F493755

General Info

Members Datasets Scaffolds Average Seq Length
1411 430 2823 119

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10311088|Ga0316583_103110881
Length 140
Sequence MGPYATPPGTATQAVIVMDDTNQAPGNGQQRQAILSLAIKDKGALYAAYMPYVKNGGLFIPTNKAYKLGDEVFLLLTLMDETEKLPVAGKVIWVTPKGSQGNRVAGIGVQFSDQDGDAARNKIETYLAGSLKSDRYTHTM

Samples

Sample ID Description Type Environment
1 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
14 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
15 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
166 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
167 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
168 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
169 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
174 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
175 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
176 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
189 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
190 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
202 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
203 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
204 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
205 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
206 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
207 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
208 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
209 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
210 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
211 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
212 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
213 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
214 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
215 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
220 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
221 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
222 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
225 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
226 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
229 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
232 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
233 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
234 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
235 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
236 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
237 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
238 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
239 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
240 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
241 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
242 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
243 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
244 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
245 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
246 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
247 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
248 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
249 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
250 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
253 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
254 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
255 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
256 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
257 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
264 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
268 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
289 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
298 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
327 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
333 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
334 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
349 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
350 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
351 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
352 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
353 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
354 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
355 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
359 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
360 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
371 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
372 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
373 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
374 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
375 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
376 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
377 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
380 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
381 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
385 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
386 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
387 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
388 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
389 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
390 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
391 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
394 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
395 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
396 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
397 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
398 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
399 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
400 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
401 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
402 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
403 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
404 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
405 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
406 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
407 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
408 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
409 2734482264 Dyella sp. AD052 Isolate Unclassified
410 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
411 2738543009 Luteibacter sp. OK325 Isolate Unclassified
412 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
413 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
414 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
415 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
416 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
417 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
418 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
419 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
420 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
421 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
422 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
423 2919404418 Luteibacter sp. 3190 Isolate Unclassified
424 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
425 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
426 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
427 2941471342 Luteibacter sp. 621 Isolate Unclassified
428 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
429 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
430 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.62
Metatranscriptomes 3.69
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0.5
Rhizoplane 2.13
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316583_10311088 3300032133 Bacteria 545
2 MRS2a_Contig_5007 2124908027 Bacteria 12299
3 SwRhRL2b_contig_1022998 2162886007 Bacteria 1714
4 JGI24736J21556_1004624 3300001904 Bacteria 2342
5 JGI24738J21930_10009582 3300002075 Bacteria 2175
6 JGI25162J39368_1000421 3300002737 Bacteria 34311
7 JGI25163J39215_1000824 3300002771 Bacteria 7443
8 JGI25164J39214_1000296 3300002772 Bacteria 34311
9 JGI25165J46597_1000528 3300003214 Bacteria 35737
10 rootH2_10097578 3300003320 Bacteria 2361
11 rootH1_10005612 3300003323 Bacteria 12697
12 rootH1_10012577 3300003316 Bacteria 3264
13 rootH1_10012577 3300003323 Bacteria 30555
14 Ga0006556J51387_1033075 3300003479 Bacteria 1707
15 JGI26143J51219_1004981 3300003502 Bacteria 650
16 JGI26141J51220_1016087 3300003503 Bacteria 512
17 Ga0006554J51385_1027885 3300003567 Bacteria 1746
18 Ga0006562J51391_1048358 3300003578 Bacteria 4740
19 Ga0006562J51391_1048362 3300003578 Bacteria 2630
20 Ga0055533_1010054 3300003756 Bacteria 1093
21 Ga0055536_1003265 3300003781 Bacteria 8790
22 Ga0055536_1003284 3300003781 Bacteria 8749
23 Ga0055536_1004864 3300003781 Bacteria 6707
24 Ga0055530_10000240 3300003791 Bacteria 49322
25 Ga0055530_10004397 3300003791 Bacteria 7269
26 Ga0055530_10098522 3300003791 Bacteria 590
27 Ga0055540_1000248 3300003792 Bacteria 49322
28 Ga0055540_1000400 3300003792 Bacteria 35238
29 Ga0055531_10000202 3300003794 Bacteria 65776
30 Ga0058692_1014349 3300003856 Bacteria 1818
31 Ga0065165_1000028 3300005262 Bacteria 224430
32 Ga0065714_10001261 3300005288 Bacteria 1249
33 Ga0065714_10014757 3300005288 Bacteria 2691
34 Ga0065714_10045372 3300005288 Bacteria 763
35 Ga0065714_10065886 3300005288 Bacteria 8197
36 Ga0065714_10108272 3300005288 Bacteria 1518
37 Ga0065714_10155290 3300005288 Bacteria 1082
38 Ga0065714_10242649 3300005288 Bacteria 767
39 Ga0065714_10243775 3300005288 Bacteria 788
40 Ga0065714_10248355 3300005288 Bacteria 768
41 Ga0065714_10287751 3300005288 Bacteria 622
42 Ga0065704_10073559 3300005289 Bacteria 7017
43 Ga0065704_10102828 3300005289 Bacteria 2191
44 Ga0065704_10265871 3300005289 Bacteria 954
45 Ga0065704_10559405 3300005289 Bacteria 630
46 Ga0065712_10070056 3300005290 Bacteria 6368
47 Ga0065712_10070345 3300005290 Bacteria 6088
48 Ga0065712_10780774 3300005290 Bacteria 518
49 Ga0065715_10145621 3300005293 Bacteria 1793
50 Ga0065707_10594074 3300005295 Bacteria 694
51 Ga0070658_10474529 3300005327 Bacteria 1079
52 Ga0070670_100930253 3300005331 Bacteria 789
53 Ga0068869_101456361 3300005334 Bacteria 607
54 Ga0068869_101960737 3300005334 Bacteria 525
55 Ga0070666_10000349 3300005335 Bacteria 28972
56 Ga0070666_10150881 3300005335 Bacteria 1621
57 Ga0070668_101820305 3300005347 Bacteria 560
58 Ga0070668_101851519 3300005347 Bacteria 555
59 Ga0070669_100039354 3300005353 Bacteria 3436
60 Ga0070675_100149452 3300005354 Bacteria 2002
61 Ga0070671_100157336 3300005355 Bacteria 1920
62 Ga0070688_100559647 3300005365 Bacteria 870
63 Ga0070688_101165752 3300005365 Bacteria 618
64 Ga0070667_100016114 3300005367 Bacteria 6183
65 Ga0070667_100072821 3300005367 Bacteria 2928
66 Ga0070667_100512035 3300005367 Bacteria 1101
67 Ga0070663_100008843 3300005455 Bacteria 6215
68 Ga0070663_100293636 3300005455 Bacteria 1299
69 Ga0070662_100019740 3300005457 Bacteria 4580
70 Ga0070662_100065544 3300005457 Bacteria 2663
71 Ga0070662_101134688 3300005457 Bacteria 671
72 Ga0070685_10001203 3300005466 Bacteria 13774
73 Ga0070685_10525559 3300005466 Bacteria 841
74 Ga0068853_100020239 3300005539 Bacteria 5532
75 Ga0068853_100926660 3300005539 Bacteria 837
76 Ga0070665_100000227 3300005548 Bacteria 93439
77 Ga0070665_100013903 3300005548 Bacteria 8097
78 Ga0068855_100097646 3300005563 Bacteria 3384
79 Ga0070664_100278872 3300005564 Bacteria 1507
80 Ga0068854_100140780 3300005578 Bacteria 1851
81 Ga0068856_100041168 3300005614 Bacteria 4539
82 Ga0068852_100036098 3300005616 Bacteria 4132
83 Ga0068852_100074224 3300005616 Bacteria 2995
84 Ga0068859_100144280 3300005617 Bacteria 2455
85 Ga0068864_100126077 3300005618 Bacteria 2295
86 Ga0068851_10001367 3300005834 Bacteria 10634
87 Ga0068851_11077851 3300005834 Bacteria 509
88 Ga0068863_100044744 3300005841 Bacteria 4201
89 Ga0068858_100001997 3300005842 Bacteria 20860
90 Ga0068858_100497266 3300005842 Bacteria 1178
91 Ga0068858_100611821 3300005842 Bacteria 1057
92 Ga0068862_100130407 3300005844 Bacteria 2223
93 Ga0081539_10030214 3300005985 Bacteria 3368
94 Ga0075364_10191846 3300006051 Bacteria 1384
95 Ga0075364_10375983 3300006051 Bacteria 969
96 Ga0075432_10003878 3300006058 Bacteria 5095
97 Ga0075432_10024222 3300006058 Bacteria 2079
98 Ga0075432_10178464 3300006058 Bacteria 830
99 Ga0075362_10081878 3300006177 Bacteria 1489
100 Ga0075362_10392788 3300006177 Bacteria 699
101 Ga0097621_100752189 3300006237 Bacteria 900
102 Ga0068865_100261987 3300006881 Bacteria 1369
103 Ga0097620_100144276 3300006931 Bacteria 2455
104 Ga0079104_1000094 3300006946 Bacteria 130202
105 Ga0079104_1036778 3300006946 Bacteria 1172
106 Ga0099826_10046334 3300006948 Bacteria 2964
107 Ga0105251_10000971 3300009011 Bacteria 25452
108 Ga0105251_10001972 3300009011 Bacteria 16765
109 Ga0105251_10006692 3300009011 Bacteria 7283
110 Ga0105251_10010185 3300009011 Bacteria 5476
111 Ga0105251_10012451 3300009011 Bacteria 4813
112 Ga0105251_10137214 3300009011 Bacteria 1107
113 Ga0105251_10140971 3300009011 Bacteria 1090
114 Ga0105251_10616837 3300009011 Bacteria 516
115 Ga0105244_10000709 3300009036 Bacteria 28850
116 Ga0105244_10006626 3300009036 Bacteria 7460
117 Ga0105244_10022875 3300009036 Bacteria 3436
118 Ga0105244_10025486 3300009036 Bacteria 3214
119 Ga0105244_10031405 3300009036 Bacteria 2818
120 Ga0105244_10045633 3300009036 Bacteria 2254
121 Ga0105244_10132648 3300009036 Bacteria 1202
122 Ga0105244_10266429 3300009036 Bacteria 796
123 Ga0105250_10000074 3300009092 Bacteria 91652
124 Ga0105250_10004551 3300009092 Bacteria 6358
125 Ga0105250_10005278 3300009092 Bacteria 5804
126 Ga0105250_10049137 3300009092 Bacteria 1691
127 Ga0105250_10183685 3300009092 Bacteria 878
128 Ga0105250_10348350 3300009092 Bacteria 648
129 Ga0105240_10001318 3300009093 Bacteria 42836
130 Ga0105240_10061849 3300009093 Bacteria 4664
131 Ga0105240_10088811 3300009093 Bacteria 3781
132 Ga0105240_11099354 3300009093 Bacteria 846
133 Ga0111539_10189307 3300009094 Bacteria 2401
134 Ga0105247_10004675 3300009101 Bacteria 8724
135 Ga0105243_10012583 3300009148 Bacteria 6396
136 Ga0105243_10046356 3300009148 Bacteria 3419
137 Ga0105243_10371643 3300009148 Bacteria 1319
138 Ga0105243_12037693 3300009148 Bacteria 609
139 Ga0105241_10061839 3300009174 Bacteria 2885
140 Ga0105248_10216798 3300009177 Bacteria 2155
141 Ga0105237_10040609 3300009545 Bacteria 4692
142 Ga0105237_10057998 3300009545 Bacteria 3875
143 Ga0105238_10004916 3300009551 Bacteria 13227
144 Ga0105238_10045807 3300009551 Bacteria 4418
145 Ga0105238_10231755 3300009551 Bacteria 1823
146 Ga0105249_10009268 3300009553 Bacteria 8608
147 Ga0105249_10132334 3300009553 Bacteria 2382
148 Ga0105239_10099795 3300010375 Bacteria 3210
149 Ga0105239_11220384 3300010375 Bacteria 867
150 Ga0105246_10010995 3300011119 Bacteria 5610
151 Ga0105246_10017718 3300011119 Bacteria 4530
152 Ga0105246_10027429 3300011119 Bacteria 3731
153 Ga0157373_10012012 3300013100 Bacteria 6365
154 Ga0157373_10015562 3300013100 Bacteria 5560
155 Ga0157373_10020104 3300013100 Bacteria 4857
156 Ga0157373_10059677 3300013100 Bacteria 2703
157 Ga0157373_10074417 3300013100 Bacteria 2396
158 Ga0157373_10156997 3300013100 Bacteria 1600
159 Ga0157373_11031773 3300013100 Bacteria 615
160 Ga0157371_10000406 3300013102 Bacteria 53786
161 Ga0157371_10003900 3300013102 Bacteria 13282
162 Ga0157371_10010020 3300013102 Bacteria 7410
163 Ga0157371_10023347 3300013102 Bacteria 4523
164 Ga0157371_10029405 3300013102 Bacteria 3974
165 Ga0157371_10040966 3300013102 Bacteria 3307
166 Ga0157371_11610423 3300013102 Bacteria 508
167 Ga0157370_10003491 3300013104 Bacteria 18436
168 Ga0157370_10029572 3300013104 Bacteria 5373
169 Ga0157370_10036318 3300013104 Bacteria 4783
170 Ga0157370_10067761 3300013104 Bacteria 3374
171 Ga0157370_10075420 3300013104 Bacteria 3179
172 Ga0157370_10134067 3300013104 Bacteria 2309
173 Ga0157370_10344341 3300013104 Bacteria 1374
174 Ga0157370_10704253 3300013104 Bacteria 922
175 Ga0157370_10981641 3300013104 Bacteria 765
176 Ga0157370_11127406 3300013104 Bacteria 708
177 Ga0157370_11400089 3300013104 Bacteria 629
178 Ga0157369_10000329 3300013105 Bacteria 63484
179 Ga0157369_10002062 3300013105 Bacteria 24256
180 Ga0157369_10027825 3300013105 Bacteria 6263
181 Ga0157369_10053199 3300013105 Bacteria 4377
182 Ga0157369_10177919 3300013105 Bacteria 2239
183 Ga0157369_10250742 3300013105 Bacteria 1847
184 Ga0157369_10262866 3300013105 Bacteria 1800
185 Ga0157369_10552434 3300013105 Bacteria 1190
186 Ga0157369_10668929 3300013105 Bacteria 1070
187 Ga0157374_10125969 3300013296 Bacteria 2476
188 Ga0157374_10627022 3300013296 Bacteria 1086
189 Ga0163162_10000030 3300013306 Bacteria 163717
190 Ga0163162_10000495 3300013306 Bacteria 36598
191 Ga0163162_10228419 3300013306 Bacteria 1991
192 Ga0157372_10219520 3300013307 Bacteria 2204
193 Ga0157372_10221324 3300013307 Bacteria 2194
194 Ga0157372_10699434 3300013307 Bacteria 1180
195 Ga0157375_10092090 3300013308 Bacteria 3094
196 Ga0157375_10297193 3300013308 Bacteria 1778
197 Ga0157375_12335801 3300013308 Bacteria 638
198 Ga0157375_13220435 3300013308 Bacteria 544
199 Ga0163163_10822619 3300014325 Bacteria 992
200 Ga0157380_12205699 3300014326 Bacteria 615
201 Ga0182008_10001710 3300014497 Bacteria 14399
202 Ga0182008_10004847 3300014497 Bacteria 7773
203 Ga0182008_10008849 3300014497 Bacteria 5464
204 Ga0182008_10009722 3300014497 Bacteria 5179
205 Ga0182008_10059579 3300014497 Bacteria 1884
206 Ga0182008_10069783 3300014497 Bacteria 1729
207 Ga0182008_10080762 3300014497 Bacteria 1600
208 Ga0182008_10214491 3300014497 Bacteria 983
209 Ga0182008_10258777 3300014497 Bacteria 900
210 Ga0182008_10500014 3300014497 Bacteria 668
211 Ga0157376_10037597 3300014969 Bacteria 3932
212 Ga0157376_12032455 3300014969 Bacteria 613
213 Ga0182006_1000072 3300015261 Bacteria 133681
214 Ga0182006_1002699 3300015261 Bacteria 9525
215 Ga0182006_1004981 3300015261 Bacteria 6400
216 Ga0182006_1008086 3300015261 Bacteria 4778
217 Ga0182006_1024729 3300015261 Bacteria 2475
218 Ga0182006_1027559 3300015261 Bacteria 2317
219 Ga0182006_1028287 3300015261 Bacteria 2280
220 Ga0182006_1059317 3300015261 Bacteria 1449
221 Ga0182006_1093958 3300015261 Bacteria 1074
222 Ga0182006_1126189 3300015261 Bacteria 884
223 Ga0182006_1134623 3300015261 Bacteria 848
224 Ga0182007_10004029 3300015262 Bacteria 6776
225 Ga0182007_10012807 3300015262 Bacteria 3219
226 Ga0182007_10076641 3300015262 Bacteria 1096
227 Ga0182007_10182043 3300015262 Bacteria 727
228 Ga0182007_10424713 3300015262 Bacteria 509
229 Ga0182005_1002599 3300015265 Bacteria 6381
230 Ga0182005_1002728 3300015265 Bacteria 6170
231 Ga0182005_1002754 3300015265 Bacteria 6133
232 Ga0182005_1019229 3300015265 Bacteria 1883
233 Ga0182005_1037481 3300015265 Bacteria 1318
234 Ga0182005_1037547 3300015265 Bacteria 1317
235 Ga0182005_1049663 3300015265 Bacteria 1140
236 Ga0182005_1060913 3300015265 Bacteria 1031
237 Ga0182005_1063406 3300015265 Bacteria 1010
238 Ga0182005_1156521 3300015265 Bacteria 666
239 Ga0182005_1252454 3300015265 Bacteria 546
240 Ga0163161_10010440 3300017792 Bacteria 6430
241 Ga0163161_10011813 3300017792 Bacteria 6056
242 Ga0163161_10012486 3300017792 Bacteria 5896
243 Ga0163161_10121726 3300017792 Bacteria 1961
244 Ga0163161_10164095 3300017792 Bacteria 1695
245 Ga0163161_10252315 3300017792 Bacteria 1375
246 Ga0163161_10452259 3300017792 Bacteria 1038
247 Ga0163161_10455393 3300017792 Bacteria 1035
248 Ga0163161_10914732 3300017792 Bacteria 744
249 Ga0209760_100114 3300025207 Bacteria 57573
250 Ga0209674_100615 3300025226 Bacteria 13401
251 Ga0209563_100338 3300025230 Bacteria 17932
252 Ga0207427_100008 3300025231 Bacteria 740731
253 Ga0209437_100014 3300025233 Bacteria 740714
254 Ga0209437_101456 3300025233 Bacteria 5743
255 Ga0209148_1001787 3300025254 Bacteria 9152
256 Ga0209759_1004233 3300025256 Bacteria 5431
257 Ga0209129_1000785 3300025258 Bacteria 20058
258 Ga0209233_1000008 3300025261 Bacteria 1356712
259 Ga0209233_1005903 3300025261 Bacteria 4010
260 Ga0209233_1014439 3300025261 Bacteria 2224
261 Ga0209675_1001650 3300025291 Bacteria 12430
262 Ga0209676_1000010 3300025292 Bacteria 954025
263 Ga0209676_1000037 3300025292 Bacteria 457562
264 Ga0209676_1000345 3300025292 Bacteria 88051
265 Ga0209676_1005862 3300025292 Bacteria 6255
266 Ga0209758_1007611 3300025297 Bacteria 7306
267 Ga0209050_1000081 3300025298 Bacteria 267533
268 Ga0209050_1000227 3300025298 Bacteria 123743
269 Ga0209050_1003874 3300025298 Bacteria 10627
270 Ga0209256_1012211 3300025299 Bacteria 3322
271 Ga0209051_1000104 3300025303 Bacteria 161001
272 Ga0209051_1000164 3300025303 Bacteria 124186
273 Ga0209051_1059822 3300025303 Bacteria 1206
274 Ga0209051_1090576 3300025303 Bacteria 852
275 Ga0209257_1000040 3300025304 Bacteria 538759
276 Ga0209257_1090914 3300025304 Bacteria 763
277 Ga0207656_10009507 3300025321 Bacteria 3613
278 Ga0207696_1000045 3300025711 Bacteria 296484
279 Ga0207696_1000097 3300025711 Bacteria 175696
280 Ga0207696_1002467 3300025711 Bacteria 9046
281 Ga0207696_1003140 3300025711 Bacteria 7692
282 Ga0207696_1050064 3300025711 Bacteria 1197
283 Ga0207655_1000005 3300025728 Bacteria 917277
284 Ga0207655_1000931 3300025728 Bacteria 30378
285 Ga0207655_1001255 3300025728 Bacteria 24204
286 Ga0207655_1008691 3300025728 Bacteria 6409
287 Ga0207655_1016895 3300025728 Bacteria 3967
288 Ga0207655_1017521 3300025728 Bacteria 3859
289 Ga0207655_1041328 3300025728 Bacteria 1977
290 Ga0207655_1042620 3300025728 Bacteria 1930
291 Ga0207655_1048550 3300025728 Bacteria 1741
292 Ga0207655_1075281 3300025728 Bacteria 1239
293 Ga0207713_1000030 3300025735 Bacteria 284027
294 Ga0207713_1000681 3300025735 Bacteria 31842
295 Ga0207713_1002600 3300025735 Bacteria 13023
296 Ga0207713_1005856 3300025735 Bacteria 7597
297 Ga0207713_1016741 3300025735 Bacteria 3710
298 Ga0207713_1042947 3300025735 Bacteria 1872
299 Ga0207713_1094723 3300025735 Bacteria 1042
300 Ga0207713_1161990 3300025735 Bacteria 712
301 Ga0207710_10005160 3300025900 Bacteria 5644
302 Ga0207680_10120450 3300025903 Bacteria 1715
303 Ga0207680_10164995 3300025903 Bacteria 1488
304 Ga0207647_10000138 3300025904 Bacteria 57656
305 Ga0207647_10000213 3300025904 Bacteria 47297
306 Ga0207705_10602960 3300025909 Bacteria 854
307 Ga0207654_10054180 3300025911 Bacteria 2318
308 Ga0207695_10000007 3300025913 Bacteria 1092551
309 Ga0207695_10012596 3300025913 Bacteria 10135
310 Ga0207695_10045432 3300025913 Bacteria 4662
311 Ga0207671_10007188 3300025914 Bacteria 9702
312 Ga0207671_10263165 3300025914 Bacteria 1358
313 Ga0207649_10056626 3300025920 Bacteria 2449
314 Ga0207681_10038369 3300025923 Bacteria 3173
315 Ga0207681_11695935 3300025923 Bacteria 528
316 Ga0207694_10002986 3300025924 Bacteria 13563
317 Ga0207694_10008956 3300025924 Bacteria 7557
318 Ga0207694_10156777 3300025924 Bacteria 1837
319 Ga0207650_10135687 3300025925 Bacteria 1930
320 Ga0207650_10480594 3300025925 Bacteria 1037
321 Ga0207644_10525525 3300025931 Bacteria 978
322 Ga0207706_10013867 3300025933 Bacteria 7310
323 Ga0207706_10030348 3300025933 Bacteria 4823
324 Ga0207709_10000035 3300025935 Bacteria 300968
325 Ga0207709_10024708 3300025935 Bacteria 3433
326 Ga0207709_10391153 3300025935 Bacteria 1060
327 Ga0207689_10919355 3300025942 Bacteria 738
328 Ga0207679_10425930 3300025945 Bacteria 1172
329 Ga0207667_10079883 3300025949 Bacteria 3389
330 Ga0207712_10000169 3300025961 Bacteria 67461
331 Ga0207712_10298208 3300025961 Bacteria 1321
332 Ga0207668_10207035 3300025972 Bacteria 1566
333 Ga0207668_11464003 3300025972 Bacteria 616
334 Ga0207640_10103641 3300025981 Bacteria 2001
335 Ga0207658_10028023 3300025986 Bacteria 3963
336 Ga0207677_12261678 3300026023 Bacteria 506
337 Ga0207703_10000456 3300026035 Bacteria 43004
338 Ga0207703_10270343 3300026035 Bacteria 1540
339 Ga0207703_10775483 3300026035 Bacteria 914
340 Ga0207639_10011000 3300026041 Bacteria 6273
341 Ga0207639_10425394 3300026041 Bacteria 1201
342 Ga0207678_10006920 3300026067 Bacteria 10062
343 Ga0207702_10011335 3300026078 Bacteria 7432
344 Ga0207641_10265562 3300026088 Bacteria 1608
345 Ga0207648_10172106 3300026089 Bacteria 1915
346 Ga0207648_10954280 3300026089 Bacteria 802
347 Ga0207676_10109058 3300026095 Bacteria 2312
348 Ga0207698_10002097 3300026142 Bacteria 11768
349 Ga0207698_10876073 3300026142 Bacteria 904
350 Ga0209281_1000212 3300027111 Bacteria 130216
351 Ga0209281_1007137 3300027111 Bacteria 2825
352 Ga0209281_1023932 3300027111 Bacteria 1152
353 Ga0209973_1030621 3300027252 Bacteria 757
354 Ga0209371_1000313 3300027312 Bacteria 53399
355 Ga0209981_1012950 3300027378 Bacteria 1158
356 Ga0209981_1054771 3300027378 Bacteria 607
357 Ga0209996_1008657 3300027395 Bacteria 1335
358 Ga0209984_1009616 3300027424 Bacteria 1232
359 Ga0210000_1008657 3300027462 Bacteria 1493
360 Ga0209995_1000628 3300027471 Bacteria 5440
361 Ga0209995_1030165 3300027471 Bacteria 907
362 Ga0209982_1019137 3300027552 Bacteria 1049
363 Ga0209970_1009883 3300027614 Bacteria 1559
364 Ga0209983_1004575 3300027665 Bacteria 2901
365 Ga0209282_1317174 3300027666 Bacteria 654
366 Ga0209971_1000556 3300027682 Bacteria 9748
367 Ga0209974_10001102 3300027876 Bacteria 9561
368 Ga0268266_10000006 3300028379 Bacteria 1410021
369 Ga0268266_10020349 3300028379 Bacteria 5657
370 Ga0268265_10055260 3300028380 Bacteria 3016
371 Ga0265318_10025797 3300028577 Unclassified 2317
372 Ga0265336_10033997 3300028666 Bacteria 1578
373 Ga0307517_10275081 3300028786 Bacteria 965
374 Ga0268256_1000274 3300030500 Bacteria 53399
375 Ga0307511_10218911 3300030521 Bacteria 959
376 Ga0316177_1123371 3300030731 Bacteria 1193
377 Ga0314311_1088196 3300030733 Bacteria 1503
378 Ga0316178_1043989 3300030735 Bacteria 34199
379 Ga0316183_1192322 3300030742 Bacteria 1390
380 Ga0316181_1100804 3300030744 Bacteria 4760
381 Ga0316181_1112713 3300030744 Bacteria 623
382 Ga0265327_10001934 3300031251 Bacteria 23916
383 Ga0265327_10291231 3300031251 Bacteria 720
384 Ga0307408_100000027 3300031548 Bacteria 261506
385 Ga0307408_100000589 3300031548 Bacteria 31221
386 Ga0307408_100001953 3300031548 Bacteria 14914
387 Ga0307408_100013344 3300031548 Bacteria 5452
388 Ga0307408_100031419 3300031548 Bacteria 3698
389 Ga0307408_100062086 3300031548 Bacteria 2729
390 Ga0307408_100170267 3300031548 Bacteria 1738
391 Ga0307508_10344339 3300031616 Bacteria 1082
392 Ga0316575_10007516 3300031665 Bacteria 3947
393 Ga0316575_10007575 3300031665 Bacteria 3931
394 Ga0316575_10033776 3300031665 Bacteria 2007
395 Ga0316575_10048392 3300031665 Bacteria 1690
396 Ga0316575_10056429 3300031665 Bacteria 1565
397 Ga0316575_10157309 3300031665 Bacteria 939
398 Ga0316575_10161584 3300031665 Bacteria 926
399 Ga0316575_10177316 3300031665 Bacteria 884
400 Ga0316575_10309089 3300031665 Bacteria 669
401 Ga0316575_10311654 3300031665 Bacteria 667
402 Ga0316579_10000223 3300031691 Bacteria 17183
403 Ga0316579_10001576 3300031691 Bacteria 8326
404 Ga0316579_10005824 3300031691 Bacteria 4995
405 Ga0316579_10034879 3300031691 Bacteria 2317
406 Ga0316579_10056030 3300031691 Bacteria 1850
407 Ga0316579_10083848 3300031691 Bacteria 1519
408 Ga0316579_10325393 3300031691 Bacteria 743
409 Ga0316579_10409436 3300031691 Bacteria 656
410 Ga0316576_10000256 3300031727 Bacteria 23138
411 Ga0316576_10004776 3300031727 Bacteria 8184
412 Ga0316576_10008248 3300031727 Bacteria 6627
413 Ga0316576_10091160 3300031727 Bacteria 2271
414 Ga0316576_10109874 3300031727 Bacteria 2066
415 Ga0316576_10126436 3300031727 Bacteria 1921
416 Ga0316576_10200402 3300031727 Bacteria 1504
417 Ga0316576_10621227 3300031727 Bacteria 788
418 Ga0316576_10679016 3300031727 Bacteria 747
419 Ga0316576_10995683 3300031727 Bacteria 597
420 Ga0316578_10001774 3300031728 Bacteria 9054
421 Ga0316578_10001869 3300031728 Bacteria 8868
422 Ga0316578_10018677 3300031728 Bacteria 3804
423 Ga0316578_10019620 3300031728 Bacteria 3725
424 Ga0316578_10030826 3300031728 Bacteria 3051
425 Ga0316578_10031007 3300031728 Bacteria 3043
426 Ga0316578_10036775 3300031728 Bacteria 2819
427 Ga0316578_10081938 3300031728 Bacteria 1920
428 Ga0316578_10165026 3300031728 Bacteria 1335
429 Ga0316578_10198962 3300031728 Bacteria 1206
430 Ga0316578_10625271 3300031728 Bacteria 630
431 Ga0316578_10741970 3300031728 Bacteria 570
432 Ga0307516_10235546 3300031730 Bacteria 1532
433 Ga0307405_10000987 3300031731 Bacteria 11428
434 Ga0307405_10015368 3300031731 Bacteria 4145
435 Ga0307405_10487151 3300031731 Bacteria 985
436 Ga0307405_11307771 3300031731 Bacteria 631
437 Ga0316577_10003405 3300031733 Bacteria 8026
438 Ga0316577_10004678 3300031733 Bacteria 7104
439 Ga0316577_10023697 3300031733 Bacteria 3408
440 Ga0316577_10045636 3300031733 Bacteria 2449
441 Ga0316577_10056850 3300031733 Bacteria 2184
442 Ga0316577_10187810 3300031733 Bacteria 1168
443 Ga0316577_10229693 3300031733 Bacteria 1049
444 Ga0316577_10269965 3300031733 Bacteria 962
445 Ga0316577_10307478 3300031733 Bacteria 898
446 Ga0316577_10352462 3300031733 Bacteria 835
447 Ga0307413_10017297 3300031824 Bacteria 3751
448 Ga0307413_10027489 3300031824 Bacteria 3153
449 Ga0307413_10047583 3300031824 Bacteria 2558
450 Ga0307413_11444641 3300031824 Bacteria 606
451 Ga0307406_10029998 3300031901 Bacteria 3297
452 Ga0307406_10059928 3300031901 Bacteria 2452
453 Ga0307406_10169260 3300031901 Bacteria 1579
454 Ga0307407_10006639 3300031903 Bacteria 5168
455 Ga0307407_10180908 3300031903 Bacteria 1397
456 Ga0307407_10411657 3300031903 Bacteria 972
457 Ga0307412_10002583 3300031911 Bacteria 10061
458 Ga0307412_10005916 3300031911 Bacteria 6892
459 Ga0307412_10011186 3300031911 Bacteria 5193
460 Ga0307412_10016826 3300031911 Bacteria 4366
461 Ga0307412_10086424 3300031911 Bacteria 2182
462 Ga0307412_10126896 3300031911 Bacteria 1846
463 Ga0307412_10472862 3300031911 Bacteria 1037
464 Ga0307412_10692898 3300031911 Bacteria 873
465 Ga0307409_100021248 3300031995 Bacteria 4446
466 Ga0307409_100036561 3300031995 Bacteria 3611
467 Ga0307416_100359120 3300032002 Bacteria 1478
468 Ga0307416_100598335 3300032002 Bacteria 1182
469 Ga0307416_101172513 3300032002 Bacteria 873
470 Ga0307414_10214662 3300032004 Bacteria 1575
471 Ga0307414_10258328 3300032004 Bacteria 1452
472 Ga0307414_10450681 3300032004 Bacteria 1128
473 Ga0307414_10691644 3300032004 Bacteria 922
474 Ga0307411_10021479 3300032005 Bacteria 3778
475 Ga0307411_10087930 3300032005 Bacteria 2159
476 Ga0307411_11000380 3300032005 Bacteria 748
477 Ga0316583_10002609 3300032133 Bacteria 6288
478 Ga0316583_10006405 3300032133 Bacteria 4227
479 Ga0316583_10010185 3300032133 Bacteria 3388
480 Ga0316583_10014224 3300032133 Bacteria 2870
481 Ga0316583_10017999 3300032133 Bacteria 2537
482 Ga0316583_10031085 3300032133 Bacteria 1901
483 Ga0316583_10038675 3300032133 Bacteria 1691
484 Ga0316583_10111001 3300032133 Bacteria 956
485 Ga0316583_10127391 3300032133 Bacteria 887
486 Ga0316583_10144965 3300032133 Bacteria 827
487 Ga0316585_10000045 3300032137 Bacteria 19293
488 Ga0316585_10002386 3300032137 Bacteria 5062
489 Ga0316585_10048247 3300032137 Bacteria 1364
490 Ga0316585_10061278 3300032137 Bacteria 1216
491 Ga0316585_10077703 3300032137 Bacteria 1080
492 Ga0316585_10081381 3300032137 Bacteria 1055
493 Ga0316585_10135362 3300032137 Bacteria 812
494 Ga0316580_10000052 3300032139 Bacteria 18421
495 Ga0316580_10009698 3300032139 Bacteria 2898
496 Ga0316580_10015636 3300032139 Bacteria 2323
497 Ga0316580_10021674 3300032139 Bacteria 1981
498 Ga0316580_10030832 3300032139 Bacteria 1660
499 Ga0316580_10042211 3300032139 Bacteria 1408
500 Ga0316593_10001775 3300032168 Bacteria 4906
501 Ga0316593_10005353 3300032168 Bacteria 3376
502 Ga0316593_10005989 3300032168 Bacteria 3253
503 Ga0316593_10014207 3300032168 Bacteria 2370
504 Ga0316593_10019300 3300032168 Bacteria 2106
505 Ga0316593_10043709 3300032168 Bacteria 1497
506 Ga0316593_10052695 3300032168 Bacteria 1378
507 Ga0316593_10057095 3300032168 Bacteria 1329
508 Ga0316593_10098566 3300032168 Bacteria 1035
509 Ga0316593_10221303 3300032168 Bacteria 703
510 Ga0316593_10235307 3300032168 Bacteria 683
511 Ga0316593_10325346 3300032168 Bacteria 585
512 Ga0316593_10453548 3300032168 Bacteria 501
513 Ga0307510_10030497 3300033180 Bacteria 6112
514 Ga0307510_10222045 3300033180 Bacteria 1400
515 Ga0316592_1000443 3300033524 Bacteria 5660
516 Ga0316592_1004880 3300033524 Bacteria 2521
517 Ga0316592_1024767 3300033524 Bacteria 1291
518 Ga0316592_1045492 3300033524 Bacteria 977
519 Ga0316592_1048157 3300033524 Bacteria 950
520 Ga0316592_1083052 3300033524 Bacteria 729
521 Ga0316586_1014253 3300033527 Bacteria 1254
522 Ga0316586_1015204 3300033527 Bacteria 1223
523 Ga0316586_1022983 3300033527 Bacteria 1039
524 Ga0316588_1000220 3300033528 Bacteria 6791
525 Ga0316588_1003976 3300033528 Bacteria 2752
526 Ga0316588_1037124 3300033528 Unclassified 1158
527 Ga0316588_1068369 3300033528 Bacteria 871
528 Ga0316587_1011069 3300033529 Bacteria 1452
529 Ga0316587_1026358 3300033529 Bacteria 1013
530 Ga0316587_1033696 3300033529 Bacteria 911
531 Ga0316587_1062296 3300033529 Bacteria 692
532 Ga0316587_1084725 3300033529 Bacteria 601
533 Ga0316587_1103648 3300033529 Bacteria 549
534 Ga0316587_1120717 3300033529 Bacteria 513
535 Ga0316596_1000105 3300033541 Bacteria 10649
536 Ga0316596_1000300 3300033541 Bacteria 7857
537 Ga0316596_1001890 3300033541 Bacteria 4377
538 Ga0316596_1012130 3300033541 Bacteria 2115
539 Ga0316596_1028091 3300033541 Bacteria 1453
540 Ga0316596_1033052 3300033541 Bacteria 1347
541 Ga0316596_1041381 3300033541 Bacteria 1211
542 Ga0316596_1057151 3300033541 Bacteria 1038
543 Ga0316596_1066524 3300033541 Unclassified 963
544 Ga0316596_1128083 3300033541 Bacteria 692
545 Ga0316596_1150878 3300033541 Bacteria 638
546 Ga0316596_1167215 3300033541 Bacteria 606
547 Ga0373952_0022981 3300035092 Bacteria 1329
548 Ga0316574_0000424 3300035398 Bacteria 16777
549 Ga0316574_0000873 3300035398 Bacteria 13313
550 Ga0316574_0043902 3300035398 Bacteria 2764
551 Ga0316574_0044101 3300035398 Bacteria 2758
552 Ga0316574_0099207 3300035398 Bacteria 1863
553 Ga0316574_0103789 3300035398 Unclassified 1820
554 Ga0316574_0108525 3300035398 Bacteria 1778
555 Ga0316574_0120938 3300035398 Bacteria 1681
556 Ga0316574_0127486 3300035398 Bacteria 1636
557 Ga0316574_0196511 3300035398 Bacteria 1296
558 Ga0316574_0224345 3300035398 Bacteria 1203
559 Ga0316574_0266190 3300035398 Bacteria 1094
560 Ga0316574_0603818 3300035398 Bacteria 678
561 Ga0316582_0000425 3300036647 Bacteria 15480
562 Ga0316582_0001793 3300036647 Bacteria 9690
563 Ga0316582_0002571 3300036647 Bacteria 8595
564 Ga0316582_0003576 3300036647 Bacteria 7655
565 Ga0316582_0011418 3300036647 Bacteria 4908
566 Ga0316582_0013421 3300036647 Bacteria 4609
567 Ga0316582_0036684 3300036647 Bacteria 3035
568 Ga0316582_0049568 3300036647 Bacteria 2657
569 Ga0316582_0093722 3300036647 Bacteria 1980
570 Ga0316582_0102391 3300036647 Bacteria 1898
571 Ga0316582_0129702 3300036647 Bacteria 1692
572 Ga0316582_0129933 3300036647 Bacteria 1691
573 Ga0316582_0180370 3300036647 Bacteria 1436
574 Ga0316582_0383187 3300036647 Bacteria 968
575 Ga0316582_0536386 3300036647 Bacteria 806
576 Ga0316582_1131147 3300036647 Bacteria 533
577 Ga0316584_0008126 3300036712 Bacteria 7209
578 Ga0316584_0012158 3300036712 Bacteria 6066
579 Ga0316584_0016520 3300036712 Bacteria 5291
580 Ga0316584_0016711 3300036712 Bacteria 5264
581 Ga0316584_0026225 3300036712 Bacteria 4282
582 Ga0316584_0057024 3300036712 Bacteria 2924
583 Ga0316584_0086613 3300036712 Bacteria 2344
584 Ga0316584_0091924 3300036712 Bacteria 2272
585 Ga0316584_0094276 3300036712 Bacteria 2241
586 Ga0316584_0145361 3300036712 Bacteria 1767
587 Ga0316584_0156930 3300036712 Bacteria 1692
588 Ga0316584_0166434 3300036712 Bacteria 1637
589 Ga0316584_0173059 3300036712 Bacteria 1600
590 Ga0316584_0179359 3300036712 Bacteria 1568
591 Ga0316584_0207034 3300036712 Bacteria 1445
592 Ga0316584_0218127 3300036712 Unclassified 1402
593 Ga0316584_0270367 3300036712 Bacteria 1237
594 Ga0316584_0296105 3300036712 Unclassified 1173
595 Ga0316584_0335995 3300036712 Bacteria 1087
596 Ga0316584_0425955 3300036712 Bacteria 942
597 Ga0316581_0006139 3300037588 Bacteria 3167
598 Ga0316581_0013331 3300037588 Bacteria 2329
599 Ga0316581_0018212 3300037588 Bacteria 2038
600 Ga0316581_0019321 3300037588 Bacteria 1986
601 Ga0316581_0081932 3300037588 Bacteria 993
602 Ga0237819_00720 3300038705 Bacteria 10688
603 Ga0237819_10282 3300038705 Bacteria 1226
604 Ga0400484_03261 3300038725 Bacteria 37196
605 Ga0400484_22124 3300038725 Bacteria 6385
606 Ga0400484_24524 3300038725 Bacteria 4866
607 Ga0400484_24604 3300038725 Bacteria 3964
608 Ga0400484_34217 3300038725 Bacteria 35210
609 Ga0400490_16939 3300038726 Bacteria 2507
610 Ga0400490_18637 3300038726 Unclassified 4056
611 Ga0400490_20091 3300038726 Bacteria 9857
612 Ga0400490_25156 3300038726 Bacteria 18125
613 Ga0400490_33872 3300038726 Bacteria 1033
614 Ga0400490_45662 3300038726 Bacteria 38225
615 Ga0400490_61215 3300038726 Bacteria 13269
616 Ga0400491_11104 3300038727 Bacteria 8310
617 Ga0400491_23332 3300038727 Bacteria 5868
618 Ga0400485_02898 3300038735 Bacteria 20319
619 Ga0400485_07793 3300038735 Bacteria 20957
620 Ga0400488_03303 3300038741 Bacteria 6108
621 Ga0400488_10662 3300038741 Bacteria 1300
622 Ga0400488_17680 3300038741 Bacteria 1507
623 Ga0400488_18679 3300038741 Bacteria 1580
624 Ga0400488_29451 3300038741 Bacteria 9666
625 Ga0400488_29660 3300038741 Bacteria 7958
626 Ga0400488_33104 3300038741 Bacteria 1070
627 Ga0400488_38090 3300038741 Bacteria 2844
628 Ga0400488_51689 3300038741 Bacteria 6393
629 Ga0400488_54154 3300038741 Bacteria 1829
630 Ga0400488_57680 3300038741 Bacteria 6245
631 Ga0400486_06140 3300038742 Bacteria 135791
632 Ga0400486_08788 3300038742 Unclassified 1684
633 Ga0400486_30182 3300038742 Bacteria 34714
634 Ga0400483_005162 3300039062 Unclassified 4126
635 Ga0400483_048826 3300039062 Bacteria 15631
636 Ga0400483_056532 3300039062 Bacteria 2762
637 Ga0400483_058543 3300039062 Bacteria 10440
638 Ga0400483_061103 3300039062 Unclassified 1322
639 Ga0400483_062240 3300039062 Bacteria 6194
640 Ga0400483_067063 3300039062 Bacteria 31217
641 Ga0400483_069725 3300039062 Bacteria 2637
642 Ga0400483_072164 3300039062 Bacteria 20984
643 Ga0400483_084581 3300039062 Bacteria 5267
644 Ga0400483_108539 3300039062 Bacteria 1336
645 Ga0400483_134009 3300039062 Bacteria 204879
646 Ga0400483_145061 3300039062 Bacteria 1581
647 Ga0400483_164358 3300039062 Bacteria 22122
648 Ga0400483_179717 3300039062 Bacteria 2619
649 Ga0400483_193304 3300039062 Bacteria 5965
650 Ga0400483_196484 3300039062 Bacteria 11326
651 Ga0400483_203162 3300039062 Unclassified 2257
652 Ga0400483_240978 3300039062 Bacteria 1421
653 Ga0400483_252208 3300039062 Bacteria 2966
654 Ga0400483_269943 3300039062 Bacteria 1902
655 Ga0400483_277286 3300039062 Bacteria 16720
656 Ga0400483_279635 3300039062 Bacteria 14003
657 Ga0400489_18813 3300039093 Bacteria 1789
658 Ga0400487_00528 3300039110 Bacteria 3240
659 Ga0400487_01707 3300039110 Bacteria 12213
660 Ga0400487_10993 3300039110 Bacteria 7450
661 Ga0400487_12856 3300039110 Unclassified 1796
662 Ga0400487_24791 3300039110 Bacteria 81428
663 Ga0400487_26365 3300039110 Bacteria 2958
664 Ga0400487_27362 3300039110 Bacteria 16177
665 Ga0400487_28448 3300039110 Bacteria 3531
666 Ga0400487_47735 3300039110 Bacteria 59107
667 Ga0439436_0000529 3300041404 Bacteria 10021
668 Ga0439436_0030612 3300041404 Bacteria 1563
669 Ga0439438_003655 3300041405 Bacteria 6144
670 Ga0439438_003712 3300041405 Bacteria 6070
671 Ga0439438_003849 3300041405 Bacteria 5921
672 Ga0439438_004132 3300041405 Bacteria 5668
673 Ga0439438_004546 3300041405 Bacteria 5289
674 Ga0439438_009436 3300041405 Bacteria 3158
675 Ga0439438_016363 3300041405 Bacteria 2157
676 Ga0439447_002115 3300041407 Bacteria 7299
677 Ga0439447_002684 3300041407 Bacteria 6443
678 Ga0439447_003500 3300041407 Bacteria 5572
679 Ga0439447_004605 3300041407 Bacteria 4703
680 Ga0439447_005034 3300041407 Bacteria 4448
681 Ga0439447_019764 3300041407 Bacteria 1792
682 Ga0439447_020417 3300041407 Bacteria 1757
683 Ga0439447_075981 3300041407 Bacteria 777
684 Ga0439453_0069226 3300041408 Bacteria 744
685 Ga0439461_0014356 3300041410 Bacteria 1506
686 Ga0439466_0003608 3300041411 Bacteria 5979
687 Ga0439466_0003822 3300041411 Bacteria 5814
688 Ga0439466_0004509 3300041411 Bacteria 5353
689 Ga0439466_0004750 3300041411 Bacteria 5218
690 Ga0439466_0005809 3300041411 Bacteria 4701
691 Ga0439466_0006690 3300041411 Bacteria 4374
692 Ga0439466_0013327 3300041411 Bacteria 3010
693 Ga0439466_0018538 3300041411 Bacteria 2495
694 Ga0439466_0023453 3300041411 Bacteria 2170
695 Ga0439466_0031287 3300041411 Bacteria 1821
696 Ga0439465_0003421 3300041413 Bacteria 5176
697 Ga0439465_0003829 3300041413 Bacteria 4909
698 Ga0451793_0038927 3300041452 Bacteria 1553
699 Ga0451800_1131212 3300041459 Bacteria 1133
700 Ga0451806_159937 3300041462 Bacteria 1575
701 Ga0451804_0897249 3300041463 Bacteria 647
702 Ga0451807_0544911 3300041486 Bacteria 1064
703 Ga0451833_1047701 3300041491 Bacteria 538
704 Ga0451837_1262131 3300041494 Unclassified 504
705 Ga0451839_0080508 3300041496 Bacteria 741
706 Ga0451839_1006830 3300041496 Bacteria 598
707 Ga0451853_0100403 3300041512 Bacteria 684
708 Ga0439437_008674 3300042000 Bacteria 1145
709 Ga0439441_093362 3300042001 Bacteria 668
710 Ga0439445_0064853 3300042004 Bacteria 1004
711 Ga0439432_008802 3300042006 Bacteria 3531
712 Ga0439432_010106 3300042006 Bacteria 3280
713 Ga0439432_010683 3300042006 Bacteria 3175
714 Ga0439432_014095 3300042006 Bacteria 2708
715 Ga0439432_022493 3300042006 Bacteria 2082
716 Ga0439432_174202 3300042006 Bacteria 627
717 Ga0439451_001759 3300042009 Bacteria 4320
718 Ga0439451_002045 3300042009 Bacteria 4052
719 Ga0439451_068680 3300042009 Bacteria 709
720 Ga0439452_000281 3300042010 Bacteria 33473
721 Ga0439452_001961 3300042010 Bacteria 7875
722 Ga0439452_002545 3300042010 Bacteria 6713
723 Ga0439452_003098 3300042010 Bacteria 5895
724 Ga0439452_008330 3300042010 Bacteria 3128
725 Ga0439452_014216 3300042010 Bacteria 2216
726 Ga0439452_014793 3300042010 Bacteria 2157
727 Ga0439452_022476 3300042010 Bacteria 1631
728 Ga0439452_040643 3300042010 Bacteria 1097
729 Ga0439456_001502 3300042013 Bacteria 4701
730 Ga0439456_002365 3300042013 Bacteria 3803
731 Ga0439456_004937 3300042013 Bacteria 2704
732 Ga0439456_005217 3300042013 Bacteria 2638
733 Ga0439456_006370 3300042013 Bacteria 2408
734 Ga0439456_030949 3300042013 Bacteria 1145
735 Ga0439463_001607 3300042016 Bacteria 5950
736 Ga0439463_031117 3300042016 Bacteria 1346
737 Ga0439463_103281 3300042016 Bacteria 735
738 Ga0450911_000007 3300042115 Bacteria 212322
739 Ga0450911_001914 3300042115 Bacteria 4371
740 Ga0450911_005729 3300042115 Bacteria 1902
741 Ga0450919_000544 3300042121 Bacteria 4739
742 Ga0450922_007945 3300042124 Bacteria 998
743 Ga0450890_000530 3300042127 Bacteria 5625
744 Ga0450891_023800 3300042129 Bacteria 612
745 Ga0450894_016168 3300042131 Bacteria 990
746 Ga0450902_004861 3300042137 Bacteria 2011
747 Ga0450902_013218 3300042137 Bacteria 1329
748 Ga0450902_016614 3300042137 Bacteria 1200
749 Ga0450903_001531 3300042138 Bacteria 4308
750 Ga0450904_000805 3300042139 Bacteria 5246
751 Ga0450905_003240 3300042142 Bacteria 2134
752 Ga0450907_001033 3300042146 Bacteria 6517
753 Ga0450907_002172 3300042146 Bacteria 3841
754 Ga0450907_031409 3300042146 Bacteria 903
755 Ga0450910_000567 3300042147 Bacteria 4394
756 Ga0439446_0000462 3300042156 Bacteria 8052
757 Ga0439446_0001926 3300042156 Bacteria 4890
758 Ga0439446_0002731 3300042156 Bacteria 4273
759 Ga0439446_0026451 3300042156 Bacteria 1662
760 Ga0439446_0030081 3300042156 Bacteria 1569
761 Ga0450908_010965 3300042184 Bacteria 1665
762 Ga0450909_000392 3300042185 Bacteria 5578
763 Ga0450909_001201 3300042185 Bacteria 3594
764 Ga0439434_0001710 3300042435 Bacteria 6369
765 Ga0439434_0009966 3300042435 Bacteria 2797
766 Ga0439434_0012388 3300042435 Bacteria 2523
767 Ga0439459_0004195 3300042438 Bacteria 2311
768 Ga0439464_0004162 3300042439 Bacteria 3684
769 Ga0439464_0148996 3300042439 Bacteria 731
770 Ga0439460_0002183 3300042461 Bacteria 4696
771 Ga0439460_0010656 3300042461 Bacteria 2358
772 Ga0450916_042978 3300042530 Bacteria 692
773 Ga0450918_007806 3300042531 Bacteria 1885
774 Ga0450893_0010040 3300042532 Bacteria 1551
775 Ga0451577_0000091 3300042876 Bacteria 201647
776 Ga0451577_0048206 3300042876 Bacteria 3806
777 Ga0451577_0212114 3300042876 Bacteria 1749
778 Ga0439440_0005213 3300042993 Bacteria 2575
779 Ga0453684_0000632 3300044712 Bacteria 127568
780 Ga0453684_0003509 3300044712 Bacteria 35177
781 Ga0453684_0322089 3300044712 Bacteria 1750
782 Ga0453684_0335614 3300044712 Bacteria 1708
783 Ga0453684_0780456 3300044712 Bacteria 1032
784 Ga0466957_0101227 3300044842 Bacteria 1817
785 Ga0451576_1266277 3300045051 Bacteria 769
786 Ga0495617_000225 3300046452 Bacteria 34294
787 Ga0495617_000424 3300046452 Bacteria 22988
788 Ga0495617_001533 3300046452 Bacteria 10035
789 Ga0495617_003852 3300046452 Bacteria 5530
790 Ga0495617_019207 3300046452 Bacteria 2311
791 Ga0495617_021058 3300046452 Bacteria 2203
792 Ga0495617_042975 3300046452 Bacteria 1509
793 Ga0495617_057819 3300046452 Bacteria 1285
794 Ga0495627_000423 3300046453 Bacteria 36816
795 Ga0495627_000451 3300046453 Bacteria 35736
796 Ga0495627_000569 3300046453 Bacteria 29766
797 Ga0495627_006643 3300046453 Bacteria 4511
798 Ga0495627_007874 3300046453 Bacteria 4043
799 Ga0495627_017726 3300046453 Bacteria 2413
800 Ga0495592_0133179 3300046454 Bacteria 1736
801 Ga0495603_0053164 3300046455 Bacteria 2403
802 Ga0495603_0111262 3300046455 Bacteria 1597
803 Ga0495603_0126308 3300046455 Bacteria 1490
804 Ga0495590_0007646 3300046457 Bacteria 4151
805 Ga0495590_0019871 3300046457 Bacteria 2389
806 Ga0495590_0038874 3300046457 Bacteria 1660
807 Ga0495590_0091246 3300046457 Bacteria 1078
808 Ga0495591_000822 3300046458 Bacteria 21997
809 Ga0495591_000971 3300046458 Bacteria 19579
810 Ga0495591_001928 3300046458 Bacteria 12161
811 Ga0495591_005086 3300046458 Bacteria 6175
812 Ga0495591_006137 3300046458 Bacteria 5384
813 Ga0495591_006343 3300046458 Bacteria 5248
814 Ga0495591_006460 3300046458 Bacteria 5182
815 Ga0495591_007307 3300046458 Bacteria 4720
816 Ga0495591_009065 3300046458 Bacteria 3994
817 Ga0495591_013233 3300046458 Bacteria 3031
818 Ga0495591_021981 3300046458 Bacteria 2070
819 Ga0495638_0000146 3300046460 Bacteria 111558
820 Ga0495638_0022371 3300046460 Bacteria 4151
821 Ga0495638_0030350 3300046460 Bacteria 3481
822 Ga0495638_0031046 3300046460 Bacteria 3435
823 Ga0495638_0053800 3300046460 Bacteria 2504
824 Ga0495638_0099568 3300046460 Bacteria 1739
825 Ga0495638_0209596 3300046460 Bacteria 1095
826 Ga0495641_0139615 3300046461 Bacteria 1082
827 Ga0495653_0014639 3300046463 Bacteria 6399
828 Ga0495653_0014669 3300046463 Bacteria 6393
829 Ga0495653_0031142 3300046463 Bacteria 4241
830 Ga0495653_0105883 3300046463 Bacteria 2029
831 Ga0495650_0001128 3300046471 Bacteria 29020
832 Ga0495650_0001933 3300046471 Bacteria 18342
833 Ga0495650_0003282 3300046471 Bacteria 11964
834 Ga0495650_0005168 3300046471 Bacteria 8596
835 Ga0495650_0008618 3300046471 Bacteria 5915
836 Ga0495650_0009821 3300046471 Bacteria 5404
837 Ga0495650_0014936 3300046471 Bacteria 4008
838 Ga0495650_0023743 3300046471 Bacteria 2912
839 Ga0495650_0030328 3300046471 Bacteria 2451
840 Ga0495650_0032981 3300046471 Bacteria 2310
841 Ga0495650_0193152 3300046471 Bacteria 710
842 Ga0495605_0000336 3300046474 Bacteria 46876
843 Ga0495605_0000831 3300046474 Bacteria 21800
844 Ga0495605_0000880 3300046474 Bacteria 20790
845 Ga0495605_0000903 3300046474 Bacteria 20403
846 Ga0495605_0001530 3300046474 Bacteria 15010
847 Ga0495605_0005834 3300046474 Bacteria 7121
848 Ga0495605_0006152 3300046474 Bacteria 6919
849 Ga0495605_0010787 3300046474 Bacteria 5106
850 Ga0495605_0010841 3300046474 Bacteria 5090
851 Ga0495605_0011420 3300046474 Bacteria 4949
852 Ga0495605_0017962 3300046474 Bacteria 3799
853 Ga0495605_0049839 3300046474 Bacteria 2044
854 Ga0495605_0097476 3300046474 Bacteria 1355
855 Ga0495605_0152092 3300046474 Bacteria 1032
856 Ga0495605_0229670 3300046474 Bacteria 799
857 Ga0495639_0000158 3300046475 Bacteria 34960
858 Ga0495639_0094586 3300046475 Bacteria 1405
859 Ga0495584_0006126 3300046491 Bacteria 6323
860 Ga0495584_0007034 3300046491 Bacteria 5877
861 Ga0495584_0008147 3300046491 Bacteria 5443
862 Ga0495584_0019573 3300046491 Bacteria 3438
863 Ga0495584_0022709 3300046491 Bacteria 3182
864 Ga0495584_0026072 3300046491 Bacteria 2962
865 Ga0495584_0028197 3300046491 Bacteria 2844
866 Ga0495584_0039576 3300046491 Bacteria 2382
867 Ga0495584_0069598 3300046491 Bacteria 1768
868 Ga0495585_0001234 3300046492 Bacteria 20628
869 Ga0495585_0008120 3300046492 Bacteria 6378
870 Ga0495585_0008710 3300046492 Bacteria 6133
871 Ga0495585_0009359 3300046492 Bacteria 5879
872 Ga0495585_0010239 3300046492 Bacteria 5595
873 Ga0495585_0028763 3300046492 Bacteria 3167
874 Ga0495585_0063726 3300046492 Bacteria 2022
875 Ga0495585_0066197 3300046492 Bacteria 1978
876 Ga0495585_0095118 3300046492 Bacteria 1600
877 Ga0495585_0096440 3300046492 Bacteria 1586
878 Ga0495594_0000612 3300046499 Bacteria 18385
879 Ga0495594_0011583 3300046499 Bacteria 4585
880 Ga0495594_0032442 3300046499 Bacteria 2835
881 Ga0495594_0081468 3300046499 Bacteria 1807
882 Ga0495594_0588995 3300046499 Bacteria 631
883 Ga0495596_0023295 3300046500 Bacteria 2513
884 Ga0495596_0059715 3300046500 Bacteria 1486
885 Ga0495596_0161569 3300046500 Bacteria 870
886 Ga0495607_0000869 3300046501 Bacteria 28344
887 Ga0495607_0001347 3300046501 Bacteria 21894
888 Ga0495607_0001549 3300046501 Bacteria 20131
889 Ga0495607_0001613 3300046501 Bacteria 19606
890 Ga0495607_0001842 3300046501 Bacteria 18063
891 Ga0495607_0002165 3300046501 Bacteria 16356
892 Ga0495607_0006360 3300046501 Bacteria 8317
893 Ga0495607_0007352 3300046501 Bacteria 7629
894 Ga0495607_0009030 3300046501 Bacteria 6778
895 Ga0495607_0012101 3300046501 Bacteria 5708
896 Ga0495607_0038125 3300046501 Bacteria 2881
897 Ga0495607_0050742 3300046501 Bacteria 2413
898 Ga0495607_0081189 3300046501 Bacteria 1781
899 Ga0495607_0094312 3300046501 Bacteria 1614
900 Ga0495607_0110787 3300046501 Bacteria 1455
901 Ga0495607_0113088 3300046501 Bacteria 1436
902 Ga0495607_0125997 3300046501 Bacteria 1339
903 Ga0495607_0163472 3300046501 Bacteria 1129
904 Ga0495607_0178747 3300046501 Bacteria 1065
905 Ga0495607_0290422 3300046501 Bacteria 773
906 Ga0495583_0000521 3300046506 Bacteria 54646
907 Ga0495583_0001354 3300046506 Bacteria 25389
908 Ga0495583_0001828 3300046506 Bacteria 19872
909 Ga0495583_0002363 3300046506 Bacteria 16292
910 Ga0495583_0006262 3300046506 Bacteria 7826
911 Ga0495583_0008207 3300046506 Bacteria 6414
912 Ga0495583_0008548 3300046506 Bacteria 6242
913 Ga0495583_0019607 3300046506 Bacteria 3526
914 Ga0495583_0040105 3300046506 Bacteria 2202
915 Ga0495583_0223962 3300046506 Bacteria 759
916 Ga0495606_0001384 3300046507 Bacteria 32777
917 Ga0495606_0001423 3300046507 Bacteria 32125
918 Ga0495606_0001894 3300046507 Bacteria 26138
919 Ga0495606_0002172 3300046507 Bacteria 23594
920 Ga0495606_0002276 3300046507 Bacteria 22718
921 Ga0495606_0005372 3300046507 Bacteria 12289
922 Ga0495606_0008218 3300046507 Bacteria 9122
923 Ga0495606_0014967 3300046507 Bacteria 6015
924 Ga0495606_0017185 3300046507 Bacteria 5480
925 Ga0495606_0128897 3300046507 Bacteria 1506
926 Ga0495606_0129762 3300046507 Bacteria 1499
927 Ga0495606_0186292 3300046507 Bacteria 1193
928 Ga0495606_0248639 3300046507 Bacteria 987
929 Ga0495606_0358245 3300046507 Bacteria 772
930 Ga0495610_0001026 3300046512 Bacteria 25659
931 Ga0495610_0004516 3300046512 Bacteria 10245
932 Ga0495610_0009001 3300046512 Bacteria 6375
933 Ga0495610_0009088 3300046512 Bacteria 6330
934 Ga0495610_0010838 3300046512 Bacteria 5628
935 Ga0495610_0011192 3300046512 Bacteria 5502
936 Ga0495610_0014996 3300046512 Bacteria 4523
937 Ga0495610_0022797 3300046512 Bacteria 3415
938 Ga0495610_0060516 3300046512 Bacteria 1802
939 Ga0495610_0135586 3300046512 Bacteria 1064
940 Ga0495610_0217429 3300046512 Bacteria 773
941 Ga0495616_0005283 3300046513 Bacteria 7963
942 Ga0495616_0007521 3300046513 Bacteria 6520
943 Ga0495616_0009442 3300046513 Bacteria 5705
944 Ga0495616_0012444 3300046513 Bacteria 4831
945 Ga0495616_0016626 3300046513 Bacteria 4068
946 Ga0495616_0052948 3300046513 Bacteria 2019
947 Ga0495616_0073936 3300046513 Bacteria 1643
948 Ga0495616_0145134 3300046513 Bacteria 1077
949 Ga0495616_0249953 3300046513 Bacteria 762
950 Ga0495616_0388951 3300046513 Bacteria 575
951 Ga0495620_0000878 3300046515 Bacteria 18545
952 Ga0495620_0001742 3300046515 Bacteria 12840
953 Ga0495620_0002259 3300046515 Bacteria 11147
954 Ga0495620_0002585 3300046515 Bacteria 10471
955 Ga0495620_0002844 3300046515 Bacteria 9940
956 Ga0495620_0007056 3300046515 Bacteria 6128
957 Ga0495620_0021421 3300046515 Bacteria 3139
958 Ga0495620_0022999 3300046515 Bacteria 2989
959 Ga0495630_0016649 3300046517 Bacteria 5376
960 Ga0495630_0438011 3300046517 Bacteria 1001
961 Ga0495631_0000478 3300046518 Bacteria 26772
962 Ga0495631_0000774 3300046518 Bacteria 20562
963 Ga0495631_0001335 3300046518 Bacteria 15074
964 Ga0495631_0001760 3300046518 Bacteria 12847
965 Ga0495631_0005026 3300046518 Bacteria 6963
966 Ga0495631_0015739 3300046518 Bacteria 3616
967 Ga0495631_0034124 3300046518 Bacteria 2282
968 Ga0495631_0050780 3300046518 Bacteria 1813
969 Ga0495631_0217353 3300046518 Bacteria 816
970 Ga0495632_0001147 3300046519 Bacteria 22609
971 Ga0495632_0002357 3300046519 Bacteria 14464
972 Ga0495632_0003511 3300046519 Bacteria 11090
973 Ga0495632_0007235 3300046519 Bacteria 7005
974 Ga0495632_0008307 3300046519 Bacteria 6392
975 Ga0495632_0008784 3300046519 Bacteria 6155
976 Ga0495632_0009540 3300046519 Bacteria 5838
977 Ga0495632_0011026 3300046519 Bacteria 5296
978 Ga0495632_0011532 3300046519 Bacteria 5151
979 Ga0495632_0040650 3300046519 Bacteria 2340
980 Ga0495632_0099337 3300046519 Bacteria 1373
981 Ga0495637_0003252 3300046520 Bacteria 8655
982 Ga0495637_0006397 3300046520 Bacteria 5916
983 Ga0495637_0006846 3300046520 Bacteria 5697
984 Ga0495637_0007301 3300046520 Bacteria 5493
985 Ga0495637_0007578 3300046520 Bacteria 5370
986 Ga0495637_0010254 3300046520 Bacteria 4537
987 Ga0495637_0011839 3300046520 Bacteria 4179
988 Ga0495637_0013088 3300046520 Bacteria 3947
989 Ga0495637_0018886 3300046520 Bacteria 3193
990 Ga0495637_0020192 3300046520 Bacteria 3068
991 Ga0495637_0035066 3300046520 Bacteria 2193
992 Ga0495637_0050801 3300046520 Bacteria 1738
993 Ga0495637_0148696 3300046520 Bacteria 885
994 Ga0495643_0000421 3300046522 Bacteria 55394
995 Ga0495643_0004499 3300046522 Bacteria 9717
996 Ga0495643_0009458 3300046522 Bacteria 6057
997 Ga0495643_0036989 3300046522 Bacteria 2679
998 Ga0495643_0052582 3300046522 Bacteria 2186
999 Ga0495643_0074771 3300046522 Bacteria 1773
1000 Ga0495643_0119586 3300046522 Bacteria 1332
1001 Ga0495644_0015663 3300046523 Bacteria 2906
1002 Ga0495644_0058964 3300046523 Bacteria 1443
1003 Ga0495644_0098017 3300046523 Bacteria 1108
1004 Ga0495648_0004823 3300046524 Bacteria 11380
1005 Ga0495648_0005023 3300046524 Bacteria 11117
1006 Ga0495648_0011986 3300046524 Bacteria 6497
1007 Ga0495648_0013468 3300046524 Bacteria 6043
1008 Ga0495648_0014011 3300046524 Bacteria 5897
1009 Ga0495648_0017468 3300046524 Bacteria 5125
1010 Ga0495648_0023252 3300046524 Bacteria 4249
1011 Ga0495648_0023803 3300046524 Bacteria 4184
1012 Ga0495648_0038246 3300046524 Bacteria 3071
1013 Ga0495648_0039520 3300046524 Bacteria 3002
1014 Ga0495648_0041480 3300046524 Bacteria 2905
1015 Ga0495648_0069769 3300046524 Bacteria 2044
1016 Ga0495648_0077013 3300046524 Bacteria 1913
1017 Ga0495666_0012928 3300046526 Bacteria 4160
1018 Ga0495666_0026972 3300046526 Bacteria 2827
1019 Ga0495666_0096513 3300046526 Bacteria 1393
1020 Ga0495642_0003041 3300046528 Bacteria 6680
1021 Ga0495642_0004114 3300046528 Bacteria 5674
1022 Ga0495652_0291527 3300046529 Bacteria 1190
1023 Ga0495654_0000672 3300046530 Bacteria 26959
1024 Ga0495654_0000875 3300046530 Bacteria 22618
1025 Ga0495654_0006669 3300046530 Bacteria 6535
1026 Ga0495654_0006958 3300046530 Bacteria 6373
1027 Ga0495654_0007483 3300046530 Bacteria 6097
1028 Ga0495654_0015065 3300046530 Bacteria 4109
1029 Ga0495654_0019786 3300046530 Bacteria 3515
1030 Ga0495654_0023494 3300046530 Bacteria 3192
1031 Ga0495654_0040871 3300046530 Bacteria 2308
1032 Ga0495654_0043771 3300046530 Bacteria 2217
1033 Ga0495654_0157262 3300046530 Bacteria 1000
1034 Ga0495654_0249085 3300046530 Bacteria 740
1035 Ga0495587_0018557 3300046536 Bacteria 4313
1036 Ga0495587_0175391 3300046536 Bacteria 1217
1037 Ga0495587_0366128 3300046536 Bacteria 802
1038 Ga0495609_0000011 3300046538 Bacteria 334377
1039 Ga0495609_0000349 3300046538 Bacteria 40285
1040 Ga0495609_0000784 3300046538 Bacteria 23757
1041 Ga0495609_0005802 3300046538 Bacteria 6409
1042 Ga0495609_0008532 3300046538 Bacteria 5014
1043 Ga0495609_0009845 3300046538 Bacteria 4608
1044 Ga0495609_0011414 3300046538 Bacteria 4231
1045 Ga0495609_0117644 3300046538 Bacteria 1144
1046 Ga0495597_0000221 3300046542 Bacteria 52360
1047 Ga0495597_0007884 3300046542 Bacteria 5369
1048 Ga0495597_0008152 3300046542 Bacteria 5268
1049 Ga0495597_0050003 3300046542 Bacteria 1846
1050 Ga0495597_0142939 3300046542 Bacteria 986
1051 Ga0495597_0285027 3300046542 Bacteria 643
1052 Ga0495645_0139290 3300046543 Bacteria 1694
1053 Ga0495622_0004041 3300046557 Bacteria 6846
1054 Ga0495622_0004514 3300046557 Bacteria 6442
1055 Ga0495622_0004608 3300046557 Bacteria 6385
1056 Ga0495622_0009876 3300046557 Bacteria 4414
1057 Ga0495622_0015519 3300046557 Bacteria 3541
1058 Ga0495633_0000287 3300046558 Bacteria 58020
1059 Ga0495633_0024742 3300046558 Bacteria 2963
1060 Ga0495656_0062158 3300046615 Bacteria 1632
1061 Ga0495668_0004341 3300046616 Bacteria 10134
1062 Ga0495668_0033511 3300046616 Bacteria 2885
1063 Ga0495668_0035932 3300046616 Bacteria 2777
1064 Ga0495668_0066635 3300046616 Bacteria 1981
1065 Ga0495668_0119052 3300046616 Bacteria 1444
1066 Ga0495668_0282987 3300046616 Bacteria 908
1067 Ga0495634_0012371 3300046642 Bacteria 6179
1068 Ga0495611_0000001 3300046648 Bacteria 2628469
1069 Ga0495611_0000674 3300046648 Bacteria 19453
1070 Ga0495611_0000679 3300046648 Bacteria 19413
1071 Ga0495611_0001919 3300046648 Bacteria 9881
1072 Ga0495611_0005044 3300046648 Bacteria 5659
1073 Ga0495611_0010711 3300046648 Bacteria 3882
1074 Ga0495611_0013643 3300046648 Bacteria 3461
1075 Ga0495611_0061830 3300046648 Bacteria 1702
1076 Ga0495625_0000001 3300046660 Bacteria 1641829
1077 Ga0495625_0000187 3300046660 Bacteria 97797
1078 Ga0495625_0001286 3300046660 Bacteria 31495
1079 Ga0495625_0014956 3300046660 Bacteria 6166
1080 Ga0495625_0018168 3300046660 Bacteria 5496
1081 Ga0495625_0031785 3300046660 Bacteria 3923
1082 Ga0495625_0050696 3300046660 Bacteria 2977
1083 Ga0495625_0075383 3300046660 Bacteria 2360
1084 Ga0495625_0115313 3300046660 Bacteria 1833
1085 Ga0495625_0289041 3300046660 Bacteria 1052
1086 Ga0495635_0011871 3300046663 Bacteria 6105
1087 Ga0495635_0564495 3300046663 Bacteria 745
1088 Ga0495659_0002188 3300046664 Bacteria 6375
1089 Ga0495659_0005793 3300046664 Bacteria 3898
1090 Ga0495659_0215745 3300046664 Bacteria 791
1091 Ga0495661_0000028 3300046665 Bacteria 182191
1092 Ga0495661_0000477 3300046665 Bacteria 42410
1093 Ga0495661_0000596 3300046665 Bacteria 37123
1094 Ga0495661_0001003 3300046665 Bacteria 25378
1095 Ga0495661_0004293 3300046665 Bacteria 10344
1096 Ga0495661_0006585 3300046665 Bacteria 8158
1097 Ga0495661_0021576 3300046665 Bacteria 4197
1098 Ga0495661_0078677 3300046665 Bacteria 1907
1099 Ga0495661_0100984 3300046665 Bacteria 1623
1100 Ga0495661_0339396 3300046665 Bacteria 742
1101 Ga0495588_0027874 3300046674 Bacteria 2824
1102 Ga0495599_0870536 3300046678 Bacteria 512
1103 Ga0495623_0011027 3300046679 Bacteria 5847
1104 Ga0495646_0091142 3300046680 Bacteria 1759
1105 Ga0495658_0656894 3300046683 Bacteria 672
1106 Ga0495669_0018630 3300046684 Bacteria 2986
1107 Ga0495613_0028299 3300046689 Bacteria 4167
1108 Ga0495613_0107369 3300046689 Bacteria 2014
1109 Ga0495613_0111379 3300046689 Bacteria 1972
1110 Ga0495624_0010386 3300046690 Bacteria 6418
1111 Ga0495670_0004101 3300046691 Bacteria 7149
1112 Ga0495670_0005209 3300046691 Bacteria 6400
1113 Ga0495670_0005708 3300046691 Bacteria 6104
1114 Ga0495670_0005850 3300046691 Bacteria 6026
1115 Ga0495670_0014500 3300046691 Bacteria 3873
1116 Ga0495670_0029246 3300046691 Bacteria 2734
1117 Ga0495670_0060659 3300046691 Bacteria 1900
1118 Ga0495670_0229965 3300046691 Bacteria 986
1119 Ga0495670_0241272 3300046691 Bacteria 962
1120 Ga0495670_0474541 3300046691 Bacteria 678
1121 Ga0495671_0000512 3300046692 Bacteria 29774
1122 Ga0495671_0000650 3300046692 Bacteria 25274
1123 Ga0495671_0001180 3300046692 Bacteria 17885
1124 Ga0495671_0002553 3300046692 Bacteria 11447
1125 Ga0495671_0007066 3300046692 Bacteria 6428
1126 Ga0495671_0013002 3300046692 Bacteria 4527
1127 Ga0495671_0039219 3300046692 Bacteria 2392
1128 Ga0495671_0057617 3300046692 Bacteria 1922
1129 Ga0495671_0065688 3300046692 Bacteria 1785
1130 Ga0495671_0074970 3300046692 Bacteria 1659
1131 Ga0495671_0404403 3300046692 Bacteria 653
1132 Ga0495649_0003758 3300046694 Bacteria 10081
1133 Ga0495649_0006713 3300046694 Bacteria 7134
1134 Ga0495649_0007221 3300046694 Bacteria 6811
1135 Ga0495649_0007939 3300046694 Bacteria 6419
1136 Ga0495649_0016821 3300046694 Bacteria 4140
1137 Ga0495649_0022992 3300046694 Bacteria 3483
1138 Ga0495649_0027233 3300046694 Bacteria 3172
1139 Ga0495649_0045228 3300046694 Bacteria 2401
1140 Ga0495649_0081859 3300046694 Bacteria 1725
1141 Ga0495589_0000236 3300046794 Bacteria 46053
1142 Ga0495589_0005797 3300046794 Bacteria 6514
1143 Ga0495589_0006835 3300046794 Bacteria 6001
1144 Ga0495589_0009516 3300046794 Bacteria 5050
1145 Ga0495589_0018838 3300046794 Bacteria 3539
1146 Ga0495589_0041537 3300046794 Bacteria 2294
1147 Ga0495589_0043186 3300046794 Bacteria 2244
1148 Ga0495600_0060865 3300046809 Bacteria 2465
1149 Ga0495600_0423426 3300046809 Bacteria 826
1150 Ga0495660_0000888 3300046810 Bacteria 22116
1151 Ga0495660_0001210 3300046810 Bacteria 18055
1152 Ga0495660_0001273 3300046810 Bacteria 17539
1153 Ga0495660_0001456 3300046810 Bacteria 16179
1154 Ga0495660_0001754 3300046810 Bacteria 14453
1155 Ga0495660_0004981 3300046810 Bacteria 7994
1156 Ga0495660_0014627 3300046810 Bacteria 4538
1157 Ga0495660_0015804 3300046810 Bacteria 4357
1158 Ga0495660_0020626 3300046810 Bacteria 3778
1159 Ga0495660_0023983 3300046810 Bacteria 3477
1160 Ga0495660_0031294 3300046810 Bacteria 2992
1161 Ga0495660_0052001 3300046810 Bacteria 2227
1162 Ga0495660_0124149 3300046810 Bacteria 1302
1163 Ga0495660_0158845 3300046810 Bacteria 1110
1164 Ga0495660_0195623 3300046810 Bacteria 968
1165 Ga0495581_0100939 3300047315 Bacteria 1676
1166 Ga0495604_0014492 3300047317 Bacteria 6287
1167 Ga0495604_0081315 3300047317 Bacteria 2425
1168 Ga0495674_0022886 3300047319 Bacteria 5758
1169 Ga0495672_0001999 3300047320 Bacteria 19270
1170 Ga0495672_0010991 3300047320 Bacteria 6414
1171 Ga0495672_0011802 3300047320 Bacteria 6137
1172 Ga0495672_0015180 3300047320 Bacteria 5241
1173 Ga0495672_0022913 3300047320 Bacteria 4051
1174 Ga0495672_0031266 3300047320 Bacteria 3325
1175 Ga0495672_0050816 3300047320 Bacteria 2444
1176 Ga0495672_0215969 3300047320 Bacteria 949
1177 Ga0495676_0000508 3300047321 Bacteria 31862
1178 Ga0495676_0088878 3300047321 Bacteria 2315
1179 Ga0495676_0462796 3300047321 Bacteria 836
1180 Ga0495680_0016282 3300047322 Bacteria 6394
1181 Ga0495680_0020798 3300047322 Bacteria 5509
1182 Ga0495680_0022963 3300047322 Bacteria 5192
1183 Ga0495683_0000053 3300047323 Bacteria 121769
1184 Ga0495683_0000216 3300047323 Bacteria 54311
1185 Ga0495683_0000279 3300047323 Bacteria 44138
1186 Ga0495683_0001237 3300047323 Bacteria 17374
1187 Ga0495683_0016482 3300047323 Bacteria 3837
1188 Ga0495683_0019039 3300047323 Bacteria 3543
1189 Ga0495683_0022999 3300047323 Bacteria 3203
1190 Ga0495683_0023793 3300047323 Bacteria 3147
1191 Ga0495683_0101430 3300047323 Bacteria 1383
1192 Ga0495687_000698 3300047443 Bacteria 37661
1193 Ga0495687_008412 3300047443 Bacteria 5909
1194 Ga0495677_0004418 3300047445 Bacteria 5399
1195 Ga0495679_000004 3300047446 Bacteria 748056
1196 Ga0495679_000075 3300047446 Bacteria 95844
1197 Ga0495679_002285 3300047446 Bacteria 9890
1198 Ga0495679_007665 3300047446 Bacteria 4476
1199 Ga0495679_012854 3300047446 Bacteria 3168
1200 Ga0495679_015325 3300047446 Bacteria 2806
1201 Ga0495679_066151 3300047446 Bacteria 1050
1202 Ga0495685_009223 3300047447 Bacteria 3291
1203 Ga0495685_060550 3300047447 Bacteria 1276
1204 Ga0495673_0000202 3300047469 Bacteria 90523
1205 Ga0495673_0000670 3300047469 Bacteria 33730
1206 Ga0495673_0000938 3300047469 Bacteria 26443
1207 Ga0495673_0001468 3300047469 Bacteria 18689
1208 Ga0495673_0001495 3300047469 Bacteria 18488
1209 Ga0495673_0002985 3300047469 Bacteria 11401
1210 Ga0495673_0006031 3300047469 Bacteria 7199
1211 Ga0495673_0006159 3300047469 Bacteria 7104
1212 Ga0495673_0006807 3300047469 Bacteria 6676
1213 Ga0495673_0007204 3300047469 Bacteria 6428
1214 Ga0495673_0007237 3300047469 Bacteria 6413
1215 Ga0495673_0009407 3300047469 Bacteria 5409
1216 Ga0495673_0085181 3300047469 Bacteria 1301
1217 Ga0495673_0110247 3300047469 Bacteria 1101
1218 Ga0495673_0117471 3300047469 Bacteria 1056
1219 Ga0495673_0140076 3300047469 Bacteria 943
1220 Ga0495673_0154008 3300047469 Bacteria 886
1221 Ga0495673_0174084 3300047469 Bacteria 818
1222 Ga0495673_0198969 3300047469 Bacteria 750
1223 Ga0495681_0000588 3300047470 Bacteria 27772
1224 Ga0495681_0005805 3300047470 Bacteria 8201
1225 Ga0495681_0012384 3300047470 Bacteria 5015
1226 Ga0495681_0016233 3300047470 Bacteria 4185
1227 Ga0495681_0024804 3300047470 Bacteria 3147
1228 Ga0495681_0025435 3300047470 Bacteria 3097
1229 Ga0495681_0098844 3300047470 Bacteria 1278
1230 Ga0495686_0000017 3300047472 Bacteria 435554
1231 Ga0495686_0002215 3300047472 Bacteria 18870
1232 Ga0495686_0011962 3300047472 Bacteria 6098
1233 Ga0495686_0097455 3300047472 Bacteria 1778
1234 Ga0495686_0125614 3300047472 Bacteria 1525
1235 Ga0495686_0142964 3300047472 Bacteria 1410
1236 Ga0495686_0168419 3300047472 Bacteria 1275
1237 Ga0495686_0359417 3300047472 Bacteria 790
1238 Ga0495593_0017034 3300047673 Bacteria 4090
1239 Ga0495593_0041728 3300047673 Bacteria 2465
1240 Ga0495602_0089939 3300048088 Bacteria 2551
1241 Ga0495626_0000250 3300048091 Bacteria 62295
1242 Ga0495626_0002158 3300048091 Bacteria 14181
1243 Ga0495626_0007151 3300048091 Bacteria 6241
1244 Ga0495626_0007269 3300048091 Bacteria 6177
1245 Ga0495626_0010027 3300048091 Bacteria 5082
1246 Ga0495626_0030432 3300048091 Bacteria 2603
1247 Ga0496102_0017499 3300048905 Bacteria 6277
1248 Ga0496102_0117760 3300048905 Bacteria 2479
1249 Ga0496103_0008923 3300048906 Bacteria 5944
1250 Ga0496103_0253436 3300048906 Bacteria 1133
1251 Ga0496106_0037962 3300048909 Bacteria 3604
1252 Ga0496107_0162336 3300048910 Bacteria 1656
1253 Ga0496110_0090019 3300048913 Bacteria 2743
1254 Ga0496110_0162260 3300048913 Bacteria 2026
1255 Ga0496110_0254903 3300048913 Bacteria 1597
1256 Ga0496111_0913089 3300048914 Bacteria 632
1257 Ga0496112_0057022 3300048915 Bacteria 3845
1258 Ga0496112_0177019 3300048915 Bacteria 2098
1259 Ga0496116_0001102 3300048919 Bacteria 32408
1260 Ga0496116_0013194 3300048919 Bacteria 6683
1261 Ga0496116_0034340 3300048919 Bacteria 3580
1262 Ga0496116_0065312 3300048919 Bacteria 2335
1263 Ga0496116_0071479 3300048919 Bacteria 2197
1264 Ga0496116_0098826 3300048919 Bacteria 1750
1265 Ga0496117_0021272 3300048920 Bacteria 5255
1266 Ga0496117_0027159 3300048920 Bacteria 4466
1267 Ga0496117_0058529 3300048920 Bacteria 2668
1268 Ga0496117_0072139 3300048920 Bacteria 2310
1269 Ga0496117_0091291 3300048920 Bacteria 1960
1270 Ga0496117_0156079 3300048920 Bacteria 1343
1271 Ga0496118_0001453 3300048921 Bacteria 35692
1272 Ga0496118_0006791 3300048921 Bacteria 12429
1273 Ga0496118_0021458 3300048921 Bacteria 5682
1274 Ga0496118_0032911 3300048921 Bacteria 4261
1275 Ga0496118_0048363 3300048921 Bacteria 3286
1276 Ga0496118_0062394 3300048921 Bacteria 2752
1277 Ga0496118_0088186 3300048921 Bacteria 2147
1278 Ga0496118_0102212 3300048921 Bacteria 1932
1279 Ga0496118_0182075 3300048921 Bacteria 1268
1280 Ga0496119_0060964 3300048922 Bacteria 2255
1281 Ga0496121_0000045 3300048924 Bacteria 336130
1282 Ga0496121_0002035 3300048924 Bacteria 31995
1283 Ga0496121_0003471 3300048924 Bacteria 22466
1284 Ga0496121_0010893 3300048924 Bacteria 10161
1285 Ga0496121_0019796 3300048924 Bacteria 6706
1286 Ga0496121_0040850 3300048924 Bacteria 4063
1287 Ga0496121_0068269 3300048924 Bacteria 2876
1288 Ga0496121_0094767 3300048924 Bacteria 2321
1289 Ga0496121_0141135 3300048924 Bacteria 1787
1290 Ga0496121_0151570 3300048924 Bacteria 1705
1291 Ga0496121_0309715 3300048924 Bacteria 1068
1292 Ga0496122_0006421 3300048925 Bacteria 13501
1293 Ga0496122_0018887 3300048925 Bacteria 6333
1294 Ga0496122_0021949 3300048925 Bacteria 5691
1295 Ga0496122_0038971 3300048925 Bacteria 3796
1296 Ga0496122_0074412 3300048925 Bacteria 2403
1297 Ga0496122_0116839 3300048925 Bacteria 1733
1298 Ga0496123_0005038 3300048926 Bacteria 13515
1299 Ga0496123_0010414 3300048926 Bacteria 8221
1300 Ga0496123_0015208 3300048926 Bacteria 6328
1301 Ga0496123_0065283 3300048926 Bacteria 2314
1302 Ga0496123_0073614 3300048926 Bacteria 2118
1303 Ga0496124_0000382 3300048927 Bacteria 80986
1304 Ga0496124_0010622 3300048927 Bacteria 9302
1305 Ga0496124_0064826 3300048927 Bacteria 3048
1306 Ga0496124_0104705 3300048927 Bacteria 2287
1307 Ga0496124_0198824 3300048927 Bacteria 1526
1308 Ga0496124_0372807 3300048927 Bacteria 1001
1309 Ga0496125_0003559 3300048928 Bacteria 18765
1310 Ga0496125_0037071 3300048928 Bacteria 4244
1311 Ga0496125_0097850 3300048928 Bacteria 2172
1312 Ga0496126_0089264 3300048929 Bacteria 2713
1313 Ga0496126_0126292 3300048929 Bacteria 2213
1314 Ga0496126_0185169 3300048929 Bacteria 1766
1315 Ga0495678_000362 3300049459 Bacteria 46331
1316 Ga0495678_000688 3300049459 Bacteria 31040
1317 Ga0495678_001023 3300049459 Bacteria 23732
1318 Ga0495678_007338 3300049459 Bacteria 5724
1319 Ga0495678_007420 3300049459 Bacteria 5681
1320 Ga0495678_010350 3300049459 Bacteria 4540
1321 Ga0495678_029227 3300049459 Bacteria 2316
1322 Ga0495678_052788 3300049459 Bacteria 1563
1323 Ga0495678_061123 3300049459 Bacteria 1414
1324 Ga0495678_115305 3300049459 Bacteria 910
1325 Ga0495678_213151 3300049459 Bacteria 589
1326 Ga0495682_0000344 3300049460 Bacteria 34342
1327 Ga0495682_0001672 3300049460 Bacteria 11334
1328 Ga0495682_0004097 3300049460 Bacteria 6332
1329 Ga0495682_0008461 3300049460 Bacteria 4052
1330 Ga0495682_0012546 3300049460 Bacteria 3245
1331 Ga0495682_0130514 3300049460 Bacteria 899
1332 Ga0501316_024797 3300049532 Bacteria 777
1333 Ga0501320_061501 3300049536 Bacteria 529
1334 Ga0501323_016353 3300049539 Bacteria 945
1335 Ga0501031_0267062 3300049568 Bacteria 1111
1336 Ga0501032_0004655 3300049569 Bacteria 10311
1337 Ga0501032_0076983 3300049569 Bacteria 2221
1338 Ga0501034_0021013 3300049571 Bacteria 6663
1339 Ga0501034_0097710 3300049571 Bacteria 2932
1340 Ga0501034_0360119 3300049571 Bacteria 1382
1341 Ga0501034_0991496 3300049571 Bacteria 724
1342 Ga0501037_0024665 3300049573 Bacteria 4446
1343 Ga0501038_0010418 3300049574 Bacteria 8501
1344 Ga0501038_0139820 3300049574 Bacteria 1982
1345 Ga0501038_0849692 3300049574 Bacteria 676
1346 Ga0501039_0467428 3300049575 Bacteria 990
1347 Ga0501039_0475462 3300049575 Bacteria 981
1348 Ga0501043_0004238 3300049579 Bacteria 11692
1349 Ga0501198_019209 3300049649 Bacteria 1075
1350 Ga0501227_044139 3300049665 Bacteria 1109
1351 Ga0501259_012650 3300049688 Bacteria 1410
1352 Ga0501079_1277675 3300049741 Bacteria 578
1353 Ga0501080_0000333 3300049742 Bacteria 36064
1354 Ga0501083_0173004 3300049744 Bacteria 1411
1355 Ga0501241_003001 3300049758 Bacteria 3225
1356 Ga0501241_121705 3300049758 Bacteria 580
1357 Ga0501241_158194 3300049758 Bacteria 526
1358 Ga0501269_041519 3300049766 Bacteria 613
1359 Ga0501035_0317279 3300049822 Bacteria 1310
1360 Ga0501204_008163 3300049850 Bacteria 1190
1361 Ga0501226_000022 3300049853 Bacteria 111874
1362 Ga0501226_011206 3300049853 Bacteria 992
1363 nmdc:mga03683_294116_c1 3300050489 Bacteria 760
1364 nmdc:mga08y16_1346074_c1 3300050511 Bacteria 679
1365 Ga0495619_0476001 3300053085 Bacteria 860
1366 Ga0500643_000075 3300053087 Bacteria 111465
1367 Ga0500555_007694 3300053103 Bacteria 3064
1368 Ga0500562_055900 3300053108 Bacteria 1058
1369 Ga0500618_008559 3300053125 Bacteria 2847
1370 Ga0500573_0052705 3300053140 Bacteria 2338
1371 Ga0500586_106454 3300053145 Bacteria 981
1372 Ga0500633_0055414 3300053160 Bacteria 1380
1373 Ga0500645_004544 3300053730 Bacteria 5294
1374 Ga0501084_1042293 3300054114 Bacteria 687
1375 2595446632 2593339238 Bacteria 4182970
1376 2595451876 2593339239 Bacteria 4124669
1377 2599504320 2599185188 Bacteria 6164180
1378 2599613610 2599185212 Bacteria 6765997
1379 2599933419 2599185300 Bacteria 6062622
1380 2599994247 2599185311 Bacteria 6354990
1381 2600023542 2599185316 Bacteria 6320029
1382 2600030656 2599185317 Bacteria 6435722
1383 2600037013 2599185318 Bacteria 6961590
1384 2600042436 2599185319 Bacteria 6637840
1385 2600060499 2599185322 Bacteria 6763055
1386 2600065598 2599185323 Bacteria 6688755
1387 2600078282 2599185325 Bacteria 6324919
1388 2600360463 2600254930 Bacteria 6431253
1389 2671129075 2667528176 Bacteria 6724917
1390 2721026742 2718218334 Bacteria 4765486
1391 2735837704 2734482264 Unclassified 5014763
1392 2738715871 2738541276 Bacteria 4690596
1393 2739228309 2738543009 Bacteria 4944499
1394 2747947854 2747842428 Bacteria 4689383
1395 2765577926 2765235840 Bacteria 4663337
1396 2794595944 2791355520 Bacteria 5948615
1397 2842859282 2842854478 Bacteria 6143501
1398 2842919519 2842918807 Bacteria 4289178
1399 2884341284 2884338543 Bacteria 4610696
1400 2894510720 2894510363 Bacteria 5121143
1401 2895502561 2895498888 Bacteria 5283788
1402 2895514110 2895511927 Bacteria 6802080
1403 2895524412 2895522137 Bacteria 3284416
1404 2895526509 2895525241 Bacteria 3388457
1405 2919404950 2919404418 Bacteria 4232372
1406 2919460944 2919456309 Bacteria 6586567
1407 2923589981 2923586266 Bacteria 6565975
1408 2931374141 2931369376 Bacteria 6847892
1409 2941472736 2941471342 Bacteria 5018624
1410 2953998016 2953994433 Bacteria 4303959
1411 2989396456 2989392574 Bacteria 4554005
1412 8056144928 8056143049 Bacteria 6307666
1413 Ga0316583_10311088
1414 MRS2a_Contig_5007
1415 SwRhRL2b_contig_1022998
1416 JGI24736J21556_1004624
1417 JGI24738J21930_10009582
1418 JGI25162J39368_1000421
1419 JGI25163J39215_1000824
1420 JGI25164J39214_1000296
1421 JGI25165J46597_1000528
1422 rootH2_10097578
1423 rootH1_10005612
1424 rootH1_10012577
1425 Ga0006556J51387_1033075
1426 JGI26143J51219_1004981
1427 JGI26141J51220_1016087
1428 Ga0006554J51385_1027885
1429 Ga0006562J51391_1048358
1430 Ga0006562J51391_1048362
1431 Ga0055533_1010054
1432 Ga0055536_1003265
1433 Ga0055536_1003284
1434 Ga0055536_1004864
1435 Ga0055530_10000240
1436 Ga0055530_10004397
1437 Ga0055530_10098522
1438 Ga0055540_1000248
1439 Ga0055540_1000400
1440 Ga0055531_10000202
1441 Ga0058692_1014349
1442 Ga0065165_1000028
1443 Ga0065714_10001261
1444 Ga0065714_10014757
1445 Ga0065714_10045372
1446 Ga0065714_10065886
1447 Ga0065714_10108272
1448 Ga0065714_10155290
1449 Ga0065714_10242649
1450 Ga0065714_10243775
1451 Ga0065714_10248355
1452 Ga0065714_10287751
1453 Ga0065704_10073559
1454 Ga0065704_10102828
1455 Ga0065704_10265871
1456 Ga0065704_10559405
1457 Ga0065712_10070056
1458 Ga0065712_10070345
1459 Ga0065712_10780774
1460 Ga0065715_10145621
1461 Ga0065707_10594074
1462 Ga0070658_10474529
1463 Ga0070670_100930253
1464 Ga0068869_101456361
1465 Ga0068869_101960737
1466 Ga0070666_10000349
1467 Ga0070666_10150881
1468 Ga0070668_101820305
1469 Ga0070668_101851519
1470 Ga0070669_100039354
1471 Ga0070675_100149452
1472 Ga0070671_100157336
1473 Ga0070688_100559647
1474 Ga0070688_101165752
1475 Ga0070667_100016114
1476 Ga0070667_100072821
1477 Ga0070667_100512035
1478 Ga0070663_100008843
1479 Ga0070663_100293636
1480 Ga0070662_100019740
1481 Ga0070662_100065544
1482 Ga0070662_101134688
1483 Ga0070685_10001203
1484 Ga0070685_10525559
1485 Ga0068853_100020239
1486 Ga0068853_100926660
1487 Ga0070665_100000227
1488 Ga0070665_100013903
1489 Ga0068855_100097646
1490 Ga0070664_100278872
1491 Ga0068854_100140780
1492 Ga0068856_100041168
1493 Ga0068852_100036098
1494 Ga0068852_100074224
1495 Ga0068859_100144280
1496 Ga0068864_100126077
1497 Ga0068851_10001367
1498 Ga0068851_11077851
1499 Ga0068863_100044744
1500 Ga0068858_100001997
1501 Ga0068858_100497266
1502 Ga0068858_100611821
1503 Ga0068862_100130407
1504 Ga0081539_10030214
1505 Ga0075364_10191846
1506 Ga0075364_10375983
1507 Ga0075432_10003878
1508 Ga0075432_10024222
1509 Ga0075432_10178464
1510 Ga0075362_10081878
1511 Ga0075362_10392788
1512 Ga0097621_100752189
1513 Ga0068865_100261987
1514 Ga0097620_100144276
1515 Ga0079104_1000094
1516 Ga0079104_1036778
1517 Ga0099826_10046334
1518 Ga0105251_10000971
1519 Ga0105251_10001972
1520 Ga0105251_10006692
1521 Ga0105251_10010185
1522 Ga0105251_10012451
1523 Ga0105251_10137214
1524 Ga0105251_10140971
1525 Ga0105251_10616837
1526 Ga0105244_10000709
1527 Ga0105244_10006626
1528 Ga0105244_10022875
1529 Ga0105244_10025486
1530 Ga0105244_10031405
1531 Ga0105244_10045633
1532 Ga0105244_10132648
1533 Ga0105244_10266429
1534 Ga0105250_10000074
1535 Ga0105250_10004551
1536 Ga0105250_10005278
1537 Ga0105250_10049137
1538 Ga0105250_10183685
1539 Ga0105250_10348350
1540 Ga0105240_10001318
1541 Ga0105240_10061849
1542 Ga0105240_10088811
1543 Ga0105240_11099354
1544 Ga0111539_10189307
1545 Ga0105247_10004675
1546 Ga0105243_10012583
1547 Ga0105243_10046356
1548 Ga0105243_10371643
1549 Ga0105243_12037693
1550 Ga0105241_10061839
1551 Ga0105248_10216798
1552 Ga0105237_10040609
1553 Ga0105237_10057998
1554 Ga0105238_10004916
1555 Ga0105238_10045807
1556 Ga0105238_10231755
1557 Ga0105249_10009268
1558 Ga0105249_10132334
1559 Ga0105239_10099795
1560 Ga0105239_11220384
1561 Ga0105246_10010995
1562 Ga0105246_10017718
1563 Ga0105246_10027429
1564 Ga0157373_10012012
1565 Ga0157373_10015562
1566 Ga0157373_10020104
1567 Ga0157373_10059677
1568 Ga0157373_10074417
1569 Ga0157373_10156997
1570 Ga0157373_11031773
1571 Ga0157371_10000406
1572 Ga0157371_10003900
1573 Ga0157371_10010020
1574 Ga0157371_10023347
1575 Ga0157371_10029405
1576 Ga0157371_10040966
1577 Ga0157371_11610423
1578 Ga0157370_10003491
1579 Ga0157370_10029572
1580 Ga0157370_10036318
1581 Ga0157370_10067761
1582 Ga0157370_10075420
1583 Ga0157370_10134067
1584 Ga0157370_10344341
1585 Ga0157370_10704253
1586 Ga0157370_10981641
1587 Ga0157370_11127406
1588 Ga0157370_11400089
1589 Ga0157369_10000329
1590 Ga0157369_10002062
1591 Ga0157369_10027825
1592 Ga0157369_10053199
1593 Ga0157369_10177919
1594 Ga0157369_10250742
1595 Ga0157369_10262866
1596 Ga0157369_10552434
1597 Ga0157369_10668929
1598 Ga0157374_10125969
1599 Ga0157374_10627022
1600 Ga0163162_10000030
1601 Ga0163162_10000495
1602 Ga0163162_10228419
1603 Ga0157372_10219520
1604 Ga0157372_10221324
1605 Ga0157372_10699434
1606 Ga0157375_10092090
1607 Ga0157375_10297193
1608 Ga0157375_12335801
1609 Ga0157375_13220435
1610 Ga0163163_10822619
1611 Ga0157380_12205699
1612 Ga0182008_10001710
1613 Ga0182008_10004847
1614 Ga0182008_10008849
1615 Ga0182008_10009722
1616 Ga0182008_10059579
1617 Ga0182008_10069783
1618 Ga0182008_10080762
1619 Ga0182008_10214491
1620 Ga0182008_10258777
1621 Ga0182008_10500014
1622 Ga0157376_10037597
1623 Ga0157376_12032455
1624 Ga0182006_1000072
1625 Ga0182006_1002699
1626 Ga0182006_1004981
1627 Ga0182006_1008086
1628 Ga0182006_1024729
1629 Ga0182006_1027559
1630 Ga0182006_1028287
1631 Ga0182006_1059317
1632 Ga0182006_1093958
1633 Ga0182006_1126189
1634 Ga0182006_1134623
1635 Ga0182007_10004029
1636 Ga0182007_10012807
1637 Ga0182007_10076641
1638 Ga0182007_10182043
1639 Ga0182007_10424713
1640 Ga0182005_1002599
1641 Ga0182005_1002728
1642 Ga0182005_1002754
1643 Ga0182005_1019229
1644 Ga0182005_1037481
1645 Ga0182005_1037547
1646 Ga0182005_1049663
1647 Ga0182005_1060913
1648 Ga0182005_1063406
1649 Ga0182005_1156521
1650 Ga0182005_1252454
1651 Ga0163161_10010440
1652 Ga0163161_10011813
1653 Ga0163161_10012486
1654 Ga0163161_10121726
1655 Ga0163161_10164095
1656 Ga0163161_10252315
1657 Ga0163161_10452259
1658 Ga0163161_10455393
1659 Ga0163161_10914732
1660 Ga0209760_100114
1661 Ga0209674_100615
1662 Ga0209563_100338
1663 Ga0207427_100008
1664 Ga0209437_100014
1665 Ga0209437_101456
1666 Ga0209148_1001787
1667 Ga0209759_1004233
1668 Ga0209129_1000785
1669 Ga0209233_1000008
1670 Ga0209233_1005903
1671 Ga0209233_1014439
1672 Ga0209675_1001650
1673 Ga0209676_1000010
1674 Ga0209676_1000037
1675 Ga0209676_1000345
1676 Ga0209676_1005862
1677 Ga0209758_1007611
1678 Ga0209050_1000081
1679 Ga0209050_1000227
1680 Ga0209050_1003874
1681 Ga0209256_1012211
1682 Ga0209051_1000104
1683 Ga0209051_1000164
1684 Ga0209051_1059822
1685 Ga0209051_1090576
1686 Ga0209257_1000040
1687 Ga0209257_1090914
1688 Ga0207656_10009507
1689 Ga0207696_1000045
1690 Ga0207696_1000097
1691 Ga0207696_1002467
1692 Ga0207696_1003140
1693 Ga0207696_1050064
1694 Ga0207655_1000005
1695 Ga0207655_1000931
1696 Ga0207655_1001255
1697 Ga0207655_1008691
1698 Ga0207655_1016895
1699 Ga0207655_1017521
1700 Ga0207655_1041328
1701 Ga0207655_1042620
1702 Ga0207655_1048550
1703 Ga0207655_1075281
1704 Ga0207713_1000030
1705 Ga0207713_1000681
1706 Ga0207713_1002600
1707 Ga0207713_1005856
1708 Ga0207713_1016741
1709 Ga0207713_1042947
1710 Ga0207713_1094723
1711 Ga0207713_1161990
1712 Ga0207710_10005160
1713 Ga0207680_10120450
1714 Ga0207680_10164995
1715 Ga0207647_10000138
1716 Ga0207647_10000213
1717 Ga0207705_10602960
1718 Ga0207654_10054180
1719 Ga0207695_10000007
1720 Ga0207695_10012596
1721 Ga0207695_10045432
1722 Ga0207671_10007188
1723 Ga0207671_10263165
1724 Ga0207649_10056626
1725 Ga0207681_10038369
1726 Ga0207681_11695935
1727 Ga0207694_10002986
1728 Ga0207694_10008956
1729 Ga0207694_10156777
1730 Ga0207650_10135687
1731 Ga0207650_10480594
1732 Ga0207644_10525525
1733 Ga0207706_10013867
1734 Ga0207706_10030348
1735 Ga0207709_10000035
1736 Ga0207709_10024708
1737 Ga0207709_10391153
1738 Ga0207689_10919355
1739 Ga0207679_10425930
1740 Ga0207667_10079883
1741 Ga0207712_10000169
1742 Ga0207712_10298208
1743 Ga0207668_10207035
1744 Ga0207668_11464003
1745 Ga0207640_10103641
1746 Ga0207658_10028023
1747 Ga0207677_12261678
1748 Ga0207703_10000456
1749 Ga0207703_10270343
1750 Ga0207703_10775483
1751 Ga0207639_10011000
1752 Ga0207639_10425394
1753 Ga0207678_10006920
1754 Ga0207702_10011335
1755 Ga0207641_10265562
1756 Ga0207648_10172106
1757 Ga0207648_10954280
1758 Ga0207676_10109058
1759 Ga0207698_10002097
1760 Ga0207698_10876073
1761 Ga0209281_1000212
1762 Ga0209281_1007137
1763 Ga0209281_1023932
1764 Ga0209973_1030621
1765 Ga0209371_1000313
1766 Ga0209981_1012950
1767 Ga0209981_1054771
1768 Ga0209996_1008657
1769 Ga0209984_1009616
1770 Ga0210000_1008657
1771 Ga0209995_1000628
1772 Ga0209995_1030165
1773 Ga0209982_1019137
1774 Ga0209970_1009883
1775 Ga0209983_1004575
1776 Ga0209282_1317174
1777 Ga0209971_1000556
1778 Ga0209974_10001102
1779 Ga0268266_10000006
1780 Ga0268266_10020349
1781 Ga0268265_10055260
1782 Ga0265318_10025797
1783 Ga0265336_10033997
1784 Ga0307517_10275081
1785 Ga0268256_1000274
1786 Ga0307511_10218911
1787 Ga0316177_1123371
1788 Ga0314311_1088196
1789 Ga0316178_1043989
1790 Ga0316183_1192322
1791 Ga0316181_1100804
1792 Ga0316181_1112713
1793 Ga0265327_10001934
1794 Ga0265327_10291231
1795 Ga0307408_100000027
1796 Ga0307408_100000589
1797 Ga0307408_100001953
1798 Ga0307408_100013344
1799 Ga0307408_100031419
1800 Ga0307408_100062086
1801 Ga0307408_100170267
1802 Ga0307508_10344339
1803 Ga0316575_10007516
1804 Ga0316575_10007575
1805 Ga0316575_10033776
1806 Ga0316575_10048392
1807 Ga0316575_10056429
1808 Ga0316575_10157309
1809 Ga0316575_10161584
1810 Ga0316575_10177316
1811 Ga0316575_10309089
1812 Ga0316575_10311654
1813 Ga0316579_10000223
1814 Ga0316579_10001576
1815 Ga0316579_10005824
1816 Ga0316579_10034879
1817 Ga0316579_10056030
1818 Ga0316579_10083848
1819 Ga0316579_10325393
1820 Ga0316579_10409436
1821 Ga0316576_10000256
1822 Ga0316576_10004776
1823 Ga0316576_10008248
1824 Ga0316576_10091160
1825 Ga0316576_10109874
1826 Ga0316576_10126436
1827 Ga0316576_10200402
1828 Ga0316576_10621227
1829 Ga0316576_10679016
1830 Ga0316576_10995683
1831 Ga0316578_10001774
1832 Ga0316578_10001869
1833 Ga0316578_10018677
1834 Ga0316578_10019620
1835 Ga0316578_10030826
1836 Ga0316578_10031007
1837 Ga0316578_10036775
1838 Ga0316578_10081938
1839 Ga0316578_10165026
1840 Ga0316578_10198962
1841 Ga0316578_10625271
1842 Ga0316578_10741970
1843 Ga0307516_10235546
1844 Ga0307405_10000987
1845 Ga0307405_10015368
1846 Ga0307405_10487151
1847 Ga0307405_11307771
1848 Ga0316577_10003405
1849 Ga0316577_10004678
1850 Ga0316577_10023697
1851 Ga0316577_10045636
1852 Ga0316577_10056850
1853 Ga0316577_10187810
1854 Ga0316577_10229693
1855 Ga0316577_10269965
1856 Ga0316577_10307478
1857 Ga0316577_10352462
1858 Ga0307413_10017297
1859 Ga0307413_10027489
1860 Ga0307413_10047583
1861 Ga0307413_11444641
1862 Ga0307406_10029998
1863 Ga0307406_10059928
1864 Ga0307406_10169260
1865 Ga0307407_10006639
1866 Ga0307407_10180908
1867 Ga0307407_10411657
1868 Ga0307412_10002583
1869 Ga0307412_10005916
1870 Ga0307412_10011186
1871 Ga0307412_10016826
1872 Ga0307412_10086424
1873 Ga0307412_10126896
1874 Ga0307412_10472862
1875 Ga0307412_10692898
1876 Ga0307409_100021248
1877 Ga0307409_100036561
1878 Ga0307416_100359120
1879 Ga0307416_100598335
1880 Ga0307416_101172513
1881 Ga0307414_10214662
1882 Ga0307414_10258328
1883 Ga0307414_10450681
1884 Ga0307414_10691644
1885 Ga0307411_10021479
1886 Ga0307411_10087930
1887 Ga0307411_11000380
1888 Ga0316583_10002609
1889 Ga0316583_10006405
1890 Ga0316583_10010185
1891 Ga0316583_10014224
1892 Ga0316583_10017999
1893 Ga0316583_10031085
1894 Ga0316583_10038675
1895 Ga0316583_10111001
1896 Ga0316583_10127391
1897 Ga0316583_10144965
1898 Ga0316585_10000045
1899 Ga0316585_10002386
1900 Ga0316585_10048247
1901 Ga0316585_10061278
1902 Ga0316585_10077703
1903 Ga0316585_10081381
1904 Ga0316585_10135362
1905 Ga0316580_10000052
1906 Ga0316580_10009698
1907 Ga0316580_10015636
1908 Ga0316580_10021674
1909 Ga0316580_10030832
1910 Ga0316580_10042211
1911 Ga0316593_10001775
1912 Ga0316593_10005353
1913 Ga0316593_10005989
1914 Ga0316593_10014207
1915 Ga0316593_10019300
1916 Ga0316593_10043709
1917 Ga0316593_10052695
1918 Ga0316593_10057095
1919 Ga0316593_10098566
1920 Ga0316593_10221303
1921 Ga0316593_10235307
1922 Ga0316593_10325346
1923 Ga0316593_10453548
1924 Ga0307510_10030497
1925 Ga0307510_10222045
1926 Ga0316592_1000443
1927 Ga0316592_1004880
1928 Ga0316592_1024767
1929 Ga0316592_1045492
1930 Ga0316592_1048157
1931 Ga0316592_1083052
1932 Ga0316586_1014253
1933 Ga0316586_1015204
1934 Ga0316586_1022983
1935 Ga0316588_1000220
1936 Ga0316588_1003976
1937 Ga0316588_1037124
1938 Ga0316588_1068369
1939 Ga0316587_1011069
1940 Ga0316587_1026358
1941 Ga0316587_1033696
1942 Ga0316587_1062296
1943 Ga0316587_1084725
1944 Ga0316587_1103648
1945 Ga0316587_1120717
1946 Ga0316596_1000105
1947 Ga0316596_1000300
1948 Ga0316596_1001890
1949 Ga0316596_1012130
1950 Ga0316596_1028091
1951 Ga0316596_1033052
1952 Ga0316596_1041381
1953 Ga0316596_1057151
1954 Ga0316596_1066524
1955 Ga0316596_1128083
1956 Ga0316596_1150878
1957 Ga0316596_1167215
1958 Ga0373952_0022981
1959 Ga0316574_0000424
1960 Ga0316574_0000873
1961 Ga0316574_0043902
1962 Ga0316574_0044101
1963 Ga0316574_0099207
1964 Ga0316574_0103789
1965 Ga0316574_0108525
1966 Ga0316574_0120938
1967 Ga0316574_0127486
1968 Ga0316574_0196511
1969 Ga0316574_0224345
1970 Ga0316574_0266190
1971 Ga0316574_0603818
1972 Ga0316582_0000425
1973 Ga0316582_0001793
1974 Ga0316582_0002571
1975 Ga0316582_0003576
1976 Ga0316582_0011418
1977 Ga0316582_0013421
1978 Ga0316582_0036684
1979 Ga0316582_0049568
1980 Ga0316582_0093722
1981 Ga0316582_0102391
1982 Ga0316582_0129702
1983 Ga0316582_0129933
1984 Ga0316582_0180370
1985 Ga0316582_0383187
1986 Ga0316582_0536386
1987 Ga0316582_1131147
1988 Ga0316584_0008126
1989 Ga0316584_0012158
1990 Ga0316584_0016520
1991 Ga0316584_0016711
1992 Ga0316584_0026225
1993 Ga0316584_0057024
1994 Ga0316584_0086613
1995 Ga0316584_0091924
1996 Ga0316584_0094276
1997 Ga0316584_0145361
1998 Ga0316584_0156930
1999 Ga0316584_0166434
2000 Ga0316584_0173059
2001 Ga0316584_0179359
2002 Ga0316584_0207034
2003 Ga0316584_0218127
2004 Ga0316584_0270367
2005 Ga0316584_0296105
2006 Ga0316584_0335995
2007 Ga0316584_0425955
2008 Ga0316581_0006139
2009 Ga0316581_0013331
2010 Ga0316581_0018212
2011 Ga0316581_0019321
2012 Ga0316581_0081932
2013 Ga0237819_00720
2014 Ga0237819_10282
2015 Ga0400484_03261
2016 Ga0400484_22124
2017 Ga0400484_24524
2018 Ga0400484_24604
2019 Ga0400484_34217
2020 Ga0400490_16939
2021 Ga0400490_18637
2022 Ga0400490_20091
2023 Ga0400490_25156
2024 Ga0400490_33872
2025 Ga0400490_45662
2026 Ga0400490_61215
2027 Ga0400491_11104
2028 Ga0400491_23332
2029 Ga0400485_02898
2030 Ga0400485_07793
2031 Ga0400488_03303
2032 Ga0400488_10662
2033 Ga0400488_17680
2034 Ga0400488_18679
2035 Ga0400488_29451
2036 Ga0400488_29660
2037 Ga0400488_33104
2038 Ga0400488_38090
2039 Ga0400488_51689
2040 Ga0400488_54154
2041 Ga0400488_57680
2042 Ga0400486_06140
2043 Ga0400486_08788
2044 Ga0400486_30182
2045 Ga0400483_005162
2046 Ga0400483_048826
2047 Ga0400483_056532
2048 Ga0400483_058543
2049 Ga0400483_061103
2050 Ga0400483_062240
2051 Ga0400483_067063
2052 Ga0400483_069725
2053 Ga0400483_072164
2054 Ga0400483_084581
2055 Ga0400483_108539
2056 Ga0400483_134009
2057 Ga0400483_145061
2058 Ga0400483_164358
2059 Ga0400483_179717
2060 Ga0400483_193304
2061 Ga0400483_196484
2062 Ga0400483_203162
2063 Ga0400483_240978
2064 Ga0400483_252208
2065 Ga0400483_269943
2066 Ga0400483_277286
2067 Ga0400483_279635
2068 Ga0400489_18813
2069 Ga0400487_00528
2070 Ga0400487_01707
2071 Ga0400487_10993
2072 Ga0400487_12856
2073 Ga0400487_24791
2074 Ga0400487_26365
2075 Ga0400487_27362
2076 Ga0400487_28448
2077 Ga0400487_47735
2078 Ga0439436_0000529
2079 Ga0439436_0030612
2080 Ga0439438_003655
2081 Ga0439438_003712
2082 Ga0439438_003849
2083 Ga0439438_004132
2084 Ga0439438_004546
2085 Ga0439438_009436
2086 Ga0439438_016363
2087 Ga0439447_002115
2088 Ga0439447_002684
2089 Ga0439447_003500
2090 Ga0439447_004605
2091 Ga0439447_005034
2092 Ga0439447_019764
2093 Ga0439447_020417
2094 Ga0439447_075981
2095 Ga0439453_0069226
2096 Ga0439461_0014356
2097 Ga0439466_0003608
2098 Ga0439466_0003822
2099 Ga0439466_0004509
2100 Ga0439466_0004750
2101 Ga0439466_0005809
2102 Ga0439466_0006690
2103 Ga0439466_0013327
2104 Ga0439466_0018538
2105 Ga0439466_0023453
2106 Ga0439466_0031287
2107 Ga0439465_0003421
2108 Ga0439465_0003829
2109 Ga0451793_0038927
2110 Ga0451800_1131212
2111 Ga0451806_159937
2112 Ga0451804_0897249
2113 Ga0451807_0544911
2114 Ga0451833_1047701
2115 Ga0451837_1262131
2116 Ga0451839_0080508
2117 Ga0451839_1006830
2118 Ga0451853_0100403
2119 Ga0439437_008674
2120 Ga0439441_093362
2121 Ga0439445_0064853
2122 Ga0439432_008802
2123 Ga0439432_010106
2124 Ga0439432_010683
2125 Ga0439432_014095
2126 Ga0439432_022493
2127 Ga0439432_174202
2128 Ga0439451_001759
2129 Ga0439451_002045
2130 Ga0439451_068680
2131 Ga0439452_000281
2132 Ga0439452_001961
2133 Ga0439452_002545
2134 Ga0439452_003098
2135 Ga0439452_008330
2136 Ga0439452_014216
2137 Ga0439452_014793
2138 Ga0439452_022476
2139 Ga0439452_040643
2140 Ga0439456_001502
2141 Ga0439456_002365
2142 Ga0439456_004937
2143 Ga0439456_005217
2144 Ga0439456_006370
2145 Ga0439456_030949
2146 Ga0439463_001607
2147 Ga0439463_031117
2148 Ga0439463_103281
2149 Ga0450911_000007
2150 Ga0450911_001914
2151 Ga0450911_005729
2152 Ga0450919_000544
2153 Ga0450922_007945
2154 Ga0450890_000530
2155 Ga0450891_023800
2156 Ga0450894_016168
2157 Ga0450902_004861
2158 Ga0450902_013218
2159 Ga0450902_016614
2160 Ga0450903_001531
2161 Ga0450904_000805
2162 Ga0450905_003240
2163 Ga0450907_001033
2164 Ga0450907_002172
2165 Ga0450907_031409
2166 Ga0450910_000567
2167 Ga0439446_0000462
2168 Ga0439446_0001926
2169 Ga0439446_0002731
2170 Ga0439446_0026451
2171 Ga0439446_0030081
2172 Ga0450908_010965
2173 Ga0450909_000392
2174 Ga0450909_001201
2175 Ga0439434_0001710
2176 Ga0439434_0009966
2177 Ga0439434_0012388
2178 Ga0439459_0004195
2179 Ga0439464_0004162
2180 Ga0439464_0148996
2181 Ga0439460_0002183
2182 Ga0439460_0010656
2183 Ga0450916_042978
2184 Ga0450918_007806
2185 Ga0450893_0010040
2186 Ga0451577_0000091
2187 Ga0451577_0048206
2188 Ga0451577_0212114
2189 Ga0439440_0005213
2190 Ga0453684_0000632
2191 Ga0453684_0003509
2192 Ga0453684_0322089
2193 Ga0453684_0335614
2194 Ga0453684_0780456
2195 Ga0466957_0101227
2196 Ga0451576_1266277
2197 Ga0495617_000225
2198 Ga0495617_000424
2199 Ga0495617_001533
2200 Ga0495617_003852
2201 Ga0495617_019207
2202 Ga0495617_021058
2203 Ga0495617_042975
2204 Ga0495617_057819
2205 Ga0495627_000423
2206 Ga0495627_000451
2207 Ga0495627_000569
2208 Ga0495627_006643
2209 Ga0495627_007874
2210 Ga0495627_017726
2211 Ga0495592_0133179
2212 Ga0495603_0053164
2213 Ga0495603_0111262
2214 Ga0495603_0126308
2215 Ga0495590_0007646
2216 Ga0495590_0019871
2217 Ga0495590_0038874
2218 Ga0495590_0091246
2219 Ga0495591_000822
2220 Ga0495591_000971
2221 Ga0495591_001928
2222 Ga0495591_005086
2223 Ga0495591_006137
2224 Ga0495591_006343
2225 Ga0495591_006460
2226 Ga0495591_007307
2227 Ga0495591_009065
2228 Ga0495591_013233
2229 Ga0495591_021981
2230 Ga0495638_0000146
2231 Ga0495638_0022371
2232 Ga0495638_0030350
2233 Ga0495638_0031046
2234 Ga0495638_0053800
2235 Ga0495638_0099568
2236 Ga0495638_0209596
2237 Ga0495641_0139615
2238 Ga0495653_0014639
2239 Ga0495653_0014669
2240 Ga0495653_0031142
2241 Ga0495653_0105883
2242 Ga0495650_0001128
2243 Ga0495650_0001933
2244 Ga0495650_0003282
2245 Ga0495650_0005168
2246 Ga0495650_0008618
2247 Ga0495650_0009821
2248 Ga0495650_0014936
2249 Ga0495650_0023743
2250 Ga0495650_0030328
2251 Ga0495650_0032981
2252 Ga0495650_0193152
2253 Ga0495605_0000336
2254 Ga0495605_0000831
2255 Ga0495605_0000880
2256 Ga0495605_0000903
2257 Ga0495605_0001530
2258 Ga0495605_0005834
2259 Ga0495605_0006152
2260 Ga0495605_0010787
2261 Ga0495605_0010841
2262 Ga0495605_0011420
2263 Ga0495605_0017962
2264 Ga0495605_0049839
2265 Ga0495605_0097476
2266 Ga0495605_0152092
2267 Ga0495605_0229670
2268 Ga0495639_0000158
2269 Ga0495639_0094586
2270 Ga0495584_0006126
2271 Ga0495584_0007034
2272 Ga0495584_0008147
2273 Ga0495584_0019573
2274 Ga0495584_0022709
2275 Ga0495584_0026072
2276 Ga0495584_0028197
2277 Ga0495584_0039576
2278 Ga0495584_0069598
2279 Ga0495585_0001234
2280 Ga0495585_0008120
2281 Ga0495585_0008710
2282 Ga0495585_0009359
2283 Ga0495585_0010239
2284 Ga0495585_0028763
2285 Ga0495585_0063726
2286 Ga0495585_0066197
2287 Ga0495585_0095118
2288 Ga0495585_0096440
2289 Ga0495594_0000612
2290 Ga0495594_0011583
2291 Ga0495594_0032442
2292 Ga0495594_0081468
2293 Ga0495594_0588995
2294 Ga0495596_0023295
2295 Ga0495596_0059715
2296 Ga0495596_0161569
2297 Ga0495607_0000869
2298 Ga0495607_0001347
2299 Ga0495607_0001549
2300 Ga0495607_0001613
2301 Ga0495607_0001842
2302 Ga0495607_0002165
2303 Ga0495607_0006360
2304 Ga0495607_0007352
2305 Ga0495607_0009030
2306 Ga0495607_0012101
2307 Ga0495607_0038125
2308 Ga0495607_0050742
2309 Ga0495607_0081189
2310 Ga0495607_0094312
2311 Ga0495607_0110787
2312 Ga0495607_0113088
2313 Ga0495607_0125997
2314 Ga0495607_0163472
2315 Ga0495607_0178747
2316 Ga0495607_0290422
2317 Ga0495583_0000521
2318 Ga0495583_0001354
2319 Ga0495583_0001828
2320 Ga0495583_0002363
2321 Ga0495583_0006262
2322 Ga0495583_0008207
2323 Ga0495583_0008548
2324 Ga0495583_0019607
2325 Ga0495583_0040105
2326 Ga0495583_0223962
2327 Ga0495606_0001384
2328 Ga0495606_0001423
2329 Ga0495606_0001894
2330 Ga0495606_0002172
2331 Ga0495606_0002276
2332 Ga0495606_0005372
2333 Ga0495606_0008218
2334 Ga0495606_0014967
2335 Ga0495606_0017185
2336 Ga0495606_0128897
2337 Ga0495606_0129762
2338 Ga0495606_0186292
2339 Ga0495606_0248639
2340 Ga0495606_0358245
2341 Ga0495610_0001026
2342 Ga0495610_0004516
2343 Ga0495610_0009001
2344 Ga0495610_0009088
2345 Ga0495610_0010838
2346 Ga0495610_0011192
2347 Ga0495610_0014996
2348 Ga0495610_0022797
2349 Ga0495610_0060516
2350 Ga0495610_0135586
2351 Ga0495610_0217429
2352 Ga0495616_0005283
2353 Ga0495616_0007521
2354 Ga0495616_0009442
2355 Ga0495616_0012444
2356 Ga0495616_0016626
2357 Ga0495616_0052948
2358 Ga0495616_0073936
2359 Ga0495616_0145134
2360 Ga0495616_0249953
2361 Ga0495616_0388951
2362 Ga0495620_0000878
2363 Ga0495620_0001742
2364 Ga0495620_0002259
2365 Ga0495620_0002585
2366 Ga0495620_0002844
2367 Ga0495620_0007056
2368 Ga0495620_0021421
2369 Ga0495620_0022999
2370 Ga0495630_0016649
2371 Ga0495630_0438011
2372 Ga0495631_0000478
2373 Ga0495631_0000774
2374 Ga0495631_0001335
2375 Ga0495631_0001760
2376 Ga0495631_0005026
2377 Ga0495631_0015739
2378 Ga0495631_0034124
2379 Ga0495631_0050780
2380 Ga0495631_0217353
2381 Ga0495632_0001147
2382 Ga0495632_0002357
2383 Ga0495632_0003511
2384 Ga0495632_0007235
2385 Ga0495632_0008307
2386 Ga0495632_0008784
2387 Ga0495632_0009540
2388 Ga0495632_0011026
2389 Ga0495632_0011532
2390 Ga0495632_0040650
2391 Ga0495632_0099337
2392 Ga0495637_0003252
2393 Ga0495637_0006397
2394 Ga0495637_0006846
2395 Ga0495637_0007301
2396 Ga0495637_0007578
2397 Ga0495637_0010254
2398 Ga0495637_0011839
2399 Ga0495637_0013088
2400 Ga0495637_0018886
2401 Ga0495637_0020192
2402 Ga0495637_0035066
2403 Ga0495637_0050801
2404 Ga0495637_0148696
2405 Ga0495643_0000421
2406 Ga0495643_0004499
2407 Ga0495643_0009458
2408 Ga0495643_0036989
2409 Ga0495643_0052582
2410 Ga0495643_0074771
2411 Ga0495643_0119586
2412 Ga0495644_0015663
2413 Ga0495644_0058964
2414 Ga0495644_0098017
2415 Ga0495648_0004823
2416 Ga0495648_0005023
2417 Ga0495648_0011986
2418 Ga0495648_0013468
2419 Ga0495648_0014011
2420 Ga0495648_0017468
2421 Ga0495648_0023252
2422 Ga0495648_0023803
2423 Ga0495648_0038246
2424 Ga0495648_0039520
2425 Ga0495648_0041480
2426 Ga0495648_0069769
2427 Ga0495648_0077013
2428 Ga0495666_0012928
2429 Ga0495666_0026972
2430 Ga0495666_0096513
2431 Ga0495642_0003041
2432 Ga0495642_0004114
2433 Ga0495652_0291527
2434 Ga0495654_0000672
2435 Ga0495654_0000875
2436 Ga0495654_0006669
2437 Ga0495654_0006958
2438 Ga0495654_0007483
2439 Ga0495654_0015065
2440 Ga0495654_0019786
2441 Ga0495654_0023494
2442 Ga0495654_0040871
2443 Ga0495654_0043771
2444 Ga0495654_0157262
2445 Ga0495654_0249085
2446 Ga0495587_0018557
2447 Ga0495587_0175391
2448 Ga0495587_0366128
2449 Ga0495609_0000011
2450 Ga0495609_0000349
2451 Ga0495609_0000784
2452 Ga0495609_0005802
2453 Ga0495609_0008532
2454 Ga0495609_0009845
2455 Ga0495609_0011414
2456 Ga0495609_0117644
2457 Ga0495597_0000221
2458 Ga0495597_0007884
2459 Ga0495597_0008152
2460 Ga0495597_0050003
2461 Ga0495597_0142939
2462 Ga0495597_0285027
2463 Ga0495645_0139290
2464 Ga0495622_0004041
2465 Ga0495622_0004514
2466 Ga0495622_0004608
2467 Ga0495622_0009876
2468 Ga0495622_0015519
2469 Ga0495633_0000287
2470 Ga0495633_0024742
2471 Ga0495656_0062158
2472 Ga0495668_0004341
2473 Ga0495668_0033511
2474 Ga0495668_0035932
2475 Ga0495668_0066635
2476 Ga0495668_0119052
2477 Ga0495668_0282987
2478 Ga0495634_0012371
2479 Ga0495611_0000001
2480 Ga0495611_0000674
2481 Ga0495611_0000679
2482 Ga0495611_0001919
2483 Ga0495611_0005044
2484 Ga0495611_0010711
2485 Ga0495611_0013643
2486 Ga0495611_0061830
2487 Ga0495625_0000001
2488 Ga0495625_0000187
2489 Ga0495625_0001286
2490 Ga0495625_0014956
2491 Ga0495625_0018168
2492 Ga0495625_0031785
2493 Ga0495625_0050696
2494 Ga0495625_0075383
2495 Ga0495625_0115313
2496 Ga0495625_0289041
2497 Ga0495635_0011871
2498 Ga0495635_0564495
2499 Ga0495659_0002188
2500 Ga0495659_0005793
2501 Ga0495659_0215745
2502 Ga0495661_0000028
2503 Ga0495661_0000477
2504 Ga0495661_0000596
2505 Ga0495661_0001003
2506 Ga0495661_0004293
2507 Ga0495661_0006585
2508 Ga0495661_0021576
2509 Ga0495661_0078677
2510 Ga0495661_0100984
2511 Ga0495661_0339396
2512 Ga0495588_0027874
2513 Ga0495599_0870536
2514 Ga0495623_0011027
2515 Ga0495646_0091142
2516 Ga0495658_0656894
2517 Ga0495669_0018630
2518 Ga0495613_0028299
2519 Ga0495613_0107369
2520 Ga0495613_0111379
2521 Ga0495624_0010386
2522 Ga0495670_0004101
2523 Ga0495670_0005209
2524 Ga0495670_0005708
2525 Ga0495670_0005850
2526 Ga0495670_0014500
2527 Ga0495670_0029246
2528 Ga0495670_0060659
2529 Ga0495670_0229965
2530 Ga0495670_0241272
2531 Ga0495670_0474541
2532 Ga0495671_0000512
2533 Ga0495671_0000650
2534 Ga0495671_0001180
2535 Ga0495671_0002553
2536 Ga0495671_0007066
2537 Ga0495671_0013002
2538 Ga0495671_0039219
2539 Ga0495671_0057617
2540 Ga0495671_0065688
2541 Ga0495671_0074970
2542 Ga0495671_0404403
2543 Ga0495649_0003758
2544 Ga0495649_0006713
2545 Ga0495649_0007221
2546 Ga0495649_0007939
2547 Ga0495649_0016821
2548 Ga0495649_0022992
2549 Ga0495649_0027233
2550 Ga0495649_0045228
2551 Ga0495649_0081859
2552 Ga0495589_0000236
2553 Ga0495589_0005797
2554 Ga0495589_0006835
2555 Ga0495589_0009516
2556 Ga0495589_0018838
2557 Ga0495589_0041537
2558 Ga0495589_0043186
2559 Ga0495600_0060865
2560 Ga0495600_0423426
2561 Ga0495660_0000888
2562 Ga0495660_0001210
2563 Ga0495660_0001273
2564 Ga0495660_0001456
2565 Ga0495660_0001754
2566 Ga0495660_0004981
2567 Ga0495660_0014627
2568 Ga0495660_0015804
2569 Ga0495660_0020626
2570 Ga0495660_0023983
2571 Ga0495660_0031294
2572 Ga0495660_0052001
2573 Ga0495660_0124149
2574 Ga0495660_0158845
2575 Ga0495660_0195623
2576 Ga0495581_0100939
2577 Ga0495604_0014492
2578 Ga0495604_0081315
2579 Ga0495674_0022886
2580 Ga0495672_0001999
2581 Ga0495672_0010991
2582 Ga0495672_0011802
2583 Ga0495672_0015180
2584 Ga0495672_0022913
2585 Ga0495672_0031266
2586 Ga0495672_0050816
2587 Ga0495672_0215969
2588 Ga0495676_0000508
2589 Ga0495676_0088878
2590 Ga0495676_0462796
2591 Ga0495680_0016282
2592 Ga0495680_0020798
2593 Ga0495680_0022963
2594 Ga0495683_0000053
2595 Ga0495683_0000216
2596 Ga0495683_0000279
2597 Ga0495683_0001237
2598 Ga0495683_0016482
2599 Ga0495683_0019039
2600 Ga0495683_0022999
2601 Ga0495683_0023793
2602 Ga0495683_0101430
2603 Ga0495687_000698
2604 Ga0495687_008412
2605 Ga0495677_0004418
2606 Ga0495679_000004
2607 Ga0495679_000075
2608 Ga0495679_002285
2609 Ga0495679_007665
2610 Ga0495679_012854
2611 Ga0495679_015325
2612 Ga0495679_066151
2613 Ga0495685_009223
2614 Ga0495685_060550
2615 Ga0495673_0000202
2616 Ga0495673_0000670
2617 Ga0495673_0000938
2618 Ga0495673_0001468
2619 Ga0495673_0001495
2620 Ga0495673_0002985
2621 Ga0495673_0006031
2622 Ga0495673_0006159
2623 Ga0495673_0006807
2624 Ga0495673_0007204
2625 Ga0495673_0007237
2626 Ga0495673_0009407
2627 Ga0495673_0085181
2628 Ga0495673_0110247
2629 Ga0495673_0117471
2630 Ga0495673_0140076
2631 Ga0495673_0154008
2632 Ga0495673_0174084
2633 Ga0495673_0198969
2634 Ga0495681_0000588
2635 Ga0495681_0005805
2636 Ga0495681_0012384
2637 Ga0495681_0016233
2638 Ga0495681_0024804
2639 Ga0495681_0025435
2640 Ga0495681_0098844
2641 Ga0495686_0000017
2642 Ga0495686_0002215
2643 Ga0495686_0011962
2644 Ga0495686_0097455
2645 Ga0495686_0125614
2646 Ga0495686_0142964
2647 Ga0495686_0168419
2648 Ga0495686_0359417
2649 Ga0495593_0017034
2650 Ga0495593_0041728
2651 Ga0495602_0089939
2652 Ga0495626_0000250
2653 Ga0495626_0002158
2654 Ga0495626_0007151
2655 Ga0495626_0007269
2656 Ga0495626_0010027
2657 Ga0495626_0030432
2658 Ga0496102_0017499
2659 Ga0496102_0117760
2660 Ga0496103_0008923
2661 Ga0496103_0253436
2662 Ga0496106_0037962
2663 Ga0496107_0162336
2664 Ga0496110_0090019
2665 Ga0496110_0162260
2666 Ga0496110_0254903
2667 Ga0496111_0913089
2668 Ga0496112_0057022
2669 Ga0496112_0177019
2670 Ga0496116_0001102
2671 Ga0496116_0013194
2672 Ga0496116_0034340
2673 Ga0496116_0065312
2674 Ga0496116_0071479
2675 Ga0496116_0098826
2676 Ga0496117_0021272
2677 Ga0496117_0027159
2678 Ga0496117_0058529
2679 Ga0496117_0072139
2680 Ga0496117_0091291
2681 Ga0496117_0156079
2682 Ga0496118_0001453
2683 Ga0496118_0006791
2684 Ga0496118_0021458
2685 Ga0496118_0032911
2686 Ga0496118_0048363
2687 Ga0496118_0062394
2688 Ga0496118_0088186
2689 Ga0496118_0102212
2690 Ga0496118_0182075
2691 Ga0496119_0060964
2692 Ga0496121_0000045
2693 Ga0496121_0002035
2694 Ga0496121_0003471
2695 Ga0496121_0010893
2696 Ga0496121_0019796
2697 Ga0496121_0040850
2698 Ga0496121_0068269
2699 Ga0496121_0094767
2700 Ga0496121_0141135
2701 Ga0496121_0151570
2702 Ga0496121_0309715
2703 Ga0496122_0006421
2704 Ga0496122_0018887
2705 Ga0496122_0021949
2706 Ga0496122_0038971
2707 Ga0496122_0074412
2708 Ga0496122_0116839
2709 Ga0496123_0005038
2710 Ga0496123_0010414
2711 Ga0496123_0015208
2712 Ga0496123_0065283
2713 Ga0496123_0073614
2714 Ga0496124_0000382
2715 Ga0496124_0010622
2716 Ga0496124_0064826
2717 Ga0496124_0104705
2718 Ga0496124_0198824
2719 Ga0496124_0372807
2720 Ga0496125_0003559
2721 Ga0496125_0037071
2722 Ga0496125_0097850
2723 Ga0496126_0089264
2724 Ga0496126_0126292
2725 Ga0496126_0185169
2726 Ga0495678_000362
2727 Ga0495678_000688
2728 Ga0495678_001023
2729 Ga0495678_007338
2730 Ga0495678_007420
2731 Ga0495678_010350
2732 Ga0495678_029227
2733 Ga0495678_052788
2734 Ga0495678_061123
2735 Ga0495678_115305
2736 Ga0495678_213151
2737 Ga0495682_0000344
2738 Ga0495682_0001672
2739 Ga0495682_0004097
2740 Ga0495682_0008461
2741 Ga0495682_0012546
2742 Ga0495682_0130514
2743 Ga0501316_024797
2744 Ga0501320_061501
2745 Ga0501323_016353
2746 Ga0501031_0267062
2747 Ga0501032_0004655
2748 Ga0501032_0076983
2749 Ga0501034_0021013
2750 Ga0501034_0097710
2751 Ga0501034_0360119
2752 Ga0501034_0991496
2753 Ga0501037_0024665
2754 Ga0501038_0010418
2755 Ga0501038_0139820
2756 Ga0501038_0849692
2757 Ga0501039_0467428
2758 Ga0501039_0475462
2759 Ga0501043_0004238
2760 Ga0501198_019209
2761 Ga0501227_044139
2762 Ga0501259_012650
2763 Ga0501079_1277675
2764 Ga0501080_0000333
2765 Ga0501083_0173004
2766 Ga0501241_003001
2767 Ga0501241_121705
2768 Ga0501241_158194
2769 Ga0501269_041519
2770 Ga0501035_0317279
2771 Ga0501204_008163
2772 Ga0501226_000022
2773 Ga0501226_011206
2774 nmdc:mga03683_294116_c1
2775 nmdc:mga08y16_1346074_c1
2776 Ga0495619_0476001
2777 Ga0500643_000075
2778 Ga0500555_007694
2779 Ga0500562_055900
2780 Ga0500618_008559
2781 Ga0500573_0052705
2782 Ga0500586_106454
2783 Ga0500633_0055414
2784 Ga0500645_004544
2785 Ga0501084_1042293
2786 2595446632
2787 2595451876
2788 2599504320
2789 2599613610
2790 2599933419
2791 2599994247
2792 2600023542
2793 2600030656
2794 2600037013
2795 2600042436
2796 2600060499
2797 2600065598
2798 2600078282
2799 2600360463
2800 2671129075
2801 2721026742
2802 2735837704
2803 2738715871
2804 2739228309
2805 2747947854
2806 2765577926
2807 2794595944
2808 2842859282
2809 2842919519
2810 2884341284
2811 2894510720
2812 2895502561
2813 2895514110
2814 2895524412
2815 2895526509
2816 2919404950
2817 2919460944
2818 2923589981
2819 2931374141
2820 2941472736
2821 2953998016
2822 2989396456
2823 8056144928

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

30

129

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lkn-assembly2.cif.gz_D the pilb(n-terminal_p70s mutant)-pilz complex (semet) 0.9758 12 118
3dsg-assembly1.cif.gz_A xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity 0.9598 12 107
4fou-assembly1.cif.gz_C structure of the pilz-fimx(eal domain)-c-di-gmp complex responsible for the regulation of bacterial type iv pilus biogenesis 0.9553 12 107
3dsg-assembly3.cif.gz_C xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity 0.9543 12 107
7lkn-assembly2.cif.gz_D the pilb(n-terminal_p70s mutant)-pilz complex (semet) 0.9497 12 118
ID Description Score Start End Superfamily
3dsgA00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.9585 12 107 2.40.10.220
3dsgA00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.9382 12 107 2.40.10.220
af_Q95XS0_332_432_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6826 48 76 2.30.30.140
af_I1LW27_291_355_2.30.30.1040 Mainly Beta;Roll;SH3 type barrels.; 0.6622 46 92 2.30.30.1040
af_K7UKA6_315_388_2.30.30.1040 Mainly Beta;Roll;SH3 type barrels.; 0.6523 45 92 2.30.30.1040
ID Description Score Start End GO Terms
AF-L8MPR7-F1-model_v4 deleted 1.001 16 118
AF-A0A355JQG9-F1-model_v4 deleted 0.9987 16 118
AF-A0A0S2FSN1-F1-model_v4 deleted 0.9937 14 118
AF-A0A2E6LZS8-F1-model_v4 Pilus assembly protein PilZ 0.9919 10 118 GO:0035438
AF-L8MPR7-F1-model_v4 deleted 0.9918 16 118

Map