630_024760 | 3300053159 | Bacteria | 2964 |
| 1299 | Ga0500634_0174604 | 3300053161 | Bacteria | 974 |
| 1300 | Ga0500638_041577 | 3300053162 | Bacteria | 2232 |
| 1301 | Ga0500638_093892 | 3300053162 | Bacteria | 1409 |
| 1302 | Ga0500638_151176 | 3300053162 | Bacteria | 1032 |
| 1303 | Ga0500639_000007 | 3300053163 | Bacteria | 152350 |
| 1304 | Ga0500639_053902 | 3300053163 | Bacteria | 2091 |
| 1305 | Ga0500636_0009096 | 3300053177 | Bacteria | 5772 |
| 1306 | Ga0500636_0023576 | 3300053177 | Bacteria | 3638 |
| 1307 | Ga0500637_0014529 | 3300053178 | Bacteria | 4153 |
| 1308 | Ga0500637_0085137 | 3300053178 | Bacteria | 1828 |
| 1309 | Ga0500637_0092471 | 3300053178 | Bacteria | 1752 |
| 1310 | Ga0500637_0114303 | 3300053178 | Bacteria | 1565 |
| 1311 | Ga0500567_040424 | 3300053723 | Bacteria | 2177 |
| 1312 | Ga0500657_081540 | 3300053728 | Bacteria | 1388 |
| 1313 | Ga0500645_027646 | 3300053730 | Bacteria | 1719 |
| 1314 | Ga0500645_156789 | 3300053730 | Bacteria | 625 |
| 1315 | Ga0500609_039019 | 3300053731 | Bacteria | 656 |
| 1316 | Ga0500656_010517 | 3300053732 | Bacteria | 1013 |
| 1317 | Ga0500552_008739 | 3300053733 | Bacteria | 1203 |
| 1318 | Ga0500596_000345 | 3300053735 | Bacteria | 8331 |
| 1319 | Ga0500596_005002 | 3300053735 | Bacteria | 2374 |
| 1320 | Ga0500601_002395 | 3300053737 | Bacteria | 2015 |
| 1321 | Ga0501084_0005904 | 3300054114 | Bacteria | 10082 |
| 1322 | Ga0501084_0007519 | 3300054114 | Bacteria | 8982 |
| 1323 | Ga0501084_0158623 | 3300054114 | Bacteria | 1909 |
| 1324 | Ga0501084_0232542 | 3300054114 | Bacteria | 1556 |
| 1325 | Ga0501084_0299553 | 3300054114 | Bacteria | 1358 |
| 1326 | Ga0501084_0587127 | 3300054114 | Bacteria | 941 |
| 1327 | Ga0501082_0006039 | 3300060353 | Bacteria | 10506 |
| 1328 | Ga0501082_0018603 | 3300060353 | Bacteria | 5988 |
| 1329 | Ga0501082_0078180 | 3300060353 | Bacteria | 2853 |
| 1330 | Ga0501082_0089798 | 3300060353 | Bacteria | 2653 |
| 1331 | Ga0501082_0105333 | 3300060353 | Bacteria | 2440 |
| 1332 | Ga0501082_0118302 | 3300060353 | Bacteria | 2295 |
| 1333 | Ga0501082_0570848 | 3300060353 | Bacteria | 990 |
| 1334 | Ga0466962_0209875 | 3300061719 | Bacteria | 953 |
| 1335 | Ga0530510_0219546 | 3300061734 | Bacteria | 1413 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_20587_c1 | nmdc:mga0n895_20587_c1_1828_2316 | 139 |
| 2 | 3300007076 | Ga0075435_100105362 | Ga0075435_1001053623 | 140 |
| 3 | 3300050513 | nmdc:mga0rr50_394913_c1 | nmdc:mga0rr50_394913_c1_67_555 | 140 |
| 4 | 3300006944 | Ga0099823_1076226 | Ga0099823_10762262 | 147 |
| 5 | 3300005347 | Ga0070668_100000021 | Ga0070668_10000002149 | 148 |
| 6 | 3300005355 | Ga0070671_100000114 | Ga0070671_10000011411 | 148 |
| 7 | 3300005548 | Ga0070665_100185823 | Ga0070665_1001858232 | 148 |
| 8 | 3300005617 | Ga0068859_100016862 | Ga0068859_1000168624 | 148 |
| 9 | 3300005841 | Ga0068863_100000043 | Ga0068863_10000004350 | 148 |
| 10 | 3300005842 | Ga0068858_100586125 | Ga0068858_1005861251 | 148 |
| 11 | 3300005843 | Ga0068860_100112956 | Ga0068860_1001129563 | 148 |
| 12 | 3300005844 | Ga0068862_100183373 | Ga0068862_1001833732 | 148 |
| 13 | 3300006931 | Ga0097620_100016862 | Ga0097620_1000168624 | 148 |
| 14 | 3300009553 | Ga0105249_10003685 | Ga0105249_1000368512 | 148 |
| 15 | 3300025925 | Ga0207650_10184894 | Ga0207650_101848942 | 148 |
| 16 | 3300025931 | Ga0207644_10000077 | Ga0207644_1000007748 | 148 |
| 17 | 3300025961 | Ga0207712_10016901 | Ga0207712_100169012 | 148 |
| 18 | 3300025972 | Ga0207668_10000068 | Ga0207668_1000006849 | 148 |
| 19 | 3300026035 | Ga0207703_10541507 | Ga0207703_105415072 | 148 |
| 20 | 3300026088 | Ga0207641_10000031 | Ga0207641_1000003153 | 148 |
| 21 | 3300028379 | Ga0268266_10146697 | Ga0268266_101466972 | 148 |
| 22 | 3300028380 | Ga0268265_10153392 | Ga0268265_101533922 | 148 |
| 23 | 3300028381 | Ga0268264_10408066 | Ga0268264_104080662 | 148 |
| 24 | 3300044735 | Ga0466968_0156600 | Ga0466968_0156600_419_964 | 148 |
| 25 | 3300048918 | Ga0496115_0263871 | Ga0496115_0263871_104_625 | 149 |
| 26 | 3300013308 | Ga0157375_10479866 | Ga0157375_104798662 | 150 |
| 27 | 3300044683 | Ga0466965_0076980 | Ga0466965_0076980_91_657 | 151 |
| 28 | 3300044765 | Ga0466970_0250436 | Ga0466970_0250436_287_853 | 151 |
| 29 | 3300046454 | Ga0495592_0127679 | Ga0495592_0127679_219_785 | 151 |
| 30 | 3300046462 | Ga0495651_0028221 | Ga0495651_0028221_1002_1568 | 151 |
| 31 | 3300046463 | Ga0495653_0046358 | Ga0495653_0046358_1040_1606 | 151 |
| 32 | 3300046477 | Ga0495664_0071811 | Ga0495664_0071811_922_1488 | 151 |
| 33 | 3300046511 | Ga0495608_0017629 | Ga0495608_0017629_3249_3815 | 151 |
| 34 | 3300046529 | Ga0495652_0029766 | Ga0495652_0029766_2335_2901 | 151 |
| 35 | 3300046559 | Ga0495667_0007414 | Ga0495667_0007414_3355_3921 | 151 |
| 36 | 3300046642 | Ga0495634_0082039 | Ga0495634_0082039_876_1442 | 151 |
| 37 | 3300046663 | Ga0495635_0082927 | Ga0495635_0082927_649_1215 | 151 |
| 38 | 3300046675 | Ga0495657_0012557 | Ga0495657_0012557_1786_2352 | 151 |
| 39 | 3300046678 | Ga0495599_0006131 | Ga0495599_0006131_5060_5626 | 151 |
| 40 | 3300046679 | Ga0495623_0071781 | Ga0495623_0071781_864_1430 | 151 |
| 41 | 3300046680 | Ga0495646_0288982 | Ga0495646_0288982_208_774 | 151 |
| 42 | 3300046809 | Ga0495600_0027672 | Ga0495600_0027672_1796_2362 | 151 |
| 43 | 3300047317 | Ga0495604_0012840 | Ga0495604_0012840_4775_5341 | 151 |
| 44 | 3300047322 | Ga0495680_0004790 | Ga0495680_0004790_8849_9415 | 151 |
| 45 | 3300047444 | Ga0495675_0025592 | Ga0495675_0025592_167_733 | 151 |
| 46 | 3300048088 | Ga0495602_0030319 | Ga0495602_0030319_2328_2894 | 151 |
| 47 | 3300050491 | nmdc:mga00v17_256673_c1 | nmdc:mga00v17_256673_c1_51_617 | 151 |
| 48 | 3300053085 | Ga0495619_0289653 | Ga0495619_0289653_49_615 | 151 |
| 49 | 3300009011 | Ga0105251_10530976 | Ga0105251_105309761 | 152 |
| 50 | 3300031247 | Ga0265340_10179736 | Ga0265340_101797362 | 152 |
| 51 | 3300031249 | Ga0265339_10018045 | Ga0265339_100180454 | 152 |
| 52 | 3300031595 | Ga0265313_10011671 | Ga0265313_100116715 | 152 |
| 53 | 3300031712 | Ga0265342_10319551 | Ga0265342_103195511 | 152 |
| 54 | 3300039453 | Ga0436362_0544940 | Ga0436362_0544940_164_751 | 152 |
| 55 | 3300005983 | Ga0081540_1069601 | Ga0081540_10696012 | 153 |
| 56 | 3300026116 | Ga0207674_10866228 | Ga0207674_108662282 | 153 |
| 57 | 3300035092 | Ga0373952_0089337 | Ga0373952_0089337_134_622 | 153 |
| 58 | 3300005548 | Ga0070665_101409716 | Ga0070665_1014097162 | 154 |
| 59 | 3300005563 | Ga0068855_100015668 | Ga0068855_1000156682 | 154 |
| 60 | 3300005577 | Ga0068857_100415707 | Ga0068857_1004157072 | 154 |
| 61 | 3300005614 | Ga0068856_100132569 | Ga0068856_1001325692 | 154 |
| 62 | 3300025900 | Ga0207710_10164795 | Ga0207710_101647951 | 154 |
| 63 | 3300025916 | Ga0207663_10286262 | Ga0207663_102862622 | 154 |
| 64 | 3300025919 | Ga0207657_10459632 | Ga0207657_104596322 | 154 |
| 65 | 3300025949 | Ga0207667_10012516 | Ga0207667_100125167 | 154 |
| 66 | 3300026078 | Ga0207702_10226868 | Ga0207702_102268682 | 154 |
| 67 | 3300035410 | Ga0373924_0264398 | Ga0373924_0264398_12_476 | 154 |
| 68 | 3300035692 | Ga0373935_0286650 | Ga0373935_0286650_685_1149 | 154 |
| 69 | 3300037853 | Ga0436364_1034666 | Ga0436364_1034666_174_671 | 154 |
| 70 | 3300041460 | Ga0451802_0893213 | Ga0451802_0893213_92_556 | 154 |
| 71 | 3300046512 | Ga0495610_0401834 | Ga0495610_0401834_10_474 | 154 |
| 72 | 3300046530 | Ga0495654_0175175 | Ga0495654_0175175_21_485 | 154 |
| 73 | 3300046689 | Ga0495613_0053582 | Ga0495613_0053582_2490_2954 | 154 |
| 74 | 3300048903 | Ga0496100_0844897 | Ga0496100_0844897_20_484 | 154 |
| 75 | 3300048914 | Ga0496111_0358751 | Ga0496111_0358751_10_474 | 154 |
| 76 | 3300049460 | Ga0495682_0044230 | Ga0495682_0044230_23_487 | 154 |
| 77 | 3300049568 | Ga0501031_0008998 | Ga0501031_0008998_2519_3016 | 154 |
| 78 | 3300049578 | Ga0501042_0122191 | Ga0501042_0122191_1324_1821 | 154 |
| 79 | 3300049585 | Ga0501069_0211789 | Ga0501069_0211789_19_483 | 154 |
| 80 | 3300049742 | Ga0501080_0133416 | Ga0501080_0133416_202_699 | 154 |
| 81 | 3300049824 | Ga0501045_0132885 | Ga0501045_0132885_265_762 | 154 |
| 82 | 3300053108 | Ga0500562_091721 | Ga0500562_091721_11_475 | 154 |
| 83 | 3300060353 | Ga0501082_0118302 | Ga0501082_0118302_1115_1612 | 154 |
| 84 | 3300006048 | Ga0075363_100696742 | Ga0075363_1006967421 | 155 |
| 85 | 3300046477 | Ga0495664_0147893 | Ga0495664_0147893_34_522 | 155 |
| 86 | 3300050510 | nmdc:mga06r32_42216_c1 | nmdc:mga06r32_42216_c1_464_1006 | 155 |
| 87 | 3300053730 | Ga0500645_156789 | Ga0500645_156789_136_612 | 155 |
| 88 | iso_pu_bacteria | 2513237087 | 2513591701 | 155 |
| 89 | iso_pu_bacteria | 8056673599 | 8056675429 | 155 |
| 90 | 3300005937 | Ga0081455_10487484 | Ga0081455_104874842 | 156 |
| 91 | 3300009545 | Ga0105237_10450674 | Ga0105237_104506742 | 156 |
| 92 | 3300025914 | Ga0207671_10239703 | Ga0207671_102397032 | 156 |
| 93 | 3300005437 | Ga0070710_10033210 | Ga0070710_100332104 | 157 |
| 94 | 3300005439 | Ga0070711_100094377 | Ga0070711_1000943772 | 157 |
| 95 | 3300006173 | Ga0070716_100039631 | Ga0070716_1000396311 | 157 |
| 96 | 3300006175 | Ga0070712_100054123 | Ga0070712_1000541232 | 157 |
| 97 | 3300025898 | Ga0207692_10017119 | Ga0207692_100171195 | 157 |
| 98 | 3300025905 | Ga0207685_10037922 | Ga0207685_100379222 | 157 |
| 99 | 3300025906 | Ga0207699_10033995 | Ga0207699_100339954 | 157 |
| 100 | 3300025915 | Ga0207693_10080355 | Ga0207693_100803552 | 157 |
| 101 | 3300025916 | Ga0207663_10031403 | Ga0207663_100314032 | 157 |
| 102 | 3300025928 | Ga0207700_10139440 | Ga0207700_101394401 | 157 |
| 103 | 3300025939 | Ga0207665_10054081 | Ga0207665_100540815 | 157 |
| 104 | 3300037418 | Ga0395900_0694941 | Ga0395900_0694941_173_661 | 157 |
| 105 | 3300049573 | Ga0501037_0021843 | Ga0501037_0021843_1441_1929 | 157 |
| 106 | 3300049744 | Ga0501083_0753101 | Ga0501083_0753101_95_592 | 157 |
| 107 | 3300006175 | Ga0070712_100024690 | Ga0070712_1000246902 | 158 |
| 108 | 3300013297 | Ga0157378_11616201 | Ga0157378_116162011 | 158 |
| 109 | 3300014325 | Ga0163163_10846248 | Ga0163163_108462482 | 158 |
| 110 | 3300025915 | Ga0207693_10034329 | Ga0207693_100343293 | 158 |
| 111 | 3300025929 | Ga0207664_10028066 | Ga0207664_100280665 | 158 |
| 112 | 3300026142 | Ga0207698_11024050 | Ga0207698_110240501 | 158 |
| 113 | 3300037312 | Ga0395899_0018741 | Ga0395899_0018741_4090_4566 | 158 |
| 114 | 3300037418 | Ga0395900_0561950 | Ga0395900_0561950_469_945 | 158 |
| 115 | 3300037466 | Ga0395898_0744456 | Ga0395898_0744456_257_733 | 158 |
| 116 | 3300038443 | Ga0395901_0003860 | Ga0395901_0003860_7830_8306 | 158 |
| 117 | 3300039438 | Ga0436360_0193747 | Ga0436360_0193747_45_521 | 158 |
| 118 | 3300049569 | Ga0501032_0176280 | Ga0501032_0176280_440_916 | 158 |
| 119 | 3300049570 | Ga0501033_0298496 | Ga0501033_0298496_197_673 | 158 |
| 120 | 3300049571 | Ga0501034_0042839 | Ga0501034_0042839_3335_3811 | 158 |
| 121 | 3300049572 | Ga0501036_0665530 | Ga0501036_0665530_357_833 | 158 |
| 122 | 3300049573 | Ga0501037_0273468 | Ga0501037_0273468_591_1067 | 158 |
| 123 | 3300049574 | Ga0501038_0481086 | Ga0501038_0481086_153_629 | 158 |
| 124 | 3300049582 | Ga0501048_0077663 | Ga0501048_0077663_436_912 | 158 |
| 125 | 3300049586 | Ga0501070_0550640 | Ga0501070_0550640_368_844 | 158 |
| 126 | 3300049589 | Ga0501073_0560138 | Ga0501073_0560138_178_654 | 158 |
| 127 | 3300049822 | Ga0501035_0120004 | Ga0501035_0120004_1770_2246 | 158 |
| 128 | 3300049823 | Ga0501044_0689653 | Ga0501044_0689653_254_730 | 158 |
| 129 | iso_pu_bacteria | 2513237096 | 2513659150 | 158 |
| 130 | iso_pu_bacteria | 2513237101 | 2513697181 | 158 |
| 131 | iso_pu_bacteria | 2513237137 | 2513859127 | 158 |
| 132 | iso_pu_bacteria | 2513237141 | 2513893042 | 158 |
| 133 | iso_pu_bacteria | 2513237145 | 2513920522 | 158 |
| 134 | iso_pu_bacteria | 2517572143 | 2517887390 | 158 |
| 135 | iso_pu_bacteria | 2524023228 | 2524539268 | 158 |
| 136 | iso_pu_bacteria | 2602042107 | 2603860518 | 158 |
| 137 | iso_pu_bacteria | 2643221651 | 2644287166 | 158 |
| 138 | iso_pu_bacteria | 2667528175 | 2671120871 | 158 |
| 139 | iso_pu_bacteria | 2721755755 | 2723848771 | 158 |
| 140 | iso_pu_bacteria | 2791355197 | 2793073822 | 158 |
| 141 | iso_pu_bacteria | 2791355199 | 2793078786 | 158 |
| 142 | iso_pu_bacteria | 2857524615 | 2857525471 | 158 |
| 143 | iso_pu_bacteria | 2874604998 | 2874606096 | 158 |
| 144 | iso_pu_bacteria | 2876808645 | 2876815271 | 158 |
| 145 | iso_pu_bacteria | 2879110137 | 2879116741 | 158 |
| 146 | iso_pu_bacteria | 2889033259 | 2889034404 | 158 |
| 147 | iso_pu_bacteria | 2893066018 | 2893070878 | 158 |
| 148 | iso_pu_bacteria | 2903748898 | 2903751064 | 158 |
| 149 | iso_pu_bacteria | 2904690495 | 2904691683 | 158 |
| 150 | iso_pu_bacteria | 2906610324 | 2906612596 | 158 |
| 151 | iso_pu_bacteria | 2906635258 | 2906643145 | 158 |
| 152 | iso_pu_bacteria | 2906660503 | 2906664841 | 158 |
| 153 | iso_pu_bacteria | 2908739725 | 2908745806 | 158 |
| 154 | iso_pu_bacteria | 2908756301 | 2908763802 | 158 |
| 155 | iso_pu_bacteria | 2919073203 | 2919074719 | 158 |
| 156 | iso_pu_bacteria | 2922361189 | 2922363479 | 158 |
| 157 | iso_pu_bacteria | 2922425934 | 2922433093 | 158 |
| 158 | iso_pu_bacteria | 2935630451 | 2935630673 | 158 |
| 159 | iso_pu_bacteria | 2941507105 | 2941507325 | 158 |
| 160 | iso_pu_bacteria | 2941515067 | 2941515752 | 158 |
| 161 | iso_pu_bacteria | 2941523033 | 2941523540 | 158 |
| 162 | iso_pu_bacteria | 3005594810 | 3005596110 | 158 |
| 163 | iso_pu_bacteria | 3005718088 | 3005719295 | 158 |
| 164 | iso_pu_bacteria | 8006964411 | 8006970081 | 158 |
| 165 | iso_pu_bacteria | 8006984368 | 8006986293 | 158 |
| 166 | iso_pu_bacteria | 8006994254 | 8006998966 | 158 |
| 167 | iso_pu_bacteria | 8019555841 | 8019563686 | 158 |
| 168 | iso_pu_bacteria | 8019565922 | 8019573753 | 158 |
| 169 | 3300005330 | Ga0070690_100369537 | Ga0070690_1003695372 | 159 |
| 170 | 3300005355 | Ga0070671_100007073 | Ga0070671_1000070739 | 159 |
| 171 | 3300005548 | Ga0070665_100058806 | Ga0070665_1000588062 | 159 |
| 172 | 3300005563 | Ga0068855_101879947 | Ga0068855_1018799471 | 159 |
| 173 | 3300005981 | Ga0081538_10022689 | Ga0081538_100226894 | 159 |
| 174 | 3300025908 | Ga0207643_10645974 | Ga0207643_106459741 | 159 |
| 175 | 3300025925 | Ga0207650_10781283 | Ga0207650_107812831 | 159 |
| 176 | 3300025931 | Ga0207644_10239399 | Ga0207644_102393991 | 159 |
| 177 | 3300031548 | Ga0307408_100086840 | Ga0307408_1000868402 | 159 |
| 178 | 3300031824 | Ga0307413_11542853 | Ga0307413_115428531 | 159 |
| 179 | 3300035691 | Ga0373931_0229891 | Ga0373931_0229891_599_1090 | 159 |
| 180 | 3300049578 | Ga0501042_0297606 | Ga0501042_0297606_412_891 | 159 |
| 181 | 3300060353 | Ga0501082_0570848 | Ga0501082_0570848_315_794 | 159 |
| 182 | 3300021361 | Ga0213872_10111020 | Ga0213872_101110202 | 160 |
| 183 | 3300031250 | Ga0265331_10007229 | Ga0265331_100072293 | 160 |
| 184 | 3300031711 | Ga0265314_10001099 | Ga0265314_1000109916 | 160 |
| 185 | 3300031711 | Ga0265314_10123984 | Ga0265314_101239842 | 160 |
| 186 | 3300039447 | Ga0436361_0086028 | Ga0436361_0086028_1170_1652 | 160 |
| 187 | 3300041456 | Ga0451795_0455491 | Ga0451795_0455491_43_525 | 160 |
| 188 | 3300046460 | Ga0495638_0024606 | Ga0495638_0024606_40_522 | 160 |
| 189 | 3300049586 | Ga0501070_0218363 | Ga0501070_0218363_734_1240 | 160 |
| 190 | iso_pu_bacteria | 2643221564 | 2643837023 | 160 |
| 191 | 3300005336 | Ga0070680_100047062 | Ga0070680_1000470622 | 161 |
| 192 | 3300005339 | Ga0070660_100105470 | Ga0070660_1001054702 | 161 |
| 193 | 3300005458 | Ga0070681_10218167 | Ga0070681_102181672 | 161 |
| 194 | 3300005530 | Ga0070679_100610053 | Ga0070679_1006100532 | 161 |
| 195 | 3300005546 | Ga0070696_100938113 | Ga0070696_1009381131 | 161 |
| 196 | 3300005614 | Ga0068856_100347992 | Ga0068856_1003479922 | 161 |
| 197 | 3300006175 | Ga0070712_100019951 | Ga0070712_1000199512 | 161 |
| 198 | 3300010375 | Ga0105239_11972325 | Ga0105239_119723251 | 161 |
| 199 | 3300013104 | Ga0157370_10018311 | Ga0157370_100183119 | 161 |
| 200 | 3300013105 | Ga0157369_10223186 | Ga0157369_102231862 | 161 |
| 201 | 3300025912 | Ga0207707_10281258 | Ga0207707_102812582 | 161 |
| 202 | 3300025915 | Ga0207693_10003443 | Ga0207693_100034432 | 161 |
| 203 | 3300028800 | Ga0265338_10283522 | Ga0265338_102835222 | 161 |
| 204 | 3300031235 | Ga0265330_10052550 | Ga0265330_100525502 | 161 |
| 205 | 3300031249 | Ga0265339_10012880 | Ga0265339_100128805 | 161 |
| 206 | 3300035695 | Ga0373927_0083369 | Ga0373927_0083369_463_948 | 161 |
| 207 | 3300046455 | Ga0495603_0011165 | Ga0495603_0011165_177_662 | 161 |
| 208 | 3300046455 | Ga0495603_0138816 | Ga0495603_0138816_843_1328 | 161 |
| 209 | 3300046674 | Ga0495588_0230927 | Ga0495588_0230927_461_946 | 161 |
| 210 | 3300046683 | Ga0495658_0368767 | Ga0495658_0368767_278_763 | 161 |
| 211 | 3300046684 | Ga0495669_0159387 | Ga0495669_0159387_120_605 | 161 |
| 212 | 3300049571 | Ga0501034_0176446 | Ga0501034_0176446_1465_1950 | 161 |
| 213 | 3300049571 | Ga0501034_0890012 | Ga0501034_0890012_211_708 | 161 |
| 214 | 3300049581 | Ga0501047_0339908 | Ga0501047_0339908_493_990 | 161 |
| 215 | 3300049589 | Ga0501073_0011409 | Ga0501073_0011409_1833_2330 | 161 |
| 216 | 3300049744 | Ga0501083_0387532 | Ga0501083_0387532_191_688 | 161 |
| 217 | iso_pu_bacteria | 8055431914 | 8055432095 | 161 |
| 218 | 3300003203 | JGI25406J46586_10004829 | JGI25406J46586_100048293 | 162 |
| 219 | 3300003203 | JGI25406J46586_10119250 | JGI25406J46586_101192502 | 162 |
| 220 | 3300003659 | JGI25404J52841_10006426 | JGI25404J52841_100064262 | 162 |
| 221 | 3300003659 | JGI25404J52841_10025723 | JGI25404J52841_100257232 | 162 |
| 222 | 3300003659 | JGI25404J52841_10055406 | JGI25404J52841_100554062 | 162 |
| 223 | 3300003752 | Ga0055539_1007498 | Ga0055539_10074982 | 162 |
| 224 | 3300003911 | JGI25405J52794_10022829 | JGI25405J52794_100228292 | 162 |
| 225 | 3300005327 | Ga0070658_10282915 | Ga0070658_102829152 | 162 |
| 226 | 3300005328 | Ga0070676_11332112 | Ga0070676_113321121 | 162 |
| 227 | 3300005329 | Ga0070683_100005509 | Ga0070683_1000055095 | 162 |
| 228 | 3300005329 | Ga0070683_100116045 | Ga0070683_1001160452 | 162 |
| 229 | 3300005335 | Ga0070666_10551198 | Ga0070666_105511981 | 162 |
| 230 | 3300005336 | Ga0070680_100032227 | Ga0070680_1000322271 | 162 |
| 231 | 3300005336 | Ga0070680_100059733 | Ga0070680_1000597332 | 162 |
| 232 | 3300005336 | Ga0070680_100081160 | Ga0070680_1000811603 | 162 |
| 233 | 3300005337 | Ga0070682_100062949 | Ga0070682_1000629493 | 162 |
| 234 | 3300005337 | Ga0070682_100467807 | Ga0070682_1004678072 | 162 |
| 235 | 3300005338 | Ga0068868_100062713 | Ga0068868_1000627132 | 162 |
| 236 | 3300005339 | Ga0070660_100129823 | Ga0070660_1001298232 | 162 |
| 237 | 3300005339 | Ga0070660_100255057 | Ga0070660_1002550572 | 162 |
| 238 | 3300005341 | Ga0070691_10092184 | Ga0070691_100921842 | 162 |
| 239 | 3300005344 | Ga0070661_100059699 | Ga0070661_1000596994 | 162 |
| 240 | 3300005344 | Ga0070661_100429771 | Ga0070661_1004297711 | 162 |
| 241 | 3300005345 | Ga0070692_10460786 | Ga0070692_104607861 | 162 |
| 242 | 3300005347 | Ga0070668_100907068 | Ga0070668_1009070682 | 162 |
| 243 | 3300005354 | Ga0070675_101088589 | Ga0070675_1010885891 | 162 |
| 244 | 3300005355 | Ga0070671_100067271 | Ga0070671_1000672713 | 162 |
| 245 | 3300005355 | Ga0070671_100150697 | Ga0070671_1001506972 | 162 |
| 246 | 3300005356 | Ga0070674_100582631 | Ga0070674_1005826312 | 162 |
| 247 | 3300005364 | Ga0070673_100517667 | Ga0070673_1005176672 | 162 |
| 248 | 3300005366 | Ga0070659_100069240 | Ga0070659_1000692403 | 162 |
| 249 | 3300005366 | Ga0070659_100179910 | Ga0070659_1001799102 | 162 |
| 250 | 3300005366 | Ga0070659_100401918 | Ga0070659_1004019182 | 162 |
| 251 | 3300005367 | Ga0070667_100254144 | Ga0070667_1002541441 | 162 |
| 252 | 3300005367 | Ga0070667_100861179 | Ga0070667_1008611792 | 162 |
| 253 | 3300005434 | Ga0070709_10002522 | Ga0070709_100025225 | 162 |
| 254 | 3300005434 | Ga0070709_10073314 | Ga0070709_100733143 | 162 |
| 255 | 3300005434 | Ga0070709_10782322 | Ga0070709_107823221 | 162 |
| 256 | 3300005434 | Ga0070709_11052826 | Ga0070709_110528261 | 162 |
| 257 | 3300005435 | Ga0070714_100022715 | Ga0070714_1000227156 | 162 |
| 258 | 3300005435 | Ga0070714_100048487 | Ga0070714_1000484872 | 162 |
| 259 | 3300005435 | Ga0070714_100511644 | Ga0070714_1005116441 | 162 |
| 260 | 3300005436 | Ga0070713_100010481 | Ga0070713_1000104818 | 162 |
| 261 | 3300005436 | Ga0070713_100024458 | Ga0070713_1000244586 | 162 |
| 262 | 3300005436 | Ga0070713_100186788 | Ga0070713_1001867882 | 162 |
| 263 | 3300005437 | Ga0070710_10002131 | Ga0070710_100021315 | 162 |
| 264 | 3300005437 | Ga0070710_10010042 | Ga0070710_100100427 | 162 |
| 265 | 3300005439 | Ga0070711_100002112 | Ga0070711_1000021126 | 162 |
| 266 | 3300005439 | Ga0070711_100010614 | Ga0070711_1000106144 | 162 |
| 267 | 3300005444 | Ga0070694_100296546 | Ga0070694_1002965462 | 162 |
| 268 | 3300005445 | Ga0070708_100507479 | Ga0070708_1005074791 | 162 |
| 269 | 3300005455 | Ga0070663_100014258 | Ga0070663_1000142584 | 162 |
| 270 | 3300005455 | Ga0070663_100071097 | Ga0070663_1000710971 | 162 |
| 271 | 3300005455 | Ga0070663_100403798 | Ga0070663_1004037982 | 162 |
| 272 | 3300005456 | Ga0070678_100057001 | Ga0070678_1000570013 | 162 |
| 273 | 3300005456 | Ga0070678_100114280 | Ga0070678_1001142802 | 162 |
| 274 | 3300005456 | Ga0070678_100276809 | Ga0070678_1002768092 | 162 |
| 275 | 3300005457 | Ga0070662_100543948 | Ga0070662_1005439482 | 162 |
| 276 | 3300005458 | Ga0070681_10026470 | Ga0070681_100264702 | 162 |
| 277 | 3300005458 | Ga0070681_10303321 | Ga0070681_103033212 | 162 |
| 278 | 3300005459 | Ga0068867_100441120 | Ga0068867_1004411201 | 162 |
| 279 | 3300005467 | Ga0070706_100290542 | Ga0070706_1002905422 | 162 |
| 280 | 3300005530 | Ga0070679_100052906 | Ga0070679_1000529065 | 162 |
| 281 | 3300005530 | Ga0070679_100084151 | Ga0070679_1000841514 | 162 |
| 282 | 3300005530 | Ga0070679_100149996 | Ga0070679_1001499963 | 162 |
| 283 | 3300005530 | Ga0070679_100267529 | Ga0070679_1002675292 | 162 |
| 284 | 3300005530 | Ga0070679_101357562 | Ga0070679_1013575621 | 162 |
| 285 | 3300005535 | Ga0070684_100036017 | Ga0070684_1000360175 | 162 |
| 286 | 3300005539 | Ga0068853_100068543 | Ga0068853_1000685434 | 162 |
| 287 | 3300005539 | Ga0068853_100185607 | Ga0068853_1001856072 | 162 |
| 288 | 3300005539 | Ga0068853_100900210 | Ga0068853_1009002101 | 162 |
| 289 | 3300005544 | Ga0070686_100404931 | Ga0070686_1004049312 | 162 |
| 290 | 3300005545 | Ga0070695_100879197 | Ga0070695_1008791971 | 162 |
| 291 | 3300005547 | Ga0070693_100108922 | Ga0070693_1001089221 | 162 |
| 292 | 3300005547 | Ga0070693_100880423 | Ga0070693_1008804231 | 162 |
| 293 | 3300005548 | Ga0070665_100007112 | Ga0070665_1000071128 | 162 |
| 294 | 3300005548 | Ga0070665_100036710 | Ga0070665_1000367103 | 162 |
| 295 | 3300005548 | Ga0070665_100404859 | Ga0070665_1004048592 | 162 |
| 296 | 3300005548 | Ga0070665_100477047 | Ga0070665_1004770472 | 162 |
| 297 | 3300005563 | Ga0068855_100025571 | Ga0068855_1000255715 | 162 |
| 298 | 3300005563 | Ga0068855_100188782 | Ga0068855_1001887824 | 162 |
| 299 | 3300005563 | Ga0068855_100284931 | Ga0068855_1002849312 | 162 |
| 300 | 3300005563 | Ga0068855_100338809 | Ga0068855_1003388092 | 162 |
| 301 | 3300005564 | Ga0070664_100071249 | Ga0070664_1000712492 | 162 |
| 302 | 3300005577 | Ga0068857_100062152 | Ga0068857_1000621527 | 162 |
| 303 | 3300005578 | Ga0068854_100118632 | Ga0068854_1001186324 | 162 |
| 304 | 3300005614 | Ga0068856_100000055 | Ga0068856_10000005586 | 162 |
| 305 | 3300005614 | Ga0068856_100109014 | Ga0068856_1001090142 | 162 |
| 306 | 3300005616 | Ga0068852_100012401 | Ga0068852_1000124017 | 162 |
| 307 | 3300005616 | Ga0068852_100085424 | Ga0068852_1000854246 | 162 |
| 308 | 3300005616 | Ga0068852_100254822 | Ga0068852_1002548222 | 162 |
| 309 | 3300005616 | Ga0068852_100394068 | Ga0068852_1003940682 | 162 |
| 310 | 3300005616 | Ga0068852_100532961 | Ga0068852_1005329612 | 162 |
| 311 | 3300005617 | Ga0068859_101926464 | Ga0068859_1019264642 | 162 |
| 312 | 3300005618 | Ga0068864_100130417 | Ga0068864_1001304172 | 162 |
| 313 | 3300005618 | Ga0068864_100625516 | Ga0068864_1006255162 | 162 |
| 314 | 3300005718 | Ga0068866_10072331 | Ga0068866_100723312 | 162 |
| 315 | 3300005719 | Ga0068861_100058125 | Ga0068861_1000581252 | 162 |
| 316 | 3300005719 | Ga0068861_100262215 | Ga0068861_1002622151 | 162 |
| 317 | 3300005719 | Ga0068861_100391056 | Ga0068861_1003910562 | 162 |
| 318 | 3300005841 | Ga0068863_100112354 | Ga0068863_1001123545 | 162 |
| 319 | 3300005841 | Ga0068863_101019888 | Ga0068863_1010198882 | 162 |
| 320 | 3300005842 | Ga0068858_100227226 | Ga0068858_1002272262 | 162 |
| 321 | 3300005843 | Ga0068860_100537885 | Ga0068860_1005378851 | 162 |
| 322 | 3300005937 | Ga0081455_10005648 | Ga0081455_100056489 | 162 |
| 323 | 3300005937 | Ga0081455_10032267 | Ga0081455_100322674 | 162 |
| 324 | 3300005937 | Ga0081455_10068600 | Ga0081455_100686004 | 162 |
| 325 | 3300005983 | Ga0081540_1001390 | Ga0081540_100139015 | 162 |
| 326 | 3300005983 | Ga0081540_1002001 | Ga0081540_100200120 | 162 |
| 327 | 3300005983 | Ga0081540_1008054 | Ga0081540_10080541 | 162 |
| 328 | 3300005983 | Ga0081540_1009977 | Ga0081540_10099774 | 162 |
| 329 | 3300005983 | Ga0081540_1025849 | Ga0081540_10258492 | 162 |
| 330 | 3300005983 | Ga0081540_1061349 | Ga0081540_10613492 | 162 |
| 331 | 3300005985 | Ga0081539_10001188 | Ga0081539_1000118818 | 162 |
| 332 | 3300005985 | Ga0081539_10040716 | Ga0081539_100407162 | 162 |
| 333 | 3300006028 | Ga0070717_10233283 | Ga0070717_102332832 | 162 |
| 334 | 3300006038 | Ga0075365_10036277 | Ga0075365_100362774 | 162 |
| 335 | 3300006038 | Ga0075365_10044545 | Ga0075365_100445452 | 162 |
| 336 | 3300006038 | Ga0075365_10154050 | Ga0075365_101540502 | 162 |
| 337 | 3300006038 | Ga0075365_10193886 | Ga0075365_101938862 | 162 |
| 338 | 3300006038 | Ga0075365_10406838 | Ga0075365_104068382 | 162 |
| 339 | 3300006042 | Ga0075368_10031198 | Ga0075368_100311983 | 162 |
| 340 | 3300006048 | Ga0075363_100024437 | Ga0075363_1000244372 | 162 |
| 341 | 3300006048 | Ga0075363_100042516 | Ga0075363_1000425162 | 162 |
| 342 | 3300006048 | Ga0075363_100287711 | Ga0075363_1002877112 | 162 |
| 343 | 3300006051 | Ga0075364_10028092 | Ga0075364_100280922 | 162 |
| 344 | 3300006051 | Ga0075364_10109512 | Ga0075364_101095122 | 162 |
| 345 | 3300006163 | Ga0070715_10047287 | Ga0070715_100472872 | 162 |
| 346 | 3300006173 | Ga0070716_100094063 | Ga0070716_1000940634 | 162 |
| 347 | 3300006173 | Ga0070716_100773824 | Ga0070716_1007738241 | 162 |
| 348 | 3300006175 | Ga0070712_100022644 | Ga0070712_1000226447 | 162 |
| 349 | 3300006175 | Ga0070712_100232178 | Ga0070712_1002321782 | 162 |
| 350 | 3300006175 | Ga0070712_100365845 | Ga0070712_1003658452 | 162 |
| 351 | 3300006177 | Ga0075362_10165498 | Ga0075362_101654983 | 162 |
| 352 | 3300006178 | Ga0075367_10015243 | Ga0075367_100152432 | 162 |
| 353 | 3300006178 | Ga0075367_10025742 | Ga0075367_100257422 | 162 |
| 354 | 3300006178 | Ga0075367_10138147 | Ga0075367_101381472 | 162 |
| 355 | 3300006178 | Ga0075367_10313901 | Ga0075367_103139011 | 162 |
| 356 | 3300006178 | Ga0075367_10380622 | Ga0075367_103806222 | 162 |
| 357 | 3300006186 | Ga0075369_10067109 | Ga0075369_100671093 | 162 |
| 358 | 3300006186 | Ga0075369_10091981 | Ga0075369_100919811 | 162 |
| 359 | 3300006186 | Ga0075369_10183723 | Ga0075369_101837232 | 162 |
| 360 | 3300006195 | Ga0075366_10296025 | Ga0075366_102960251 | 162 |
| 361 | 3300006237 | Ga0097621_100071832 | Ga0097621_1000718323 | 162 |
| 362 | 3300006237 | Ga0097621_101801221 | Ga0097621_1018012211 | 162 |
| 363 | 3300006353 | Ga0075370_10107531 | Ga0075370_101075312 | 162 |
| 364 | 3300006353 | Ga0075370_10348669 | Ga0075370_103486692 | 162 |
| 365 | 3300006358 | Ga0068871_100263261 | Ga0068871_1002632612 | 162 |
| 366 | 3300006358 | Ga0068871_100654333 | Ga0068871_1006543331 | 162 |
| 367 | 3300006358 | Ga0068871_100974776 | Ga0068871_1009747762 | 162 |
| 368 | 3300006844 | Ga0075428_100062853 | Ga0075428_1000628533 | 162 |
| 369 | 3300006871 | Ga0075434_100042655 | Ga0075434_1000426557 | 162 |
| 370 | 3300006881 | Ga0068865_100196452 | Ga0068865_1001964521 | 162 |
| 371 | 3300006881 | Ga0068865_100297496 | Ga0068865_1002974962 | 162 |
| 372 | 3300006931 | Ga0097620_100284108 | Ga0097620_1002841082 | 162 |
| 373 | 3300006931 | Ga0097620_101926151 | Ga0097620_1019261512 | 162 |
| 374 | 3300006942 | Ga0099824_1007275 | Ga0099824_100727511 | 162 |
| 375 | 3300006943 | Ga0099822_1013306 | Ga0099822_101330610 | 162 |
| 376 | 3300007076 | Ga0075435_101115497 | Ga0075435_1011154971 | 162 |
| 377 | 3300007788 | Ga0099795_10089844 | Ga0099795_100898441 | 162 |
| 378 | 3300009093 | Ga0105240_10057119 | Ga0105240_100571191 | 162 |
| 379 | 3300009094 | Ga0111539_10069960 | Ga0111539_100699603 | 162 |
| 380 | 3300009098 | Ga0105245_10782135 | Ga0105245_107821352 | 162 |
| 381 | 3300009101 | Ga0105247_10047041 | Ga0105247_100470412 | 162 |
| 382 | 3300009101 | Ga0105247_10074777 | Ga0105247_100747774 | 162 |
| 383 | 3300009101 | Ga0105247_10127179 | Ga0105247_101271792 | 162 |
| 384 | 3300009101 | Ga0105247_10212662 | Ga0105247_102126622 | 162 |
| 385 | 3300009147 | Ga0114129_10263752 | Ga0114129_102637522 | 162 |
| 386 | 3300009147 | Ga0114129_11200066 | Ga0114129_112000662 | 162 |
| 387 | 3300009148 | Ga0105243_10613798 | Ga0105243_106137981 | 162 |
| 388 | 3300009174 | Ga0105241_10194732 | Ga0105241_101947322 | 162 |
| 389 | 3300009174 | Ga0105241_10313467 | Ga0105241_103134672 | 162 |
| 390 | 3300009174 | Ga0105241_10660773 | Ga0105241_106607732 | 162 |
| 391 | 3300009176 | Ga0105242_11469260 | Ga0105242_114692602 | 162 |
| 392 | 3300009177 | Ga0105248_10048948 | Ga0105248_100489484 | 162 |
| 393 | 3300009177 | Ga0105248_10062199 | Ga0105248_100621994 | 162 |
| 394 | 3300009177 | Ga0105248_10461520 | Ga0105248_104615202 | 162 |
| 395 | 3300009545 | Ga0105237_10033693 | Ga0105237_100336934 | 162 |
| 396 | 3300009545 | Ga0105237_10157860 | Ga0105237_101578603 | 162 |
| 397 | 3300009551 | Ga0105238_11454779 | Ga0105238_114547791 | 162 |
| 398 | 3300010159 | Ga0099796_10290222 | Ga0099796_102902222 | 162 |
| 399 | 3300010375 | Ga0105239_10064277 | Ga0105239_100642776 | 162 |
| 400 | 3300010375 | Ga0105239_10115634 | Ga0105239_101156343 | 162 |
| 401 | 3300010375 | Ga0105239_10408015 | Ga0105239_104080152 | 162 |
| 402 | 3300010375 | Ga0105239_11261989 | Ga0105239_112619892 | 162 |
| 403 | 3300011119 | Ga0105246_10132355 | Ga0105246_101323552 | 162 |
| 404 | 3300011119 | Ga0105246_10257260 | Ga0105246_102572602 | 162 |
| 405 | 3300013104 | Ga0157370_10012374 | Ga0157370_100123743 | 162 |
| 406 | 3300013104 | Ga0157370_10056509 | Ga0157370_100565093 | 162 |
| 407 | 3300013104 | Ga0157370_10222336 | Ga0157370_102223362 | 162 |
| 408 | 3300013105 | Ga0157369_10010958 | Ga0157369_100109582 | 162 |
| 409 | 3300013105 | Ga0157369_10305195 | Ga0157369_103051952 | 162 |
| 410 | 3300013105 | Ga0157369_10601811 | Ga0157369_106018112 | 162 |
| 411 | 3300013296 | Ga0157374_10018619 | Ga0157374_100186196 | 162 |
| 412 | 3300013297 | Ga0157378_10048781 | Ga0157378_100487814 | 162 |
| 413 | 3300013297 | Ga0157378_10643001 | Ga0157378_106430011 | 162 |
| 414 | 3300013306 | Ga0163162_10889368 | Ga0163162_108893682 | 162 |
| 415 | 3300013306 | Ga0163162_12605797 | Ga0163162_126057971 | 162 |
| 416 | 3300013307 | Ga0157372_10041439 | Ga0157372_100414392 | 162 |
| 417 | 3300013307 | Ga0157372_10294661 | Ga0157372_102946611 | 162 |
| 418 | 3300013307 | Ga0157372_11020285 | Ga0157372_110202852 | 162 |
| 419 | 3300013307 | Ga0157372_12357385 | Ga0157372_123573851 | 162 |
| 420 | 3300013308 | Ga0157375_10026458 | Ga0157375_100264586 | 162 |
| 421 | 3300013308 | Ga0157375_10156886 | Ga0157375_101568862 | 162 |
| 422 | 3300013308 | Ga0157375_12404742 | Ga0157375_124047421 | 162 |
| 423 | 3300014325 | Ga0163163_10493659 | Ga0163163_104936591 | 162 |
| 424 | 3300014325 | Ga0163163_10757124 | Ga0163163_107571242 | 162 |
| 425 | 3300014326 | Ga0157380_10462971 | Ga0157380_104629712 | 162 |
| 426 | 3300014968 | Ga0157379_10013008 | Ga0157379_1001300810 | 162 |
| 427 | 3300014968 | Ga0157379_10721605 | Ga0157379_107216052 | 162 |
| 428 | 3300014969 | Ga0157376_10069756 | Ga0157376_100697562 | 162 |
| 429 | 3300014969 | Ga0157376_11124189 | Ga0157376_111241892 | 162 |
| 430 | 3300014969 | Ga0157376_11501603 | Ga0157376_115016031 | 162 |
| 431 | 3300020081 | Ga0206354_11535455 | Ga0206354_115354552 | 162 |
| 432 | 3300020082 | Ga0206353_10607391 | Ga0206353_106073912 | 162 |
| 433 | 3300021377 | Ga0213874_10054570 | Ga0213874_100545702 | 162 |
| 434 | 3300021377 | Ga0213874_10088994 | Ga0213874_100889942 | 162 |
| 435 | 3300021384 | Ga0213876_10016738 | Ga0213876_100167382 | 162 |
| 436 | 3300021388 | Ga0213875_10024254 | Ga0213875_100242542 | 162 |
| 437 | 3300025253 | Ga0209677_100264 | Ga0209677_10026418 | 162 |
| 438 | 3300025254 | Ga0209148_1013301 | Ga0209148_10133012 | 162 |
| 439 | 3300025261 | Ga0209233_1001365 | Ga0209233_100136510 | 162 |
| 440 | 3300025261 | Ga0209233_1004762 | Ga0209233_10047622 | 162 |
| 441 | 3300025272 | Ga0209455_1004866 | Ga0209455_10048667 | 162 |
| 442 | 3300025272 | Ga0209455_1018854 | Ga0209455_10188542 | 162 |
| 443 | 3300025295 | Ga0209564_1009473 | Ga0209564_10094738 | 162 |
| 444 | 3300025297 | Ga0209758_1038909 | Ga0209758_10389093 | 162 |
| 445 | 3300025315 | Ga0207697_10079095 | Ga0207697_100790952 | 162 |
| 446 | 3300025315 | Ga0207697_10113864 | Ga0207697_101138642 | 162 |
| 447 | 3300025885 | Ga0207653_10005522 | Ga0207653_100055225 | 162 |
| 448 | 3300025893 | Ga0207682_10043080 | Ga0207682_100430802 | 162 |
| 449 | 3300025898 | Ga0207692_10002507 | Ga0207692_100025074 | 162 |
| 450 | 3300025898 | Ga0207692_10119824 | Ga0207692_101198242 | 162 |
| 451 | 3300025898 | Ga0207692_10716662 | Ga0207692_107166621 | 162 |
| 452 | 3300025899 | Ga0207642_10009209 | Ga0207642_100092093 | 162 |
| 453 | 3300025900 | Ga0207710_10032980 | Ga0207710_100329801 | 162 |
| 454 | 3300025900 | Ga0207710_10223611 | Ga0207710_102236112 | 162 |
| 455 | 3300025901 | Ga0207688_10246677 | Ga0207688_102466771 | 162 |
| 456 | 3300025901 | Ga0207688_10384606 | Ga0207688_103846062 | 162 |
| 457 | 3300025904 | Ga0207647_10104124 | Ga0207647_101041242 | 162 |
| 458 | 3300025904 | Ga0207647_10266406 | Ga0207647_102664061 | 162 |
| 459 | 3300025904 | Ga0207647_10499800 | Ga0207647_104998002 | 162 |
| 460 | 3300025905 | Ga0207685_10060377 | Ga0207685_100603772 | 162 |
| 461 | 3300025906 | Ga0207699_10031457 | Ga0207699_100314576 | 162 |
| 462 | 3300025906 | Ga0207699_10164847 | Ga0207699_101648471 | 162 |
| 463 | 3300025906 | Ga0207699_10415613 | Ga0207699_104156132 | 162 |
| 464 | 3300025906 | Ga0207699_10590914 | Ga0207699_105909142 | 162 |
| 465 | 3300025907 | Ga0207645_10107923 | Ga0207645_101079234 | 162 |
| 466 | 3300025907 | Ga0207645_10299138 | Ga0207645_102991382 | 162 |
| 467 | 3300025909 | Ga0207705_10421672 | Ga0207705_104216722 | 162 |
| 468 | 3300025910 | Ga0207684_10242111 | Ga0207684_102421112 | 162 |
| 469 | 3300025910 | Ga0207684_10836184 | Ga0207684_108361842 | 162 |
| 470 | 3300025911 | Ga0207654_10770809 | Ga0207654_107708092 | 162 |
| 471 | 3300025912 | Ga0207707_10015807 | Ga0207707_100158075 | 162 |
| 472 | 3300025912 | Ga0207707_10037322 | Ga0207707_100373226 | 162 |
| 473 | 3300025912 | Ga0207707_10491678 | Ga0207707_104916782 | 162 |
| 474 | 3300025912 | Ga0207707_10921718 | Ga0207707_109217181 | 162 |
| 475 | 3300025912 | Ga0207707_11051478 | Ga0207707_110514781 | 162 |
| 476 | 3300025913 | Ga0207695_10349049 | Ga0207695_103490492 | 162 |
| 477 | 3300025914 | Ga0207671_10020809 | Ga0207671_100208095 | 162 |
| 478 | 3300025914 | Ga0207671_10057575 | Ga0207671_100575753 | 162 |
| 479 | 3300025914 | Ga0207671_10129995 | Ga0207671_101299952 | 162 |
| 480 | 3300025914 | Ga0207671_10179245 | Ga0207671_101792452 | 162 |
| 481 | 3300025914 | Ga0207671_10796407 | Ga0207671_107964071 | 162 |
| 482 | 3300025915 | Ga0207693_10066850 | Ga0207693_100668502 | 162 |
| 483 | 3300025915 | Ga0207693_10075789 | Ga0207693_100757892 | 162 |
| 484 | 3300025915 | Ga0207693_10140313 | Ga0207693_101403132 | 162 |
| 485 | 3300025916 | Ga0207663_10002035 | Ga0207663_100020352 | 162 |
| 486 | 3300025916 | Ga0207663_10031644 | Ga0207663_100316442 | 162 |
| 487 | 3300025917 | Ga0207660_10061983 | Ga0207660_100619832 | 162 |
| 488 | 3300025917 | Ga0207660_10298987 | Ga0207660_102989872 | 162 |
| 489 | 3300025917 | Ga0207660_10940508 | Ga0207660_109405082 | 162 |
| 490 | 3300025919 | Ga0207657_10009705 | Ga0207657_100097053 | 162 |
| 491 | 3300025919 | Ga0207657_10223318 | Ga0207657_102233181 | 162 |
| 492 | 3300025919 | Ga0207657_10223488 | Ga0207657_102234882 | 162 |
| 493 | 3300025920 | Ga0207649_10121706 | Ga0207649_101217061 | 162 |
| 494 | 3300025920 | Ga0207649_10133867 | Ga0207649_101338672 | 162 |
| 495 | 3300025920 | Ga0207649_10670281 | Ga0207649_106702811 | 162 |
| 496 | 3300025921 | Ga0207652_10095355 | Ga0207652_100953553 | 162 |
| 497 | 3300025921 | Ga0207652_10240711 | Ga0207652_102407112 | 162 |
| 498 | 3300025921 | Ga0207652_10559937 | Ga0207652_105599372 | 162 |
| 499 | 3300025923 | Ga0207681_10107400 | Ga0207681_101074001 | 162 |
| 500 | 3300025923 | Ga0207681_10259799 | Ga0207681_102597992 | 162 |
| 501 | 3300025924 | Ga0207694_11205163 | Ga0207694_112051631 | 162 |
| 502 | 3300025928 | Ga0207700_10007067 | Ga0207700_100070675 | 162 |
| 503 | 3300025928 | Ga0207700_10080515 | Ga0207700_100805152 | 162 |
| 504 | 3300025928 | Ga0207700_10140903 | Ga0207700_101409032 | 162 |
| 505 | 3300025928 | Ga0207700_10360134 | Ga0207700_103601342 | 162 |
| 506 | 3300025929 | Ga0207664_10021207 | Ga0207664_100212074 | 162 |
| 507 | 3300025929 | Ga0207664_10036418 | Ga0207664_100364187 | 162 |
| 508 | 3300025931 | Ga0207644_10305068 | Ga0207644_103050681 | 162 |
| 509 | 3300025932 | Ga0207690_10107512 | Ga0207690_101075121 | 162 |
| 510 | 3300025932 | Ga0207690_10155100 | Ga0207690_101551001 | 162 |
| 511 | 3300025932 | Ga0207690_10604848 | Ga0207690_106048482 | 162 |
| 512 | 3300025933 | Ga0207706_10023157 | Ga0207706_100231577 | 162 |
| 513 | 3300025937 | Ga0207669_10539659 | Ga0207669_105396592 | 162 |
| 514 | 3300025939 | Ga0207665_10010412 | Ga0207665_100104122 | 162 |
| 515 | 3300025939 | Ga0207665_10719502 | Ga0207665_107195021 | 162 |
| 516 | 3300025941 | Ga0207711_10184139 | Ga0207711_101841393 | 162 |
| 517 | 3300025941 | Ga0207711_10363533 | Ga0207711_103635332 | 162 |
| 518 | 3300025942 | Ga0207689_10220943 | Ga0207689_102209432 | 162 |
| 519 | 3300025944 | Ga0207661_10015139 | Ga0207661_100151393 | 162 |
| 520 | 3300025944 | Ga0207661_10895380 | Ga0207661_108953801 | 162 |
| 521 | 3300025945 | Ga0207679_11035552 | Ga0207679_110355522 | 162 |
| 522 | 3300025949 | Ga0207667_10010515 | Ga0207667_100105152 | 162 |
| 523 | 3300025949 | Ga0207667_10503559 | Ga0207667_105035592 | 162 |
| 524 | 3300025949 | Ga0207667_11155936 | Ga0207667_111559362 | 162 |
| 525 | 3300025949 | Ga0207667_11597022 | Ga0207667_115970221 | 162 |
| 526 | 3300025960 | Ga0207651_11429407 | Ga0207651_114294071 | 162 |
| 527 | 3300025972 | Ga0207668_10677433 | Ga0207668_106774331 | 162 |
| 528 | 3300025972 | Ga0207668_11297870 | Ga0207668_112978701 | 162 |
| 529 | 3300025981 | Ga0207640_10166036 | Ga0207640_101660363 | 162 |
| 530 | 3300025981 | Ga0207640_10313821 | Ga0207640_103138212 | 162 |
| 531 | 3300025981 | Ga0207640_10326328 | Ga0207640_103263282 | 162 |
| 532 | 3300025986 | Ga0207658_10220840 | Ga0207658_102208401 | 162 |
| 533 | 3300026023 | Ga0207677_10240770 | Ga0207677_102407702 | 162 |
| 534 | 3300026035 | Ga0207703_10176674 | Ga0207703_101766742 | 162 |
| 535 | 3300026035 | Ga0207703_11371736 | Ga0207703_113717361 | 162 |
| 536 | 3300026035 | Ga0207703_11908406 | Ga0207703_119084061 | 162 |
| 537 | 3300026041 | Ga0207639_10046533 | Ga0207639_100465333 | 162 |
| 538 | 3300026041 | Ga0207639_10344440 | Ga0207639_103444401 | 162 |
| 539 | 3300026041 | Ga0207639_10453430 | Ga0207639_104534302 | 162 |
| 540 | 3300026041 | Ga0207639_10793080 | Ga0207639_107930802 | 162 |
| 541 | 3300026067 | Ga0207678_10036005 | Ga0207678_100360052 | 162 |
| 542 | 3300026067 | Ga0207678_10197973 | Ga0207678_101979732 | 162 |
| 543 | 3300026067 | Ga0207678_10199123 | Ga0207678_101991233 | 162 |
| 544 | 3300026067 | Ga0207678_11270392 | Ga0207678_112703921 | 162 |
| 545 | 3300026078 | Ga0207702_10000287 | Ga0207702_1000028754 | 162 |
| 546 | 3300026078 | Ga0207702_10082643 | Ga0207702_100826433 | 162 |
| 547 | 3300026078 | Ga0207702_10469161 | Ga0207702_104691612 | 162 |
| 548 | 3300026078 | Ga0207702_11399887 | Ga0207702_113998871 | 162 |
| 549 | 3300026088 | Ga0207641_10118152 | Ga0207641_101181525 | 162 |
| 550 | 3300026088 | Ga0207641_10884774 | Ga0207641_108847742 | 162 |
| 551 | 3300026089 | Ga0207648_10123038 | Ga0207648_101230382 | 162 |
| 552 | 3300026095 | Ga0207676_10277842 | Ga0207676_102778422 | 162 |
| 553 | 3300026116 | Ga0207674_10068661 | Ga0207674_100686612 | 162 |
| 554 | 3300026116 | Ga0207674_11076227 | Ga0207674_110762272 | 162 |
| 555 | 3300026118 | Ga0207675_100065722 | Ga0207675_1000657222 | 162 |
| 556 | 3300026118 | Ga0207675_100785536 | Ga0207675_1007855362 | 162 |
| 557 | 3300026121 | Ga0207683_10077274 | Ga0207683_100772743 | 162 |
| 558 | 3300026121 | Ga0207683_10272055 | Ga0207683_102720553 | 162 |
| 559 | 3300026121 | Ga0207683_10291806 | Ga0207683_102918062 | 162 |
| 560 | 3300026121 | Ga0207683_10371043 | Ga0207683_103710432 | 162 |
| 561 | 3300026121 | Ga0207683_10477914 | Ga0207683_104779142 | 162 |
| 562 | 3300026121 | Ga0207683_10810966 | Ga0207683_108109661 | 162 |
| 563 | 3300026142 | Ga0207698_10010329 | Ga0207698_100103299 | 162 |
| 564 | 3300026142 | Ga0207698_10381493 | Ga0207698_103814932 | 162 |
| 565 | 3300026142 | Ga0207698_10911832 | Ga0207698_109118321 | 162 |
| 566 | 3300027357 | Ga0209589_1000005 | Ga0209589_100000578 | 162 |
| 567 | 3300027361 | Ga0209489_100005 | Ga0209489_10000578 | 162 |
| 568 | 3300027363 | Ga0209700_100006 | Ga0209700_10000678 | 162 |
| 569 | 3300027907 | Ga0207428_10464316 | Ga0207428_104643161 | 162 |
| 570 | 3300028379 | Ga0268266_10003479 | Ga0268266_1000347910 | 162 |
| 571 | 3300028379 | Ga0268266_10007831 | Ga0268266_100078312 | 162 |
| 572 | 3300028379 | Ga0268266_10425440 | Ga0268266_104254402 | 162 |
| 573 | 3300028380 | Ga0268265_10534337 | Ga0268265_105343372 | 162 |
| 574 | 3300028786 | Ga0307517_10000098 | Ga0307517_1000009857 | 162 |
| 575 | 3300028794 | Ga0307515_10164978 | Ga0307515_101649785 | 162 |
| 576 | 3300031239 | Ga0265328_10043394 | Ga0265328_100433943 | 162 |
| 577 | 3300031249 | Ga0265339_10061831 | Ga0265339_100618312 | 162 |
| 578 | 3300031456 | Ga0307513_10225523 | Ga0307513_102255232 | 162 |
| 579 | 3300031456 | Ga0307513_10423239 | Ga0307513_104232391 | 162 |
| 580 | 3300031456 | Ga0307513_10506529 | Ga0307513_105065292 | 162 |
| 581 | 3300031507 | Ga0307509_10102974 | Ga0307509_101029743 | 162 |
| 582 | 3300031507 | Ga0307509_10279735 | Ga0307509_102797352 | 162 |
| 583 | 3300031507 | Ga0307509_10323496 | Ga0307509_103234962 | 162 |
| 584 | 3300031548 | Ga0307408_100124425 | Ga0307408_1001244253 | 162 |
| 585 | 3300031616 | Ga0307508_10000678 | Ga0307508_1000067832 | 162 |
| 586 | 3300031616 | Ga0307508_10027524 | Ga0307508_100275242 | 162 |
| 587 | 3300031616 | Ga0307508_10115305 | Ga0307508_101153052 | 162 |
| 588 | 3300031616 | Ga0307508_10803174 | Ga0307508_108031741 | 162 |
| 589 | 3300031711 | Ga0265314_10007614 | Ga0265314_1000761412 | 162 |
| 590 | 3300031711 | Ga0265314_10063760 | Ga0265314_100637603 | 162 |
| 591 | 3300031712 | Ga0265342_10039973 | Ga0265342_100399732 | 162 |
| 592 | 3300031730 | Ga0307516_10044194 | Ga0307516_100441946 | 162 |
| 593 | 3300031730 | Ga0307516_10054727 | Ga0307516_100547275 | 162 |
| 594 | 3300031730 | Ga0307516_10185848 | Ga0307516_101858482 | 162 |
| 595 | 3300031731 | Ga0307405_10225583 | Ga0307405_102255831 | 162 |
| 596 | 3300031731 | Ga0307405_10302810 | Ga0307405_103028102 | 162 |
| 597 | 3300031731 | Ga0307405_10340387 | Ga0307405_103403872 | 162 |
| 598 | 3300031824 | Ga0307413_10160948 | Ga0307413_101609481 | 162 |
| 599 | 3300031824 | Ga0307413_10363307 | Ga0307413_103633072 | 162 |
| 600 | 3300031824 | Ga0307413_10441353 | Ga0307413_104413532 | 162 |
| 601 | 3300031852 | Ga0307410_10460271 | Ga0307410_104602712 | 162 |
| 602 | 3300031911 | Ga0307412_10246753 | Ga0307412_102467531 | 162 |
| 603 | 3300031995 | Ga0307409_100310908 | Ga0307409_1003109083 | 162 |
| 604 | 3300032002 | Ga0307416_100307599 | Ga0307416_1003075992 | 162 |
| 605 | 3300032002 | Ga0307416_102498649 | Ga0307416_1024986491 | 162 |
| 606 | 3300032005 | Ga0307411_10195186 | Ga0307411_101951862 | 162 |
| 607 | 3300032005 | Ga0307411_10331018 | Ga0307411_103310182 | 162 |
| 608 | 3300032126 | Ga0307415_100977281 | Ga0307415_1009772812 | 162 |
| 609 | 3300033180 | Ga0307510_10005253 | Ga0307510_100052538 | 162 |
| 610 | 3300033442 | Ga0315911_1000022 | Ga0315911_100002286 | 162 |
| 611 | 3300033544 | Ga0316215_1006240 | Ga0316215_10062401 | 162 |
| 612 | 3300033548 | Ga0316216_1003343 | Ga0316216_10033431 | 162 |
| 613 | 3300034818 | Ga0373950_0012861 | Ga0373950_0012861_201_689 | 162 |
| 614 | 3300034957 | Ga0373938_0054638 | Ga0373938_0054638_266_754 | 162 |
| 615 | 3300035083 | Ga0373926_0024385 | Ga0373926_0024385_978_1466 | 162 |
| 616 | 3300035083 | Ga0373926_0138356 | Ga0373926_0138356_280_768 | 162 |
| 617 | 3300035085 | Ga0373929_0024231 | Ga0373929_0024231_611_1099 | 162 |
| 618 | 3300035090 | Ga0373949_0010439 | Ga0373949_0010439_159_647 | 162 |
| 619 | 3300035111 | Ga0373923_0007172 | Ga0373923_0007172_1735_2223 | 162 |
| 620 | 3300035112 | Ga0373932_0082230 | Ga0373932_0082230_287_775 | 162 |
| 621 | 3300035113 | Ga0373936_0038057 | Ga0373936_0038057_185_673 | 162 |
| 622 | 3300035113 | Ga0373936_0046065 | Ga0373936_0046065_1141_1629 | 162 |
| 623 | 3300035113 | Ga0373936_0075618 | Ga0373936_0075618_664_1152 | 162 |
| 624 | 3300035113 | Ga0373936_0302135 | Ga0373936_0302135_109_597 | 162 |
| 625 | 3300035116 | Ga0373945_0006472 | Ga0373945_0006472_3060_3548 | 162 |
| 626 | 3300035116 | Ga0373945_0260912 | Ga0373945_0260912_133_621 | 162 |
| 627 | 3300035117 | Ga0373953_0049275 | Ga0373953_0049275_19_507 | 162 |
| 628 | 3300035121 | Ga0373960_0046468 | Ga0373960_0046468_651_1139 | 162 |
| 629 | 3300035170 | Ga0373943_0127658 | Ga0373943_0127658_249_737 | 162 |
| 630 | 3300035171 | Ga0373946_0200659 | Ga0373946_0200659_174_662 | 162 |
| 631 | 3300035171 | Ga0373946_0366950 | Ga0373946_0366950_106_594 | 162 |
| 632 | 3300035691 | Ga0373931_0000915 | Ga0373931_0000915_6864_7352 | 162 |
| 633 | 3300035692 | Ga0373935_0073599 | Ga0373935_0073599_501_989 | 162 |
| 634 | 3300035692 | Ga0373935_0151442 | Ga0373935_0151442_141_629 | 162 |
| 635 | 3300035695 | Ga0373927_0003250 | Ga0373927_0003250_2458_2946 | 162 |
| 636 | 3300035695 | Ga0373927_0005961 | Ga0373927_0005961_4779_5267 | 162 |
| 637 | 3300035695 | Ga0373927_0032352 | Ga0373927_0032352_484_972 | 162 |
| 638 | 3300035695 | Ga0373927_0074901 | Ga0373927_0074901_1684_2172 | 162 |
| 639 | 3300035695 | Ga0373927_0080688 | Ga0373927_0080688_823_1311 | 162 |
| 640 | 3300035695 | Ga0373927_0131012 | Ga0373927_0131012_113_601 | 162 |
| 641 | 3300035695 | Ga0373927_0485256 | Ga0373927_0485256_20_508 | 162 |
| 642 | 3300035724 | Ga0373933_0000536 | Ga0373933_0000536_21355_21843 | 162 |
| 643 | 3300035724 | Ga0373933_0009887 | Ga0373933_0009887_3195_3683 | 162 |
| 644 | 3300035724 | Ga0373933_0579030 | Ga0373933_0579030_40_528 | 162 |
| 645 | 3300035725 | Ga0373947_0078460 | Ga0373947_0078460_1167_1655 | 162 |
| 646 | 3300035725 | Ga0373947_0125529 | Ga0373947_0125529_355_843 | 162 |
| 647 | 3300035725 | Ga0373947_0305050 | Ga0373947_0305050_532_1020 | 162 |
| 648 | 3300035725 | Ga0373947_0307882 | Ga0373947_0307882_60_548 | 162 |
| 649 | 3300036401 | Ga0373937_0021969 | Ga0373937_0021969_642_1130 | 162 |
| 650 | 3300036459 | Ga0372808_000838 | Ga0372808_000838_1143_1631 | 162 |
| 651 | 3300037068 | Ga0373925_0036358 | Ga0373925_0036358_1812_2300 | 162 |
| 652 | 3300037068 | Ga0373925_0173379 | Ga0373925_0173379_521_1009 | 162 |
| 653 | 3300037068 | Ga0373925_0477839 | Ga0373925_0477839_402_890 | 162 |
| 654 | 3300037418 | Ga0395900_0095404 | Ga0395900_0095404_28_516 | 162 |
| 655 | 3300037418 | Ga0395900_0417097 | Ga0395900_0417097_182_676 | 162 |
| 656 | 3300037466 | Ga0395898_0035381 | Ga0395898_0035381_282_770 | 162 |
| 657 | 3300037466 | Ga0395898_0054928 | Ga0395898_0054928_2739_3227 | 162 |
| 658 | 3300037466 | Ga0395898_0108406 | Ga0395898_0108406_1244_1738 | 162 |
| 659 | 3300037471 | Ga0395905_1096722 | Ga0395905_1096722_70_558 | 162 |
| 660 | 3300037853 | Ga0436364_0982560 | Ga0436364_0982560_5018_5506 | 162 |
| 661 | 3300037853 | Ga0436364_1143755 | Ga0436364_1143755_795_1283 | 162 |
| 662 | 3300039437 | Ga0436365_0205832 | Ga0436365_0205832_6097_6585 | 162 |
| 663 | 3300039437 | Ga0436365_0924470 | Ga0436365_0924470_1133_1621 | 162 |
| 664 | 3300039438 | Ga0436360_0179349 | Ga0436360_0179349_94_582 | 162 |
| 665 | 3300039438 | Ga0436360_1291396 | Ga0436360_1291396_496_984 | 162 |
| 666 | 3300039447 | Ga0436361_0028451 | Ga0436361_0028451_255_743 | 162 |
| 667 | 3300039447 | Ga0436361_0339604 | Ga0436361_0339604_986_1474 | 162 |
| 668 | 3300039450 | Ga0436363_1083454 | Ga0436363_1083454_671_1159 | 162 |
| 669 | 3300039450 | Ga0436363_1193054 | Ga0436363_1193054_827_1315 | 162 |
| 670 | 3300039453 | Ga0436362_0088613 | Ga0436362_0088613_5715_6203 | 162 |
| 671 | 3300039453 | Ga0436362_0915997 | Ga0436362_0915997_240_830 | 162 |
| 672 | 3300041452 | Ga0451793_1853703 | Ga0451793_1853703_303_815 | 162 |
| 673 | 3300041492 | Ga0451835_0578077 | Ga0451835_0578077_145_633 | 162 |
| 674 | 3300041512 | Ga0451853_0044773 | Ga0451853_0044773_124_612 | 162 |
| 675 | 3300041512 | Ga0451853_1423910 | Ga0451853_1423910_169_657 | 162 |
| 676 | 3300042012 | Ga0439455_0065262 | Ga0439455_0065262_207_695 | 162 |
| 677 | 3300044656 | Ga0466969_0129919 | Ga0466969_0129919_53_541 | 162 |
| 678 | 3300044693 | Ga0466961_0465244 | Ga0466961_0465244_172_660 | 162 |
| 679 | 3300044735 | Ga0466968_0111699 | Ga0466968_0111699_680_1168 | 162 |
| 680 | 3300044765 | Ga0466970_0223633 | Ga0466970_0223633_205_693 | 162 |
| 681 | 3300044765 | Ga0466970_0416689 | Ga0466970_0416689_182_670 | 162 |
| 682 | 3300044842 | Ga0466957_0587806 | Ga0466957_0587806_279_767 | 162 |
| 683 | 3300045049 | Ga0466959_0102092 | Ga0466959_0102092_1276_1764 | 162 |
| 684 | 3300045049 | Ga0466959_0761497 | Ga0466959_0761497_97_585 | 162 |
| 685 | 3300045976 | Ga0466967_1372846 | Ga0466967_1372846_104_592 | 162 |
| 686 | 3300046452 | Ga0495617_035898 | Ga0495617_035898_61_549 | 162 |
| 687 | 3300046453 | Ga0495627_095052 | Ga0495627_095052_327_815 | 162 |
| 688 | 3300046454 | Ga0495592_0038026 | Ga0495592_0038026_2422_2910 | 162 |
| 689 | 3300046455 | Ga0495603_0022523 | Ga0495603_0022523_2280_2768 | 162 |
| 690 | 3300046455 | Ga0495603_0025847 | Ga0495603_0025847_728_1216 | 162 |
| 691 | 3300046455 | Ga0495603_0521846 | Ga0495603_0521846_43_531 | 162 |
| 692 | 3300046457 | Ga0495590_0065417 | Ga0495590_0065417_626_1114 | 162 |
| 693 | 3300046459 | Ga0495629_0182227 | Ga0495629_0182227_927_1415 | 162 |
| 694 | 3300046459 | Ga0495629_0184168 | Ga0495629_0184168_723_1211 | 162 |
| 695 | 3300046459 | Ga0495629_0567327 | Ga0495629_0567327_158_646 | 162 |
| 696 | 3300046459 | Ga0495629_0868525 | Ga0495629_0868525_87_575 | 162 |
| 697 | 3300046460 | Ga0495638_0054657 | Ga0495638_0054657_757_1245 | 162 |
| 698 | 3300046461 | Ga0495641_0044799 | Ga0495641_0044799_620_1108 | 162 |
| 699 | 3300046461 | Ga0495641_0369729 | Ga0495641_0369729_88_576 | 162 |
| 700 | 3300046462 | Ga0495651_0113504 | Ga0495651_0113504_375_863 | 162 |
| 701 | 3300046462 | Ga0495651_0117170 | Ga0495651_0117170_770_1258 | 162 |
| 702 | 3300046472 | Ga0495580_0009940 | Ga0495580_0009940_3805_4293 | 162 |
| 703 | 3300046472 | Ga0495580_0530150 | Ga0495580_0530150_187_675 | 162 |
| 704 | 3300046473 | Ga0495582_0007218 | Ga0495582_0007218_5433_5921 | 162 |
| 705 | 3300046473 | Ga0495582_0344184 | Ga0495582_0344184_238_726 | 162 |
| 706 | 3300046474 | Ga0495605_0066802 | Ga0495605_0066802_1201_1689 | 162 |
| 707 | 3300046475 | Ga0495639_0014200 | Ga0495639_0014200_2117_2605 | 162 |
| 708 | 3300046475 | Ga0495639_0133759 | Ga0495639_0133759_595_1083 | 162 |
| 709 | 3300046475 | Ga0495639_0312781 | Ga0495639_0312781_278_766 | 162 |
| 710 | 3300046476 | Ga0495662_0205676 | Ga0495662_0205676_228_716 | 162 |
| 711 | 3300046477 | Ga0495664_0015668 | Ga0495664_0015668_2279_2767 | 162 |
| 712 | 3300046477 | Ga0495664_0016768 | Ga0495664_0016768_3065_3553 | 162 |
| 713 | 3300046477 | Ga0495664_0091152 | Ga0495664_0091152_137_625 | 162 |
| 714 | 3300046477 | Ga0495664_0428084 | Ga0495664_0428084_214_702 | 162 |
| 715 | 3300046491 | Ga0495584_0286735 | Ga0495584_0286735_53_541 | 162 |
| 716 | 3300046491 | Ga0495584_0385134 | Ga0495584_0385134_62_550 | 162 |
| 717 | 3300046492 | Ga0495585_0082648 | Ga0495585_0082648_1099_1587 | 162 |
| 718 | 3300046492 | Ga0495585_0087368 | Ga0495585_0087368_1027_1515 | 162 |
| 719 | 3300046492 | Ga0495585_0544216 | Ga0495585_0544216_36_524 | 162 |
| 720 | 3300046500 | Ga0495596_0032426 | Ga0495596_0032426_1335_1823 | 162 |
| 721 | 3300046500 | Ga0495596_0145491 | Ga0495596_0145491_54_542 | 162 |
| 722 | 3300046500 | Ga0495596_0273855 | Ga0495596_0273855_122_610 | 162 |
| 723 | 3300046501 | Ga0495607_0244587 | Ga0495607_0244587_42_530 | 162 |
| 724 | 3300046506 | Ga0495583_0048885 | Ga0495583_0048885_1121_1609 | 162 |
| 725 | 3300046506 | Ga0495583_0157240 | Ga0495583_0157240_251_739 | 162 |
| 726 | 3300046507 | Ga0495606_0155528 | Ga0495606_0155528_398_886 | 162 |
| 727 | 3300046507 | Ga0495606_0302575 | Ga0495606_0302575_335_823 | 162 |
| 728 | 3300046507 | Ga0495606_0554059 | Ga0495606_0554059_17_505 | 162 |
| 729 | 3300046511 | Ga0495608_0175709 | Ga0495608_0175709_564_1052 | 162 |
| 730 | 3300046511 | Ga0495608_0316986 | Ga0495608_0316986_170_658 | 162 |
| 731 | 3300046511 | Ga0495608_0692296 | Ga0495608_0692296_88_576 | 162 |
| 732 | 3300046513 | Ga0495616_0059046 | Ga0495616_0059046_390_878 | 162 |
| 733 | 3300046513 | Ga0495616_0414348 | Ga0495616_0414348_18_506 | 162 |
| 734 | 3300046514 | Ga0495618_0022470 | Ga0495618_0022470_748_1236 | 162 |
| 735 | 3300046515 | Ga0495620_0078980 | Ga0495620_0078980_324_812 | 162 |
| 736 | 3300046516 | Ga0495628_0546390 | Ga0495628_0546390_35_523 | 162 |
| 737 | 3300046516 | Ga0495628_0822976 | Ga0495628_0822976_71_559 | 162 |
| 738 | 3300046517 | Ga0495630_0040315 | Ga0495630_0040315_2991_3479 | 162 |
| 739 | 3300046517 | Ga0495630_0733223 | Ga0495630_0733223_89_577 | 162 |
| 740 | 3300046518 | Ga0495631_0038572 | Ga0495631_0038572_1037_1525 | 162 |
| 741 | 3300046518 | Ga0495631_0068981 | Ga0495631_0068981_89_577 | 162 |
| 742 | 3300046518 | Ga0495631_0114158 | Ga0495631_0114158_208_696 | 162 |
| 743 | 3300046518 | Ga0495631_0130948 | Ga0495631_0130948_174_662 | 162 |
| 744 | 3300046518 | Ga0495631_0264148 | Ga0495631_0264148_38_526 | 162 |
| 745 | 3300046519 | Ga0495632_0107100 | Ga0495632_0107100_48_536 | 162 |
| 746 | 3300046519 | Ga0495632_0142233 | Ga0495632_0142233_165_653 | 162 |
| 747 | 3300046520 | Ga0495637_0020908 | Ga0495637_0020908_2458_2946 | 162 |
| 748 | 3300046523 | Ga0495644_0216776 | Ga0495644_0216776_40_528 | 162 |
| 749 | 3300046524 | Ga0495648_0067597 | Ga0495648_0067597_523_1011 | 162 |
| 750 | 3300046529 | Ga0495652_0264476 | Ga0495652_0264476_531_1019 | 162 |
| 751 | 3300046529 | Ga0495652_0288021 | Ga0495652_0288021_39_527 | 162 |
| 752 | 3300046530 | Ga0495654_0126291 | Ga0495654_0126291_486_974 | 162 |
| 753 | 3300046535 | Ga0495586_0104521 | Ga0495586_0104521_222_710 | 162 |
| 754 | 3300046537 | Ga0495598_0048896 | Ga0495598_0048896_132_620 | 162 |
| 755 | 3300046542 | Ga0495597_0025983 | Ga0495597_0025983_1908_2396 | 162 |
| 756 | 3300046542 | Ga0495597_0095688 | Ga0495597_0095688_663_1151 | 162 |
| 757 | 3300046543 | Ga0495645_0064136 | Ga0495645_0064136_1402_1890 | 162 |
| 758 | 3300046543 | Ga0495645_0135798 | Ga0495645_0135798_139_627 | 162 |
| 759 | 3300046557 | Ga0495622_0138326 | Ga0495622_0138326_53_541 | 162 |
| 760 | 3300046557 | Ga0495622_0240388 | Ga0495622_0240388_95_583 | 162 |
| 761 | 3300046558 | Ga0495633_0195751 | Ga0495633_0195751_391_879 | 162 |
| 762 | 3300046558 | Ga0495633_0333405 | Ga0495633_0333405_151_639 | 162 |
| 763 | 3300046559 | Ga0495667_0081398 | Ga0495667_0081398_664_1152 | 162 |
| 764 | 3300046559 | Ga0495667_0301080 | Ga0495667_0301080_207_695 | 162 |
| 765 | 3300046615 | Ga0495656_0008259 | Ga0495656_0008259_2371_2859 | 162 |
| 766 | 3300046615 | Ga0495656_0215723 | Ga0495656_0215723_202_690 | 162 |
| 767 | 3300046615 | Ga0495656_0255403 | Ga0495656_0255403_204_692 | 162 |
| 768 | 3300046615 | Ga0495656_0312739 | Ga0495656_0312739_219_707 | 162 |
| 769 | 3300046616 | Ga0495668_0017269 | Ga0495668_0017269_2826_3314 | 162 |
| 770 | 3300046616 | Ga0495668_0177892 | Ga0495668_0177892_261_749 | 162 |
| 771 | 3300046642 | Ga0495634_0065864 | Ga0495634_0065864_1881_2369 | 162 |
| 772 | 3300046642 | Ga0495634_0502189 | Ga0495634_0502189_40_528 | 162 |
| 773 | 3300046648 | Ga0495611_0169521 | Ga0495611_0169521_489_977 | 162 |
| 774 | 3300046660 | Ga0495625_0242268 | Ga0495625_0242268_488_976 | 162 |
| 775 | 3300046660 | Ga0495625_0364230 | Ga0495625_0364230_384_872 | 162 |
| 776 | 3300046663 | Ga0495635_0098507 | Ga0495635_0098507_373_861 | 162 |
| 777 | 3300046663 | Ga0495635_0449267 | Ga0495635_0449267_222_710 | 162 |
| 778 | 3300046665 | Ga0495661_0150860 | Ga0495661_0150860_234_722 | 162 |
| 779 | 3300046674 | Ga0495588_0036900 | Ga0495588_0036900_25_513 | 162 |
| 780 | 3300046674 | Ga0495588_0038457 | Ga0495588_0038457_1613_2101 | 162 |
| 781 | 3300046674 | Ga0495588_0153256 | Ga0495588_0153256_248_736 | 162 |
| 782 | 3300046675 | Ga0495657_0051753 | Ga0495657_0051753_907_1395 | 162 |
| 783 | 3300046678 | Ga0495599_0221366 | Ga0495599_0221366_333_821 | 162 |
| 784 | 3300046678 | Ga0495599_0510830 | Ga0495599_0510830_175_663 | 162 |
| 785 | 3300046679 | Ga0495623_0090972 | Ga0495623_0090972_581_1069 | 162 |
| 786 | 3300046680 | Ga0495646_0015482 | Ga0495646_0015482_1683_2171 | 162 |
| 787 | 3300046681 | Ga0495647_0026501 | Ga0495647_0026501_650_1138 | 162 |
| 788 | 3300046681 | Ga0495647_0194729 | Ga0495647_0194729_70_558 | 162 |
| 789 | 3300046683 | Ga0495658_0338535 | Ga0495658_0338535_439_927 | 162 |
| 790 | 3300046683 | Ga0495658_0507078 | Ga0495658_0507078_65_553 | 162 |
| 791 | 3300046684 | Ga0495669_0002775 | Ga0495669_0002775_1167_1655 | 162 |
| 792 | 3300046684 | Ga0495669_0019989 | Ga0495669_0019989_1304_1792 | 162 |
| 793 | 3300046689 | Ga0495613_0286885 | Ga0495613_0286885_519_1007 | 162 |
| 794 | 3300046690 | Ga0495624_0050542 | Ga0495624_0050542_1306_1794 | 162 |
| 795 | 3300046690 | Ga0495624_0183834 | Ga0495624_0183834_100_588 | 162 |
| 796 | 3300046691 | Ga0495670_0153058 | Ga0495670_0153058_232_720 | 162 |
| 797 | 3300046691 | Ga0495670_0561006 | Ga0495670_0561006_46_534 | 162 |
| 798 | 3300046694 | Ga0495649_0224752 | Ga0495649_0224752_91_579 | 162 |
| 799 | 3300046794 | Ga0495589_0247741 | Ga0495589_0247741_21_509 | 162 |
| 800 | 3300046794 | Ga0495589_0345063 | Ga0495589_0345063_29_517 | 162 |
| 801 | 3300046809 | Ga0495600_0055460 | Ga0495600_0055460_1196_1684 | 162 |
| 802 | 3300046810 | Ga0495660_0070392 | Ga0495660_0070392_980_1468 | 162 |
| 803 | 3300046810 | Ga0495660_0076497 | Ga0495660_0076497_1102_1590 | 162 |
| 804 | 3300047315 | Ga0495581_0018052 | Ga0495581_0018052_3427_3915 | 162 |
| 805 | 3300047315 | Ga0495581_0324521 | Ga0495581_0324521_372_860 | 162 |
| 806 | 3300047317 | Ga0495604_0665217 | Ga0495604_0665217_33_521 | 162 |
| 807 | 3300047317 | Ga0495604_0734151 | Ga0495604_0734151_40_528 | 162 |
| 808 | 3300047318 | Ga0495636_0112816 | Ga0495636_0112816_395_883 | 162 |
| 809 | 3300047318 | Ga0495636_0203635 | Ga0495636_0203635_136_624 | 162 |
| 810 | 3300047318 | Ga0495636_0258248 | Ga0495636_0258248_127_615 | 162 |
| 811 | 3300047319 | Ga0495674_0012852 | Ga0495674_0012852_3825_4313 | 162 |
| 812 | 3300047319 | Ga0495674_0142272 | Ga0495674_0142272_173_661 | 162 |
| 813 | 3300047320 | Ga0495672_0024770 | Ga0495672_0024770_1920_2408 | 162 |
| 814 | 3300047320 | Ga0495672_0052208 | Ga0495672_0052208_1679_2167 | 162 |
| 815 | 3300047320 | Ga0495672_0098193 | Ga0495672_0098193_559_1047 | 162 |
| 816 | 3300047320 | Ga0495672_0100853 | Ga0495672_0100853_483_971 | 162 |
| 817 | 3300047321 | Ga0495676_0092919 | Ga0495676_0092919_1751_2239 | 162 |
| 818 | 3300047321 | Ga0495676_0781324 | Ga0495676_0781324_33_521 | 162 |
| 819 | 3300047322 | Ga0495680_0394090 | Ga0495680_0394090_343_831 | 162 |
| 820 | 3300047443 | Ga0495687_035147 | Ga0495687_035147_1072_1560 | 162 |
| 821 | 3300047444 | Ga0495675_0255568 | Ga0495675_0255568_479_967 | 162 |
| 822 | 3300047445 | Ga0495677_0210766 | Ga0495677_0210766_190_678 | 162 |
| 823 | 3300047445 | Ga0495677_0215538 | Ga0495677_0215538_46_534 | 162 |
| 824 | 3300047446 | Ga0495679_076078 | Ga0495679_076078_255_743 | 162 |
| 825 | 3300047469 | Ga0495673_0184098 | Ga0495673_0184098_53_541 | 162 |
| 826 | 3300047471 | Ga0495684_0105554 | Ga0495684_0105554_1538_2026 | 162 |
| 827 | 3300047472 | Ga0495686_0038202 | Ga0495686_0038202_2088_2576 | 162 |
| 828 | 3300047472 | Ga0495686_0045381 | Ga0495686_0045381_1575_2063 | 162 |
| 829 | 3300048088 | Ga0495602_0232981 | Ga0495602_0232981_626_1114 | 162 |
| 830 | 3300048088 | Ga0495602_0237796 | Ga0495602_0237796_866_1354 | 162 |
| 831 | 3300048091 | Ga0495626_0061888 | Ga0495626_0061888_1008_1496 | 162 |
| 832 | 3300048903 | Ga0496100_0007336 | Ga0496100_0007336_4474_4962 | 162 |
| 833 | 3300048903 | Ga0496100_0209783 | Ga0496100_0209783_877_1365 | 162 |
| 834 | 3300048903 | Ga0496100_0243050 | Ga0496100_0243050_650_1138 | 162 |
| 835 | 3300048903 | Ga0496100_0406779 | Ga0496100_0406779_136_624 | 162 |
| 836 | 3300048903 | Ga0496100_0859312 | Ga0496100_0859312_17_505 | 162 |
| 837 | 3300048904 | Ga0496101_0002063 | Ga0496101_0002063_8586_9074 | 162 |
| 838 | 3300048904 | Ga0496101_0006658 | Ga0496101_0006658_6222_6710 | 162 |
| 839 | 3300048904 | Ga0496101_0061032 | Ga0496101_0061032_1304_1792 | 162 |
| 840 | 3300048904 | Ga0496101_0546338 | Ga0496101_0546338_304_792 | 162 |
| 841 | 3300048905 | Ga0496102_0002920 | Ga0496102_0002920_10481_10969 | 162 |
| 842 | 3300048905 | Ga0496102_0023415 | Ga0496102_0023415_1617_2105 | 162 |
| 843 | 3300048905 | Ga0496102_0157380 | Ga0496102_0157380_712_1200 | 162 |
| 844 | 3300048905 | Ga0496102_0196308 | Ga0496102_0196308_266_754 | 162 |
| 845 | 3300048905 | Ga0496102_0300694 | Ga0496102_0300694_203_691 | 162 |
| 846 | 3300048906 | Ga0496103_0060499 | Ga0496103_0060499_335_823 | 162 |
| 847 | 3300048907 | Ga0496104_0044633 | Ga0496104_0044633_2925_3413 | 162 |
| 848 | 3300048907 | Ga0496104_0044919 | Ga0496104_0044919_1808_2296 | 162 |
| 849 | 3300048907 | Ga0496104_0174939 | Ga0496104_0174939_1159_1647 | 162 |
| 850 | 3300048908 | Ga0496105_0001825 | Ga0496105_0001825_12597_13085 | 162 |
| 851 | 3300048909 | Ga0496106_0000743 | Ga0496106_0000743_7878_8366 | 162 |
| 852 | 3300048909 | Ga0496106_0005280 | Ga0496106_0005280_6948_7436 | 162 |
| 853 | 3300048909 | Ga0496106_0029914 | Ga0496106_0029914_2166_2654 | 162 |
| 854 | 3300048909 | Ga0496106_0132630 | Ga0496106_0132630_534_1022 | 162 |
| 855 | 3300048909 | Ga0496106_0716970 | Ga0496106_0716970_29_517 | 162 |
| 856 | 3300048910 | Ga0496107_0013354 | Ga0496107_0013354_3276_3764 | 162 |
| 857 | 3300048910 | Ga0496107_0052957 | Ga0496107_0052957_413_901 | 162 |
| 858 | 3300048911 | Ga0496108_0001385 | Ga0496108_0001385_1163_1651 | 162 |
| 859 | 3300048911 | Ga0496108_0299562 | Ga0496108_0299562_411_899 | 162 |
| 860 | 3300048911 | Ga0496108_1084554 | Ga0496108_1084554_115_603 | 162 |
| 861 | 3300048912 | Ga0496109_0018394 | Ga0496109_0018394_2814_3302 | 162 |
| 862 | 3300048912 | Ga0496109_0024523 | Ga0496109_0024523_2935_3423 | 162 |
| 863 | 3300048913 | Ga0496110_0041497 | Ga0496110_0041497_1387_1875 | 162 |
| 864 | 3300048913 | Ga0496110_0053691 | Ga0496110_0053691_3021_3509 | 162 |
| 865 | 3300048913 | Ga0496110_0252065 | Ga0496110_0252065_186_674 | 162 |
| 866 | 3300048914 | Ga0496111_0063898 | Ga0496111_0063898_530_1018 | 162 |
| 867 | 3300048914 | Ga0496111_0228175 | Ga0496111_0228175_707_1195 | 162 |
| 868 | 3300048914 | Ga0496111_0366214 | Ga0496111_0366214_147_635 | 162 |
| 869 | 3300048915 | Ga0496112_0000023 | Ga0496112_0000023_144427_144915 | 162 |
| 870 | 3300048915 | Ga0496112_0002038 | Ga0496112_0002038_12842_13330 | 162 |
| 871 | 3300048915 | Ga0496112_0005113 | Ga0496112_0005113_2179_2667 | 162 |
| 872 | 3300048915 | Ga0496112_0115648 | Ga0496112_0115648_1080_1568 | 162 |
| 873 | 3300048915 | Ga0496112_0422591 | Ga0496112_0422591_651_1139 | 162 |
| 874 | 3300048915 | Ga0496112_0452333 | Ga0496112_0452333_258_746 | 162 |
| 875 | 3300048915 | Ga0496112_0964275 | Ga0496112_0964275_93_581 | 162 |
| 876 | 3300048915 | Ga0496112_1099666 | Ga0496112_1099666_100_588 | 162 |
| 877 | 3300048916 | Ga0496113_0001405 | Ga0496113_0001405_1812_2300 | 162 |
| 878 | 3300048916 | Ga0496113_0014962 | Ga0496113_0014962_2877_3365 | 162 |
| 879 | 3300048916 | Ga0496113_0040253 | Ga0496113_0040253_925_1413 | 162 |
| 880 | 3300048917 | Ga0496114_0014943 | Ga0496114_0014943_1517_2005 | 162 |
| 881 | 3300048917 | Ga0496114_0275580 | Ga0496114_0275580_62_550 | 162 |
| 882 | 3300048917 | Ga0496114_0554520 | Ga0496114_0554520_249_737 | 162 |
| 883 | 3300048917 | Ga0496114_0713976 | Ga0496114_0713976_169_657 | 162 |
| 884 | 3300048917 | Ga0496114_0902272 | Ga0496114_0902272_36_524 | 162 |
| 885 | 3300048918 | Ga0496115_0000800 | Ga0496115_0000800_9867_10355 | 162 |
| 886 | 3300048918 | Ga0496115_0024514 | Ga0496115_0024514_2128_2616 | 162 |
| 887 | 3300048918 | Ga0496115_0086214 | Ga0496115_0086214_1736_2224 | 162 |
| 888 | 3300048918 | Ga0496115_0744485 | Ga0496115_0744485_39_527 | 162 |
| 889 | 3300048919 | Ga0496116_0004324 | Ga0496116_0004324_679_1167 | 162 |
| 890 | 3300048919 | Ga0496116_0072522 | Ga0496116_0072522_191_679 | 162 |
| 891 | 3300048919 | Ga0496116_0084975 | Ga0496116_0084975_351_839 | 162 |
| 892 | 3300048919 | Ga0496116_0267094 | Ga0496116_0267094_195_683 | 162 |
| 893 | 3300048920 | Ga0496117_0009472 | Ga0496117_0009472_1517_2005 | 162 |
| 894 | 3300048920 | Ga0496117_0060686 | Ga0496117_0060686_2027_2515 | 162 |
| 895 | 3300048920 | Ga0496117_0061687 | Ga0496117_0061687_1405_1893 | 162 |
| 896 | 3300048920 | Ga0496117_0102981 | Ga0496117_0102981_866_1354 | 162 |
| 897 | 3300048921 | Ga0496118_0002385 | Ga0496118_0002385_17863_18351 | 162 |
| 898 | 3300048921 | Ga0496118_0022944 | Ga0496118_0022944_1180_1668 | 162 |
| 899 | 3300048921 | Ga0496118_0040700 | Ga0496118_0040700_2702_3190 | 162 |
| 900 | 3300048921 | Ga0496118_0112935 | Ga0496118_0112935_456_944 | 162 |
| 901 | 3300048921 | Ga0496118_0232350 | Ga0496118_0232350_342_830 | 162 |
| 902 | 3300048922 | Ga0496119_0071155 | Ga0496119_0071155_550_1038 | 162 |
| 903 | 3300048923 | Ga0496120_0014398 | Ga0496120_0014398_3829_4317 | 162 |
| 904 | 3300048923 | Ga0496120_0032697 | Ga0496120_0032697_775_1263 | 162 |
| 905 | 3300048923 | Ga0496120_0423439 | Ga0496120_0423439_10_498 | 162 |
| 906 | 3300048924 | Ga0496121_0000555 | Ga0496121_0000555_27621_28109 | 162 |
| 907 | 3300048924 | Ga0496121_0001104 | Ga0496121_0001104_16546_17034 | 162 |
| 908 | 3300048924 | Ga0496121_0004417 | Ga0496121_0004417_15970_16458 | 162 |
| 909 | 3300048924 | Ga0496121_0006145 | Ga0496121_0006145_4161_4649 | 162 |
| 910 | 3300048924 | Ga0496121_0008758 | Ga0496121_0008758_8049_8537 | 162 |
| 911 | 3300048924 | Ga0496121_0030175 | Ga0496121_0030175_184_672 | 162 |
| 912 | 3300048924 | Ga0496121_0088762 | Ga0496121_0088762_1470_1958 | 162 |
| 913 | 3300048924 | Ga0496121_0093652 | Ga0496121_0093652_1122_1610 | 162 |
| 914 | 3300048924 | Ga0496121_0101048 | Ga0496121_0101048_1725_2213 | 162 |
| 915 | 3300048924 | Ga0496121_0104189 | Ga0496121_0104189_1474_1962 | 162 |
| 916 | 3300048924 | Ga0496121_0111552 | Ga0496121_0111552_1181_1669 | 162 |
| 917 | 3300048924 | Ga0496121_0121837 | Ga0496121_0121837_626_1114 | 162 |
| 918 | 3300048924 | Ga0496121_0135368 | Ga0496121_0135368_383_871 | 162 |
| 919 | 3300048924 | Ga0496121_0140641 | Ga0496121_0140641_359_847 | 162 |
| 920 | 3300048924 | Ga0496121_0185157 | Ga0496121_0185157_203_691 | 162 |
| 921 | 3300048924 | Ga0496121_0293576 | Ga0496121_0293576_401_889 | 162 |
| 922 | 3300048924 | Ga0496121_0411354 | Ga0496121_0411354_59_547 | 162 |
| 923 | 3300048924 | Ga0496121_0571984 | Ga0496121_0571984_70_558 | 162 |
| 924 | 3300048925 | Ga0496122_0093358 | Ga0496122_0093358_493_981 | 162 |
| 925 | 3300048925 | Ga0496122_0220033 | Ga0496122_0220033_68_556 | 162 |
| 926 | 3300048927 | Ga0496124_0003672 | Ga0496124_0003672_16020_16508 | 162 |
| 927 | 3300048927 | Ga0496124_0155574 | Ga0496124_0155574_801_1289 | 162 |
| 928 | 3300048927 | Ga0496124_0210764 | Ga0496124_0210764_853_1341 | 162 |
| 929 | 3300048927 | Ga0496124_0348767 | Ga0496124_0348767_153_641 | 162 |
| 930 | 3300048927 | Ga0496124_0444985 | Ga0496124_0444985_357_845 | 162 |
| 931 | 3300048928 | Ga0496125_0008907 | Ga0496125_0008907_2763_3251 | 162 |
| 932 | 3300048928 | Ga0496125_0013241 | Ga0496125_0013241_1903_2391 | 162 |
| 933 | 3300048928 | Ga0496125_0044576 | Ga0496125_0044576_1810_2298 | 162 |
| 934 | 3300048928 | Ga0496125_0397670 | Ga0496125_0397670_213_701 | 162 |
| 935 | 3300048929 | Ga0496126_0006275 | Ga0496126_0006275_6423_6911 | 162 |
| 936 | 3300048929 | Ga0496126_0009900 | Ga0496126_0009900_2122_2610 | 162 |
| 937 | 3300048929 | Ga0496126_0020393 | Ga0496126_0020393_216_704 | 162 |
| 938 | 3300048929 | Ga0496126_0023944 | Ga0496126_0023944_3294_3782 | 162 |
| 939 | 3300048929 | Ga0496126_0055111 | Ga0496126_0055111_340_828 | 162 |
| 940 | 3300048929 | Ga0496126_0063893 | Ga0496126_0063893_924_1412 | 162 |
| 941 | 3300048929 | Ga0496126_0107344 | Ga0496126_0107344_137_625 | 162 |
| 942 | 3300048929 | Ga0496126_0138204 | Ga0496126_0138204_299_787 | 162 |
| 943 | 3300048929 | Ga0496126_0367815 | Ga0496126_0367815_164_652 | 162 |
| 944 | 3300048929 | Ga0496126_0392351 | Ga0496126_0392351_444_932 | 162 |
| 945 | 3300049459 | Ga0495678_052183 | Ga0495678_052183_952_1440 | 162 |
| 946 | 3300049459 | Ga0495678_070390 | Ga0495678_070390_538_1026 | 162 |
| 947 | 3300049460 | Ga0495682_0147443 | Ga0495682_0147443_147_635 | 162 |
| 948 | 3300049568 | Ga0501031_0000823 | Ga0501031_0000823_924_1412 | 162 |
| 949 | 3300049568 | Ga0501031_0088622 | Ga0501031_0088622_1445_1933 | 162 |
| 950 | 3300049568 | Ga0501031_0119769 | Ga0501031_0119769_834_1322 | 162 |
| 951 | 3300049568 | Ga0501031_0361128 | Ga0501031_0361128_97_585 | 162 |
| 952 | 3300049569 | Ga0501032_0000030 | Ga0501032_0000030_94270_94758 | 162 |
| 953 | 3300049569 | Ga0501032_0342406 | Ga0501032_0342406_436_924 | 162 |
| 954 | 3300049570 | Ga0501033_0000060 | Ga0501033_0000060_15754_16242 | 162 |
| 955 | 3300049570 | Ga0501033_0034480 | Ga0501033_0034480_2935_3423 | 162 |
| 956 | 3300049570 | Ga0501033_0294131 | Ga0501033_0294131_607_1095 | 162 |
| 957 | 3300049571 | Ga0501034_0000117 | Ga0501034_0000117_50418_50906 | 162 |
| 958 | 3300049571 | Ga0501034_0141891 | Ga0501034_0141891_1845_2333 | 162 |
| 959 | 3300049571 | Ga0501034_0149676 | Ga0501034_0149676_1144_1632 | 162 |
| 960 | 3300049571 | Ga0501034_0214822 | Ga0501034_0214822_10_498 | 162 |
| 961 | 3300049571 | Ga0501034_0225737 | Ga0501034_0225737_44_532 | 162 |
| 962 | 3300049571 | Ga0501034_0229035 | Ga0501034_0229035_75_563 | 162 |
| 963 | 3300049571 | Ga0501034_1147853 | Ga0501034_1147853_22_516 | 162 |
| 964 | 3300049572 | Ga0501036_0000148 | Ga0501036_0000148_23941_24429 | 162 |
| 965 | 3300049572 | Ga0501036_0081074 | Ga0501036_0081074_1347_1835 | 162 |
| 966 | 3300049572 | Ga0501036_0082295 | Ga0501036_0082295_1371_1859 | 162 |
| 967 | 3300049572 | Ga0501036_0473214 | Ga0501036_0473214_104_592 | 162 |
| 968 | 3300049572 | Ga0501036_1090023 | Ga0501036_1090023_119_607 | 162 |
| 969 | 3300049573 | Ga0501037_0000090 | Ga0501037_0000090_72195_72683 | 162 |
| 970 | 3300049573 | Ga0501037_0024322 | Ga0501037_0024322_2238_2726 | 162 |
| 971 | 3300049573 | Ga0501037_0506433 | Ga0501037_0506433_143_631 | 162 |
| 972 | 3300049574 | Ga0501038_0000441 | Ga0501038_0000441_16920_17408 | 162 |
| 973 | 3300049574 | Ga0501038_0080180 | Ga0501038_0080180_987_1475 | 162 |
| 974 | 3300049574 | Ga0501038_0139211 | Ga0501038_0139211_206_694 | 162 |
| 975 | 3300049574 | Ga0501038_0635107 | Ga0501038_0635107_115_603 | 162 |
| 976 | 3300049574 | Ga0501038_0892041 | Ga0501038_0892041_85_573 | 162 |
| 977 | 3300049575 | Ga0501039_0000443 | Ga0501039_0000443_23175_23663 | 162 |
| 978 | 3300049575 | Ga0501039_0031373 | Ga0501039_0031373_2496_2984 | 162 |
| 979 | 3300049575 | Ga0501039_0168611 | Ga0501039_0168611_1158_1646 | 162 |
| 980 | 3300049575 | Ga0501039_0272219 | Ga0501039_0272219_616_1104 | 162 |
| 981 | 3300049576 | Ga0501040_0538541 | Ga0501040_0538541_245_733 | 162 |
| 982 | 3300049576 | Ga0501040_0753248 | Ga0501040_0753248_168_656 | 162 |
| 983 | 3300049577 | Ga0501041_0109087 | Ga0501041_0109087_692_1180 | 162 |
| 984 | 3300049578 | Ga0501042_0006690 | Ga0501042_0006690_2421_2909 | 162 |
| 985 | 3300049578 | Ga0501042_0011206 | Ga0501042_0011206_3233_3721 | 162 |
| 986 | 3300049578 | Ga0501042_0088649 | Ga0501042_0088649_1260_1748 | 162 |
| 987 | 3300049579 | Ga0501043_0000919 | Ga0501043_0000919_15293_15781 | 162 |
| 988 | 3300049579 | Ga0501043_0024179 | Ga0501043_0024179_1239_1727 | 162 |
| 989 | 3300049579 | Ga0501043_0027132 | Ga0501043_0027132_2578_3066 | 162 |
| 990 | 3300049579 | Ga0501043_0070998 | Ga0501043_0070998_814_1302 | 162 |
| 991 | 3300049580 | Ga0501046_0000214 | Ga0501046_0000214_59437_59925 | 162 |
| 992 | 3300049580 | Ga0501046_0412349 | Ga0501046_0412349_428_916 | 162 |
| 993 | 3300049581 | Ga0501047_0000571 | Ga0501047_0000571_29653_30141 | 162 |
| 994 | 3300049581 | Ga0501047_0008142 | Ga0501047_0008142_1270_1758 | 162 |
| 995 | 3300049581 | Ga0501047_0364450 | Ga0501047_0364450_186_674 | 162 |
| 996 | 3300049581 | Ga0501047_0407940 | Ga0501047_0407940_303_791 | 162 |
| 997 | 3300049582 | Ga0501048_0000563 | Ga0501048_0000563_9025_9513 | 162 |
| 998 | 3300049582 | Ga0501048_0089334 | Ga0501048_0089334_1627_2115 | 162 |
| 999 | 3300049582 | Ga0501048_0378902 | Ga0501048_0378902_189_677 | 162 |
| 1000 | 3300049582 | Ga0501048_0861283 | Ga0501048_0861283_67_555 | 162 |
| 1001 | 3300049583 | Ga0501067_0001731 | Ga0501067_0001731_953_1441 | 162 |
| 1002 | 3300049583 | Ga0501067_0044658 | Ga0501067_0044658_1366_1854 | 162 |
| 1003 | 3300049583 | Ga0501067_0064718 | Ga0501067_0064718_1302_1790 | 162 |
| 1004 | 3300049583 | Ga0501067_0068385 | Ga0501067_0068385_1075_1563 | 162 |
| 1005 | 3300049584 | Ga0501068_0002870 | Ga0501068_0002870_2704_3192 | 162 |
| 1006 | 3300049584 | Ga0501068_0012451 | Ga0501068_0012451_1506_1994 | 162 |
| 1007 | 3300049584 | Ga0501068_0477906 | Ga0501068_0477906_221_709 | 162 |
| 1008 | 3300049585 | Ga0501069_0013605 | Ga0501069_0013605_2650_3138 | 162 |
| 1009 | 3300049585 | Ga0501069_0033968 | Ga0501069_0033968_1086_1574 | 162 |
| 1010 | 3300049585 | Ga0501069_0452105 | Ga0501069_0452105_198_686 | 162 |
| 1011 | 3300049586 | Ga0501070_0003669 | Ga0501070_0003669_9098_9586 | 162 |
| 1012 | 3300049586 | Ga0501070_0011392 | Ga0501070_0011392_4799_5287 | 162 |
| 1013 | 3300049586 | Ga0501070_0102800 | Ga0501070_0102800_1662_2150 | 162 |
| 1014 | 3300049586 | Ga0501070_0248133 | Ga0501070_0248133_319_807 | 162 |
| 1015 | 3300049586 | Ga0501070_0283144 | Ga0501070_0283144_46_534 | 162 |
| 1016 | 3300049586 | Ga0501070_0336040 | Ga0501070_0336040_536_1024 | 162 |
| 1017 | 3300049587 | Ga0501071_0009025 | Ga0501071_0009025_1272_1760 | 162 |
| 1018 | 3300049587 | Ga0501071_0035767 | Ga0501071_0035767_2017_2505 | 162 |
| 1019 | 3300049587 | Ga0501071_0167798 | Ga0501071_0167798_1049_1537 | 162 |
| 1020 | 3300049588 | Ga0501072_0003654 | Ga0501072_0003654_10294_10782 | 162 |
| 1021 | 3300049588 | Ga0501072_0011728 | Ga0501072_0011728_5602_6090 | 162 |
| 1022 | 3300049589 | Ga0501073_0000203 | Ga0501073_0000203_36350_36838 | 162 |
| 1023 | 3300049589 | Ga0501073_0038233 | Ga0501073_0038233_735_1223 | 162 |
| 1024 | 3300049589 | Ga0501073_0128939 | Ga0501073_0128939_1052_1540 | 162 |
| 1025 | 3300049589 | Ga0501073_0145316 | Ga0501073_0145316_235_723 | 162 |
| 1026 | 3300049590 | Ga0501074_0011327 | Ga0501074_0011327_5198_5686 | 162 |
| 1027 | 3300049590 | Ga0501074_0017548 | Ga0501074_0017548_3226_3714 | 162 |
| 1028 | 3300049590 | Ga0501074_0070618 | Ga0501074_0070618_412_900 | 162 |
| 1029 | 3300049592 | Ga0501076_0029209 | Ga0501076_0029209_561_1049 | 162 |
| 1030 | 3300049592 | Ga0501076_0093360 | Ga0501076_0093360_709_1197 | 162 |
| 1031 | 3300049592 | Ga0501076_0201144 | Ga0501076_0201144_933_1421 | 162 |
| 1032 | 3300049593 | Ga0501077_0036684 | Ga0501077_0036684_186_674 | 162 |
| 1033 | 3300049686 | Ga0501257_227293 | Ga0501257_227293_12_500 | 162 |
| 1034 | 3300049741 | Ga0501079_0001971 | Ga0501079_0001971_5717_6205 | 162 |
| 1035 | 3300049741 | Ga0501079_0071756 | Ga0501079_0071756_1473_1961 | 162 |
| 1036 | 3300049741 | Ga0501079_0395243 | Ga0501079_0395243_26_514 | 162 |
| 1037 | 3300049742 | Ga0501080_0004629 | Ga0501080_0004629_8362_8850 | 162 |
| 1038 | 3300049742 | Ga0501080_0040087 | Ga0501080_0040087_2408_2896 | 162 |
| 1039 | 3300049742 | Ga0501080_0093992 | Ga0501080_0093992_2238_2726 | 162 |
| 1040 | 3300049743 | Ga0501081_0566327 | Ga0501081_0566327_345_833 | 162 |
| 1041 | 3300049744 | Ga0501083_0000539 | Ga0501083_0000539_10315_10803 | 162 |
| 1042 | 3300049744 | Ga0501083_0018195 | Ga0501083_0018195_431_919 | 162 |
| 1043 | 3300049744 | Ga0501083_0636525 | Ga0501083_0636525_130_618 | 162 |
| 1044 | 3300049822 | Ga0501035_0000212 | Ga0501035_0000212_43370_43858 | 162 |
| 1045 | 3300049822 | Ga0501035_0086552 | Ga0501035_0086552_1622_2110 | 162 |
| 1046 | 3300049822 | Ga0501035_0958770 | Ga0501035_0958770_146_634 | 162 |
| 1047 | 3300049823 | Ga0501044_0000304 | Ga0501044_0000304_10972_11460 | 162 |
| 1048 | 3300049823 | Ga0501044_0026748 | Ga0501044_0026748_979_1467 | 162 |
| 1049 | 3300049823 | Ga0501044_0065215 | Ga0501044_0065215_2248_2736 | 162 |
| 1050 | 3300049823 | Ga0501044_0141992 | Ga0501044_0141992_267_755 | 162 |
| 1051 | 3300049823 | Ga0501044_0202168 | Ga0501044_0202168_604_1092 | 162 |
| 1052 | 3300049823 | Ga0501044_0305203 | Ga0501044_0305203_258_746 | 162 |
| 1053 | 3300049823 | Ga0501044_0689710 | Ga0501044_0689710_238_726 | 162 |
| 1054 | 3300049824 | Ga0501045_0006869 | Ga0501045_0006869_6089_6577 | 162 |
| 1055 | 3300049824 | Ga0501045_0055821 | Ga0501045_0055821_1152_1640 | 162 |
| 1056 | 3300050490 | nmdc:mga03n38_12816_c1 | nmdc:mga03n38_12816_c1_474_962 | 162 |
| 1057 | 3300050490 | nmdc:mga03n38_237305_c1 | nmdc:mga03n38_237305_c1_152_640 | 162 |
| 1058 | 3300050491 | nmdc:mga00v17_36882_c1 | nmdc:mga00v17_36882_c1_872_1360 | 162 |
| 1059 | 3300050492 | nmdc:mga0yw44_15471_c1 | nmdc:mga0yw44_15471_c1_3229_3717 | 162 |
| 1060 | 3300050492 | nmdc:mga0yw44_158281_c1 | nmdc:mga0yw44_158281_c1_800_1288 | 162 |
| 1061 | 3300050493 | nmdc:mga0k408_142534_c1 | nmdc:mga0k408_142534_c1_516_1004 | 162 |
| 1062 | 3300050493 | nmdc:mga0k408_255565_c1 | nmdc:mga0k408_255565_c1_168_656 | 162 |
| 1063 | 3300050493 | nmdc:mga0k408_282596_c1 | nmdc:mga0k408_282596_c1_23_511 | 162 |
| 1064 | 3300050494 | nmdc:mga06z11_113072_c1 | nmdc:mga06z11_113072_c1_390_878 | 162 |
| 1065 | 3300050494 | nmdc:mga06z11_122364_c1 | nmdc:mga06z11_122364_c1_401_889 | 162 |
| 1066 | 3300050494 | nmdc:mga06z11_37411_c1 | nmdc:mga06z11_37411_c1_1866_2354 | 162 |
| 1067 | 3300050494 | nmdc:mga06z11_414367_c1 | nmdc:mga06z11_414367_c1_51_539 | 162 |
| 1068 | 3300050494 | nmdc:mga06z11_93972_c1 | nmdc:mga06z11_93972_c1_15_503 | 162 |
| 1069 | 3300050496 | nmdc:mga07m45_314263_c1 | nmdc:mga07m45_314263_c1_11_499 | 162 |
| 1070 | 3300050496 | nmdc:mga07m45_389335_c1 | nmdc:mga07m45_389335_c1_109_597 | 162 |
| 1071 | 3300050507 | nmdc:mga05p37_120308_c1 | nmdc:mga05p37_120308_c1_2253_2741 | 162 |
| 1072 | 3300050508 | nmdc:mga09592_229157_c1 | nmdc:mga09592_229157_c1_1109_1597 | 162 |
| 1073 | 3300050509 | nmdc:mga0qj67_1023009_c1 | nmdc:mga0qj67_1023009_c1_52_540 | 162 |
| 1074 | 3300050511 | nmdc:mga08y16_92319_c1 | nmdc:mga08y16_92319_c1_402_890 | 162 |
| 1075 | 3300050512 | nmdc:mga0n895_125054_c1 | nmdc:mga0n895_125054_c1_772_1260 | 162 |
| 1076 | 3300050516 | nmdc:mga0sz30_244485_c1 | nmdc:mga0sz30_244485_c1_97_585 | 162 |
| 1077 | 3300053077 | Ga0495601_0022366 | Ga0495601_0022366_1692_2180 | 162 |
| 1078 | 3300053077 | Ga0495601_0148848 | Ga0495601_0148848_985_1473 | 162 |
| 1079 | 3300053077 | Ga0495601_0185190 | Ga0495601_0185190_161_649 | 162 |
| 1080 | 3300053078 | Ga0495612_0008523 | Ga0495612_0008523_3327_3815 | 162 |
| 1081 | 3300053078 | Ga0495612_0266555 | Ga0495612_0266555_191_679 | 162 |
| 1082 | 3300053080 | Ga0500635_0008274 | Ga0500635_0008274_1202_1690 | 162 |
| 1083 | 3300053080 | Ga0500635_0037941 | Ga0500635_0037941_185_673 | 162 |
| 1084 | 3300053083 | Ga0495655_0147691 | Ga0495655_0147691_143_631 | 162 |
| 1085 | 3300053084 | Ga0495595_0152806 | Ga0495595_0152806_602_1090 | 162 |
| 1086 | 3300053085 | Ga0495619_0187299 | Ga0495619_0187299_483_971 | 162 |
| 1087 | 3300053085 | Ga0495619_0240422 | Ga0495619_0240422_69_557 | 162 |
| 1088 | 3300053085 | Ga0495619_0352108 | Ga0495619_0352108_177_665 | 162 |
| 1089 | 3300053085 | Ga0495619_0450690 | Ga0495619_0450690_327_815 | 162 |
| 1090 | 3300053088 | Ga0500644_0203026 | Ga0500644_0203026_31_519 | 162 |
| 1091 | 3300053089 | Ga0500581_120380 | Ga0500581_120380_743_1231 | 162 |
| 1092 | 3300053090 | Ga0500646_0180263 | Ga0500646_0180263_188_676 | 162 |
| 1093 | 3300053091 | Ga0500647_0071120 | Ga0500647_0071120_471_959 | 162 |
| 1094 | 3300053092 | Ga0500583_0072186 | Ga0500583_0072186_829_1317 | 162 |
| 1095 | 3300053093 | Ga0500651_0213026 | Ga0500651_0213026_317_805 | 162 |
| 1096 | 3300053094 | Ga0500566_0000197 | Ga0500566_0000197_10297_10785 | 162 |
| 1097 | 3300053094 | Ga0500566_0007746 | Ga0500566_0007746_3641_4129 | 162 |
| 1098 | 3300053094 | Ga0500566_0074079 | Ga0500566_0074079_913_1401 | 162 |
| 1099 | 3300053094 | Ga0500566_0130342 | Ga0500566_0130342_407_895 | 162 |
| 1100 | 3300053095 | Ga0500640_000151 | Ga0500640_000151_1440_1928 | 162 |
| 1101 | 3300053096 | Ga0500641_0037558 | Ga0500641_0037558_897_1385 | 162 |
| 1102 | 3300053099 | Ga0500654_136382 | Ga0500654_136382_185_673 | 162 |
| 1103 | 3300053103 | Ga0500555_039672 | Ga0500555_039672_188_676 | 162 |
| 1104 | 3300053104 | Ga0500556_0000045 | Ga0500556_0000045_84328_84816 | 162 |
| 1105 | 3300053104 | Ga0500556_0044468 | Ga0500556_0044468_201_689 | 162 |
| 1106 | 3300053109 | Ga0500569_019436 | Ga0500569_019436_1221_1709 | 162 |
| 1107 | 3300053111 | Ga0500572_000154 | Ga0500572_000154_21548_22036 | 162 |
| 1108 | 3300053111 | Ga0500572_000578 | Ga0500572_000578_10437_10925 | 162 |
| 1109 | 3300053115 | Ga0500591_083881 | Ga0500591_083881_259_747 | 162 |
| 1110 | 3300053116 | Ga0500592_000586 | Ga0500592_000586_1098_1586 | 162 |
| 1111 | 3300053116 | Ga0500592_009040 | Ga0500592_009040_378_866 | 162 |
| 1112 | 3300053117 | Ga0500593_096486 | Ga0500593_096486_58_546 | 162 |
| 1113 | 3300053118 | Ga0500594_0082810 | Ga0500594_0082810_102_590 | 162 |
| 1114 | 3300053119 | Ga0500595_002082 | Ga0500595_002082_6702_7190 | 162 |
| 1115 | 3300053119 | Ga0500595_002732 | Ga0500595_002732_2377_2865 | 162 |
| 1116 | 3300053119 | Ga0500595_018178 | Ga0500595_018178_489_977 | 162 |
| 1117 | 3300053120 | Ga0500597_115245 | Ga0500597_115245_107_595 | 162 |
| 1118 | 3300053121 | Ga0500607_045000 | Ga0500607_045000_1014_1502 | 162 |
| 1119 | 3300053122 | Ga0500608_007213 | Ga0500608_007213_3033_3521 | 162 |
| 1120 | 3300053122 | Ga0500608_011405 | Ga0500608_011405_2465_2953 | 162 |
| 1121 | 3300053123 | Ga0500614_001112 | Ga0500614_001112_3971_4459 | 162 |
| 1122 | 3300053125 | Ga0500618_012229 | Ga0500618_012229_528_1016 | 162 |
| 1123 | 3300053126 | Ga0500621_104479 | Ga0500621_104479_62_550 | 162 |
| 1124 | 3300053126 | Ga0500621_246260 | Ga0500621_246260_67_555 | 162 |
| 1125 | 3300053129 | Ga0500628_015616 | Ga0500628_015616_577_1065 | 162 |
| 1126 | 3300053130 | Ga0500642_0000024 | Ga0500642_0000024_88236_88724 | 162 |
| 1127 | 3300053130 | Ga0500642_0266028 | Ga0500642_0266028_40_528 | 162 |
| 1128 | 3300053131 | Ga0500652_000356 | Ga0500652_000356_13525_14013 | 162 |
| 1129 | 3300053134 | Ga0500658_0144026 | Ga0500658_0144026_140_628 | 162 |
| 1130 | 3300053134 | Ga0500658_0426328 | Ga0500658_0426328_26_514 | 162 |
| 1131 | 3300053134 | Ga0500658_0447432 | Ga0500658_0447432_83_571 | 162 |
| 1132 | 3300053136 | Ga0500559_0000051 | Ga0500559_0000051_4479_4967 | 162 |
| 1133 | 3300053136 | Ga0500559_0001682 | Ga0500559_0001682_9878_10366 | 162 |
| 1134 | 3300053136 | Ga0500559_0064120 | Ga0500559_0064120_594_1082 | 162 |
| 1135 | 3300053136 | Ga0500559_0152765 | Ga0500559_0152765_396_884 | 162 |
| 1136 | 3300053136 | Ga0500559_0202067 | Ga0500559_0202067_69_557 | 162 |
| 1137 | 3300053139 | Ga0500568_0000456 | Ga0500568_0000456_8202_8690 | 162 |
| 1138 | 3300053142 | Ga0500577_0000189 | Ga0500577_0000189_8514_9002 | 162 |
| 1139 | 3300053142 | Ga0500577_0057994 | Ga0500577_0057994_589_1077 | 162 |
| 1140 | 3300053145 | Ga0500586_007803 | Ga0500586_007803_327_815 | 162 |
| 1141 | 3300053146 | Ga0500588_0125490 | Ga0500588_0125490_219_707 | 162 |
| 1142 | 3300053147 | Ga0500589_213218 | Ga0500589_213218_141_629 | 162 |
| 1143 | 3300053148 | Ga0500590_035413 | Ga0500590_035413_2072_2560 | 162 |
| 1144 | 3300053148 | Ga0500590_229305 | Ga0500590_229305_86_574 | 162 |
| 1145 | 3300053150 | Ga0500603_000220 | Ga0500603_000220_7847_8335 | 162 |
| 1146 | 3300053150 | Ga0500603_016023 | Ga0500603_016023_1137_1625 | 162 |
| 1147 | 3300053150 | Ga0500603_030295 | Ga0500603_030295_892_1380 | 162 |
| 1148 | 3300053151 | Ga0500604_0066594 | Ga0500604_0066594_162_650 | 162 |
| 1149 | 3300053151 | Ga0500604_0183544 | Ga0500604_0183544_187_675 | 162 |
| 1150 | 3300053153 | Ga0500616_0000048 | Ga0500616_0000048_243237_243725 | 162 |
| 1151 | 3300053153 | Ga0500616_0000054 | Ga0500616_0000054_87245_87733 | 162 |
| 1152 | 3300053154 | Ga0500619_003777 | Ga0500619_003777_2094_2582 | 162 |
| 1153 | 3300053154 | Ga0500619_162516 | Ga0500619_162516_22_510 | 162 |
| 1154 | 3300053156 | Ga0500622_0000714 | Ga0500622_0000714_23800_24288 | 162 |
| 1155 | 3300053158 | Ga0500627_0064431 | Ga0500627_0064431_820_1308 | 162 |
| 1156 | 3300053159 | Ga0500630_024760 | Ga0500630_024760_2375_2863 | 162 |
| 1157 | 3300053161 | Ga0500634_0174604 | Ga0500634_0174604_420_908 | 162 |
| 1158 | 3300053162 | Ga0500638_041577 | Ga0500638_041577_1540_2028 | 162 |
| 1159 | 3300053162 | Ga0500638_093892 | Ga0500638_093892_398_886 | 162 |
| 1160 | 3300053162 | Ga0500638_151176 | Ga0500638_151176_532_1020 | 162 |
| 1161 | 3300053163 | Ga0500639_000007 | Ga0500639_000007_44832_45320 | 162 |
| 1162 | 3300053163 | Ga0500639_053902 | Ga0500639_053902_929_1417 | 162 |
| 1163 | 3300053177 | Ga0500636_0009096 | Ga0500636_0009096_3841_4329 | 162 |
| 1164 | 3300053177 | Ga0500636_0023576 | Ga0500636_0023576_2990_3478 | 162 |
| 1165 | 3300053178 | Ga0500637_0014529 | Ga0500637_0014529_2494_2982 | 162 |
| 1166 | 3300053178 | Ga0500637_0085137 | Ga0500637_0085137_960_1448 | 162 |
| 1167 | 3300053178 | Ga0500637_0092471 | Ga0500637_0092471_767_1255 | 162 |
| 1168 | 3300053178 | Ga0500637_0114303 | Ga0500637_0114303_1032_1520 | 162 |
| 1169 | 3300053723 | Ga0500567_040424 | Ga0500567_040424_1108_1596 | 162 |
| 1170 | 3300053728 | Ga0500657_081540 | Ga0500657_081540_363_851 | 162 |
| 1171 | 3300053730 | Ga0500645_027646 | Ga0500645_027646_1021_1509 | 162 |
| 1172 | 3300053731 | Ga0500609_039019 | Ga0500609_039019_70_558 | 162 |
| 1173 | 3300053732 | Ga0500656_010517 | Ga0500656_010517_281_769 | 162 |
| 1174 | 3300053733 | Ga0500552_008739 | Ga0500552_008739_217_705 | 162 |
| 1175 | 3300053735 | Ga0500596_000345 | Ga0500596_000345_54_542 | 162 |
| 1176 | 3300053735 | Ga0500596_005002 | Ga0500596_005002_1090_1578 | 162 |
| 1177 | 3300053737 | Ga0500601_002395 | Ga0500601_002395_496_984 | 162 |
| 1178 | 3300054114 | Ga0501084_0007519 | Ga0501084_0007519_3937_4425 | 162 |
| 1179 | 3300054114 | Ga0501084_0158623 | Ga0501084_0158623_35_523 | 162 |
| 1180 | 3300060353 | Ga0501082_0006039 | Ga0501082_0006039_8831_9319 | 162 |
| 1181 | 3300060353 | Ga0501082_0018603 | Ga0501082_0018603_5466_5954 | 162 |
| 1182 | 3300061719 | Ga0466962_0209875 | Ga0466962_0209875_291_779 | 162 |
| 1183 | 3300061734 | Ga0530510_0219546 | Ga0530510_0219546_203_691 | 162 |
| 1184 | iso_pu_bacteria | 2508501122 | 2509109779 | 162 |
| 1185 | iso_pu_bacteria | 2509276019 | 2509379069 | 162 |
| 1186 | iso_pu_bacteria | 2516143018 | 2516205173 | 162 |
| 1187 | iso_pu_bacteria | 2558860100 | 2558860353 | 162 |
| 1188 | iso_pu_bacteria | 2599185352 | 2600194612 | 162 |
| 1189 | iso_pu_bacteria | 2643221618 | 2644108547 | 162 |
| 1190 | iso_pu_bacteria | 2643221626 | 2644145593 | 162 |
| 1191 | iso_pu_bacteria | 2643221655 | 2644312330 | 162 |
| 1192 | iso_pu_bacteria | 2643221659 | 2644335959 | 162 |
| 1193 | iso_pu_bacteria | 2643221698 | 2644546815 | 162 |
| 1194 | iso_pu_bacteria | 2643221712 | 2644618013 | 162 |
| 1195 | iso_pu_bacteria | 2643221723 | 2644676808 | 162 |
| 1196 | iso_pu_bacteria | 2657244999 | 2657684043 | 162 |
| 1197 | iso_pu_bacteria | 2690316117 | 2692314569 | 162 |
| 1198 | iso_pu_bacteria | 2751185821 | 2753458675 | 162 |
| 1199 | iso_pu_bacteria | 2791355082 | 2792582606 | 162 |
| 1200 | iso_pu_bacteria | 2791355091 | 2792622935 | 162 |
| 1201 | iso_pu_bacteria | 2791355092 | 2792629189 | 162 |
| 1202 | iso_pu_bacteria | 2791355094 | 2792640459 | 162 |
| 1203 | iso_pu_bacteria | 2802429268 | 2804753267 | 162 |
| 1204 | iso_pu_bacteria | 2838074704 | 2838077374 | 162 |
| 1205 | iso_pu_bacteria | 2844163670 | 2844169181 | 162 |
| 1206 | iso_pu_bacteria | 2847417321 | 2847420379 | 162 |
| 1207 | iso_pu_bacteria | 2848992105 | 2848995185 | 162 |
| 1208 | iso_pu_bacteria | 2850079185 | 2850082251 | 162 |
| 1209 | iso_pu_bacteria | 2855872281 | 2855878494 | 162 |
| 1210 | iso_pu_bacteria | 2896384573 | 2896386387 | 162 |
| 1211 | iso_pu_bacteria | 2913295892 | 2913299785 | 162 |
| 1212 | iso_pu_bacteria | 2920760137 | 2920760837 | 162 |
| 1213 | iso_pu_bacteria | 2920822456 | 2920828551 | 162 |
| 1214 | iso_pu_bacteria | 2941499720 | 2941501759 | 162 |
| 1215 | iso_pu_bacteria | 643692032 | 643827022 | 162 |
| 1216 | iso_pu_bacteria | 8049293176 | 8049295880 | 162 |
| 1217 | 3300005406 | Ga0070703_10011423 | Ga0070703_100114232 | 163 |
| 1218 | 3300005435 | Ga0070714_100154234 | Ga0070714_1001542342 | 163 |
| 1219 | 3300005435 | Ga0070714_100301584 | Ga0070714_1003015842 | 163 |
| 1220 | 3300005436 | Ga0070713_100343902 | Ga0070713_1003439022 | 163 |
| 1221 | 3300005467 | Ga0070706_101186902 | Ga0070706_1011869021 | 163 |
| 1222 | 3300005518 | Ga0070699_100143795 | Ga0070699_1001437953 | 163 |
| 1223 | 3300005518 | Ga0070699_101548770 | Ga0070699_1015487701 | 163 |
| 1224 | 3300005536 | Ga0070697_100305752 | Ga0070697_1003057522 | 163 |
| 1225 | 3300005549 | Ga0070704_100193939 | Ga0070704_1001939391 | 163 |
| 1226 | 3300005578 | Ga0068854_100341037 | Ga0068854_1003410372 | 163 |
| 1227 | 3300005981 | Ga0081538_10001674 | Ga0081538_100016746 | 163 |
| 1228 | 3300005983 | Ga0081540_1007778 | Ga0081540_10077787 | 163 |
| 1229 | 3300006028 | Ga0070717_10378248 | Ga0070717_103782482 | 163 |
| 1230 | 3300006163 | Ga0070715_10017492 | Ga0070715_100174922 | 163 |
| 1231 | 3300006173 | Ga0070716_101073402 | Ga0070716_1010734021 | 163 |
| 1232 | 3300006175 | Ga0070712_100105334 | Ga0070712_1001053341 | 163 |
| 1233 | 3300006846 | Ga0075430_100079159 | Ga0075430_1000791595 | 163 |
| 1234 | 3300006847 | Ga0075431_100001907 | Ga0075431_1000019075 | 163 |
| 1235 | 3300006852 | Ga0075433_10426323 | Ga0075433_104263232 | 163 |
| 1236 | 3300006871 | Ga0075434_100281484 | Ga0075434_1002814841 | 163 |
| 1237 | 3300006880 | Ga0075429_100005227 | Ga0075429_1000052278 | 163 |
| 1238 | 3300007076 | Ga0075435_100084152 | Ga0075435_1000841524 | 163 |
| 1239 | 3300009094 | Ga0111539_10000178 | Ga0111539_1000017811 | 163 |
| 1240 | 3300009147 | Ga0114129_10001129 | Ga0114129_1000112910 | 163 |
| 1241 | 3300009147 | Ga0114129_10147099 | Ga0114129_101470994 | 163 |
| 1242 | 3300010375 | Ga0105239_10259389 | Ga0105239_102593893 | 163 |
| 1243 | 3300021388 | Ga0213875_10322147 | Ga0213875_103221471 | 163 |
| 1244 | 3300025905 | Ga0207685_10063552 | Ga0207685_100635522 | 163 |
| 1245 | 3300025906 | Ga0207699_10165041 | Ga0207699_101650413 | 163 |
| 1246 | 3300025910 | Ga0207684_10312679 | Ga0207684_103126792 | 163 |
| 1247 | 3300025915 | Ga0207693_10065210 | Ga0207693_100652102 | 163 |
| 1248 | 3300025916 | Ga0207663_10574300 | Ga0207663_105743002 | 163 |
| 1249 | 3300025929 | Ga0207664_10773984 | Ga0207664_107739842 | 163 |
| 1250 | 3300025939 | Ga0207665_10151020 | Ga0207665_101510202 | 163 |
| 1251 | 3300027907 | Ga0207428_10002929 | Ga0207428_100029297 | 163 |
| 1252 | 3300028577 | Ga0265318_10197676 | Ga0265318_101976761 | 163 |
| 1253 | 3300031344 | Ga0265316_10785473 | Ga0265316_107854731 | 163 |
| 1254 | 3300032126 | Ga0307415_101680905 | Ga0307415_1016809051 | 163 |
| 1255 | 3300035111 | Ga0373923_0313601 | Ga0373923_0313601_170_667 | 163 |
| 1256 | 3300035170 | Ga0373943_0154842 | Ga0373943_0154842_588_1085 | 163 |
| 1257 | 3300035692 | Ga0373935_0009266 | Ga0373935_0009266_2547_3044 | 163 |
| 1258 | 3300035695 | Ga0373927_0032748 | Ga0373927_0032748_2028_2525 | 163 |
| 1259 | 3300035725 | Ga0373947_0283629 | Ga0373947_0283629_272_769 | 163 |
| 1260 | 3300037068 | Ga0373925_0027008 | Ga0373925_0027008_436_933 | 163 |
| 1261 | 3300037853 | Ga0436364_0005842 | Ga0436364_0005842_32_529 | 163 |
| 1262 | 3300037853 | Ga0436364_1324733 | Ga0436364_1324733_805_1302 | 163 |
| 1263 | 3300039453 | Ga0436362_0681126 | Ga0436362_0681126_52_546 | 163 |
| 1264 | 3300041407 | Ga0439447_095373 | Ga0439447_095373_122_619 | 163 |
| 1265 | 3300041413 | Ga0439465_0007899 | Ga0439465_0007899_371_868 | 163 |
| 1266 | 3300042004 | Ga0439445_0074119 | Ga0439445_0074119_53_550 | 163 |
| 1267 | 3300042006 | Ga0439432_012787 | Ga0439432_012787_831_1328 | 163 |
| 1268 | 3300042007 | Ga0439449_0030566 | Ga0439449_0030566_1079_1576 | 163 |
| 1269 | 3300042993 | Ga0439440_0168658 | Ga0439440_0168658_63_560 | 163 |
| 1270 | 3300046517 | Ga0495630_0039214 | Ga0495630_0039214_223_720 | 163 |
| 1271 | 3300046642 | Ga0495634_0113718 | Ga0495634_0113718_1123_1620 | 163 |
| 1272 | 3300046690 | Ga0495624_0104170 | Ga0495624_0104170_976_1473 | 163 |
| 1273 | 3300047315 | Ga0495581_0127362 | Ga0495581_0127362_272_769 | 163 |
| 1274 | 3300047319 | Ga0495674_0023420 | Ga0495674_0023420_4213_4710 | 163 |
| 1275 | 3300048913 | Ga0496110_0075104 | Ga0496110_0075104_293_787 | 163 |
| 1276 | 3300048914 | Ga0496111_0071123 | Ga0496111_0071123_1641_2135 | 163 |
| 1277 | 3300049570 | Ga0501033_0206092 | Ga0501033_0206092_489_983 | 163 |
| 1278 | 3300049572 | Ga0501036_0429129 | Ga0501036_0429129_504_998 | 163 |
| 1279 | 3300049574 | Ga0501038_0017412 | Ga0501038_0017412_5369_5863 | 163 |
| 1280 | 3300049579 | Ga0501043_0051850 | Ga0501043_0051850_1463_1957 | 163 |
| 1281 | 3300049581 | Ga0501047_0054534 | Ga0501047_0054534_504_998 | 163 |
| 1282 | 3300049582 | Ga0501048_0605888 | Ga0501048_0605888_125_619 | 163 |
| 1283 | 3300049586 | Ga0501070_0003380 | Ga0501070_0003380_12937_13431 | 163 |
| 1284 | 3300049590 | Ga0501074_0257765 | Ga0501074_0257765_596_1090 | 163 |
| 1285 | 3300049742 | Ga0501080_0121335 | Ga0501080_0121335_411_905 | 163 |
| 1286 | 3300049822 | Ga0501035_0043346 | Ga0501035_0043346_1582_2076 | 163 |
| 1287 | 3300049823 | Ga0501044_0008608 | Ga0501044_0008608_5577_6071 | 163 |
| 1288 | 3300050507 | nmdc:mga05p37_148209_c1 | nmdc:mga05p37_148209_c1_1664_2158 | 163 |
| 1289 | 3300050507 | nmdc:mga05p37_743_c1 | nmdc:mga05p37_743_c1_27276_27773 | 163 |
| 1290 | 3300050508 | nmdc:mga09592_781_c1 | nmdc:mga09592_781_c1_13109_13606 | 163 |
| 1291 | 3300050509 | nmdc:mga0qj67_72223_c1 | nmdc:mga0qj67_72223_c1_223_720 | 163 |
| 1292 | 3300050510 | nmdc:mga06r32_19037_c1 | nmdc:mga06r32_19037_c1_3198_3695 | 163 |
| 1293 | 3300050511 | nmdc:mga08y16_121_c1 | nmdc:mga08y16_121_c1_8245_8742 | 163 |
| 1294 | 3300050513 | nmdc:mga0rr50_560776_c1 | nmdc:mga0rr50_560776_c1_34_528 | 163 |
| 1295 | 3300053117 | Ga0500593_003188 | Ga0500593_003188_2900_3403 | 163 |
| 1296 | 3300031239 | Ga0265328_10000085 | Ga0265328_1000008517 | 165 |
| 1297 | 3300031241 | Ga0265325_10003663 | Ga0265325_100036636 | 165 |
| 1298 | 3300031250 | Ga0265331_10000007 | Ga0265331_1000000788 | 165 |
| 1299 | 3300049571 | Ga0501034_0180341 | Ga0501034_0180341_1385_1903 | 165 |
| 1300 | 3300049572 | Ga0501036_0109857 | Ga0501036_0109857_1087_1632 | 165 |
| 1301 | 3300049583 | Ga0501067_0002121 | Ga0501067_0002121_6923_7441 | 165 |
| 1302 | 3300049588 | Ga0501072_0180631 | Ga0501072_0180631_865_1383 | 165 |
| 1303 | 3300049589 | Ga0501073_0026397 | Ga0501073_0026397_2224_2742 | 165 |
| 1304 | 3300049590 | Ga0501074_0289819 | Ga0501074_0289819_105_623 | 165 |
| 1305 | 3300049592 | Ga0501076_0040338 | Ga0501076_0040338_2075_2593 | 165 |
| 1306 | 3300049742 | Ga0501080_0002834 | Ga0501080_0002834_3081_3599 | 165 |
| 1307 | 3300049744 | Ga0501083_0003563 | Ga0501083_0003563_1432_1950 | 165 |
| 1308 | 3300049823 | Ga0501044_1069585 | Ga0501044_1069585_67_573 | 165 |
| 1309 | 3300054114 | Ga0501084_0005904 | Ga0501084_0005904_5495_6013 | 165 |
| 1310 | 3300054114 | Ga0501084_0587127 | Ga0501084_0587127_156_674 | 165 |
| 1311 | 3300060353 | Ga0501082_0078180 | Ga0501082_0078180_2156_2674 | 165 |
| 1312 | 3300002739 | JGI25158J39367_1001328 | JGI25158J39367_10013287 | 166 |
| 1313 | 3300002987 | JGI25159J45721_1000018 | JGI25159J45721_100001886 | 166 |
| 1314 | 3300003354 | JGI25160J50197_1000009 | JGI25160J50197_1000009122 | 166 |
| 1315 | 3300003374 | JGI25161J50226_1000920 | JGI25161J50226_10009202 | 166 |
| 1316 | 3300003771 | Ga0055526_1003070 | Ga0055526_100307010 | 166 |
| 1317 | 3300003781 | Ga0055536_1000168 | Ga0055536_100016841 | 166 |
| 1318 | 3300003791 | Ga0055530_10009693 | Ga0055530_100096932 | 166 |
| 1319 | 3300003794 | Ga0055531_10001176 | Ga0055531_1000117615 | 166 |
| 1320 | 3300004625 | Ga0055543_1000379 | Ga0055543_100037920 | 166 |
| 1321 | 3300005262 | Ga0065165_1000020 | Ga0065165_1000020148 | 166 |
| 1322 | 3300006847 | Ga0075431_100472959 | Ga0075431_1004729592 | 166 |
| 1323 | 3300009094 | Ga0111539_10091704 | Ga0111539_100917044 | 166 |
| 1324 | 3300009147 | Ga0114129_11436707 | Ga0114129_114367072 | 166 |
| 1325 | 3300013249 | Ga0171463_1006 | Ga0171463_1006201 | 166 |
| 1326 | 3300015690 | Ga0183363_1018 | Ga0183363_101830 | 166 |
| 1327 | 3300021320 | Ga0214544_1001241 | Ga0214544_100124125 | 166 |
| 1328 | 3300021321 | Ga0214542_1000115 | Ga0214542_100011526 | 166 |
| 1329 | 3300021321 | Ga0214542_1014437 | Ga0214542_101443710 | 166 |
| 1330 | 3300021327 | Ga0214543_1000008 | Ga0214543_1000008168 | 166 |
| 1331 | 3300021327 | Ga0214543_1000098 | Ga0214543_100009826 | 166 |
| 1332 | 3300025208 | Ga0209436_104530 | Ga0209436_1045302 | 166 |
| 1333 | 3300025245 | Ga0207425_1011774 | Ga0207425_10117744 | 166 |
| 1334 | 3300025263 | Ga0209565_1010490 | Ga0209565_10104901 | 166 |
| 1335 | 3300025284 | Ga0209130_1000037 | Ga0209130_1000037148 | 166 |
| 1336 | 3300025292 | Ga0209676_1000239 | Ga0209676_100023921 | 166 |
| 1337 | 3300025294 | Ga0209025_1000196 | Ga0209025_100019629 | 166 |
| 1338 | 3300025295 | Ga0209564_1000086 | Ga0209564_1000086122 | 166 |
| 1339 | 3300025298 | Ga0209050_1001390 | Ga0209050_100139013 | 166 |
| 1340 | 3300025302 | Ga0207426_1000048 | Ga0207426_1000048188 | 166 |
| 1341 | 3300025303 | Ga0209051_1001690 | Ga0209051_100169014 | 166 |
| 1342 | 3300025304 | Ga0209257_1001192 | Ga0209257_100119215 | 166 |
| 1343 | 3300028379 | Ga0268266_11388549 | Ga0268266_113885492 | 166 |
| 1344 | 3300041404 | Ga0439436_0061893 | Ga0439436_0061893_31_531 | 166 |
| 1345 | 3300042007 | Ga0439449_0153962 | Ga0439449_0153962_229_729 | 166 |
| 1346 | 3300045051 | Ga0451576_0041218 | Ga0451576_0041218_883_1386 | 166 |
| 1347 | 3300048920 | Ga0496117_0340054 | Ga0496117_0340054_221_730 | 166 |
| 1348 | 3300049589 | Ga0501073_0510186 | Ga0501073_0510186_210_731 | 166 |
| 1349 | 3300050507 | nmdc:mga05p37_1257441_c1 | nmdc:mga05p37_1257441_c1_137_637 | 166 |
| 1350 | 3300050510 | nmdc:mga06r32_56820_c1 | nmdc:mga06r32_56820_c1_2726_3226 | 166 |
| 1351 | 3300054114 | Ga0501084_0232542 | Ga0501084_0232542_858_1379 | 166 |
| 1352 | 3300060353 | Ga0501082_0105333 | Ga0501082_0105333_487_1008 | 166 |
| 1353 | iso_pu_bacteria | 2909042592 | 2909046495 | 166 |
| 1354 | 3300049587 | Ga0501071_0079802 | Ga0501071_0079802_986_1522 | 167 |
| 1355 | 3300049583 | Ga0501067_0065370 | Ga0501067_0065370_735_1265 | 169 |
| 1356 | 3300049593 | Ga0501077_0018802 | Ga0501077_0018802_1160_1690 | 169 |
| 1357 | 3300054114 | Ga0501084_0299553 | Ga0501084_0299553_763_1293 | 169 |
| 1358 | 3300060353 | Ga0501082_0089798 | Ga0501082_0089798_1773_2303 | 169 |
| 1359 | 3300009094 | Ga0111539_10057625 | Ga0111539_100576253 | 170 |
| 1360 | 3300028577 | Ga0265318_10069538 | Ga0265318_100695381 | 170 |
| 1361 | 3300031238 | Ga0265332_10072809 | Ga0265332_100728091 | 170 |
| 1362 | 3300031242 | Ga0265329_10028176 | Ga0265329_100281762 | 170 |
| 1363 | 3300031247 | Ga0265340_10023460 | Ga0265340_100234606 | 170 |
| 1364 | 3300031249 | Ga0265339_10002699 | Ga0265339_100026991 | 170 |
| 1365 | 3300031250 | Ga0265331_10183401 | Ga0265331_101834012 | 170 |
| 1366 | 3300031250 | Ga0265331_10302707 | Ga0265331_103027072 | 170 |
| 1367 | 3300031344 | Ga0265316_10029606 | Ga0265316_100296065 | 170 |
| 1368 | 3300031344 | Ga0265316_10148855 | Ga0265316_101488552 | 170 |
| 1369 | 3300031595 | Ga0265313_10002977 | Ga0265313_100029777 | 170 |
| 1370 | 3300031595 | Ga0265313_10004093 | Ga0265313_1000409313 | 170 |
| 1371 | 3300031595 | Ga0265313_10029352 | Ga0265313_100293524 | 170 |
| 1372 | 3300031711 | Ga0265314_10006996 | Ga0265314_100069962 | 170 |
| 1373 | 3300048924 | Ga0496121_0468864 | Ga0496121_0468864_237_761 | 170 |
| 1374 | 3300049571 | Ga0501034_0632136 | Ga0501034_0632136_394_927 | 170 |
| 1375 | 3300049573 | Ga0501037_0238013 | Ga0501037_0238013_115_648 | 170 |
| 1376 | 3300049581 | Ga0501047_0143269 | Ga0501047_0143269_63_596 | 170 |
| 1377 | 3300049584 | Ga0501068_0324073 | Ga0501068_0324073_141_674 | 170 |
| 1378 | 3300049586 | Ga0501070_0270857 | Ga0501070_0270857_719_1252 | 170 |
| 1379 | 3300049742 | Ga0501080_0161611 | Ga0501080_0161611_400_933 | 170 |
| 1380 | 3300049823 | Ga0501044_0108222 | Ga0501044_0108222_2196_2729 | 170 |
| 1381 | 3300050512 | nmdc:mga0n895_14611_c1 | nmdc:mga0n895_14611_c1_2061_2576 | 170 |
| 1382 | 3300050515 | nmdc:mga0a205_172488_c1 | nmdc:mga0a205_172488_c1_404_919 | 170 |
| 1383 | 3300002244 | JGI24742J22300_10013161 | JGI24742J22300_100131611 | 183 |
| 1384 | 3300005328 | Ga0070676_10128819 | Ga0070676_101288191 | 183 |
| 1385 | 3300005330 | Ga0070690_100283953 | Ga0070690_1002839532 | 183 |
| 1386 | 3300005331 | Ga0070670_100585954 | Ga0070670_1005859541 | 183 |
| 1387 | 3300005337 | Ga0070682_100103296 | Ga0070682_1001032963 | 183 |
| 1388 | 3300005340 | Ga0070689_100141012 | Ga0070689_1001410121 | 183 |
| 1389 | 3300005356 | Ga0070674_100020438 | Ga0070674_1000204387 | 183 |
| 1390 | 3300005367 | Ga0070667_100491344 | Ga0070667_1004913442 | 183 |
| 1391 | 3300005456 | Ga0070678_100391638 | Ga0070678_1003916382 | 183 |
| 1392 | 3300005459 | Ga0068867_100185987 | Ga0068867_1001859871 | 183 |
| 1393 | 3300005543 | Ga0070672_100163221 | Ga0070672_1001632212 | 183 |
| 1394 | 3300005544 | Ga0070686_100315103 | Ga0070686_1003151032 | 183 |
| 1395 | 3300005615 | Ga0070702_100245080 | Ga0070702_1002450801 | 183 |
| 1396 | 3300005842 | Ga0068858_100479481 | Ga0068858_1004794812 | 183 |
| 1397 | 3300017792 | Ga0163161_10109321 | Ga0163161_101093212 | 183 |
| 1398 | 3300025907 | Ga0207645_10064188 | Ga0207645_100641882 | 183 |
| 1399 | 3300025925 | Ga0207650_10315235 | Ga0207650_103152352 | 183 |
| 1400 | 3300025934 | Ga0207686_10377361 | Ga0207686_103773612 | 183 |
| 1401 | 3300025935 | Ga0207709_10050550 | Ga0207709_100505505 | 183 |
| 1402 | 3300025937 | Ga0207669_10018069 | Ga0207669_100180692 | 183 |
| 1403 | 3300025937 | Ga0207669_10468097 | Ga0207669_104680972 | 183 |
| 1404 | 3300025938 | Ga0207704_10476479 | Ga0207704_104764791 | 183 |
| 1405 | 3300025940 | Ga0207691_10144444 | Ga0207691_101444442 | 183 |
| 1406 | 3300025940 | Ga0207691_10830352 | Ga0207691_108303522 | 183 |
| 1407 | 3300025941 | Ga0207711_10981675 | Ga0207711_109816751 | 183 |
| 1408 | 3300026089 | Ga0207648_10100216 | Ga0207648_101002162 | 183 |
| 1409 | 3300026121 | Ga0207683_10455525 | Ga0207683_104555252 | 183 |
| 1410 | 3300027907 | Ga0207428_10160227 | Ga0207428_101602272 | 183 |
| 1411 | 3300028380 | Ga0268265_10141140 | Ga0268265_101411404 | 183 |
| 1412 | 3300028380 | Ga0268265_10312183 | Ga0268265_103121832 | 183 |
| 1413 | 3300037418 | Ga0395900_0317077 | Ga0395900_0317077_219_848 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5clh-assembly1.cif.gz_A | structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, at ph 8 | 0.9925 | 23 | 180 |
| 4zc8-assembly1.cif.gz_A | structure of acetobacter aceti pure-s57t | 0.991 | 23 | 178 |
| 2fw9-assembly1.cif.gz_B | structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8 | 0.9895 | 23 | 180 |
| 2fw8-assembly1.cif.gz_A | structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89g from the acidophilic bacterium acetobacter aceti, at ph 8 | 0.986 | 23 | 178 |
| 5bor-assembly1.cif.gz_A | structure of acetobacter aceti pure-s57c, sulfonate form | 0.9856 | 23 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZJ5_1_139_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.985 | 46 | 172 | 3.40.50.1970 |
| af_Q9SJ42_1_162_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9717 | 30 | 172 | 3.40.50.1970 |
| 5cvtB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9712 | 23 | 182 | 3.40.50.1970 |
| 5cvtB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9594 | 23 | 182 | 3.40.50.1970 |
| 2ywxA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9552 | 26 | 172 | 3.40.50.1970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357KZ10-F1-model_v4 | 5-(Carboxyamino)imidazole ribonucleotide mutase | 0.9945 | 30 | 163 |
GO:0006189
GO:0016853 |
| AF-A0A6P1UC75-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9938 | 30 | 174 |
GO:0006189
GO:0016829 GO:0034023 |
| AF-A0A099DE03-F1-model_v4 | deleted | 0.9935 | 30 | 172 |
|
| AF-A0A517NX97-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9932 | 24 | 172 |
GO:0006189
GO:0034023 |
| AF-A0A258C9D1-F1-model_v4 | deleted | 0.993 | 23 | 141 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar