F493755
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1411 | 430 | 2823 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300032133|Ga0316583_10311088|Ga0316583_103110881 |
| Length | 140 |
| Sequence | MGPYATPPGTATQAVIVMDDTNQAPGNGQQRQAILSLAIKDKGALYAAYMPYVKNGGLFIPTNKAYKLGDEVFLLLTLMDETEKLPVAGKVIWVTPKGSQGNRVAGIGVQFSDQDGDAARNKIETYLAGSLKSDRYTHTM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003502 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM | Metagenome | Rhizosphere |
| 14 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 15 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 63 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 163 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 165 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 166 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 167 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 168 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 169 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 170 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 173 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 174 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 175 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 176 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 177 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 189 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 190 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 200 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 201 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 202 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 203 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 204 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 205 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 206 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 207 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 208 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 209 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 210 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 211 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 212 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 213 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 214 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 215 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 216 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 217 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 218 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 219 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 225 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 226 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 227 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 228 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 229 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 230 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 231 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 232 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 233 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 234 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 235 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 236 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 237 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 238 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 239 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 240 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 241 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 242 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 243 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 244 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 245 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 246 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 247 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 248 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 249 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 250 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 251 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 252 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 253 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 254 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 255 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 256 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 257 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 348 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 349 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 350 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 351 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 352 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 353 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 354 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 355 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 356 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 371 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 372 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 373 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 377 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 380 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 381 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 382 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 385 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 386 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 387 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 389 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 390 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 391 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 394 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 395 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 396 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 397 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 398 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 399 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 400 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 401 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 402 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 403 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 404 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 405 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 406 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 407 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 408 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 409 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 410 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 411 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 412 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 413 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 414 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 415 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 416 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 417 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 418 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 419 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 420 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 421 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 422 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 423 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 424 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 425 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 426 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 427 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 428 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 429 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 430 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.62 |
| Metatranscriptomes | 3.69 |
| Isolates | 2.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.9 |
| Nodule | 0.5 |
| Rhizoplane | 2.13 |
| Rhizosphere | 82.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316583_10311088 | 3300032133 | Bacteria | 545 |
| 2 | MRS2a_Contig_5007 | 2124908027 | Bacteria | 12299 |
| 3 | SwRhRL2b_contig_1022998 | 2162886007 | Bacteria | 1714 |
| 4 | JGI24736J21556_1004624 | 3300001904 | Bacteria | 2342 |
| 5 | JGI24738J21930_10009582 | 3300002075 | Bacteria | 2175 |
| 6 | JGI25162J39368_1000421 | 3300002737 | Bacteria | 34311 |
| 7 | JGI25163J39215_1000824 | 3300002771 | Bacteria | 7443 |
| 8 | JGI25164J39214_1000296 | 3300002772 | Bacteria | 34311 |
| 9 | JGI25165J46597_1000528 | 3300003214 | Bacteria | 35737 |
| 10 | rootH2_10097578 | 3300003320 | Bacteria | 2361 |
| 11 | rootH1_10005612 | 3300003323 | Bacteria | 12697 |
| 12 | rootH1_10012577 | 3300003316 | Bacteria | 3264 |
| 13 | rootH1_10012577 | 3300003323 | Bacteria | 30555 |
| 14 | Ga0006556J51387_1033075 | 3300003479 | Bacteria | 1707 |
| 15 | JGI26143J51219_1004981 | 3300003502 | Bacteria | 650 |
| 16 | JGI26141J51220_1016087 | 3300003503 | Bacteria | 512 |
| 17 | Ga0006554J51385_1027885 | 3300003567 | Bacteria | 1746 |
| 18 | Ga0006562J51391_1048358 | 3300003578 | Bacteria | 4740 |
| 19 | Ga0006562J51391_1048362 | 3300003578 | Bacteria | 2630 |
| 20 | Ga0055533_1010054 | 3300003756 | Bacteria | 1093 |
| 21 | Ga0055536_1003265 | 3300003781 | Bacteria | 8790 |
| 22 | Ga0055536_1003284 | 3300003781 | Bacteria | 8749 |
| 23 | Ga0055536_1004864 | 3300003781 | Bacteria | 6707 |
| 24 | Ga0055530_10000240 | 3300003791 | Bacteria | 49322 |
| 25 | Ga0055530_10004397 | 3300003791 | Bacteria | 7269 |
| 26 | Ga0055530_10098522 | 3300003791 | Bacteria | 590 |
| 27 | Ga0055540_1000248 | 3300003792 | Bacteria | 49322 |
| 28 | Ga0055540_1000400 | 3300003792 | Bacteria | 35238 |
| 29 | Ga0055531_10000202 | 3300003794 | Bacteria | 65776 |
| 30 | Ga0058692_1014349 | 3300003856 | Bacteria | 1818 |
| 31 | Ga0065165_1000028 | 3300005262 | Bacteria | 224430 |
| 32 | Ga0065714_10001261 | 3300005288 | Bacteria | 1249 |
| 33 | Ga0065714_10014757 | 3300005288 | Bacteria | 2691 |
| 34 | Ga0065714_10045372 | 3300005288 | Bacteria | 763 |
| 35 | Ga0065714_10065886 | 3300005288 | Bacteria | 8197 |
| 36 | Ga0065714_10108272 | 3300005288 | Bacteria | 1518 |
| 37 | Ga0065714_10155290 | 3300005288 | Bacteria | 1082 |
| 38 | Ga0065714_10242649 | 3300005288 | Bacteria | 767 |
| 39 | Ga0065714_10243775 | 3300005288 | Bacteria | 788 |
| 40 | Ga0065714_10248355 | 3300005288 | Bacteria | 768 |
| 41 | Ga0065714_10287751 | 3300005288 | Bacteria | 622 |
| 42 | Ga0065704_10073559 | 3300005289 | Bacteria | 7017 |
| 43 | Ga0065704_10102828 | 3300005289 | Bacteria | 2191 |
| 44 | Ga0065704_10265871 | 3300005289 | Bacteria | 954 |
| 45 | Ga0065704_10559405 | 3300005289 | Bacteria | 630 |
| 46 | Ga0065712_10070056 | 3300005290 | Bacteria | 6368 |
| 47 | Ga0065712_10070345 | 3300005290 | Bacteria | 6088 |
| 48 | Ga0065712_10780774 | 3300005290 | Bacteria | 518 |
| 49 | Ga0065715_10145621 | 3300005293 | Bacteria | 1793 |
| 50 | Ga0065707_10594074 | 3300005295 | Bacteria | 694 |
| 51 | Ga0070658_10474529 | 3300005327 | Bacteria | 1079 |
| 52 | Ga0070670_100930253 | 3300005331 | Bacteria | 789 |
| 53 | Ga0068869_101456361 | 3300005334 | Bacteria | 607 |
| 54 | Ga0068869_101960737 | 3300005334 | Bacteria | 525 |
| 55 | Ga0070666_10000349 | 3300005335 | Bacteria | 28972 |
| 56 | Ga0070666_10150881 | 3300005335 | Bacteria | 1621 |
| 57 | Ga0070668_101820305 | 3300005347 | Bacteria | 560 |
| 58 | Ga0070668_101851519 | 3300005347 | Bacteria | 555 |
| 59 | Ga0070669_100039354 | 3300005353 | Bacteria | 3436 |
| 60 | Ga0070675_100149452 | 3300005354 | Bacteria | 2002 |
| 61 | Ga0070671_100157336 | 3300005355 | Bacteria | 1920 |
| 62 | Ga0070688_100559647 | 3300005365 | Bacteria | 870 |
| 63 | Ga0070688_101165752 | 3300005365 | Bacteria | 618 |
| 64 | Ga0070667_100016114 | 3300005367 | Bacteria | 6183 |
| 65 | Ga0070667_100072821 | 3300005367 | Bacteria | 2928 |
| 66 | Ga0070667_100512035 | 3300005367 | Bacteria | 1101 |
| 67 | Ga0070663_100008843 | 3300005455 | Bacteria | 6215 |
| 68 | Ga0070663_100293636 | 3300005455 | Bacteria | 1299 |
| 69 | Ga0070662_100019740 | 3300005457 | Bacteria | 4580 |
| 70 | Ga0070662_100065544 | 3300005457 | Bacteria | 2663 |
| 71 | Ga0070662_101134688 | 3300005457 | Bacteria | 671 |
| 72 | Ga0070685_10001203 | 3300005466 | Bacteria | 13774 |
| 73 | Ga0070685_10525559 | 3300005466 | Bacteria | 841 |
| 74 | Ga0068853_100020239 | 3300005539 | Bacteria | 5532 |
| 75 | Ga0068853_100926660 | 3300005539 | Bacteria | 837 |
| 76 | Ga0070665_100000227 | 3300005548 | Bacteria | 93439 |
| 77 | Ga0070665_100013903 | 3300005548 | Bacteria | 8097 |
| 78 | Ga0068855_100097646 | 3300005563 | Bacteria | 3384 |
| 79 | Ga0070664_100278872 | 3300005564 | Bacteria | 1507 |
| 80 | Ga0068854_100140780 | 3300005578 | Bacteria | 1851 |
| 81 | Ga0068856_100041168 | 3300005614 | Bacteria | 4539 |
| 82 | Ga0068852_100036098 | 3300005616 | Bacteria | 4132 |
| 83 | Ga0068852_100074224 | 3300005616 | Bacteria | 2995 |
| 84 | Ga0068859_100144280 | 3300005617 | Bacteria | 2455 |
| 85 | Ga0068864_100126077 | 3300005618 | Bacteria | 2295 |
| 86 | Ga0068851_10001367 | 3300005834 | Bacteria | 10634 |
| 87 | Ga0068851_11077851 | 3300005834 | Bacteria | 509 |
| 88 | Ga0068863_100044744 | 3300005841 | Bacteria | 4201 |
| 89 | Ga0068858_100001997 | 3300005842 | Bacteria | 20860 |
| 90 | Ga0068858_100497266 | 3300005842 | Bacteria | 1178 |
| 91 | Ga0068858_100611821 | 3300005842 | Bacteria | 1057 |
| 92 | Ga0068862_100130407 | 3300005844 | Bacteria | 2223 |
| 93 | Ga0081539_10030214 | 3300005985 | Bacteria | 3368 |
| 94 | Ga0075364_10191846 | 3300006051 | Bacteria | 1384 |
| 95 | Ga0075364_10375983 | 3300006051 | Bacteria | 969 |
| 96 | Ga0075432_10003878 | 3300006058 | Bacteria | 5095 |
| 97 | Ga0075432_10024222 | 3300006058 | Bacteria | 2079 |
| 98 | Ga0075432_10178464 | 3300006058 | Bacteria | 830 |
| 99 | Ga0075362_10081878 | 3300006177 | Bacteria | 1489 |
| 100 | Ga0075362_10392788 | 3300006177 | Bacteria | 699 |
| 101 | Ga0097621_100752189 | 3300006237 | Bacteria | 900 |
| 102 | Ga0068865_100261987 | 3300006881 | Bacteria | 1369 |
| 103 | Ga0097620_100144276 | 3300006931 | Bacteria | 2455 |
| 104 | Ga0079104_1000094 | 3300006946 | Bacteria | 130202 |
| 105 | Ga0079104_1036778 | 3300006946 | Bacteria | 1172 |
| 106 | Ga0099826_10046334 | 3300006948 | Bacteria | 2964 |
| 107 | Ga0105251_10000971 | 3300009011 | Bacteria | 25452 |
| 108 | Ga0105251_10001972 | 3300009011 | Bacteria | 16765 |
| 109 | Ga0105251_10006692 | 3300009011 | Bacteria | 7283 |
| 110 | Ga0105251_10010185 | 3300009011 | Bacteria | 5476 |
| 111 | Ga0105251_10012451 | 3300009011 | Bacteria | 4813 |
| 112 | Ga0105251_10137214 | 3300009011 | Bacteria | 1107 |
| 113 | Ga0105251_10140971 | 3300009011 | Bacteria | 1090 |
| 114 | Ga0105251_10616837 | 3300009011 | Bacteria | 516 |
| 115 | Ga0105244_10000709 | 3300009036 | Bacteria | 28850 |
| 116 | Ga0105244_10006626 | 3300009036 | Bacteria | 7460 |
| 117 | Ga0105244_10022875 | 3300009036 | Bacteria | 3436 |
| 118 | Ga0105244_10025486 | 3300009036 | Bacteria | 3214 |
| 119 | Ga0105244_10031405 | 3300009036 | Bacteria | 2818 |
| 120 | Ga0105244_10045633 | 3300009036 | Bacteria | 2254 |
| 121 | Ga0105244_10132648 | 3300009036 | Bacteria | 1202 |
| 122 | Ga0105244_10266429 | 3300009036 | Bacteria | 796 |
| 123 | Ga0105250_10000074 | 3300009092 | Bacteria | 91652 |
| 124 | Ga0105250_10004551 | 3300009092 | Bacteria | 6358 |
| 125 | Ga0105250_10005278 | 3300009092 | Bacteria | 5804 |
| 126 | Ga0105250_10049137 | 3300009092 | Bacteria | 1691 |
| 127 | Ga0105250_10183685 | 3300009092 | Bacteria | 878 |
| 128 | Ga0105250_10348350 | 3300009092 | Bacteria | 648 |
| 129 | Ga0105240_10001318 | 3300009093 | Bacteria | 42836 |
| 130 | Ga0105240_10061849 | 3300009093 | Bacteria | 4664 |
| 131 | Ga0105240_10088811 | 3300009093 | Bacteria | 3781 |
| 132 | Ga0105240_11099354 | 3300009093 | Bacteria | 846 |
| 133 | Ga0111539_10189307 | 3300009094 | Bacteria | 2401 |
| 134 | Ga0105247_10004675 | 3300009101 | Bacteria | 8724 |
| 135 | Ga0105243_10012583 | 3300009148 | Bacteria | 6396 |
| 136 | Ga0105243_10046356 | 3300009148 | Bacteria | 3419 |
| 137 | Ga0105243_10371643 | 3300009148 | Bacteria | 1319 |
| 138 | Ga0105243_12037693 | 3300009148 | Bacteria | 609 |
| 139 | Ga0105241_10061839 | 3300009174 | Bacteria | 2885 |
| 140 | Ga0105248_10216798 | 3300009177 | Bacteria | 2155 |
| 141 | Ga0105237_10040609 | 3300009545 | Bacteria | 4692 |
| 142 | Ga0105237_10057998 | 3300009545 | Bacteria | 3875 |
| 143 | Ga0105238_10004916 | 3300009551 | Bacteria | 13227 |
| 144 | Ga0105238_10045807 | 3300009551 | Bacteria | 4418 |
| 145 | Ga0105238_10231755 | 3300009551 | Bacteria | 1823 |
| 146 | Ga0105249_10009268 | 3300009553 | Bacteria | 8608 |
| 147 | Ga0105249_10132334 | 3300009553 | Bacteria | 2382 |
| 148 | Ga0105239_10099795 | 3300010375 | Bacteria | 3210 |
| 149 | Ga0105239_11220384 | 3300010375 | Bacteria | 867 |
| 150 | Ga0105246_10010995 | 3300011119 | Bacteria | 5610 |
| 151 | Ga0105246_10017718 | 3300011119 | Bacteria | 4530 |
| 152 | Ga0105246_10027429 | 3300011119 | Bacteria | 3731 |
| 153 | Ga0157373_10012012 | 3300013100 | Bacteria | 6365 |
| 154 | Ga0157373_10015562 | 3300013100 | Bacteria | 5560 |
| 155 | Ga0157373_10020104 | 3300013100 | Bacteria | 4857 |
| 156 | Ga0157373_10059677 | 3300013100 | Bacteria | 2703 |
| 157 | Ga0157373_10074417 | 3300013100 | Bacteria | 2396 |
| 158 | Ga0157373_10156997 | 3300013100 | Bacteria | 1600 |
| 159 | Ga0157373_11031773 | 3300013100 | Bacteria | 615 |
| 160 | Ga0157371_10000406 | 3300013102 | Bacteria | 53786 |
| 161 | Ga0157371_10003900 | 3300013102 | Bacteria | 13282 |
| 162 | Ga0157371_10010020 | 3300013102 | Bacteria | 7410 |
| 163 | Ga0157371_10023347 | 3300013102 | Bacteria | 4523 |
| 164 | Ga0157371_10029405 | 3300013102 | Bacteria | 3974 |
| 165 | Ga0157371_10040966 | 3300013102 | Bacteria | 3307 |
| 166 | Ga0157371_11610423 | 3300013102 | Bacteria | 508 |
| 167 | Ga0157370_10003491 | 3300013104 | Bacteria | 18436 |
| 168 | Ga0157370_10029572 | 3300013104 | Bacteria | 5373 |
| 169 | Ga0157370_10036318 | 3300013104 | Bacteria | 4783 |
| 170 | Ga0157370_10067761 | 3300013104 | Bacteria | 3374 |
| 171 | Ga0157370_10075420 | 3300013104 | Bacteria | 3179 |
| 172 | Ga0157370_10134067 | 3300013104 | Bacteria | 2309 |
| 173 | Ga0157370_10344341 | 3300013104 | Bacteria | 1374 |
| 174 | Ga0157370_10704253 | 3300013104 | Bacteria | 922 |
| 175 | Ga0157370_10981641 | 3300013104 | Bacteria | 765 |
| 176 | Ga0157370_11127406 | 3300013104 | Bacteria | 708 |
| 177 | Ga0157370_11400089 | 3300013104 | Bacteria | 629 |
| 178 | Ga0157369_10000329 | 3300013105 | Bacteria | 63484 |
| 179 | Ga0157369_10002062 | 3300013105 | Bacteria | 24256 |
| 180 | Ga0157369_10027825 | 3300013105 | Bacteria | 6263 |
| 181 | Ga0157369_10053199 | 3300013105 | Bacteria | 4377 |
| 182 | Ga0157369_10177919 | 3300013105 | Bacteria | 2239 |
| 183 | Ga0157369_10250742 | 3300013105 | Bacteria | 1847 |
| 184 | Ga0157369_10262866 | 3300013105 | Bacteria | 1800 |
| 185 | Ga0157369_10552434 | 3300013105 | Bacteria | 1190 |
| 186 | Ga0157369_10668929 | 3300013105 | Bacteria | 1070 |
| 187 | Ga0157374_10125969 | 3300013296 | Bacteria | 2476 |
| 188 | Ga0157374_10627022 | 3300013296 | Bacteria | 1086 |
| 189 | Ga0163162_10000030 | 3300013306 | Bacteria | 163717 |
| 190 | Ga0163162_10000495 | 3300013306 | Bacteria | 36598 |
| 191 | Ga0163162_10228419 | 3300013306 | Bacteria | 1991 |
| 192 | Ga0157372_10219520 | 3300013307 | Bacteria | 2204 |
| 193 | Ga0157372_10221324 | 3300013307 | Bacteria | 2194 |
| 194 | Ga0157372_10699434 | 3300013307 | Bacteria | 1180 |
| 195 | Ga0157375_10092090 | 3300013308 | Bacteria | 3094 |
| 196 | Ga0157375_10297193 | 3300013308 | Bacteria | 1778 |
| 197 | Ga0157375_12335801 | 3300013308 | Bacteria | 638 |
| 198 | Ga0157375_13220435 | 3300013308 | Bacteria | 544 |
| 199 | Ga0163163_10822619 | 3300014325 | Bacteria | 992 |
| 200 | Ga0157380_12205699 | 3300014326 | Bacteria | 615 |
| 201 | Ga0182008_10001710 | 3300014497 | Bacteria | 14399 |
| 202 | Ga0182008_10004847 | 3300014497 | Bacteria | 7773 |
| 203 | Ga0182008_10008849 | 3300014497 | Bacteria | 5464 |
| 204 | Ga0182008_10009722 | 3300014497 | Bacteria | 5179 |
| 205 | Ga0182008_10059579 | 3300014497 | Bacteria | 1884 |
| 206 | Ga0182008_10069783 | 3300014497 | Bacteria | 1729 |
| 207 | Ga0182008_10080762 | 3300014497 | Bacteria | 1600 |
| 208 | Ga0182008_10214491 | 3300014497 | Bacteria | 983 |
| 209 | Ga0182008_10258777 | 3300014497 | Bacteria | 900 |
| 210 | Ga0182008_10500014 | 3300014497 | Bacteria | 668 |
| 211 | Ga0157376_10037597 | 3300014969 | Bacteria | 3932 |
| 212 | Ga0157376_12032455 | 3300014969 | Bacteria | 613 |
| 213 | Ga0182006_1000072 | 3300015261 | Bacteria | 133681 |
| 214 | Ga0182006_1002699 | 3300015261 | Bacteria | 9525 |
| 215 | Ga0182006_1004981 | 3300015261 | Bacteria | 6400 |
| 216 | Ga0182006_1008086 | 3300015261 | Bacteria | 4778 |
| 217 | Ga0182006_1024729 | 3300015261 | Bacteria | 2475 |
| 218 | Ga0182006_1027559 | 3300015261 | Bacteria | 2317 |
| 219 | Ga0182006_1028287 | 3300015261 | Bacteria | 2280 |
| 220 | Ga0182006_1059317 | 3300015261 | Bacteria | 1449 |
| 221 | Ga0182006_1093958 | 3300015261 | Bacteria | 1074 |
| 222 | Ga0182006_1126189 | 3300015261 | Bacteria | 884 |
| 223 | Ga0182006_1134623 | 3300015261 | Bacteria | 848 |
| 224 | Ga0182007_10004029 | 3300015262 | Bacteria | 6776 |
| 225 | Ga0182007_10012807 | 3300015262 | Bacteria | 3219 |
| 226 | Ga0182007_10076641 | 3300015262 | Bacteria | 1096 |
| 227 | Ga0182007_10182043 | 3300015262 | Bacteria | 727 |
| 228 | Ga0182007_10424713 | 3300015262 | Bacteria | 509 |
| 229 | Ga0182005_1002599 | 3300015265 | Bacteria | 6381 |
| 230 | Ga0182005_1002728 | 3300015265 | Bacteria | 6170 |
| 231 | Ga0182005_1002754 | 3300015265 | Bacteria | 6133 |
| 232 | Ga0182005_1019229 | 3300015265 | Bacteria | 1883 |
| 233 | Ga0182005_1037481 | 3300015265 | Bacteria | 1318 |
| 234 | Ga0182005_1037547 | 3300015265 | Bacteria | 1317 |
| 235 | Ga0182005_1049663 | 3300015265 | Bacteria | 1140 |
| 236 | Ga0182005_1060913 | 3300015265 | Bacteria | 1031 |
| 237 | Ga0182005_1063406 | 3300015265 | Bacteria | 1010 |
| 238 | Ga0182005_1156521 | 3300015265 | Bacteria | 666 |
| 239 | Ga0182005_1252454 | 3300015265 | Bacteria | 546 |
| 240 | Ga0163161_10010440 | 3300017792 | Bacteria | 6430 |
| 241 | Ga0163161_10011813 | 3300017792 | Bacteria | 6056 |
| 242 | Ga0163161_10012486 | 3300017792 | Bacteria | 5896 |
| 243 | Ga0163161_10121726 | 3300017792 | Bacteria | 1961 |
| 244 | Ga0163161_10164095 | 3300017792 | Bacteria | 1695 |
| 245 | Ga0163161_10252315 | 3300017792 | Bacteria | 1375 |
| 246 | Ga0163161_10452259 | 3300017792 | Bacteria | 1038 |
| 247 | Ga0163161_10455393 | 3300017792 | Bacteria | 1035 |
| 248 | Ga0163161_10914732 | 3300017792 | Bacteria | 744 |
| 249 | Ga0209760_100114 | 3300025207 | Bacteria | 57573 |
| 250 | Ga0209674_100615 | 3300025226 | Bacteria | 13401 |
| 251 | Ga0209563_100338 | 3300025230 | Bacteria | 17932 |
| 252 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 253 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 254 | Ga0209437_101456 | 3300025233 | Bacteria | 5743 |
| 255 | Ga0209148_1001787 | 3300025254 | Bacteria | 9152 |
| 256 | Ga0209759_1004233 | 3300025256 | Bacteria | 5431 |
| 257 | Ga0209129_1000785 | 3300025258 | Bacteria | 20058 |
| 258 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 259 | Ga0209233_1005903 | 3300025261 | Bacteria | 4010 |
| 260 | Ga0209233_1014439 | 3300025261 | Bacteria | 2224 |
| 261 | Ga0209675_1001650 | 3300025291 | Bacteria | 12430 |
| 262 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 263 | Ga0209676_1000037 | 3300025292 | Bacteria | 457562 |
| 264 | Ga0209676_1000345 | 3300025292 | Bacteria | 88051 |
| 265 | Ga0209676_1005862 | 3300025292 | Bacteria | 6255 |
| 266 | Ga0209758_1007611 | 3300025297 | Bacteria | 7306 |
| 267 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 268 | Ga0209050_1000227 | 3300025298 | Bacteria | 123743 |
| 269 | Ga0209050_1003874 | 3300025298 | Bacteria | 10627 |
| 270 | Ga0209256_1012211 | 3300025299 | Bacteria | 3322 |
| 271 | Ga0209051_1000104 | 3300025303 | Bacteria | 161001 |
| 272 | Ga0209051_1000164 | 3300025303 | Bacteria | 124186 |
| 273 | Ga0209051_1059822 | 3300025303 | Bacteria | 1206 |
| 274 | Ga0209051_1090576 | 3300025303 | Bacteria | 852 |
| 275 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 276 | Ga0209257_1090914 | 3300025304 | Bacteria | 763 |
| 277 | Ga0207656_10009507 | 3300025321 | Bacteria | 3613 |
| 278 | Ga0207696_1000045 | 3300025711 | Bacteria | 296484 |
| 279 | Ga0207696_1000097 | 3300025711 | Bacteria | 175696 |
| 280 | Ga0207696_1002467 | 3300025711 | Bacteria | 9046 |
| 281 | Ga0207696_1003140 | 3300025711 | Bacteria | 7692 |
| 282 | Ga0207696_1050064 | 3300025711 | Bacteria | 1197 |
| 283 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 284 | Ga0207655_1000931 | 3300025728 | Bacteria | 30378 |
| 285 | Ga0207655_1001255 | 3300025728 | Bacteria | 24204 |
| 286 | Ga0207655_1008691 | 3300025728 | Bacteria | 6409 |
| 287 | Ga0207655_1016895 | 3300025728 | Bacteria | 3967 |
| 288 | Ga0207655_1017521 | 3300025728 | Bacteria | 3859 |
| 289 | Ga0207655_1041328 | 3300025728 | Bacteria | 1977 |
| 290 | Ga0207655_1042620 | 3300025728 | Bacteria | 1930 |
| 291 | Ga0207655_1048550 | 3300025728 | Bacteria | 1741 |
| 292 | Ga0207655_1075281 | 3300025728 | Bacteria | 1239 |
| 293 | Ga0207713_1000030 | 3300025735 | Bacteria | 284027 |
| 294 | Ga0207713_1000681 | 3300025735 | Bacteria | 31842 |
| 295 | Ga0207713_1002600 | 3300025735 | Bacteria | 13023 |
| 296 | Ga0207713_1005856 | 3300025735 | Bacteria | 7597 |
| 297 | Ga0207713_1016741 | 3300025735 | Bacteria | 3710 |
| 298 | Ga0207713_1042947 | 3300025735 | Bacteria | 1872 |
| 299 | Ga0207713_1094723 | 3300025735 | Bacteria | 1042 |
| 300 | Ga0207713_1161990 | 3300025735 | Bacteria | 712 |
| 301 | Ga0207710_10005160 | 3300025900 | Bacteria | 5644 |
| 302 | Ga0207680_10120450 | 3300025903 | Bacteria | 1715 |
| 303 | Ga0207680_10164995 | 3300025903 | Bacteria | 1488 |
| 304 | Ga0207647_10000138 | 3300025904 | Bacteria | 57656 |
| 305 | Ga0207647_10000213 | 3300025904 | Bacteria | 47297 |
| 306 | Ga0207705_10602960 | 3300025909 | Bacteria | 854 |
| 307 | Ga0207654_10054180 | 3300025911 | Bacteria | 2318 |
| 308 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 309 | Ga0207695_10012596 | 3300025913 | Bacteria | 10135 |
| 310 | Ga0207695_10045432 | 3300025913 | Bacteria | 4662 |
| 311 | Ga0207671_10007188 | 3300025914 | Bacteria | 9702 |
| 312 | Ga0207671_10263165 | 3300025914 | Bacteria | 1358 |
| 313 | Ga0207649_10056626 | 3300025920 | Bacteria | 2449 |
| 314 | Ga0207681_10038369 | 3300025923 | Bacteria | 3173 |
| 315 | Ga0207681_11695935 | 3300025923 | Bacteria | 528 |
| 316 | Ga0207694_10002986 | 3300025924 | Bacteria | 13563 |
| 317 | Ga0207694_10008956 | 3300025924 | Bacteria | 7557 |
| 318 | Ga0207694_10156777 | 3300025924 | Bacteria | 1837 |
| 319 | Ga0207650_10135687 | 3300025925 | Bacteria | 1930 |
| 320 | Ga0207650_10480594 | 3300025925 | Bacteria | 1037 |
| 321 | Ga0207644_10525525 | 3300025931 | Bacteria | 978 |
| 322 | Ga0207706_10013867 | 3300025933 | Bacteria | 7310 |
| 323 | Ga0207706_10030348 | 3300025933 | Bacteria | 4823 |
| 324 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 325 | Ga0207709_10024708 | 3300025935 | Bacteria | 3433 |
| 326 | Ga0207709_10391153 | 3300025935 | Bacteria | 1060 |
| 327 | Ga0207689_10919355 | 3300025942 | Bacteria | 738 |
| 328 | Ga0207679_10425930 | 3300025945 | Bacteria | 1172 |
| 329 | Ga0207667_10079883 | 3300025949 | Bacteria | 3389 |
| 330 | Ga0207712_10000169 | 3300025961 | Bacteria | 67461 |
| 331 | Ga0207712_10298208 | 3300025961 | Bacteria | 1321 |
| 332 | Ga0207668_10207035 | 3300025972 | Bacteria | 1566 |
| 333 | Ga0207668_11464003 | 3300025972 | Bacteria | 616 |
| 334 | Ga0207640_10103641 | 3300025981 | Bacteria | 2001 |
| 335 | Ga0207658_10028023 | 3300025986 | Bacteria | 3963 |
| 336 | Ga0207677_12261678 | 3300026023 | Bacteria | 506 |
| 337 | Ga0207703_10000456 | 3300026035 | Bacteria | 43004 |
| 338 | Ga0207703_10270343 | 3300026035 | Bacteria | 1540 |
| 339 | Ga0207703_10775483 | 3300026035 | Bacteria | 914 |
| 340 | Ga0207639_10011000 | 3300026041 | Bacteria | 6273 |
| 341 | Ga0207639_10425394 | 3300026041 | Bacteria | 1201 |
| 342 | Ga0207678_10006920 | 3300026067 | Bacteria | 10062 |
| 343 | Ga0207702_10011335 | 3300026078 | Bacteria | 7432 |
| 344 | Ga0207641_10265562 | 3300026088 | Bacteria | 1608 |
| 345 | Ga0207648_10172106 | 3300026089 | Bacteria | 1915 |
| 346 | Ga0207648_10954280 | 3300026089 | Bacteria | 802 |
| 347 | Ga0207676_10109058 | 3300026095 | Bacteria | 2312 |
| 348 | Ga0207698_10002097 | 3300026142 | Bacteria | 11768 |
| 349 | Ga0207698_10876073 | 3300026142 | Bacteria | 904 |
| 350 | Ga0209281_1000212 | 3300027111 | Bacteria | 130216 |
| 351 | Ga0209281_1007137 | 3300027111 | Bacteria | 2825 |
| 352 | Ga0209281_1023932 | 3300027111 | Bacteria | 1152 |
| 353 | Ga0209973_1030621 | 3300027252 | Bacteria | 757 |
| 354 | Ga0209371_1000313 | 3300027312 | Bacteria | 53399 |
| 355 | Ga0209981_1012950 | 3300027378 | Bacteria | 1158 |
| 356 | Ga0209981_1054771 | 3300027378 | Bacteria | 607 |
| 357 | Ga0209996_1008657 | 3300027395 | Bacteria | 1335 |
| 358 | Ga0209984_1009616 | 3300027424 | Bacteria | 1232 |
| 359 | Ga0210000_1008657 | 3300027462 | Bacteria | 1493 |
| 360 | Ga0209995_1000628 | 3300027471 | Bacteria | 5440 |
| 361 | Ga0209995_1030165 | 3300027471 | Bacteria | 907 |
| 362 | Ga0209982_1019137 | 3300027552 | Bacteria | 1049 |
| 363 | Ga0209970_1009883 | 3300027614 | Bacteria | 1559 |
| 364 | Ga0209983_1004575 | 3300027665 | Bacteria | 2901 |
| 365 | Ga0209282_1317174 | 3300027666 | Bacteria | 654 |
| 366 | Ga0209971_1000556 | 3300027682 | Bacteria | 9748 |
| 367 | Ga0209974_10001102 | 3300027876 | Bacteria | 9561 |
| 368 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 369 | Ga0268266_10020349 | 3300028379 | Bacteria | 5657 |
| 370 | Ga0268265_10055260 | 3300028380 | Bacteria | 3016 |
| 371 | Ga0265318_10025797 | 3300028577 | Unclassified | 2317 |
| 372 | Ga0265336_10033997 | 3300028666 | Bacteria | 1578 |
| 373 | Ga0307517_10275081 | 3300028786 | Bacteria | 965 |
| 374 | Ga0268256_1000274 | 3300030500 | Bacteria | 53399 |
| 375 | Ga0307511_10218911 | 3300030521 | Bacteria | 959 |
| 376 | Ga0316177_1123371 | 3300030731 | Bacteria | 1193 |
| 377 | Ga0314311_1088196 | 3300030733 | Bacteria | 1503 |
| 378 | Ga0316178_1043989 | 3300030735 | Bacteria | 34199 |
| 379 | Ga0316183_1192322 | 3300030742 | Bacteria | 1390 |
| 380 | Ga0316181_1100804 | 3300030744 | Bacteria | 4760 |
| 381 | Ga0316181_1112713 | 3300030744 | Bacteria | 623 |
| 382 | Ga0265327_10001934 | 3300031251 | Bacteria | 23916 |
| 383 | Ga0265327_10291231 | 3300031251 | Bacteria | 720 |
| 384 | Ga0307408_100000027 | 3300031548 | Bacteria | 261506 |
| 385 | Ga0307408_100000589 | 3300031548 | Bacteria | 31221 |
| 386 | Ga0307408_100001953 | 3300031548 | Bacteria | 14914 |
| 387 | Ga0307408_100013344 | 3300031548 | Bacteria | 5452 |
| 388 | Ga0307408_100031419 | 3300031548 | Bacteria | 3698 |
| 389 | Ga0307408_100062086 | 3300031548 | Bacteria | 2729 |
| 390 | Ga0307408_100170267 | 3300031548 | Bacteria | 1738 |
| 391 | Ga0307508_10344339 | 3300031616 | Bacteria | 1082 |
| 392 | Ga0316575_10007516 | 3300031665 | Bacteria | 3947 |
| 393 | Ga0316575_10007575 | 3300031665 | Bacteria | 3931 |
| 394 | Ga0316575_10033776 | 3300031665 | Bacteria | 2007 |
| 395 | Ga0316575_10048392 | 3300031665 | Bacteria | 1690 |
| 396 | Ga0316575_10056429 | 3300031665 | Bacteria | 1565 |
| 397 | Ga0316575_10157309 | 3300031665 | Bacteria | 939 |
| 398 | Ga0316575_10161584 | 3300031665 | Bacteria | 926 |
| 399 | Ga0316575_10177316 | 3300031665 | Bacteria | 884 |
| 400 | Ga0316575_10309089 | 3300031665 | Bacteria | 669 |
| 401 | Ga0316575_10311654 | 3300031665 | Bacteria | 667 |
| 402 | Ga0316579_10000223 | 3300031691 | Bacteria | 17183 |
| 403 | Ga0316579_10001576 | 3300031691 | Bacteria | 8326 |
| 404 | Ga0316579_10005824 | 3300031691 | Bacteria | 4995 |
| 405 | Ga0316579_10034879 | 3300031691 | Bacteria | 2317 |
| 406 | Ga0316579_10056030 | 3300031691 | Bacteria | 1850 |
| 407 | Ga0316579_10083848 | 3300031691 | Bacteria | 1519 |
| 408 | Ga0316579_10325393 | 3300031691 | Bacteria | 743 |
| 409 | Ga0316579_10409436 | 3300031691 | Bacteria | 656 |
| 410 | Ga0316576_10000256 | 3300031727 | Bacteria | 23138 |
| 411 | Ga0316576_10004776 | 3300031727 | Bacteria | 8184 |
| 412 | Ga0316576_10008248 | 3300031727 | Bacteria | 6627 |
| 413 | Ga0316576_10091160 | 3300031727 | Bacteria | 2271 |
| 414 | Ga0316576_10109874 | 3300031727 | Bacteria | 2066 |
| 415 | Ga0316576_10126436 | 3300031727 | Bacteria | 1921 |
| 416 | Ga0316576_10200402 | 3300031727 | Bacteria | 1504 |
| 417 | Ga0316576_10621227 | 3300031727 | Bacteria | 788 |
| 418 | Ga0316576_10679016 | 3300031727 | Bacteria | 747 |
| 419 | Ga0316576_10995683 | 3300031727 | Bacteria | 597 |
| 420 | Ga0316578_10001774 | 3300031728 | Bacteria | 9054 |
| 421 | Ga0316578_10001869 | 3300031728 | Bacteria | 8868 |
| 422 | Ga0316578_10018677 | 3300031728 | Bacteria | 3804 |
| 423 | Ga0316578_10019620 | 3300031728 | Bacteria | 3725 |
| 424 | Ga0316578_10030826 | 3300031728 | Bacteria | 3051 |
| 425 | Ga0316578_10031007 | 3300031728 | Bacteria | 3043 |
| 426 | Ga0316578_10036775 | 3300031728 | Bacteria | 2819 |
| 427 | Ga0316578_10081938 | 3300031728 | Bacteria | 1920 |
| 428 | Ga0316578_10165026 | 3300031728 | Bacteria | 1335 |
| 429 | Ga0316578_10198962 | 3300031728 | Bacteria | 1206 |
| 430 | Ga0316578_10625271 | 3300031728 | Bacteria | 630 |
| 431 | Ga0316578_10741970 | 3300031728 | Bacteria | 570 |
| 432 | Ga0307516_10235546 | 3300031730 | Bacteria | 1532 |
| 433 | Ga0307405_10000987 | 3300031731 | Bacteria | 11428 |
| 434 | Ga0307405_10015368 | 3300031731 | Bacteria | 4145 |
| 435 | Ga0307405_10487151 | 3300031731 | Bacteria | 985 |
| 436 | Ga0307405_11307771 | 3300031731 | Bacteria | 631 |
| 437 | Ga0316577_10003405 | 3300031733 | Bacteria | 8026 |
| 438 | Ga0316577_10004678 | 3300031733 | Bacteria | 7104 |
| 439 | Ga0316577_10023697 | 3300031733 | Bacteria | 3408 |
| 440 | Ga0316577_10045636 | 3300031733 | Bacteria | 2449 |
| 441 | Ga0316577_10056850 | 3300031733 | Bacteria | 2184 |
| 442 | Ga0316577_10187810 | 3300031733 | Bacteria | 1168 |
| 443 | Ga0316577_10229693 | 3300031733 | Bacteria | 1049 |
| 444 | Ga0316577_10269965 | 3300031733 | Bacteria | 962 |
| 445 | Ga0316577_10307478 | 3300031733 | Bacteria | 898 |
| 446 | Ga0316577_10352462 | 3300031733 | Bacteria | 835 |
| 447 | Ga0307413_10017297 | 3300031824 | Bacteria | 3751 |
| 448 | Ga0307413_10027489 | 3300031824 | Bacteria | 3153 |
| 449 | Ga0307413_10047583 | 3300031824 | Bacteria | 2558 |
| 450 | Ga0307413_11444641 | 3300031824 | Bacteria | 606 |
| 451 | Ga0307406_10029998 | 3300031901 | Bacteria | 3297 |
| 452 | Ga0307406_10059928 | 3300031901 | Bacteria | 2452 |
| 453 | Ga0307406_10169260 | 3300031901 | Bacteria | 1579 |
| 454 | Ga0307407_10006639 | 3300031903 | Bacteria | 5168 |
| 455 | Ga0307407_10180908 | 3300031903 | Bacteria | 1397 |
| 456 | Ga0307407_10411657 | 3300031903 | Bacteria | 972 |
| 457 | Ga0307412_10002583 | 3300031911 | Bacteria | 10061 |
| 458 | Ga0307412_10005916 | 3300031911 | Bacteria | 6892 |
| 459 | Ga0307412_10011186 | 3300031911 | Bacteria | 5193 |
| 460 | Ga0307412_10016826 | 3300031911 | Bacteria | 4366 |
| 461 | Ga0307412_10086424 | 3300031911 | Bacteria | 2182 |
| 462 | Ga0307412_10126896 | 3300031911 | Bacteria | 1846 |
| 463 | Ga0307412_10472862 | 3300031911 | Bacteria | 1037 |
| 464 | Ga0307412_10692898 | 3300031911 | Bacteria | 873 |
| 465 | Ga0307409_100021248 | 3300031995 | Bacteria | 4446 |
| 466 | Ga0307409_100036561 | 3300031995 | Bacteria | 3611 |
| 467 | Ga0307416_100359120 | 3300032002 | Bacteria | 1478 |
| 468 | Ga0307416_100598335 | 3300032002 | Bacteria | 1182 |
| 469 | Ga0307416_101172513 | 3300032002 | Bacteria | 873 |
| 470 | Ga0307414_10214662 | 3300032004 | Bacteria | 1575 |
| 471 | Ga0307414_10258328 | 3300032004 | Bacteria | 1452 |
| 472 | Ga0307414_10450681 | 3300032004 | Bacteria | 1128 |
| 473 | Ga0307414_10691644 | 3300032004 | Bacteria | 922 |
| 474 | Ga0307411_10021479 | 3300032005 | Bacteria | 3778 |
| 475 | Ga0307411_10087930 | 3300032005 | Bacteria | 2159 |
| 476 | Ga0307411_11000380 | 3300032005 | Bacteria | 748 |
| 477 | Ga0316583_10002609 | 3300032133 | Bacteria | 6288 |
| 478 | Ga0316583_10006405 | 3300032133 | Bacteria | 4227 |
| 479 | Ga0316583_10010185 | 3300032133 | Bacteria | 3388 |
| 480 | Ga0316583_10014224 | 3300032133 | Bacteria | 2870 |
| 481 | Ga0316583_10017999 | 3300032133 | Bacteria | 2537 |
| 482 | Ga0316583_10031085 | 3300032133 | Bacteria | 1901 |
| 483 | Ga0316583_10038675 | 3300032133 | Bacteria | 1691 |
| 484 | Ga0316583_10111001 | 3300032133 | Bacteria | 956 |
| 485 | Ga0316583_10127391 | 3300032133 | Bacteria | 887 |
| 486 | Ga0316583_10144965 | 3300032133 | Bacteria | 827 |
| 487 | Ga0316585_10000045 | 3300032137 | Bacteria | 19293 |
| 488 | Ga0316585_10002386 | 3300032137 | Bacteria | 5062 |
| 489 | Ga0316585_10048247 | 3300032137 | Bacteria | 1364 |
| 490 | Ga0316585_10061278 | 3300032137 | Bacteria | 1216 |
| 491 | Ga0316585_10077703 | 3300032137 | Bacteria | 1080 |
| 492 | Ga0316585_10081381 | 3300032137 | Bacteria | 1055 |
| 493 | Ga0316585_10135362 | 3300032137 | Bacteria | 812 |
| 494 | Ga0316580_10000052 | 3300032139 | Bacteria | 18421 |
| 495 | Ga0316580_10009698 | 3300032139 | Bacteria | 2898 |
| 496 | Ga0316580_10015636 | 3300032139 | Bacteria | 2323 |
| 497 | Ga0316580_10021674 | 3300032139 | Bacteria | 1981 |
| 498 | Ga0316580_10030832 | 3300032139 | Bacteria | 1660 |
| 499 | Ga0316580_10042211 | 3300032139 | Bacteria | 1408 |
| 500 | Ga0316593_10001775 | 3300032168 | Bacteria | 4906 |
| 501 | Ga0316593_10005353 | 3300032168 | Bacteria | 3376 |
| 502 | Ga0316593_10005989 | 3300032168 | Bacteria | 3253 |
| 503 | Ga0316593_10014207 | 3300032168 | Bacteria | 2370 |
| 504 | Ga0316593_10019300 | 3300032168 | Bacteria | 2106 |
| 505 | Ga0316593_10043709 | 3300032168 | Bacteria | 1497 |
| 506 | Ga0316593_10052695 | 3300032168 | Bacteria | 1378 |
| 507 | Ga0316593_10057095 | 3300032168 | Bacteria | 1329 |
| 508 | Ga0316593_10098566 | 3300032168 | Bacteria | 1035 |
| 509 | Ga0316593_10221303 | 3300032168 | Bacteria | 703 |
| 510 | Ga0316593_10235307 | 3300032168 | Bacteria | 683 |
| 511 | Ga0316593_10325346 | 3300032168 | Bacteria | 585 |
| 512 | Ga0316593_10453548 | 3300032168 | Bacteria | 501 |
| 513 | Ga0307510_10030497 | 3300033180 | Bacteria | 6112 |
| 514 | Ga0307510_10222045 | 3300033180 | Bacteria | 1400 |
| 515 | Ga0316592_1000443 | 3300033524 | Bacteria | 5660 |
| 516 | Ga0316592_1004880 | 3300033524 | Bacteria | 2521 |
| 517 | Ga0316592_1024767 | 3300033524 | Bacteria | 1291 |
| 518 | Ga0316592_1045492 | 3300033524 | Bacteria | 977 |
| 519 | Ga0316592_1048157 | 3300033524 | Bacteria | 950 |
| 520 | Ga0316592_1083052 | 3300033524 | Bacteria | 729 |
| 521 | Ga0316586_1014253 | 3300033527 | Bacteria | 1254 |
| 522 | Ga0316586_1015204 | 3300033527 | Bacteria | 1223 |
| 523 | Ga0316586_1022983 | 3300033527 | Bacteria | 1039 |
| 524 | Ga0316588_1000220 | 3300033528 | Bacteria | 6791 |
| 525 | Ga0316588_1003976 | 3300033528 | Bacteria | 2752 |
| 526 | Ga0316588_1037124 | 3300033528 | Unclassified | 1158 |
| 527 | Ga0316588_1068369 | 3300033528 | Bacteria | 871 |
| 528 | Ga0316587_1011069 | 3300033529 | Bacteria | 1452 |
| 529 | Ga0316587_1026358 | 3300033529 | Bacteria | 1013 |
| 530 | Ga0316587_1033696 | 3300033529 | Bacteria | 911 |
| 531 | Ga0316587_1062296 | 3300033529 | Bacteria | 692 |
| 532 | Ga0316587_1084725 | 3300033529 | Bacteria | 601 |
| 533 | Ga0316587_1103648 | 3300033529 | Bacteria | 549 |
| 534 | Ga0316587_1120717 | 3300033529 | Bacteria | 513 |
| 535 | Ga0316596_1000105 | 3300033541 | Bacteria | 10649 |
| 536 | Ga0316596_1000300 | 3300033541 | Bacteria | 7857 |
| 537 | Ga0316596_1001890 | 3300033541 | Bacteria | 4377 |
| 538 | Ga0316596_1012130 | 3300033541 | Bacteria | 2115 |
| 539 | Ga0316596_1028091 | 3300033541 | Bacteria | 1453 |
| 540 | Ga0316596_1033052 | 3300033541 | Bacteria | 1347 |
| 541 | Ga0316596_1041381 | 3300033541 | Bacteria | 1211 |
| 542 | Ga0316596_1057151 | 3300033541 | Bacteria | 1038 |
| 543 | Ga0316596_1066524 | 3300033541 | Unclassified | 963 |
| 544 | Ga0316596_1128083 | 3300033541 | Bacteria | 692 |
| 545 | Ga0316596_1150878 | 3300033541 | Bacteria | 638 |
| 546 | Ga0316596_1167215 | 3300033541 | Bacteria | 606 |
| 547 | Ga0373952_0022981 | 3300035092 | Bacteria | 1329 |
| 548 | Ga0316574_0000424 | 3300035398 | Bacteria | 16777 |
| 549 | Ga0316574_0000873 | 3300035398 | Bacteria | 13313 |
| 550 | Ga0316574_0043902 | 3300035398 | Bacteria | 2764 |
| 551 | Ga0316574_0044101 | 3300035398 | Bacteria | 2758 |
| 552 | Ga0316574_0099207 | 3300035398 | Bacteria | 1863 |
| 553 | Ga0316574_0103789 | 3300035398 | Unclassified | 1820 |
| 554 | Ga0316574_0108525 | 3300035398 | Bacteria | 1778 |
| 555 | Ga0316574_0120938 | 3300035398 | Bacteria | 1681 |
| 556 | Ga0316574_0127486 | 3300035398 | Bacteria | 1636 |
| 557 | Ga0316574_0196511 | 3300035398 | Bacteria | 1296 |
| 558 | Ga0316574_0224345 | 3300035398 | Bacteria | 1203 |
| 559 | Ga0316574_0266190 | 3300035398 | Bacteria | 1094 |
| 560 | Ga0316574_0603818 | 3300035398 | Bacteria | 678 |
| 561 | Ga0316582_0000425 | 3300036647 | Bacteria | 15480 |
| 562 | Ga0316582_0001793 | 3300036647 | Bacteria | 9690 |
| 563 | Ga0316582_0002571 | 3300036647 | Bacteria | 8595 |
| 564 | Ga0316582_0003576 | 3300036647 | Bacteria | 7655 |
| 565 | Ga0316582_0011418 | 3300036647 | Bacteria | 4908 |
| 566 | Ga0316582_0013421 | 3300036647 | Bacteria | 4609 |
| 567 | Ga0316582_0036684 | 3300036647 | Bacteria | 3035 |
| 568 | Ga0316582_0049568 | 3300036647 | Bacteria | 2657 |
| 569 | Ga0316582_0093722 | 3300036647 | Bacteria | 1980 |
| 570 | Ga0316582_0102391 | 3300036647 | Bacteria | 1898 |
| 571 | Ga0316582_0129702 | 3300036647 | Bacteria | 1692 |
| 572 | Ga0316582_0129933 | 3300036647 | Bacteria | 1691 |
| 573 | Ga0316582_0180370 | 3300036647 | Bacteria | 1436 |
| 574 | Ga0316582_0383187 | 3300036647 | Bacteria | 968 |
| 575 | Ga0316582_0536386 | 3300036647 | Bacteria | 806 |
| 576 | Ga0316582_1131147 | 3300036647 | Bacteria | 533 |
| 577 | Ga0316584_0008126 | 3300036712 | Bacteria | 7209 |
| 578 | Ga0316584_0012158 | 3300036712 | Bacteria | 6066 |
| 579 | Ga0316584_0016520 | 3300036712 | Bacteria | 5291 |
| 580 | Ga0316584_0016711 | 3300036712 | Bacteria | 5264 |
| 581 | Ga0316584_0026225 | 3300036712 | Bacteria | 4282 |
| 582 | Ga0316584_0057024 | 3300036712 | Bacteria | 2924 |
| 583 | Ga0316584_0086613 | 3300036712 | Bacteria | 2344 |
| 584 | Ga0316584_0091924 | 3300036712 | Bacteria | 2272 |
| 585 | Ga0316584_0094276 | 3300036712 | Bacteria | 2241 |
| 586 | Ga0316584_0145361 | 3300036712 | Bacteria | 1767 |
| 587 | Ga0316584_0156930 | 3300036712 | Bacteria | 1692 |
| 588 | Ga0316584_0166434 | 3300036712 | Bacteria | 1637 |
| 589 | Ga0316584_0173059 | 3300036712 | Bacteria | 1600 |
| 590 | Ga0316584_0179359 | 3300036712 | Bacteria | 1568 |
| 591 | Ga0316584_0207034 | 3300036712 | Bacteria | 1445 |
| 592 | Ga0316584_0218127 | 3300036712 | Unclassified | 1402 |
| 593 | Ga0316584_0270367 | 3300036712 | Bacteria | 1237 |
| 594 | Ga0316584_0296105 | 3300036712 | Unclassified | 1173 |
| 595 | Ga0316584_0335995 | 3300036712 | Bacteria | 1087 |
| 596 | Ga0316584_0425955 | 3300036712 | Bacteria | 942 |
| 597 | Ga0316581_0006139 | 3300037588 | Bacteria | 3167 |
| 598 | Ga0316581_0013331 | 3300037588 | Bacteria | 2329 |
| 599 | Ga0316581_0018212 | 3300037588 | Bacteria | 2038 |
| 600 | Ga0316581_0019321 | 3300037588 | Bacteria | 1986 |
| 601 | Ga0316581_0081932 | 3300037588 | Bacteria | 993 |
| 602 | Ga0237819_00720 | 3300038705 | Bacteria | 10688 |
| 603 | Ga0237819_10282 | 3300038705 | Bacteria | 1226 |
| 604 | Ga0400484_03261 | 3300038725 | Bacteria | 37196 |
| 605 | Ga0400484_22124 | 3300038725 | Bacteria | 6385 |
| 606 | Ga0400484_24524 | 3300038725 | Bacteria | 4866 |
| 607 | Ga0400484_24604 | 3300038725 | Bacteria | 3964 |
| 608 | Ga0400484_34217 | 3300038725 | Bacteria | 35210 |
| 609 | Ga0400490_16939 | 3300038726 | Bacteria | 2507 |
| 610 | Ga0400490_18637 | 3300038726 | Unclassified | 4056 |
| 611 | Ga0400490_20091 | 3300038726 | Bacteria | 9857 |
| 612 | Ga0400490_25156 | 3300038726 | Bacteria | 18125 |
| 613 | Ga0400490_33872 | 3300038726 | Bacteria | 1033 |
| 614 | Ga0400490_45662 | 3300038726 | Bacteria | 38225 |
| 615 | Ga0400490_61215 | 3300038726 | Bacteria | 13269 |
| 616 | Ga0400491_11104 | 3300038727 | Bacteria | 8310 |
| 617 | Ga0400491_23332 | 3300038727 | Bacteria | 5868 |
| 618 | Ga0400485_02898 | 3300038735 | Bacteria | 20319 |
| 619 | Ga0400485_07793 | 3300038735 | Bacteria | 20957 |
| 620 | Ga0400488_03303 | 3300038741 | Bacteria | 6108 |
| 621 | Ga0400488_10662 | 3300038741 | Bacteria | 1300 |
| 622 | Ga0400488_17680 | 3300038741 | Bacteria | 1507 |
| 623 | Ga0400488_18679 | 3300038741 | Bacteria | 1580 |
| 624 | Ga0400488_29451 | 3300038741 | Bacteria | 9666 |
| 625 | Ga0400488_29660 | 3300038741 | Bacteria | 7958 |
| 626 | Ga0400488_33104 | 3300038741 | Bacteria | 1070 |
| 627 | Ga0400488_38090 | 3300038741 | Bacteria | 2844 |
| 628 | Ga0400488_51689 | 3300038741 | Bacteria | 6393 |
| 629 | Ga0400488_54154 | 3300038741 | Bacteria | 1829 |
| 630 | Ga0400488_57680 | 3300038741 | Bacteria | 6245 |
| 631 | Ga0400486_06140 | 3300038742 | Bacteria | 135791 |
| 632 | Ga0400486_08788 | 3300038742 | Unclassified | 1684 |
| 633 | Ga0400486_30182 | 3300038742 | Bacteria | 34714 |
| 634 | Ga0400483_005162 | 3300039062 | Unclassified | 4126 |
| 635 | Ga0400483_048826 | 3300039062 | Bacteria | 15631 |
| 636 | Ga0400483_056532 | 3300039062 | Bacteria | 2762 |
| 637 | Ga0400483_058543 | 3300039062 | Bacteria | 10440 |
| 638 | Ga0400483_061103 | 3300039062 | Unclassified | 1322 |
| 639 | Ga0400483_062240 | 3300039062 | Bacteria | 6194 |
| 640 | Ga0400483_067063 | 3300039062 | Bacteria | 31217 |
| 641 | Ga0400483_069725 | 3300039062 | Bacteria | 2637 |
| 642 | Ga0400483_072164 | 3300039062 | Bacteria | 20984 |
| 643 | Ga0400483_084581 | 3300039062 | Bacteria | 5267 |
| 644 | Ga0400483_108539 | 3300039062 | Bacteria | 1336 |
| 645 | Ga0400483_134009 | 3300039062 | Bacteria | 204879 |
| 646 | Ga0400483_145061 | 3300039062 | Bacteria | 1581 |
| 647 | Ga0400483_164358 | 3300039062 | Bacteria | 22122 |
| 648 | Ga0400483_179717 | 3300039062 | Bacteria | 2619 |
| 649 | Ga0400483_193304 | 3300039062 | Bacteria | 5965 |
| 650 | Ga0400483_196484 | 3300039062 | Bacteria | 11326 |
| 651 | Ga0400483_203162 | 3300039062 | Unclassified | 2257 |
| 652 | Ga0400483_240978 | 3300039062 | Bacteria | 1421 |
| 653 | Ga0400483_252208 | 3300039062 | Bacteria | 2966 |
| 654 | Ga0400483_269943 | 3300039062 | Bacteria | 1902 |
| 655 | Ga0400483_277286 | 3300039062 | Bacteria | 16720 |
| 656 | Ga0400483_279635 | 3300039062 | Bacteria | 14003 |
| 657 | Ga0400489_18813 | 3300039093 | Bacteria | 1789 |
| 658 | Ga0400487_00528 | 3300039110 | Bacteria | 3240 |
| 659 | Ga0400487_01707 | 3300039110 | Bacteria | 12213 |
| 660 | Ga0400487_10993 | 3300039110 | Bacteria | 7450 |
| 661 | Ga0400487_12856 | 3300039110 | Unclassified | 1796 |
| 662 | Ga0400487_24791 | 3300039110 | Bacteria | 81428 |
| 663 | Ga0400487_26365 | 3300039110 | Bacteria | 2958 |
| 664 | Ga0400487_27362 | 3300039110 | Bacteria | 16177 |
| 665 | Ga0400487_28448 | 3300039110 | Bacteria | 3531 |
| 666 | Ga0400487_47735 | 3300039110 | Bacteria | 59107 |
| 667 | Ga0439436_0000529 | 3300041404 | Bacteria | 10021 |
| 668 | Ga0439436_0030612 | 3300041404 | Bacteria | 1563 |
| 669 | Ga0439438_003655 | 3300041405 | Bacteria | 6144 |
| 670 | Ga0439438_003712 | 3300041405 | Bacteria | 6070 |
| 671 | Ga0439438_003849 | 3300041405 | Bacteria | 5921 |
| 672 | Ga0439438_004132 | 3300041405 | Bacteria | 5668 |
| 673 | Ga0439438_004546 | 3300041405 | Bacteria | 5289 |
| 674 | Ga0439438_009436 | 3300041405 | Bacteria | 3158 |
| 675 | Ga0439438_016363 | 3300041405 | Bacteria | 2157 |
| 676 | Ga0439447_002115 | 3300041407 | Bacteria | 7299 |
| 677 | Ga0439447_002684 | 3300041407 | Bacteria | 6443 |
| 678 | Ga0439447_003500 | 3300041407 | Bacteria | 5572 |
| 679 | Ga0439447_004605 | 3300041407 | Bacteria | 4703 |
| 680 | Ga0439447_005034 | 3300041407 | Bacteria | 4448 |
| 681 | Ga0439447_019764 | 3300041407 | Bacteria | 1792 |
| 682 | Ga0439447_020417 | 3300041407 | Bacteria | 1757 |
| 683 | Ga0439447_075981 | 3300041407 | Bacteria | 777 |
| 684 | Ga0439453_0069226 | 3300041408 | Bacteria | 744 |
| 685 | Ga0439461_0014356 | 3300041410 | Bacteria | 1506 |
| 686 | Ga0439466_0003608 | 3300041411 | Bacteria | 5979 |
| 687 | Ga0439466_0003822 | 3300041411 | Bacteria | 5814 |
| 688 | Ga0439466_0004509 | 3300041411 | Bacteria | 5353 |
| 689 | Ga0439466_0004750 | 3300041411 | Bacteria | 5218 |
| 690 | Ga0439466_0005809 | 3300041411 | Bacteria | 4701 |
| 691 | Ga0439466_0006690 | 3300041411 | Bacteria | 4374 |
| 692 | Ga0439466_0013327 | 3300041411 | Bacteria | 3010 |
| 693 | Ga0439466_0018538 | 3300041411 | Bacteria | 2495 |
| 694 | Ga0439466_0023453 | 3300041411 | Bacteria | 2170 |
| 695 | Ga0439466_0031287 | 3300041411 | Bacteria | 1821 |
| 696 | Ga0439465_0003421 | 3300041413 | Bacteria | 5176 |
| 697 | Ga0439465_0003829 | 3300041413 | Bacteria | 4909 |
| 698 | Ga0451793_0038927 | 3300041452 | Bacteria | 1553 |
| 699 | Ga0451800_1131212 | 3300041459 | Bacteria | 1133 |
| 700 | Ga0451806_159937 | 3300041462 | Bacteria | 1575 |
| 701 | Ga0451804_0897249 | 3300041463 | Bacteria | 647 |
| 702 | Ga0451807_0544911 | 3300041486 | Bacteria | 1064 |
| 703 | Ga0451833_1047701 | 3300041491 | Bacteria | 538 |
| 704 | Ga0451837_1262131 | 3300041494 | Unclassified | 504 |
| 705 | Ga0451839_0080508 | 3300041496 | Bacteria | 741 |
| 706 | Ga0451839_1006830 | 3300041496 | Bacteria | 598 |
| 707 | Ga0451853_0100403 | 3300041512 | Bacteria | 684 |
| 708 | Ga0439437_008674 | 3300042000 | Bacteria | 1145 |
| 709 | Ga0439441_093362 | 3300042001 | Bacteria | 668 |
| 710 | Ga0439445_0064853 | 3300042004 | Bacteria | 1004 |
| 711 | Ga0439432_008802 | 3300042006 | Bacteria | 3531 |
| 712 | Ga0439432_010106 | 3300042006 | Bacteria | 3280 |
| 713 | Ga0439432_010683 | 3300042006 | Bacteria | 3175 |
| 714 | Ga0439432_014095 | 3300042006 | Bacteria | 2708 |
| 715 | Ga0439432_022493 | 3300042006 | Bacteria | 2082 |
| 716 | Ga0439432_174202 | 3300042006 | Bacteria | 627 |
| 717 | Ga0439451_001759 | 3300042009 | Bacteria | 4320 |
| 718 | Ga0439451_002045 | 3300042009 | Bacteria | 4052 |
| 719 | Ga0439451_068680 | 3300042009 | Bacteria | 709 |
| 720 | Ga0439452_000281 | 3300042010 | Bacteria | 33473 |
| 721 | Ga0439452_001961 | 3300042010 | Bacteria | 7875 |
| 722 | Ga0439452_002545 | 3300042010 | Bacteria | 6713 |
| 723 | Ga0439452_003098 | 3300042010 | Bacteria | 5895 |
| 724 | Ga0439452_008330 | 3300042010 | Bacteria | 3128 |
| 725 | Ga0439452_014216 | 3300042010 | Bacteria | 2216 |
| 726 | Ga0439452_014793 | 3300042010 | Bacteria | 2157 |
| 727 | Ga0439452_022476 | 3300042010 | Bacteria | 1631 |
| 728 | Ga0439452_040643 | 3300042010 | Bacteria | 1097 |
| 729 | Ga0439456_001502 | 3300042013 | Bacteria | 4701 |
| 730 | Ga0439456_002365 | 3300042013 | Bacteria | 3803 |
| 731 | Ga0439456_004937 | 3300042013 | Bacteria | 2704 |
| 732 | Ga0439456_005217 | 3300042013 | Bacteria | 2638 |
| 733 | Ga0439456_006370 | 3300042013 | Bacteria | 2408 |
| 734 | Ga0439456_030949 | 3300042013 | Bacteria | 1145 |
| 735 | Ga0439463_001607 | 3300042016 | Bacteria | 5950 |
| 736 | Ga0439463_031117 | 3300042016 | Bacteria | 1346 |
| 737 | Ga0439463_103281 | 3300042016 | Bacteria | 735 |
| 738 | Ga0450911_000007 | 3300042115 | Bacteria | 212322 |
| 739 | Ga0450911_001914 | 3300042115 | Bacteria | 4371 |
| 740 | Ga0450911_005729 | 3300042115 | Bacteria | 1902 |
| 741 | Ga0450919_000544 | 3300042121 | Bacteria | 4739 |
| 742 | Ga0450922_007945 | 3300042124 | Bacteria | 998 |
| 743 | Ga0450890_000530 | 3300042127 | Bacteria | 5625 |
| 744 | Ga0450891_023800 | 3300042129 | Bacteria | 612 |
| 745 | Ga0450894_016168 | 3300042131 | Bacteria | 990 |
| 746 | Ga0450902_004861 | 3300042137 | Bacteria | 2011 |
| 747 | Ga0450902_013218 | 3300042137 | Bacteria | 1329 |
| 748 | Ga0450902_016614 | 3300042137 | Bacteria | 1200 |
| 749 | Ga0450903_001531 | 3300042138 | Bacteria | 4308 |
| 750 | Ga0450904_000805 | 3300042139 | Bacteria | 5246 |
| 751 | Ga0450905_003240 | 3300042142 | Bacteria | 2134 |
| 752 | Ga0450907_001033 | 3300042146 | Bacteria | 6517 |
| 753 | Ga0450907_002172 | 3300042146 | Bacteria | 3841 |
| 754 | Ga0450907_031409 | 3300042146 | Bacteria | 903 |
| 755 | Ga0450910_000567 | 3300042147 | Bacteria | 4394 |
| 756 | Ga0439446_0000462 | 3300042156 | Bacteria | 8052 |
| 757 | Ga0439446_0001926 | 3300042156 | Bacteria | 4890 |
| 758 | Ga0439446_0002731 | 3300042156 | Bacteria | 4273 |
| 759 | Ga0439446_0026451 | 3300042156 | Bacteria | 1662 |
| 760 | Ga0439446_0030081 | 3300042156 | Bacteria | 1569 |
| 761 | Ga0450908_010965 | 3300042184 | Bacteria | 1665 |
| 762 | Ga0450909_000392 | 3300042185 | Bacteria | 5578 |
| 763 | Ga0450909_001201 | 3300042185 | Bacteria | 3594 |
| 764 | Ga0439434_0001710 | 3300042435 | Bacteria | 6369 |
| 765 | Ga0439434_0009966 | 3300042435 | Bacteria | 2797 |
| 766 | Ga0439434_0012388 | 3300042435 | Bacteria | 2523 |
| 767 | Ga0439459_0004195 | 3300042438 | Bacteria | 2311 |
| 768 | Ga0439464_0004162 | 3300042439 | Bacteria | 3684 |
| 769 | Ga0439464_0148996 | 3300042439 | Bacteria | 731 |
| 770 | Ga0439460_0002183 | 3300042461 | Bacteria | 4696 |
| 771 | Ga0439460_0010656 | 3300042461 | Bacteria | 2358 |
| 772 | Ga0450916_042978 | 3300042530 | Bacteria | 692 |
| 773 | Ga0450918_007806 | 3300042531 | Bacteria | 1885 |
| 774 | Ga0450893_0010040 | 3300042532 | Bacteria | 1551 |
| 775 | Ga0451577_0000091 | 3300042876 | Bacteria | 201647 |
| 776 | Ga0451577_0048206 | 3300042876 | Bacteria | 3806 |
| 777 | Ga0451577_0212114 | 3300042876 | Bacteria | 1749 |
| 778 | Ga0439440_0005213 | 3300042993 | Bacteria | 2575 |
| 779 | Ga0453684_0000632 | 3300044712 | Bacteria | 127568 |
| 780 | Ga0453684_0003509 | 3300044712 | Bacteria | 35177 |
| 781 | Ga0453684_0322089 | 3300044712 | Bacteria | 1750 |
| 782 | Ga0453684_0335614 | 3300044712 | Bacteria | 1708 |
| 783 | Ga0453684_0780456 | 3300044712 | Bacteria | 1032 |
| 784 | Ga0466957_0101227 | 3300044842 | Bacteria | 1817 |
| 785 | Ga0451576_1266277 | 3300045051 | Bacteria | 769 |
| 786 | Ga0495617_000225 | 3300046452 | Bacteria | 34294 |
| 787 | Ga0495617_000424 | 3300046452 | Bacteria | 22988 |
| 788 | Ga0495617_001533 | 3300046452 | Bacteria | 10035 |
| 789 | Ga0495617_003852 | 3300046452 | Bacteria | 5530 |
| 790 | Ga0495617_019207 | 3300046452 | Bacteria | 2311 |
| 791 | Ga0495617_021058 | 3300046452 | Bacteria | 2203 |
| 792 | Ga0495617_042975 | 3300046452 | Bacteria | 1509 |
| 793 | Ga0495617_057819 | 3300046452 | Bacteria | 1285 |
| 794 | Ga0495627_000423 | 3300046453 | Bacteria | 36816 |
| 795 | Ga0495627_000451 | 3300046453 | Bacteria | 35736 |
| 796 | Ga0495627_000569 | 3300046453 | Bacteria | 29766 |
| 797 | Ga0495627_006643 | 3300046453 | Bacteria | 4511 |
| 798 | Ga0495627_007874 | 3300046453 | Bacteria | 4043 |
| 799 | Ga0495627_017726 | 3300046453 | Bacteria | 2413 |
| 800 | Ga0495592_0133179 | 3300046454 | Bacteria | 1736 |
| 801 | Ga0495603_0053164 | 3300046455 | Bacteria | 2403 |
| 802 | Ga0495603_0111262 | 3300046455 | Bacteria | 1597 |
| 803 | Ga0495603_0126308 | 3300046455 | Bacteria | 1490 |
| 804 | Ga0495590_0007646 | 3300046457 | Bacteria | 4151 |
| 805 | Ga0495590_0019871 | 3300046457 | Bacteria | 2389 |
| 806 | Ga0495590_0038874 | 3300046457 | Bacteria | 1660 |
| 807 | Ga0495590_0091246 | 3300046457 | Bacteria | 1078 |
| 808 | Ga0495591_000822 | 3300046458 | Bacteria | 21997 |
| 809 | Ga0495591_000971 | 3300046458 | Bacteria | 19579 |
| 810 | Ga0495591_001928 | 3300046458 | Bacteria | 12161 |
| 811 | Ga0495591_005086 | 3300046458 | Bacteria | 6175 |
| 812 | Ga0495591_006137 | 3300046458 | Bacteria | 5384 |
| 813 | Ga0495591_006343 | 3300046458 | Bacteria | 5248 |
| 814 | Ga0495591_006460 | 3300046458 | Bacteria | 5182 |
| 815 | Ga0495591_007307 | 3300046458 | Bacteria | 4720 |
| 816 | Ga0495591_009065 | 3300046458 | Bacteria | 3994 |
| 817 | Ga0495591_013233 | 3300046458 | Bacteria | 3031 |
| 818 | Ga0495591_021981 | 3300046458 | Bacteria | 2070 |
| 819 | Ga0495638_0000146 | 3300046460 | Bacteria | 111558 |
| 820 | Ga0495638_0022371 | 3300046460 | Bacteria | 4151 |
| 821 | Ga0495638_0030350 | 3300046460 | Bacteria | 3481 |
| 822 | Ga0495638_0031046 | 3300046460 | Bacteria | 3435 |
| 823 | Ga0495638_0053800 | 3300046460 | Bacteria | 2504 |
| 824 | Ga0495638_0099568 | 3300046460 | Bacteria | 1739 |
| 825 | Ga0495638_0209596 | 3300046460 | Bacteria | 1095 |
| 826 | Ga0495641_0139615 | 3300046461 | Bacteria | 1082 |
| 827 | Ga0495653_0014639 | 3300046463 | Bacteria | 6399 |
| 828 | Ga0495653_0014669 | 3300046463 | Bacteria | 6393 |
| 829 | Ga0495653_0031142 | 3300046463 | Bacteria | 4241 |
| 830 | Ga0495653_0105883 | 3300046463 | Bacteria | 2029 |
| 831 | Ga0495650_0001128 | 3300046471 | Bacteria | 29020 |
| 832 | Ga0495650_0001933 | 3300046471 | Bacteria | 18342 |
| 833 | Ga0495650_0003282 | 3300046471 | Bacteria | 11964 |
| 834 | Ga0495650_0005168 | 3300046471 | Bacteria | 8596 |
| 835 | Ga0495650_0008618 | 3300046471 | Bacteria | 5915 |
| 836 | Ga0495650_0009821 | 3300046471 | Bacteria | 5404 |
| 837 | Ga0495650_0014936 | 3300046471 | Bacteria | 4008 |
| 838 | Ga0495650_0023743 | 3300046471 | Bacteria | 2912 |
| 839 | Ga0495650_0030328 | 3300046471 | Bacteria | 2451 |
| 840 | Ga0495650_0032981 | 3300046471 | Bacteria | 2310 |
| 841 | Ga0495650_0193152 | 3300046471 | Bacteria | 710 |
| 842 | Ga0495605_0000336 | 3300046474 | Bacteria | 46876 |
| 843 | Ga0495605_0000831 | 3300046474 | Bacteria | 21800 |
| 844 | Ga0495605_0000880 | 3300046474 | Bacteria | 20790 |
| 845 | Ga0495605_0000903 | 3300046474 | Bacteria | 20403 |
| 846 | Ga0495605_0001530 | 3300046474 | Bacteria | 15010 |
| 847 | Ga0495605_0005834 | 3300046474 | Bacteria | 7121 |
| 848 | Ga0495605_0006152 | 3300046474 | Bacteria | 6919 |
| 849 | Ga0495605_0010787 | 3300046474 | Bacteria | 5106 |
| 850 | Ga0495605_0010841 | 3300046474 | Bacteria | 5090 |
| 851 | Ga0495605_0011420 | 3300046474 | Bacteria | 4949 |
| 852 | Ga0495605_0017962 | 3300046474 | Bacteria | 3799 |
| 853 | Ga0495605_0049839 | 3300046474 | Bacteria | 2044 |
| 854 | Ga0495605_0097476 | 3300046474 | Bacteria | 1355 |
| 855 | Ga0495605_0152092 | 3300046474 | Bacteria | 1032 |
| 856 | Ga0495605_0229670 | 3300046474 | Bacteria | 799 |
| 857 | Ga0495639_0000158 | 3300046475 | Bacteria | 34960 |
| 858 | Ga0495639_0094586 | 3300046475 | Bacteria | 1405 |
| 859 | Ga0495584_0006126 | 3300046491 | Bacteria | 6323 |
| 860 | Ga0495584_0007034 | 3300046491 | Bacteria | 5877 |
| 861 | Ga0495584_0008147 | 3300046491 | Bacteria | 5443 |
| 862 | Ga0495584_0019573 | 3300046491 | Bacteria | 3438 |
| 863 | Ga0495584_0022709 | 3300046491 | Bacteria | 3182 |
| 864 | Ga0495584_0026072 | 3300046491 | Bacteria | 2962 |
| 865 | Ga0495584_0028197 | 3300046491 | Bacteria | 2844 |
| 866 | Ga0495584_0039576 | 3300046491 | Bacteria | 2382 |
| 867 | Ga0495584_0069598 | 3300046491 | Bacteria | 1768 |
| 868 | Ga0495585_0001234 | 3300046492 | Bacteria | 20628 |
| 869 | Ga0495585_0008120 | 3300046492 | Bacteria | 6378 |
| 870 | Ga0495585_0008710 | 3300046492 | Bacteria | 6133 |
| 871 | Ga0495585_0009359 | 3300046492 | Bacteria | 5879 |
| 872 | Ga0495585_0010239 | 3300046492 | Bacteria | 5595 |
| 873 | Ga0495585_0028763 | 3300046492 | Bacteria | 3167 |
| 874 | Ga0495585_0063726 | 3300046492 | Bacteria | 2022 |
| 875 | Ga0495585_0066197 | 3300046492 | Bacteria | 1978 |
| 876 | Ga0495585_0095118 | 3300046492 | Bacteria | 1600 |
| 877 | Ga0495585_0096440 | 3300046492 | Bacteria | 1586 |
| 878 | Ga0495594_0000612 | 3300046499 | Bacteria | 18385 |
| 879 | Ga0495594_0011583 | 3300046499 | Bacteria | 4585 |
| 880 | Ga0495594_0032442 | 3300046499 | Bacteria | 2835 |
| 881 | Ga0495594_0081468 | 3300046499 | Bacteria | 1807 |
| 882 | Ga0495594_0588995 | 3300046499 | Bacteria | 631 |
| 883 | Ga0495596_0023295 | 3300046500 | Bacteria | 2513 |
| 884 | Ga0495596_0059715 | 3300046500 | Bacteria | 1486 |
| 885 | Ga0495596_0161569 | 3300046500 | Bacteria | 870 |
| 886 | Ga0495607_0000869 | 3300046501 | Bacteria | 28344 |
| 887 | Ga0495607_0001347 | 3300046501 | Bacteria | 21894 |
| 888 | Ga0495607_0001549 | 3300046501 | Bacteria | 20131 |
| 889 | Ga0495607_0001613 | 3300046501 | Bacteria | 19606 |
| 890 | Ga0495607_0001842 | 3300046501 | Bacteria | 18063 |
| 891 | Ga0495607_0002165 | 3300046501 | Bacteria | 16356 |
| 892 | Ga0495607_0006360 | 3300046501 | Bacteria | 8317 |
| 893 | Ga0495607_0007352 | 3300046501 | Bacteria | 7629 |
| 894 | Ga0495607_0009030 | 3300046501 | Bacteria | 6778 |
| 895 | Ga0495607_0012101 | 3300046501 | Bacteria | 5708 |
| 896 | Ga0495607_0038125 | 3300046501 | Bacteria | 2881 |
| 897 | Ga0495607_0050742 | 3300046501 | Bacteria | 2413 |
| 898 | Ga0495607_0081189 | 3300046501 | Bacteria | 1781 |
| 899 | Ga0495607_0094312 | 3300046501 | Bacteria | 1614 |
| 900 | Ga0495607_0110787 | 3300046501 | Bacteria | 1455 |
| 901 | Ga0495607_0113088 | 3300046501 | Bacteria | 1436 |
| 902 | Ga0495607_0125997 | 3300046501 | Bacteria | 1339 |
| 903 | Ga0495607_0163472 | 3300046501 | Bacteria | 1129 |
| 904 | Ga0495607_0178747 | 3300046501 | Bacteria | 1065 |
| 905 | Ga0495607_0290422 | 3300046501 | Bacteria | 773 |
| 906 | Ga0495583_0000521 | 3300046506 | Bacteria | 54646 |
| 907 | Ga0495583_0001354 | 3300046506 | Bacteria | 25389 |
| 908 | Ga0495583_0001828 | 3300046506 | Bacteria | 19872 |
| 909 | Ga0495583_0002363 | 3300046506 | Bacteria | 16292 |
| 910 | Ga0495583_0006262 | 3300046506 | Bacteria | 7826 |
| 911 | Ga0495583_0008207 | 3300046506 | Bacteria | 6414 |
| 912 | Ga0495583_0008548 | 3300046506 | Bacteria | 6242 |
| 913 | Ga0495583_0019607 | 3300046506 | Bacteria | 3526 |
| 914 | Ga0495583_0040105 | 3300046506 | Bacteria | 2202 |
| 915 | Ga0495583_0223962 | 3300046506 | Bacteria | 759 |
| 916 | Ga0495606_0001384 | 3300046507 | Bacteria | 32777 |
| 917 | Ga0495606_0001423 | 3300046507 | Bacteria | 32125 |
| 918 | Ga0495606_0001894 | 3300046507 | Bacteria | 26138 |
| 919 | Ga0495606_0002172 | 3300046507 | Bacteria | 23594 |
| 920 | Ga0495606_0002276 | 3300046507 | Bacteria | 22718 |
| 921 | Ga0495606_0005372 | 3300046507 | Bacteria | 12289 |
| 922 | Ga0495606_0008218 | 3300046507 | Bacteria | 9122 |
| 923 | Ga0495606_0014967 | 3300046507 | Bacteria | 6015 |
| 924 | Ga0495606_0017185 | 3300046507 | Bacteria | 5480 |
| 925 | Ga0495606_0128897 | 3300046507 | Bacteria | 1506 |
| 926 | Ga0495606_0129762 | 3300046507 | Bacteria | 1499 |
| 927 | Ga0495606_0186292 | 3300046507 | Bacteria | 1193 |
| 928 | Ga0495606_0248639 | 3300046507 | Bacteria | 987 |
| 929 | Ga0495606_0358245 | 3300046507 | Bacteria | 772 |
| 930 | Ga0495610_0001026 | 3300046512 | Bacteria | 25659 |
| 931 | Ga0495610_0004516 | 3300046512 | Bacteria | 10245 |
| 932 | Ga0495610_0009001 | 3300046512 | Bacteria | 6375 |
| 933 | Ga0495610_0009088 | 3300046512 | Bacteria | 6330 |
| 934 | Ga0495610_0010838 | 3300046512 | Bacteria | 5628 |
| 935 | Ga0495610_0011192 | 3300046512 | Bacteria | 5502 |
| 936 | Ga0495610_0014996 | 3300046512 | Bacteria | 4523 |
| 937 | Ga0495610_0022797 | 3300046512 | Bacteria | 3415 |
| 938 | Ga0495610_0060516 | 3300046512 | Bacteria | 1802 |
| 939 | Ga0495610_0135586 | 3300046512 | Bacteria | 1064 |
| 940 | Ga0495610_0217429 | 3300046512 | Bacteria | 773 |
| 941 | Ga0495616_0005283 | 3300046513 | Bacteria | 7963 |
| 942 | Ga0495616_0007521 | 3300046513 | Bacteria | 6520 |
| 943 | Ga0495616_0009442 | 3300046513 | Bacteria | 5705 |
| 944 | Ga0495616_0012444 | 3300046513 | Bacteria | 4831 |
| 945 | Ga0495616_0016626 | 3300046513 | Bacteria | 4068 |
| 946 | Ga0495616_0052948 | 3300046513 | Bacteria | 2019 |
| 947 | Ga0495616_0073936 | 3300046513 | Bacteria | 1643 |
| 948 | Ga0495616_0145134 | 3300046513 | Bacteria | 1077 |
| 949 | Ga0495616_0249953 | 3300046513 | Bacteria | 762 |
| 950 | Ga0495616_0388951 | 3300046513 | Bacteria | 575 |
| 951 | Ga0495620_0000878 | 3300046515 | Bacteria | 18545 |
| 952 | Ga0495620_0001742 | 3300046515 | Bacteria | 12840 |
| 953 | Ga0495620_0002259 | 3300046515 | Bacteria | 11147 |
| 954 | Ga0495620_0002585 | 3300046515 | Bacteria | 10471 |
| 955 | Ga0495620_0002844 | 3300046515 | Bacteria | 9940 |
| 956 | Ga0495620_0007056 | 3300046515 | Bacteria | 6128 |
| 957 | Ga0495620_0021421 | 3300046515 | Bacteria | 3139 |
| 958 | Ga0495620_0022999 | 3300046515 | Bacteria | 2989 |
| 959 | Ga0495630_0016649 | 3300046517 | Bacteria | 5376 |
| 960 | Ga0495630_0438011 | 3300046517 | Bacteria | 1001 |
| 961 | Ga0495631_0000478 | 3300046518 | Bacteria | 26772 |
| 962 | Ga0495631_0000774 | 3300046518 | Bacteria | 20562 |
| 963 | Ga0495631_0001335 | 3300046518 | Bacteria | 15074 |
| 964 | Ga0495631_0001760 | 3300046518 | Bacteria | 12847 |
| 965 | Ga0495631_0005026 | 3300046518 | Bacteria | 6963 |
| 966 | Ga0495631_0015739 | 3300046518 | Bacteria | 3616 |
| 967 | Ga0495631_0034124 | 3300046518 | Bacteria | 2282 |
| 968 | Ga0495631_0050780 | 3300046518 | Bacteria | 1813 |
| 969 | Ga0495631_0217353 | 3300046518 | Bacteria | 816 |
| 970 | Ga0495632_0001147 | 3300046519 | Bacteria | 22609 |
| 971 | Ga0495632_0002357 | 3300046519 | Bacteria | 14464 |
| 972 | Ga0495632_0003511 | 3300046519 | Bacteria | 11090 |
| 973 | Ga0495632_0007235 | 3300046519 | Bacteria | 7005 |
| 974 | Ga0495632_0008307 | 3300046519 | Bacteria | 6392 |
| 975 | Ga0495632_0008784 | 3300046519 | Bacteria | 6155 |
| 976 | Ga0495632_0009540 | 3300046519 | Bacteria | 5838 |
| 977 | Ga0495632_0011026 | 3300046519 | Bacteria | 5296 |
| 978 | Ga0495632_0011532 | 3300046519 | Bacteria | 5151 |
| 979 | Ga0495632_0040650 | 3300046519 | Bacteria | 2340 |
| 980 | Ga0495632_0099337 | 3300046519 | Bacteria | 1373 |
| 981 | Ga0495637_0003252 | 3300046520 | Bacteria | 8655 |
| 982 | Ga0495637_0006397 | 3300046520 | Bacteria | 5916 |
| 983 | Ga0495637_0006846 | 3300046520 | Bacteria | 5697 |
| 984 | Ga0495637_0007301 | 3300046520 | Bacteria | 5493 |
| 985 | Ga0495637_0007578 | 3300046520 | Bacteria | 5370 |
| 986 | Ga0495637_0010254 | 3300046520 | Bacteria | 4537 |
| 987 | Ga0495637_0011839 | 3300046520 | Bacteria | 4179 |
| 988 | Ga0495637_0013088 | 3300046520 | Bacteria | 3947 |
| 989 | Ga0495637_0018886 | 3300046520 | Bacteria | 3193 |
| 990 | Ga0495637_0020192 | 3300046520 | Bacteria | 3068 |
| 991 | Ga0495637_0035066 | 3300046520 | Bacteria | 2193 |
| 992 | Ga0495637_0050801 | 3300046520 | Bacteria | 1738 |
| 993 | Ga0495637_0148696 | 3300046520 | Bacteria | 885 |
| 994 | Ga0495643_0000421 | 3300046522 | Bacteria | 55394 |
| 995 | Ga0495643_0004499 | 3300046522 | Bacteria | 9717 |
| 996 | Ga0495643_0009458 | 3300046522 | Bacteria | 6057 |
| 997 | Ga0495643_0036989 | 3300046522 | Bacteria | 2679 |
| 998 | Ga0495643_0052582 | 3300046522 | Bacteria | 2186 |
| 999 | Ga0495643_0074771 | 3300046522 | Bacteria | 1773 |
| 1000 | Ga0495643_0119586 | 3300046522 | Bacteria | 1332 |
| 1001 | Ga0495644_0015663 | 3300046523 | Bacteria | 2906 |
| 1002 | Ga0495644_0058964 | 3300046523 | Bacteria | 1443 |
| 1003 | Ga0495644_0098017 | 3300046523 | Bacteria | 1108 |
| 1004 | Ga0495648_0004823 | 3300046524 | Bacteria | 11380 |
| 1005 | Ga0495648_0005023 | 3300046524 | Bacteria | 11117 |
| 1006 | Ga0495648_0011986 | 3300046524 | Bacteria | 6497 |
| 1007 | Ga0495648_0013468 | 3300046524 | Bacteria | 6043 |
| 1008 | Ga0495648_0014011 | 3300046524 | Bacteria | 5897 |
| 1009 | Ga0495648_0017468 | 3300046524 | Bacteria | 5125 |
| 1010 | Ga0495648_0023252 | 3300046524 | Bacteria | 4249 |
| 1011 | Ga0495648_0023803 | 3300046524 | Bacteria | 4184 |
| 1012 | Ga0495648_0038246 | 3300046524 | Bacteria | 3071 |
| 1013 | Ga0495648_0039520 | 3300046524 | Bacteria | 3002 |
| 1014 | Ga0495648_0041480 | 3300046524 | Bacteria | 2905 |
| 1015 | Ga0495648_0069769 | 3300046524 | Bacteria | 2044 |
| 1016 | Ga0495648_0077013 | 3300046524 | Bacteria | 1913 |
| 1017 | Ga0495666_0012928 | 3300046526 | Bacteria | 4160 |
| 1018 | Ga0495666_0026972 | 3300046526 | Bacteria | 2827 |
| 1019 | Ga0495666_0096513 | 3300046526 | Bacteria | 1393 |
| 1020 | Ga0495642_0003041 | 3300046528 | Bacteria | 6680 |
| 1021 | Ga0495642_0004114 | 3300046528 | Bacteria | 5674 |
| 1022 | Ga0495652_0291527 | 3300046529 | Bacteria | 1190 |
| 1023 | Ga0495654_0000672 | 3300046530 | Bacteria | 26959 |
| 1024 | Ga0495654_0000875 | 3300046530 | Bacteria | 22618 |
| 1025 | Ga0495654_0006669 | 3300046530 | Bacteria | 6535 |
| 1026 | Ga0495654_0006958 | 3300046530 | Bacteria | 6373 |
| 1027 | Ga0495654_0007483 | 3300046530 | Bacteria | 6097 |
| 1028 | Ga0495654_0015065 | 3300046530 | Bacteria | 4109 |
| 1029 | Ga0495654_0019786 | 3300046530 | Bacteria | 3515 |
| 1030 | Ga0495654_0023494 | 3300046530 | Bacteria | 3192 |
| 1031 | Ga0495654_0040871 | 3300046530 | Bacteria | 2308 |
| 1032 | Ga0495654_0043771 | 3300046530 | Bacteria | 2217 |
| 1033 | Ga0495654_0157262 | 3300046530 | Bacteria | 1000 |
| 1034 | Ga0495654_0249085 | 3300046530 | Bacteria | 740 |
| 1035 | Ga0495587_0018557 | 3300046536 | Bacteria | 4313 |
| 1036 | Ga0495587_0175391 | 3300046536 | Bacteria | 1217 |
| 1037 | Ga0495587_0366128 | 3300046536 | Bacteria | 802 |
| 1038 | Ga0495609_0000011 | 3300046538 | Bacteria | 334377 |
| 1039 | Ga0495609_0000349 | 3300046538 | Bacteria | 40285 |
| 1040 | Ga0495609_0000784 | 3300046538 | Bacteria | 23757 |
| 1041 | Ga0495609_0005802 | 3300046538 | Bacteria | 6409 |
| 1042 | Ga0495609_0008532 | 3300046538 | Bacteria | 5014 |
| 1043 | Ga0495609_0009845 | 3300046538 | Bacteria | 4608 |
| 1044 | Ga0495609_0011414 | 3300046538 | Bacteria | 4231 |
| 1045 | Ga0495609_0117644 | 3300046538 | Bacteria | 1144 |
| 1046 | Ga0495597_0000221 | 3300046542 | Bacteria | 52360 |
| 1047 | Ga0495597_0007884 | 3300046542 | Bacteria | 5369 |
| 1048 | Ga0495597_0008152 | 3300046542 | Bacteria | 5268 |
| 1049 | Ga0495597_0050003 | 3300046542 | Bacteria | 1846 |
| 1050 | Ga0495597_0142939 | 3300046542 | Bacteria | 986 |
| 1051 | Ga0495597_0285027 | 3300046542 | Bacteria | 643 |
| 1052 | Ga0495645_0139290 | 3300046543 | Bacteria | 1694 |
| 1053 | Ga0495622_0004041 | 3300046557 | Bacteria | 6846 |
| 1054 | Ga0495622_0004514 | 3300046557 | Bacteria | 6442 |
| 1055 | Ga0495622_0004608 | 3300046557 | Bacteria | 6385 |
| 1056 | Ga0495622_0009876 | 3300046557 | Bacteria | 4414 |
| 1057 | Ga0495622_0015519 | 3300046557 | Bacteria | 3541 |
| 1058 | Ga0495633_0000287 | 3300046558 | Bacteria | 58020 |
| 1059 | Ga0495633_0024742 | 3300046558 | Bacteria | 2963 |
| 1060 | Ga0495656_0062158 | 3300046615 | Bacteria | 1632 |
| 1061 | Ga0495668_0004341 | 3300046616 | Bacteria | 10134 |
| 1062 | Ga0495668_0033511 | 3300046616 | Bacteria | 2885 |
| 1063 | Ga0495668_0035932 | 3300046616 | Bacteria | 2777 |
| 1064 | Ga0495668_0066635 | 3300046616 | Bacteria | 1981 |
| 1065 | Ga0495668_0119052 | 3300046616 | Bacteria | 1444 |
| 1066 | Ga0495668_0282987 | 3300046616 | Bacteria | 908 |
| 1067 | Ga0495634_0012371 | 3300046642 | Bacteria | 6179 |
| 1068 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 1069 | Ga0495611_0000674 | 3300046648 | Bacteria | 19453 |
| 1070 | Ga0495611_0000679 | 3300046648 | Bacteria | 19413 |
| 1071 | Ga0495611_0001919 | 3300046648 | Bacteria | 9881 |
| 1072 | Ga0495611_0005044 | 3300046648 | Bacteria | 5659 |
| 1073 | Ga0495611_0010711 | 3300046648 | Bacteria | 3882 |
| 1074 | Ga0495611_0013643 | 3300046648 | Bacteria | 3461 |
| 1075 | Ga0495611_0061830 | 3300046648 | Bacteria | 1702 |
| 1076 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 1077 | Ga0495625_0000187 | 3300046660 | Bacteria | 97797 |
| 1078 | Ga0495625_0001286 | 3300046660 | Bacteria | 31495 |
| 1079 | Ga0495625_0014956 | 3300046660 | Bacteria | 6166 |
| 1080 | Ga0495625_0018168 | 3300046660 | Bacteria | 5496 |
| 1081 | Ga0495625_0031785 | 3300046660 | Bacteria | 3923 |
| 1082 | Ga0495625_0050696 | 3300046660 | Bacteria | 2977 |
| 1083 | Ga0495625_0075383 | 3300046660 | Bacteria | 2360 |
| 1084 | Ga0495625_0115313 | 3300046660 | Bacteria | 1833 |
| 1085 | Ga0495625_0289041 | 3300046660 | Bacteria | 1052 |
| 1086 | Ga0495635_0011871 | 3300046663 | Bacteria | 6105 |
| 1087 | Ga0495635_0564495 | 3300046663 | Bacteria | 745 |
| 1088 | Ga0495659_0002188 | 3300046664 | Bacteria | 6375 |
| 1089 | Ga0495659_0005793 | 3300046664 | Bacteria | 3898 |
| 1090 | Ga0495659_0215745 | 3300046664 | Bacteria | 791 |
| 1091 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 1092 | Ga0495661_0000477 | 3300046665 | Bacteria | 42410 |
| 1093 | Ga0495661_0000596 | 3300046665 | Bacteria | 37123 |
| 1094 | Ga0495661_0001003 | 3300046665 | Bacteria | 25378 |
| 1095 | Ga0495661_0004293 | 3300046665 | Bacteria | 10344 |
| 1096 | Ga0495661_0006585 | 3300046665 | Bacteria | 8158 |
| 1097 | Ga0495661_0021576 | 3300046665 | Bacteria | 4197 |
| 1098 | Ga0495661_0078677 | 3300046665 | Bacteria | 1907 |
| 1099 | Ga0495661_0100984 | 3300046665 | Bacteria | 1623 |
| 1100 | Ga0495661_0339396 | 3300046665 | Bacteria | 742 |
| 1101 | Ga0495588_0027874 | 3300046674 | Bacteria | 2824 |
| 1102 | Ga0495599_0870536 | 3300046678 | Bacteria | 512 |
| 1103 | Ga0495623_0011027 | 3300046679 | Bacteria | 5847 |
| 1104 | Ga0495646_0091142 | 3300046680 | Bacteria | 1759 |
| 1105 | Ga0495658_0656894 | 3300046683 | Bacteria | 672 |
| 1106 | Ga0495669_0018630 | 3300046684 | Bacteria | 2986 |
| 1107 | Ga0495613_0028299 | 3300046689 | Bacteria | 4167 |
| 1108 | Ga0495613_0107369 | 3300046689 | Bacteria | 2014 |
| 1109 | Ga0495613_0111379 | 3300046689 | Bacteria | 1972 |
| 1110 | Ga0495624_0010386 | 3300046690 | Bacteria | 6418 |
| 1111 | Ga0495670_0004101 | 3300046691 | Bacteria | 7149 |
| 1112 | Ga0495670_0005209 | 3300046691 | Bacteria | 6400 |
| 1113 | Ga0495670_0005708 | 3300046691 | Bacteria | 6104 |
| 1114 | Ga0495670_0005850 | 3300046691 | Bacteria | 6026 |
| 1115 | Ga0495670_0014500 | 3300046691 | Bacteria | 3873 |
| 1116 | Ga0495670_0029246 | 3300046691 | Bacteria | 2734 |
| 1117 | Ga0495670_0060659 | 3300046691 | Bacteria | 1900 |
| 1118 | Ga0495670_0229965 | 3300046691 | Bacteria | 986 |
| 1119 | Ga0495670_0241272 | 3300046691 | Bacteria | 962 |
| 1120 | Ga0495670_0474541 | 3300046691 | Bacteria | 678 |
| 1121 | Ga0495671_0000512 | 3300046692 | Bacteria | 29774 |
| 1122 | Ga0495671_0000650 | 3300046692 | Bacteria | 25274 |
| 1123 | Ga0495671_0001180 | 3300046692 | Bacteria | 17885 |
| 1124 | Ga0495671_0002553 | 3300046692 | Bacteria | 11447 |
| 1125 | Ga0495671_0007066 | 3300046692 | Bacteria | 6428 |
| 1126 | Ga0495671_0013002 | 3300046692 | Bacteria | 4527 |
| 1127 | Ga0495671_0039219 | 3300046692 | Bacteria | 2392 |
| 1128 | Ga0495671_0057617 | 3300046692 | Bacteria | 1922 |
| 1129 | Ga0495671_0065688 | 3300046692 | Bacteria | 1785 |
| 1130 | Ga0495671_0074970 | 3300046692 | Bacteria | 1659 |
| 1131 | Ga0495671_0404403 | 3300046692 | Bacteria | 653 |
| 1132 | Ga0495649_0003758 | 3300046694 | Bacteria | 10081 |
| 1133 | Ga0495649_0006713 | 3300046694 | Bacteria | 7134 |
| 1134 | Ga0495649_0007221 | 3300046694 | Bacteria | 6811 |
| 1135 | Ga0495649_0007939 | 3300046694 | Bacteria | 6419 |
| 1136 | Ga0495649_0016821 | 3300046694 | Bacteria | 4140 |
| 1137 | Ga0495649_0022992 | 3300046694 | Bacteria | 3483 |
| 1138 | Ga0495649_0027233 | 3300046694 | Bacteria | 3172 |
| 1139 | Ga0495649_0045228 | 3300046694 | Bacteria | 2401 |
| 1140 | Ga0495649_0081859 | 3300046694 | Bacteria | 1725 |
| 1141 | Ga0495589_0000236 | 3300046794 | Bacteria | 46053 |
| 1142 | Ga0495589_0005797 | 3300046794 | Bacteria | 6514 |
| 1143 | Ga0495589_0006835 | 3300046794 | Bacteria | 6001 |
| 1144 | Ga0495589_0009516 | 3300046794 | Bacteria | 5050 |
| 1145 | Ga0495589_0018838 | 3300046794 | Bacteria | 3539 |
| 1146 | Ga0495589_0041537 | 3300046794 | Bacteria | 2294 |
| 1147 | Ga0495589_0043186 | 3300046794 | Bacteria | 2244 |
| 1148 | Ga0495600_0060865 | 3300046809 | Bacteria | 2465 |
| 1149 | Ga0495600_0423426 | 3300046809 | Bacteria | 826 |
| 1150 | Ga0495660_0000888 | 3300046810 | Bacteria | 22116 |
| 1151 | Ga0495660_0001210 | 3300046810 | Bacteria | 18055 |
| 1152 | Ga0495660_0001273 | 3300046810 | Bacteria | 17539 |
| 1153 | Ga0495660_0001456 | 3300046810 | Bacteria | 16179 |
| 1154 | Ga0495660_0001754 | 3300046810 | Bacteria | 14453 |
| 1155 | Ga0495660_0004981 | 3300046810 | Bacteria | 7994 |
| 1156 | Ga0495660_0014627 | 3300046810 | Bacteria | 4538 |
| 1157 | Ga0495660_0015804 | 3300046810 | Bacteria | 4357 |
| 1158 | Ga0495660_0020626 | 3300046810 | Bacteria | 3778 |
| 1159 | Ga0495660_0023983 | 3300046810 | Bacteria | 3477 |
| 1160 | Ga0495660_0031294 | 3300046810 | Bacteria | 2992 |
| 1161 | Ga0495660_0052001 | 3300046810 | Bacteria | 2227 |
| 1162 | Ga0495660_0124149 | 3300046810 | Bacteria | 1302 |
| 1163 | Ga0495660_0158845 | 3300046810 | Bacteria | 1110 |
| 1164 | Ga0495660_0195623 | 3300046810 | Bacteria | 968 |
| 1165 | Ga0495581_0100939 | 3300047315 | Bacteria | 1676 |
| 1166 | Ga0495604_0014492 | 3300047317 | Bacteria | 6287 |
| 1167 | Ga0495604_0081315 | 3300047317 | Bacteria | 2425 |
| 1168 | Ga0495674_0022886 | 3300047319 | Bacteria | 5758 |
| 1169 | Ga0495672_0001999 | 3300047320 | Bacteria | 19270 |
| 1170 | Ga0495672_0010991 | 3300047320 | Bacteria | 6414 |
| 1171 | Ga0495672_0011802 | 3300047320 | Bacteria | 6137 |
| 1172 | Ga0495672_0015180 | 3300047320 | Bacteria | 5241 |
| 1173 | Ga0495672_0022913 | 3300047320 | Bacteria | 4051 |
| 1174 | Ga0495672_0031266 | 3300047320 | Bacteria | 3325 |
| 1175 | Ga0495672_0050816 | 3300047320 | Bacteria | 2444 |
| 1176 | Ga0495672_0215969 | 3300047320 | Bacteria | 949 |
| 1177 | Ga0495676_0000508 | 3300047321 | Bacteria | 31862 |
| 1178 | Ga0495676_0088878 | 3300047321 | Bacteria | 2315 |
| 1179 | Ga0495676_0462796 | 3300047321 | Bacteria | 836 |
| 1180 | Ga0495680_0016282 | 3300047322 | Bacteria | 6394 |
| 1181 | Ga0495680_0020798 | 3300047322 | Bacteria | 5509 |
| 1182 | Ga0495680_0022963 | 3300047322 | Bacteria | 5192 |
| 1183 | Ga0495683_0000053 | 3300047323 | Bacteria | 121769 |
| 1184 | Ga0495683_0000216 | 3300047323 | Bacteria | 54311 |
| 1185 | Ga0495683_0000279 | 3300047323 | Bacteria | 44138 |
| 1186 | Ga0495683_0001237 | 3300047323 | Bacteria | 17374 |
| 1187 | Ga0495683_0016482 | 3300047323 | Bacteria | 3837 |
| 1188 | Ga0495683_0019039 | 3300047323 | Bacteria | 3543 |
| 1189 | Ga0495683_0022999 | 3300047323 | Bacteria | 3203 |
| 1190 | Ga0495683_0023793 | 3300047323 | Bacteria | 3147 |
| 1191 | Ga0495683_0101430 | 3300047323 | Bacteria | 1383 |
| 1192 | Ga0495687_000698 | 3300047443 | Bacteria | 37661 |
| 1193 | Ga0495687_008412 | 3300047443 | Bacteria | 5909 |
| 1194 | Ga0495677_0004418 | 3300047445 | Bacteria | 5399 |
| 1195 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 1196 | Ga0495679_000075 | 3300047446 | Bacteria | 95844 |
| 1197 | Ga0495679_002285 | 3300047446 | Bacteria | 9890 |
| 1198 | Ga0495679_007665 | 3300047446 | Bacteria | 4476 |
| 1199 | Ga0495679_012854 | 3300047446 | Bacteria | 3168 |
| 1200 | Ga0495679_015325 | 3300047446 | Bacteria | 2806 |
| 1201 | Ga0495679_066151 | 3300047446 | Bacteria | 1050 |
| 1202 | Ga0495685_009223 | 3300047447 | Bacteria | 3291 |
| 1203 | Ga0495685_060550 | 3300047447 | Bacteria | 1276 |
| 1204 | Ga0495673_0000202 | 3300047469 | Bacteria | 90523 |
| 1205 | Ga0495673_0000670 | 3300047469 | Bacteria | 33730 |
| 1206 | Ga0495673_0000938 | 3300047469 | Bacteria | 26443 |
| 1207 | Ga0495673_0001468 | 3300047469 | Bacteria | 18689 |
| 1208 | Ga0495673_0001495 | 3300047469 | Bacteria | 18488 |
| 1209 | Ga0495673_0002985 | 3300047469 | Bacteria | 11401 |
| 1210 | Ga0495673_0006031 | 3300047469 | Bacteria | 7199 |
| 1211 | Ga0495673_0006159 | 3300047469 | Bacteria | 7104 |
| 1212 | Ga0495673_0006807 | 3300047469 | Bacteria | 6676 |
| 1213 | Ga0495673_0007204 | 3300047469 | Bacteria | 6428 |
| 1214 | Ga0495673_0007237 | 3300047469 | Bacteria | 6413 |
| 1215 | Ga0495673_0009407 | 3300047469 | Bacteria | 5409 |
| 1216 | Ga0495673_0085181 | 3300047469 | Bacteria | 1301 |
| 1217 | Ga0495673_0110247 | 3300047469 | Bacteria | 1101 |
| 1218 | Ga0495673_0117471 | 3300047469 | Bacteria | 1056 |
| 1219 | Ga0495673_0140076 | 3300047469 | Bacteria | 943 |
| 1220 | Ga0495673_0154008 | 3300047469 | Bacteria | 886 |
| 1221 | Ga0495673_0174084 | 3300047469 | Bacteria | 818 |
| 1222 | Ga0495673_0198969 | 3300047469 | Bacteria | 750 |
| 1223 | Ga0495681_0000588 | 3300047470 | Bacteria | 27772 |
| 1224 | Ga0495681_0005805 | 3300047470 | Bacteria | 8201 |
| 1225 | Ga0495681_0012384 | 3300047470 | Bacteria | 5015 |
| 1226 | Ga0495681_0016233 | 3300047470 | Bacteria | 4185 |
| 1227 | Ga0495681_0024804 | 3300047470 | Bacteria | 3147 |
| 1228 | Ga0495681_0025435 | 3300047470 | Bacteria | 3097 |
| 1229 | Ga0495681_0098844 | 3300047470 | Bacteria | 1278 |
| 1230 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 1231 | Ga0495686_0002215 | 3300047472 | Bacteria | 18870 |
| 1232 | Ga0495686_0011962 | 3300047472 | Bacteria | 6098 |
| 1233 | Ga0495686_0097455 | 3300047472 | Bacteria | 1778 |
| 1234 | Ga0495686_0125614 | 3300047472 | Bacteria | 1525 |
| 1235 | Ga0495686_0142964 | 3300047472 | Bacteria | 1410 |
| 1236 | Ga0495686_0168419 | 3300047472 | Bacteria | 1275 |
| 1237 | Ga0495686_0359417 | 3300047472 | Bacteria | 790 |
| 1238 | Ga0495593_0017034 | 3300047673 | Bacteria | 4090 |
| 1239 | Ga0495593_0041728 | 3300047673 | Bacteria | 2465 |
| 1240 | Ga0495602_0089939 | 3300048088 | Bacteria | 2551 |
| 1241 | Ga0495626_0000250 | 3300048091 | Bacteria | 62295 |
| 1242 | Ga0495626_0002158 | 3300048091 | Bacteria | 14181 |
| 1243 | Ga0495626_0007151 | 3300048091 | Bacteria | 6241 |
| 1244 | Ga0495626_0007269 | 3300048091 | Bacteria | 6177 |
| 1245 | Ga0495626_0010027 | 3300048091 | Bacteria | 5082 |
| 1246 | Ga0495626_0030432 | 3300048091 | Bacteria | 2603 |
| 1247 | Ga0496102_0017499 | 3300048905 | Bacteria | 6277 |
| 1248 | Ga0496102_0117760 | 3300048905 | Bacteria | 2479 |
| 1249 | Ga0496103_0008923 | 3300048906 | Bacteria | 5944 |
| 1250 | Ga0496103_0253436 | 3300048906 | Bacteria | 1133 |
| 1251 | Ga0496106_0037962 | 3300048909 | Bacteria | 3604 |
| 1252 | Ga0496107_0162336 | 3300048910 | Bacteria | 1656 |
| 1253 | Ga0496110_0090019 | 3300048913 | Bacteria | 2743 |
| 1254 | Ga0496110_0162260 | 3300048913 | Bacteria | 2026 |
| 1255 | Ga0496110_0254903 | 3300048913 | Bacteria | 1597 |
| 1256 | Ga0496111_0913089 | 3300048914 | Bacteria | 632 |
| 1257 | Ga0496112_0057022 | 3300048915 | Bacteria | 3845 |
| 1258 | Ga0496112_0177019 | 3300048915 | Bacteria | 2098 |
| 1259 | Ga0496116_0001102 | 3300048919 | Bacteria | 32408 |
| 1260 | Ga0496116_0013194 | 3300048919 | Bacteria | 6683 |
| 1261 | Ga0496116_0034340 | 3300048919 | Bacteria | 3580 |
| 1262 | Ga0496116_0065312 | 3300048919 | Bacteria | 2335 |
| 1263 | Ga0496116_0071479 | 3300048919 | Bacteria | 2197 |
| 1264 | Ga0496116_0098826 | 3300048919 | Bacteria | 1750 |
| 1265 | Ga0496117_0021272 | 3300048920 | Bacteria | 5255 |
| 1266 | Ga0496117_0027159 | 3300048920 | Bacteria | 4466 |
| 1267 | Ga0496117_0058529 | 3300048920 | Bacteria | 2668 |
| 1268 | Ga0496117_0072139 | 3300048920 | Bacteria | 2310 |
| 1269 | Ga0496117_0091291 | 3300048920 | Bacteria | 1960 |
| 1270 | Ga0496117_0156079 | 3300048920 | Bacteria | 1343 |
| 1271 | Ga0496118_0001453 | 3300048921 | Bacteria | 35692 |
| 1272 | Ga0496118_0006791 | 3300048921 | Bacteria | 12429 |
| 1273 | Ga0496118_0021458 | 3300048921 | Bacteria | 5682 |
| 1274 | Ga0496118_0032911 | 3300048921 | Bacteria | 4261 |
| 1275 | Ga0496118_0048363 | 3300048921 | Bacteria | 3286 |
| 1276 | Ga0496118_0062394 | 3300048921 | Bacteria | 2752 |
| 1277 | Ga0496118_0088186 | 3300048921 | Bacteria | 2147 |
| 1278 | Ga0496118_0102212 | 3300048921 | Bacteria | 1932 |
| 1279 | Ga0496118_0182075 | 3300048921 | Bacteria | 1268 |
| 1280 | Ga0496119_0060964 | 3300048922 | Bacteria | 2255 |
| 1281 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 1282 | Ga0496121_0002035 | 3300048924 | Bacteria | 31995 |
| 1283 | Ga0496121_0003471 | 3300048924 | Bacteria | 22466 |
| 1284 | Ga0496121_0010893 | 3300048924 | Bacteria | 10161 |
| 1285 | Ga0496121_0019796 | 3300048924 | Bacteria | 6706 |
| 1286 | Ga0496121_0040850 | 3300048924 | Bacteria | 4063 |
| 1287 | Ga0496121_0068269 | 3300048924 | Bacteria | 2876 |
| 1288 | Ga0496121_0094767 | 3300048924 | Bacteria | 2321 |
| 1289 | Ga0496121_0141135 | 3300048924 | Bacteria | 1787 |
| 1290 | Ga0496121_0151570 | 3300048924 | Bacteria | 1705 |
| 1291 | Ga0496121_0309715 | 3300048924 | Bacteria | 1068 |
| 1292 | Ga0496122_0006421 | 3300048925 | Bacteria | 13501 |
| 1293 | Ga0496122_0018887 | 3300048925 | Bacteria | 6333 |
| 1294 | Ga0496122_0021949 | 3300048925 | Bacteria | 5691 |
| 1295 | Ga0496122_0038971 | 3300048925 | Bacteria | 3796 |
| 1296 | Ga0496122_0074412 | 3300048925 | Bacteria | 2403 |
| 1297 | Ga0496122_0116839 | 3300048925 | Bacteria | 1733 |
| 1298 | Ga0496123_0005038 | 3300048926 | Bacteria | 13515 |
| 1299 | Ga0496123_0010414 | 3300048926 | Bacteria | 8221 |
| 1300 | Ga0496123_0015208 | 3300048926 | Bacteria | 6328 |
| 1301 | Ga0496123_0065283 | 3300048926 | Bacteria | 2314 |
| 1302 | Ga0496123_0073614 | 3300048926 | Bacteria | 2118 |
| 1303 | Ga0496124_0000382 | 3300048927 | Bacteria | 80986 |
| 1304 | Ga0496124_0010622 | 3300048927 | Bacteria | 9302 |
| 1305 | Ga0496124_0064826 | 3300048927 | Bacteria | 3048 |
| 1306 | Ga0496124_0104705 | 3300048927 | Bacteria | 2287 |
| 1307 | Ga0496124_0198824 | 3300048927 | Bacteria | 1526 |
| 1308 | Ga0496124_0372807 | 3300048927 | Bacteria | 1001 |
| 1309 | Ga0496125_0003559 | 3300048928 | Bacteria | 18765 |
| 1310 | Ga0496125_0037071 | 3300048928 | Bacteria | 4244 |
| 1311 | Ga0496125_0097850 | 3300048928 | Bacteria | 2172 |
| 1312 | Ga0496126_0089264 | 3300048929 | Bacteria | 2713 |
| 1313 | Ga0496126_0126292 | 3300048929 | Bacteria | 2213 |
| 1314 | Ga0496126_0185169 | 3300048929 | Bacteria | 1766 |
| 1315 | Ga0495678_000362 | 3300049459 | Bacteria | 46331 |
| 1316 | Ga0495678_000688 | 3300049459 | Bacteria | 31040 |
| 1317 | Ga0495678_001023 | 3300049459 | Bacteria | 23732 |
| 1318 | Ga0495678_007338 | 3300049459 | Bacteria | 5724 |
| 1319 | Ga0495678_007420 | 3300049459 | Bacteria | 5681 |
| 1320 | Ga0495678_010350 | 3300049459 | Bacteria | 4540 |
| 1321 | Ga0495678_029227 | 3300049459 | Bacteria | 2316 |
| 1322 | Ga0495678_052788 | 3300049459 | Bacteria | 1563 |
| 1323 | Ga0495678_061123 | 3300049459 | Bacteria | 1414 |
| 1324 | Ga0495678_115305 | 3300049459 | Bacteria | 910 |
| 1325 | Ga0495678_213151 | 3300049459 | Bacteria | 589 |
| 1326 | Ga0495682_0000344 | 3300049460 | Bacteria | 34342 |
| 1327 | Ga0495682_0001672 | 3300049460 | Bacteria | 11334 |
| 1328 | Ga0495682_0004097 | 3300049460 | Bacteria | 6332 |
| 1329 | Ga0495682_0008461 | 3300049460 | Bacteria | 4052 |
| 1330 | Ga0495682_0012546 | 3300049460 | Bacteria | 3245 |
| 1331 | Ga0495682_0130514 | 3300049460 | Bacteria | 899 |
| 1332 | Ga0501316_024797 | 3300049532 | Bacteria | 777 |
| 1333 | Ga0501320_061501 | 3300049536 | Bacteria | 529 |
| 1334 | Ga0501323_016353 | 3300049539 | Bacteria | 945 |
| 1335 | Ga0501031_0267062 | 3300049568 | Bacteria | 1111 |
| 1336 | Ga0501032_0004655 | 3300049569 | Bacteria | 10311 |
| 1337 | Ga0501032_0076983 | 3300049569 | Bacteria | 2221 |
| 1338 | Ga0501034_0021013 | 3300049571 | Bacteria | 6663 |
| 1339 | Ga0501034_0097710 | 3300049571 | Bacteria | 2932 |
| 1340 | Ga0501034_0360119 | 3300049571 | Bacteria | 1382 |
| 1341 | Ga0501034_0991496 | 3300049571 | Bacteria | 724 |
| 1342 | Ga0501037_0024665 | 3300049573 | Bacteria | 4446 |
| 1343 | Ga0501038_0010418 | 3300049574 | Bacteria | 8501 |
| 1344 | Ga0501038_0139820 | 3300049574 | Bacteria | 1982 |
| 1345 | Ga0501038_0849692 | 3300049574 | Bacteria | 676 |
| 1346 | Ga0501039_0467428 | 3300049575 | Bacteria | 990 |
| 1347 | Ga0501039_0475462 | 3300049575 | Bacteria | 981 |
| 1348 | Ga0501043_0004238 | 3300049579 | Bacteria | 11692 |
| 1349 | Ga0501198_019209 | 3300049649 | Bacteria | 1075 |
| 1350 | Ga0501227_044139 | 3300049665 | Bacteria | 1109 |
| 1351 | Ga0501259_012650 | 3300049688 | Bacteria | 1410 |
| 1352 | Ga0501079_1277675 | 3300049741 | Bacteria | 578 |
| 1353 | Ga0501080_0000333 | 3300049742 | Bacteria | 36064 |
| 1354 | Ga0501083_0173004 | 3300049744 | Bacteria | 1411 |
| 1355 | Ga0501241_003001 | 3300049758 | Bacteria | 3225 |
| 1356 | Ga0501241_121705 | 3300049758 | Bacteria | 580 |
| 1357 | Ga0501241_158194 | 3300049758 | Bacteria | 526 |
| 1358 | Ga0501269_041519 | 3300049766 | Bacteria | 613 |
| 1359 | Ga0501035_0317279 | 3300049822 | Bacteria | 1310 |
| 1360 | Ga0501204_008163 | 3300049850 | Bacteria | 1190 |
| 1361 | Ga0501226_000022 | 3300049853 | Bacteria | 111874 |
| 1362 | Ga0501226_011206 | 3300049853 | Bacteria | 992 |
| 1363 | nmdc:mga03683_294116_c1 | 3300050489 | Bacteria | 760 |
| 1364 | nmdc:mga08y16_1346074_c1 | 3300050511 | Bacteria | 679 |
| 1365 | Ga0495619_0476001 | 3300053085 | Bacteria | 860 |
| 1366 | Ga0500643_000075 | 3300053087 | Bacteria | 111465 |
| 1367 | Ga0500555_007694 | 3300053103 | Bacteria | 3064 |
| 1368 | Ga0500562_055900 | 3300053108 | Bacteria | 1058 |
| 1369 | Ga0500618_008559 | 3300053125 | Bacteria | 2847 |
| 1370 | Ga0500573_0052705 | 3300053140 | Bacteria | 2338 |
| 1371 | Ga0500586_106454 | 3300053145 | Bacteria | 981 |
| 1372 | Ga0500633_0055414 | 3300053160 | Bacteria | 1380 |
| 1373 | Ga0500645_004544 | 3300053730 | Bacteria | 5294 |
| 1374 | Ga0501084_1042293 | 3300054114 | Bacteria | 687 |
| 1375 | 2595446632 | 2593339238 | Bacteria | 4182970 |
| 1376 | 2595451876 | 2593339239 | Bacteria | 4124669 |
| 1377 | 2599504320 | 2599185188 | Bacteria | 6164180 |
| 1378 | 2599613610 | 2599185212 | Bacteria | 6765997 |
| 1379 | 2599933419 | 2599185300 | Bacteria | 6062622 |
| 1380 | 2599994247 | 2599185311 | Bacteria | 6354990 |
| 1381 | 2600023542 | 2599185316 | Bacteria | 6320029 |
| 1382 | 2600030656 | 2599185317 | Bacteria | 6435722 |
| 1383 | 2600037013 | 2599185318 | Bacteria | 6961590 |
| 1384 | 2600042436 | 2599185319 | Bacteria | 6637840 |
| 1385 | 2600060499 | 2599185322 | Bacteria | 6763055 |
| 1386 | 2600065598 | 2599185323 | Bacteria | 6688755 |
| 1387 | 2600078282 | 2599185325 | Bacteria | 6324919 |
| 1388 | 2600360463 | 2600254930 | Bacteria | 6431253 |
| 1389 | 2671129075 | 2667528176 | Bacteria | 6724917 |
| 1390 | 2721026742 | 2718218334 | Bacteria | 4765486 |
| 1391 | 2735837704 | 2734482264 | Unclassified | 5014763 |
| 1392 | 2738715871 | 2738541276 | Bacteria | 4690596 |
| 1393 | 2739228309 | 2738543009 | Bacteria | 4944499 |
| 1394 | 2747947854 | 2747842428 | Bacteria | 4689383 |
| 1395 | 2765577926 | 2765235840 | Bacteria | 4663337 |
| 1396 | 2794595944 | 2791355520 | Bacteria | 5948615 |
| 1397 | 2842859282 | 2842854478 | Bacteria | 6143501 |
| 1398 | 2842919519 | 2842918807 | Bacteria | 4289178 |
| 1399 | 2884341284 | 2884338543 | Bacteria | 4610696 |
| 1400 | 2894510720 | 2894510363 | Bacteria | 5121143 |
| 1401 | 2895502561 | 2895498888 | Bacteria | 5283788 |
| 1402 | 2895514110 | 2895511927 | Bacteria | 6802080 |
| 1403 | 2895524412 | 2895522137 | Bacteria | 3284416 |
| 1404 | 2895526509 | 2895525241 | Bacteria | 3388457 |
| 1405 | 2919404950 | 2919404418 | Bacteria | 4232372 |
| 1406 | 2919460944 | 2919456309 | Bacteria | 6586567 |
| 1407 | 2923589981 | 2923586266 | Bacteria | 6565975 |
| 1408 | 2931374141 | 2931369376 | Bacteria | 6847892 |
| 1409 | 2941472736 | 2941471342 | Bacteria | 5018624 |
| 1410 | 2953998016 | 2953994433 | Bacteria | 4303959 |
| 1411 | 2989396456 | 2989392574 | Bacteria | 4554005 |
| 1412 | 8056144928 | 8056143049 | Bacteria | 6307666 |
| 1413 | Ga0316583_10311088 | |||
| 1414 | MRS2a_Contig_5007 | |||
| 1415 | SwRhRL2b_contig_1022998 | |||
| 1416 | JGI24736J21556_1004624 | |||
| 1417 | JGI24738J21930_10009582 | |||
| 1418 | JGI25162J39368_1000421 | |||
| 1419 | JGI25163J39215_1000824 | |||
| 1420 | JGI25164J39214_1000296 | |||
| 1421 | JGI25165J46597_1000528 | |||
| 1422 | rootH2_10097578 | |||
| 1423 | rootH1_10005612 | |||
| 1424 | rootH1_10012577 | |||
| 1425 | Ga0006556J51387_1033075 | |||
| 1426 | JGI26143J51219_1004981 | |||
| 1427 | JGI26141J51220_1016087 | |||
| 1428 | Ga0006554J51385_1027885 | |||
| 1429 | Ga0006562J51391_1048358 | |||
| 1430 | Ga0006562J51391_1048362 | |||
| 1431 | Ga0055533_1010054 | |||
| 1432 | Ga0055536_1003265 | |||
| 1433 | Ga0055536_1003284 | |||
| 1434 | Ga0055536_1004864 | |||
| 1435 | Ga0055530_10000240 | |||
| 1436 | Ga0055530_10004397 | |||
| 1437 | Ga0055530_10098522 | |||
| 1438 | Ga0055540_1000248 | |||
| 1439 | Ga0055540_1000400 | |||
| 1440 | Ga0055531_10000202 | |||
| 1441 | Ga0058692_1014349 | |||
| 1442 | Ga0065165_1000028 | |||
| 1443 | Ga0065714_10001261 | |||
| 1444 | Ga0065714_10014757 | |||
| 1445 | Ga0065714_10045372 | |||
| 1446 | Ga0065714_10065886 | |||
| 1447 | Ga0065714_10108272 | |||
| 1448 | Ga0065714_10155290 | |||
| 1449 | Ga0065714_10242649 | |||
| 1450 | Ga0065714_10243775 | |||
| 1451 | Ga0065714_10248355 | |||
| 1452 | Ga0065714_10287751 | |||
| 1453 | Ga0065704_10073559 | |||
| 1454 | Ga0065704_10102828 | |||
| 1455 | Ga0065704_10265871 | |||
| 1456 | Ga0065704_10559405 | |||
| 1457 | Ga0065712_10070056 | |||
| 1458 | Ga0065712_10070345 | |||
| 1459 | Ga0065712_10780774 | |||
| 1460 | Ga0065715_10145621 | |||
| 1461 | Ga0065707_10594074 | |||
| 1462 | Ga0070658_10474529 | |||
| 1463 | Ga0070670_100930253 | |||
| 1464 | Ga0068869_101456361 | |||
| 1465 | Ga0068869_101960737 | |||
| 1466 | Ga0070666_10000349 | |||
| 1467 | Ga0070666_10150881 | |||
| 1468 | Ga0070668_101820305 | |||
| 1469 | Ga0070668_101851519 | |||
| 1470 | Ga0070669_100039354 | |||
| 1471 | Ga0070675_100149452 | |||
| 1472 | Ga0070671_100157336 | |||
| 1473 | Ga0070688_100559647 | |||
| 1474 | Ga0070688_101165752 | |||
| 1475 | Ga0070667_100016114 | |||
| 1476 | Ga0070667_100072821 | |||
| 1477 | Ga0070667_100512035 | |||
| 1478 | Ga0070663_100008843 | |||
| 1479 | Ga0070663_100293636 | |||
| 1480 | Ga0070662_100019740 | |||
| 1481 | Ga0070662_100065544 | |||
| 1482 | Ga0070662_101134688 | |||
| 1483 | Ga0070685_10001203 | |||
| 1484 | Ga0070685_10525559 | |||
| 1485 | Ga0068853_100020239 | |||
| 1486 | Ga0068853_100926660 | |||
| 1487 | Ga0070665_100000227 | |||
| 1488 | Ga0070665_100013903 | |||
| 1489 | Ga0068855_100097646 | |||
| 1490 | Ga0070664_100278872 | |||
| 1491 | Ga0068854_100140780 | |||
| 1492 | Ga0068856_100041168 | |||
| 1493 | Ga0068852_100036098 | |||
| 1494 | Ga0068852_100074224 | |||
| 1495 | Ga0068859_100144280 | |||
| 1496 | Ga0068864_100126077 | |||
| 1497 | Ga0068851_10001367 | |||
| 1498 | Ga0068851_11077851 | |||
| 1499 | Ga0068863_100044744 | |||
| 1500 | Ga0068858_100001997 | |||
| 1501 | Ga0068858_100497266 | |||
| 1502 | Ga0068858_100611821 | |||
| 1503 | Ga0068862_100130407 | |||
| 1504 | Ga0081539_10030214 | |||
| 1505 | Ga0075364_10191846 | |||
| 1506 | Ga0075364_10375983 | |||
| 1507 | Ga0075432_10003878 | |||
| 1508 | Ga0075432_10024222 | |||
| 1509 | Ga0075432_10178464 | |||
| 1510 | Ga0075362_10081878 | |||
| 1511 | Ga0075362_10392788 | |||
| 1512 | Ga0097621_100752189 | |||
| 1513 | Ga0068865_100261987 | |||
| 1514 | Ga0097620_100144276 | |||
| 1515 | Ga0079104_1000094 | |||
| 1516 | Ga0079104_1036778 | |||
| 1517 | Ga0099826_10046334 | |||
| 1518 | Ga0105251_10000971 | |||
| 1519 | Ga0105251_10001972 | |||
| 1520 | Ga0105251_10006692 | |||
| 1521 | Ga0105251_10010185 | |||
| 1522 | Ga0105251_10012451 | |||
| 1523 | Ga0105251_10137214 | |||
| 1524 | Ga0105251_10140971 | |||
| 1525 | Ga0105251_10616837 | |||
| 1526 | Ga0105244_10000709 | |||
| 1527 | Ga0105244_10006626 | |||
| 1528 | Ga0105244_10022875 | |||
| 1529 | Ga0105244_10025486 | |||
| 1530 | Ga0105244_10031405 | |||
| 1531 | Ga0105244_10045633 | |||
| 1532 | Ga0105244_10132648 | |||
| 1533 | Ga0105244_10266429 | |||
| 1534 | Ga0105250_10000074 | |||
| 1535 | Ga0105250_10004551 | |||
| 1536 | Ga0105250_10005278 | |||
| 1537 | Ga0105250_10049137 | |||
| 1538 | Ga0105250_10183685 | |||
| 1539 | Ga0105250_10348350 | |||
| 1540 | Ga0105240_10001318 | |||
| 1541 | Ga0105240_10061849 | |||
| 1542 | Ga0105240_10088811 | |||
| 1543 | Ga0105240_11099354 | |||
| 1544 | Ga0111539_10189307 | |||
| 1545 | Ga0105247_10004675 | |||
| 1546 | Ga0105243_10012583 | |||
| 1547 | Ga0105243_10046356 | |||
| 1548 | Ga0105243_10371643 | |||
| 1549 | Ga0105243_12037693 | |||
| 1550 | Ga0105241_10061839 | |||
| 1551 | Ga0105248_10216798 | |||
| 1552 | Ga0105237_10040609 | |||
| 1553 | Ga0105237_10057998 | |||
| 1554 | Ga0105238_10004916 | |||
| 1555 | Ga0105238_10045807 | |||
| 1556 | Ga0105238_10231755 | |||
| 1557 | Ga0105249_10009268 | |||
| 1558 | Ga0105249_10132334 | |||
| 1559 | Ga0105239_10099795 | |||
| 1560 | Ga0105239_11220384 | |||
| 1561 | Ga0105246_10010995 | |||
| 1562 | Ga0105246_10017718 | |||
| 1563 | Ga0105246_10027429 | |||
| 1564 | Ga0157373_10012012 | |||
| 1565 | Ga0157373_10015562 | |||
| 1566 | Ga0157373_10020104 | |||
| 1567 | Ga0157373_10059677 | |||
| 1568 | Ga0157373_10074417 | |||
| 1569 | Ga0157373_10156997 | |||
| 1570 | Ga0157373_11031773 | |||
| 1571 | Ga0157371_10000406 | |||
| 1572 | Ga0157371_10003900 | |||
| 1573 | Ga0157371_10010020 | |||
| 1574 | Ga0157371_10023347 | |||
| 1575 | Ga0157371_10029405 | |||
| 1576 | Ga0157371_10040966 | |||
| 1577 | Ga0157371_11610423 | |||
| 1578 | Ga0157370_10003491 | |||
| 1579 | Ga0157370_10029572 | |||
| 1580 | Ga0157370_10036318 | |||
| 1581 | Ga0157370_10067761 | |||
| 1582 | Ga0157370_10075420 | |||
| 1583 | Ga0157370_10134067 | |||
| 1584 | Ga0157370_10344341 | |||
| 1585 | Ga0157370_10704253 | |||
| 1586 | Ga0157370_10981641 | |||
| 1587 | Ga0157370_11127406 | |||
| 1588 | Ga0157370_11400089 | |||
| 1589 | Ga0157369_10000329 | |||
| 1590 | Ga0157369_10002062 | |||
| 1591 | Ga0157369_10027825 | |||
| 1592 | Ga0157369_10053199 | |||
| 1593 | Ga0157369_10177919 | |||
| 1594 | Ga0157369_10250742 | |||
| 1595 | Ga0157369_10262866 | |||
| 1596 | Ga0157369_10552434 | |||
| 1597 | Ga0157369_10668929 | |||
| 1598 | Ga0157374_10125969 | |||
| 1599 | Ga0157374_10627022 | |||
| 1600 | Ga0163162_10000030 | |||
| 1601 | Ga0163162_10000495 | |||
| 1602 | Ga0163162_10228419 | |||
| 1603 | Ga0157372_10219520 | |||
| 1604 | Ga0157372_10221324 | |||
| 1605 | Ga0157372_10699434 | |||
| 1606 | Ga0157375_10092090 | |||
| 1607 | Ga0157375_10297193 | |||
| 1608 | Ga0157375_12335801 | |||
| 1609 | Ga0157375_13220435 | |||
| 1610 | Ga0163163_10822619 | |||
| 1611 | Ga0157380_12205699 | |||
| 1612 | Ga0182008_10001710 | |||
| 1613 | Ga0182008_10004847 | |||
| 1614 | Ga0182008_10008849 | |||
| 1615 | Ga0182008_10009722 | |||
| 1616 | Ga0182008_10059579 | |||
| 1617 | Ga0182008_10069783 | |||
| 1618 | Ga0182008_10080762 | |||
| 1619 | Ga0182008_10214491 | |||
| 1620 | Ga0182008_10258777 | |||
| 1621 | Ga0182008_10500014 | |||
| 1622 | Ga0157376_10037597 | |||
| 1623 | Ga0157376_12032455 | |||
| 1624 | Ga0182006_1000072 | |||
| 1625 | Ga0182006_1002699 | |||
| 1626 | Ga0182006_1004981 | |||
| 1627 | Ga0182006_1008086 | |||
| 1628 | Ga0182006_1024729 | |||
| 1629 | Ga0182006_1027559 | |||
| 1630 | Ga0182006_1028287 | |||
| 1631 | Ga0182006_1059317 | |||
| 1632 | Ga0182006_1093958 | |||
| 1633 | Ga0182006_1126189 | |||
| 1634 | Ga0182006_1134623 | |||
| 1635 | Ga0182007_10004029 | |||
| 1636 | Ga0182007_10012807 | |||
| 1637 | Ga0182007_10076641 | |||
| 1638 | Ga0182007_10182043 | |||
| 1639 | Ga0182007_10424713 | |||
| 1640 | Ga0182005_1002599 | |||
| 1641 | Ga0182005_1002728 | |||
| 1642 | Ga0182005_1002754 | |||
| 1643 | Ga0182005_1019229 | |||
| 1644 | Ga0182005_1037481 | |||
| 1645 | Ga0182005_1037547 | |||
| 1646 | Ga0182005_1049663 | |||
| 1647 | Ga0182005_1060913 | |||
| 1648 | Ga0182005_1063406 | |||
| 1649 | Ga0182005_1156521 | |||
| 1650 | Ga0182005_1252454 | |||
| 1651 | Ga0163161_10010440 | |||
| 1652 | Ga0163161_10011813 | |||
| 1653 | Ga0163161_10012486 | |||
| 1654 | Ga0163161_10121726 | |||
| 1655 | Ga0163161_10164095 | |||
| 1656 | Ga0163161_10252315 | |||
| 1657 | Ga0163161_10452259 | |||
| 1658 | Ga0163161_10455393 | |||
| 1659 | Ga0163161_10914732 | |||
| 1660 | Ga0209760_100114 | |||
| 1661 | Ga0209674_100615 | |||
| 1662 | Ga0209563_100338 | |||
| 1663 | Ga0207427_100008 | |||
| 1664 | Ga0209437_100014 | |||
| 1665 | Ga0209437_101456 | |||
| 1666 | Ga0209148_1001787 | |||
| 1667 | Ga0209759_1004233 | |||
| 1668 | Ga0209129_1000785 | |||
| 1669 | Ga0209233_1000008 | |||
| 1670 | Ga0209233_1005903 | |||
| 1671 | Ga0209233_1014439 | |||
| 1672 | Ga0209675_1001650 | |||
| 1673 | Ga0209676_1000010 | |||
| 1674 | Ga0209676_1000037 | |||
| 1675 | Ga0209676_1000345 | |||
| 1676 | Ga0209676_1005862 | |||
| 1677 | Ga0209758_1007611 | |||
| 1678 | Ga0209050_1000081 | |||
| 1679 | Ga0209050_1000227 | |||
| 1680 | Ga0209050_1003874 | |||
| 1681 | Ga0209256_1012211 | |||
| 1682 | Ga0209051_1000104 | |||
| 1683 | Ga0209051_1000164 | |||
| 1684 | Ga0209051_1059822 | |||
| 1685 | Ga0209051_1090576 | |||
| 1686 | Ga0209257_1000040 | |||
| 1687 | Ga0209257_1090914 | |||
| 1688 | Ga0207656_10009507 | |||
| 1689 | Ga0207696_1000045 | |||
| 1690 | Ga0207696_1000097 | |||
| 1691 | Ga0207696_1002467 | |||
| 1692 | Ga0207696_1003140 | |||
| 1693 | Ga0207696_1050064 | |||
| 1694 | Ga0207655_1000005 | |||
| 1695 | Ga0207655_1000931 | |||
| 1696 | Ga0207655_1001255 | |||
| 1697 | Ga0207655_1008691 | |||
| 1698 | Ga0207655_1016895 | |||
| 1699 | Ga0207655_1017521 | |||
| 1700 | Ga0207655_1041328 | |||
| 1701 | Ga0207655_1042620 | |||
| 1702 | Ga0207655_1048550 | |||
| 1703 | Ga0207655_1075281 | |||
| 1704 | Ga0207713_1000030 | |||
| 1705 | Ga0207713_1000681 | |||
| 1706 | Ga0207713_1002600 | |||
| 1707 | Ga0207713_1005856 | |||
| 1708 | Ga0207713_1016741 | |||
| 1709 | Ga0207713_1042947 | |||
| 1710 | Ga0207713_1094723 | |||
| 1711 | Ga0207713_1161990 | |||
| 1712 | Ga0207710_10005160 | |||
| 1713 | Ga0207680_10120450 | |||
| 1714 | Ga0207680_10164995 | |||
| 1715 | Ga0207647_10000138 | |||
| 1716 | Ga0207647_10000213 | |||
| 1717 | Ga0207705_10602960 | |||
| 1718 | Ga0207654_10054180 | |||
| 1719 | Ga0207695_10000007 | |||
| 1720 | Ga0207695_10012596 | |||
| 1721 | Ga0207695_10045432 | |||
| 1722 | Ga0207671_10007188 | |||
| 1723 | Ga0207671_10263165 | |||
| 1724 | Ga0207649_10056626 | |||
| 1725 | Ga0207681_10038369 | |||
| 1726 | Ga0207681_11695935 | |||
| 1727 | Ga0207694_10002986 | |||
| 1728 | Ga0207694_10008956 | |||
| 1729 | Ga0207694_10156777 | |||
| 1730 | Ga0207650_10135687 | |||
| 1731 | Ga0207650_10480594 | |||
| 1732 | Ga0207644_10525525 | |||
| 1733 | Ga0207706_10013867 | |||
| 1734 | Ga0207706_10030348 | |||
| 1735 | Ga0207709_10000035 | |||
| 1736 | Ga0207709_10024708 | |||
| 1737 | Ga0207709_10391153 | |||
| 1738 | Ga0207689_10919355 | |||
| 1739 | Ga0207679_10425930 | |||
| 1740 | Ga0207667_10079883 | |||
| 1741 | Ga0207712_10000169 | |||
| 1742 | Ga0207712_10298208 | |||
| 1743 | Ga0207668_10207035 | |||
| 1744 | Ga0207668_11464003 | |||
| 1745 | Ga0207640_10103641 | |||
| 1746 | Ga0207658_10028023 | |||
| 1747 | Ga0207677_12261678 | |||
| 1748 | Ga0207703_10000456 | |||
| 1749 | Ga0207703_10270343 | |||
| 1750 | Ga0207703_10775483 | |||
| 1751 | Ga0207639_10011000 | |||
| 1752 | Ga0207639_10425394 | |||
| 1753 | Ga0207678_10006920 | |||
| 1754 | Ga0207702_10011335 | |||
| 1755 | Ga0207641_10265562 | |||
| 1756 | Ga0207648_10172106 | |||
| 1757 | Ga0207648_10954280 | |||
| 1758 | Ga0207676_10109058 | |||
| 1759 | Ga0207698_10002097 | |||
| 1760 | Ga0207698_10876073 | |||
| 1761 | Ga0209281_1000212 | |||
| 1762 | Ga0209281_1007137 | |||
| 1763 | Ga0209281_1023932 | |||
| 1764 | Ga0209973_1030621 | |||
| 1765 | Ga0209371_1000313 | |||
| 1766 | Ga0209981_1012950 | |||
| 1767 | Ga0209981_1054771 | |||
| 1768 | Ga0209996_1008657 | |||
| 1769 | Ga0209984_1009616 | |||
| 1770 | Ga0210000_1008657 | |||
| 1771 | Ga0209995_1000628 | |||
| 1772 | Ga0209995_1030165 | |||
| 1773 | Ga0209982_1019137 | |||
| 1774 | Ga0209970_1009883 | |||
| 1775 | Ga0209983_1004575 | |||
| 1776 | Ga0209282_1317174 | |||
| 1777 | Ga0209971_1000556 | |||
| 1778 | Ga0209974_10001102 | |||
| 1779 | Ga0268266_10000006 | |||
| 1780 | Ga0268266_10020349 | |||
| 1781 | Ga0268265_10055260 | |||
| 1782 | Ga0265318_10025797 | |||
| 1783 | Ga0265336_10033997 | |||
| 1784 | Ga0307517_10275081 | |||
| 1785 | Ga0268256_1000274 | |||
| 1786 | Ga0307511_10218911 | |||
| 1787 | Ga0316177_1123371 | |||
| 1788 | Ga0314311_1088196 | |||
| 1789 | Ga0316178_1043989 | |||
| 1790 | Ga0316183_1192322 | |||
| 1791 | Ga0316181_1100804 | |||
| 1792 | Ga0316181_1112713 | |||
| 1793 | Ga0265327_10001934 | |||
| 1794 | Ga0265327_10291231 | |||
| 1795 | Ga0307408_100000027 | |||
| 1796 | Ga0307408_100000589 | |||
| 1797 | Ga0307408_100001953 | |||
| 1798 | Ga0307408_100013344 | |||
| 1799 | Ga0307408_100031419 | |||
| 1800 | Ga0307408_100062086 | |||
| 1801 | Ga0307408_100170267 | |||
| 1802 | Ga0307508_10344339 | |||
| 1803 | Ga0316575_10007516 | |||
| 1804 | Ga0316575_10007575 | |||
| 1805 | Ga0316575_10033776 | |||
| 1806 | Ga0316575_10048392 | |||
| 1807 | Ga0316575_10056429 | |||
| 1808 | Ga0316575_10157309 | |||
| 1809 | Ga0316575_10161584 | |||
| 1810 | Ga0316575_10177316 | |||
| 1811 | Ga0316575_10309089 | |||
| 1812 | Ga0316575_10311654 | |||
| 1813 | Ga0316579_10000223 | |||
| 1814 | Ga0316579_10001576 | |||
| 1815 | Ga0316579_10005824 | |||
| 1816 | Ga0316579_10034879 | |||
| 1817 | Ga0316579_10056030 | |||
| 1818 | Ga0316579_10083848 | |||
| 1819 | Ga0316579_10325393 | |||
| 1820 | Ga0316579_10409436 | |||
| 1821 | Ga0316576_10000256 | |||
| 1822 | Ga0316576_10004776 | |||
| 1823 | Ga0316576_10008248 | |||
| 1824 | Ga0316576_10091160 | |||
| 1825 | Ga0316576_10109874 | |||
| 1826 | Ga0316576_10126436 | |||
| 1827 | Ga0316576_10200402 | |||
| 1828 | Ga0316576_10621227 | |||
| 1829 | Ga0316576_10679016 | |||
| 1830 | Ga0316576_10995683 | |||
| 1831 | Ga0316578_10001774 | |||
| 1832 | Ga0316578_10001869 | |||
| 1833 | Ga0316578_10018677 | |||
| 1834 | Ga0316578_10019620 | |||
| 1835 | Ga0316578_10030826 | |||
| 1836 | Ga0316578_10031007 | |||
| 1837 | Ga0316578_10036775 | |||
| 1838 | Ga0316578_10081938 | |||
| 1839 | Ga0316578_10165026 | |||
| 1840 | Ga0316578_10198962 | |||
| 1841 | Ga0316578_10625271 | |||
| 1842 | Ga0316578_10741970 | |||
| 1843 | Ga0307516_10235546 | |||
| 1844 | Ga0307405_10000987 | |||
| 1845 | Ga0307405_10015368 | |||
| 1846 | Ga0307405_10487151 | |||
| 1847 | Ga0307405_11307771 | |||
| 1848 | Ga0316577_10003405 | |||
| 1849 | Ga0316577_10004678 | |||
| 1850 | Ga0316577_10023697 | |||
| 1851 | Ga0316577_10045636 | |||
| 1852 | Ga0316577_10056850 | |||
| 1853 | Ga0316577_10187810 | |||
| 1854 | Ga0316577_10229693 | |||
| 1855 | Ga0316577_10269965 | |||
| 1856 | Ga0316577_10307478 | |||
| 1857 | Ga0316577_10352462 | |||
| 1858 | Ga0307413_10017297 | |||
| 1859 | Ga0307413_10027489 | |||
| 1860 | Ga0307413_10047583 | |||
| 1861 | Ga0307413_11444641 | |||
| 1862 | Ga0307406_10029998 | |||
| 1863 | Ga0307406_10059928 | |||
| 1864 | Ga0307406_10169260 | |||
| 1865 | Ga0307407_10006639 | |||
| 1866 | Ga0307407_10180908 | |||
| 1867 | Ga0307407_10411657 | |||
| 1868 | Ga0307412_10002583 | |||
| 1869 | Ga0307412_10005916 | |||
| 1870 | Ga0307412_10011186 | |||
| 1871 | Ga0307412_10016826 | |||
| 1872 | Ga0307412_10086424 | |||
| 1873 | Ga0307412_10126896 | |||
| 1874 | Ga0307412_10472862 | |||
| 1875 | Ga0307412_10692898 | |||
| 1876 | Ga0307409_100021248 | |||
| 1877 | Ga0307409_100036561 | |||
| 1878 | Ga0307416_100359120 | |||
| 1879 | Ga0307416_100598335 | |||
| 1880 | Ga0307416_101172513 | |||
| 1881 | Ga0307414_10214662 | |||
| 1882 | Ga0307414_10258328 | |||
| 1883 | Ga0307414_10450681 | |||
| 1884 | Ga0307414_10691644 | |||
| 1885 | Ga0307411_10021479 | |||
| 1886 | Ga0307411_10087930 | |||
| 1887 | Ga0307411_11000380 | |||
| 1888 | Ga0316583_10002609 | |||
| 1889 | Ga0316583_10006405 | |||
| 1890 | Ga0316583_10010185 | |||
| 1891 | Ga0316583_10014224 | |||
| 1892 | Ga0316583_10017999 | |||
| 1893 | Ga0316583_10031085 | |||
| 1894 | Ga0316583_10038675 | |||
| 1895 | Ga0316583_10111001 | |||
| 1896 | Ga0316583_10127391 | |||
| 1897 | Ga0316583_10144965 | |||
| 1898 | Ga0316585_10000045 | |||
| 1899 | Ga0316585_10002386 | |||
| 1900 | Ga0316585_10048247 | |||
| 1901 | Ga0316585_10061278 | |||
| 1902 | Ga0316585_10077703 | |||
| 1903 | Ga0316585_10081381 | |||
| 1904 | Ga0316585_10135362 | |||
| 1905 | Ga0316580_10000052 | |||
| 1906 | Ga0316580_10009698 | |||
| 1907 | Ga0316580_10015636 | |||
| 1908 | Ga0316580_10021674 | |||
| 1909 | Ga0316580_10030832 | |||
| 1910 | Ga0316580_10042211 | |||
| 1911 | Ga0316593_10001775 | |||
| 1912 | Ga0316593_10005353 | |||
| 1913 | Ga0316593_10005989 | |||
| 1914 | Ga0316593_10014207 | |||
| 1915 | Ga0316593_10019300 | |||
| 1916 | Ga0316593_10043709 | |||
| 1917 | Ga0316593_10052695 | |||
| 1918 | Ga0316593_10057095 | |||
| 1919 | Ga0316593_10098566 | |||
| 1920 | Ga0316593_10221303 | |||
| 1921 | Ga0316593_10235307 | |||
| 1922 | Ga0316593_10325346 | |||
| 1923 | Ga0316593_10453548 | |||
| 1924 | Ga0307510_10030497 | |||
| 1925 | Ga0307510_10222045 | |||
| 1926 | Ga0316592_1000443 | |||
| 1927 | Ga0316592_1004880 | |||
| 1928 | Ga0316592_1024767 | |||
| 1929 | Ga0316592_1045492 | |||
| 1930 | Ga0316592_1048157 | |||
| 1931 | Ga0316592_1083052 | |||
| 1932 | Ga0316586_1014253 | |||
| 1933 | Ga0316586_1015204 | |||
| 1934 | Ga0316586_1022983 | |||
| 1935 | Ga0316588_1000220 | |||
| 1936 | Ga0316588_1003976 | |||
| 1937 | Ga0316588_1037124 | |||
| 1938 | Ga0316588_1068369 | |||
| 1939 | Ga0316587_1011069 | |||
| 1940 | Ga0316587_1026358 | |||
| 1941 | Ga0316587_1033696 | |||
| 1942 | Ga0316587_1062296 | |||
| 1943 | Ga0316587_1084725 | |||
| 1944 | Ga0316587_1103648 | |||
| 1945 | Ga0316587_1120717 | |||
| 1946 | Ga0316596_1000105 | |||
| 1947 | Ga0316596_1000300 | |||
| 1948 | Ga0316596_1001890 | |||
| 1949 | Ga0316596_1012130 | |||
| 1950 | Ga0316596_1028091 | |||
| 1951 | Ga0316596_1033052 | |||
| 1952 | Ga0316596_1041381 | |||
| 1953 | Ga0316596_1057151 | |||
| 1954 | Ga0316596_1066524 | |||
| 1955 | Ga0316596_1128083 | |||
| 1956 | Ga0316596_1150878 | |||
| 1957 | Ga0316596_1167215 | |||
| 1958 | Ga0373952_0022981 | |||
| 1959 | Ga0316574_0000424 | |||
| 1960 | Ga0316574_0000873 | |||
| 1961 | Ga0316574_0043902 | |||
| 1962 | Ga0316574_0044101 | |||
| 1963 | Ga0316574_0099207 | |||
| 1964 | Ga0316574_0103789 | |||
| 1965 | Ga0316574_0108525 | |||
| 1966 | Ga0316574_0120938 | |||
| 1967 | Ga0316574_0127486 | |||
| 1968 | Ga0316574_0196511 | |||
| 1969 | Ga0316574_0224345 | |||
| 1970 | Ga0316574_0266190 | |||
| 1971 | Ga0316574_0603818 | |||
| 1972 | Ga0316582_0000425 | |||
| 1973 | Ga0316582_0001793 | |||
| 1974 | Ga0316582_0002571 | |||
| 1975 | Ga0316582_0003576 | |||
| 1976 | Ga0316582_0011418 | |||
| 1977 | Ga0316582_0013421 | |||
| 1978 | Ga0316582_0036684 | |||
| 1979 | Ga0316582_0049568 | |||
| 1980 | Ga0316582_0093722 | |||
| 1981 | Ga0316582_0102391 | |||
| 1982 | Ga0316582_0129702 | |||
| 1983 | Ga0316582_0129933 | |||
| 1984 | Ga0316582_0180370 | |||
| 1985 | Ga0316582_0383187 | |||
| 1986 | Ga0316582_0536386 | |||
| 1987 | Ga0316582_1131147 | |||
| 1988 | Ga0316584_0008126 | |||
| 1989 | Ga0316584_0012158 | |||
| 1990 | Ga0316584_0016520 | |||
| 1991 | Ga0316584_0016711 | |||
| 1992 | Ga0316584_0026225 | |||
| 1993 | Ga0316584_0057024 | |||
| 1994 | Ga0316584_0086613 | |||
| 1995 | Ga0316584_0091924 | |||
| 1996 | Ga0316584_0094276 | |||
| 1997 | Ga0316584_0145361 | |||
| 1998 | Ga0316584_0156930 | |||
| 1999 | Ga0316584_0166434 | |||
| 2000 | Ga0316584_0173059 | |||
| 2001 | Ga0316584_0179359 | |||
| 2002 | Ga0316584_0207034 | |||
| 2003 | Ga0316584_0218127 | |||
| 2004 | Ga0316584_0270367 | |||
| 2005 | Ga0316584_0296105 | |||
| 2006 | Ga0316584_0335995 | |||
| 2007 | Ga0316584_0425955 | |||
| 2008 | Ga0316581_0006139 | |||
| 2009 | Ga0316581_0013331 | |||
| 2010 | Ga0316581_0018212 | |||
| 2011 | Ga0316581_0019321 | |||
| 2012 | Ga0316581_0081932 | |||
| 2013 | Ga0237819_00720 | |||
| 2014 | Ga0237819_10282 | |||
| 2015 | Ga0400484_03261 | |||
| 2016 | Ga0400484_22124 | |||
| 2017 | Ga0400484_24524 | |||
| 2018 | Ga0400484_24604 | |||
| 2019 | Ga0400484_34217 | |||
| 2020 | Ga0400490_16939 | |||
| 2021 | Ga0400490_18637 | |||
| 2022 | Ga0400490_20091 | |||
| 2023 | Ga0400490_25156 | |||
| 2024 | Ga0400490_33872 | |||
| 2025 | Ga0400490_45662 | |||
| 2026 | Ga0400490_61215 | |||
| 2027 | Ga0400491_11104 | |||
| 2028 | Ga0400491_23332 | |||
| 2029 | Ga0400485_02898 | |||
| 2030 | Ga0400485_07793 | |||
| 2031 | Ga0400488_03303 | |||
| 2032 | Ga0400488_10662 | |||
| 2033 | Ga0400488_17680 | |||
| 2034 | Ga0400488_18679 | |||
| 2035 | Ga0400488_29451 | |||
| 2036 | Ga0400488_29660 | |||
| 2037 | Ga0400488_33104 | |||
| 2038 | Ga0400488_38090 | |||
| 2039 | Ga0400488_51689 | |||
| 2040 | Ga0400488_54154 | |||
| 2041 | Ga0400488_57680 | |||
| 2042 | Ga0400486_06140 | |||
| 2043 | Ga0400486_08788 | |||
| 2044 | Ga0400486_30182 | |||
| 2045 | Ga0400483_005162 | |||
| 2046 | Ga0400483_048826 | |||
| 2047 | Ga0400483_056532 | |||
| 2048 | Ga0400483_058543 | |||
| 2049 | Ga0400483_061103 | |||
| 2050 | Ga0400483_062240 | |||
| 2051 | Ga0400483_067063 | |||
| 2052 | Ga0400483_069725 | |||
| 2053 | Ga0400483_072164 | |||
| 2054 | Ga0400483_084581 | |||
| 2055 | Ga0400483_108539 | |||
| 2056 | Ga0400483_134009 | |||
| 2057 | Ga0400483_145061 | |||
| 2058 | Ga0400483_164358 | |||
| 2059 | Ga0400483_179717 | |||
| 2060 | Ga0400483_193304 | |||
| 2061 | Ga0400483_196484 | |||
| 2062 | Ga0400483_203162 | |||
| 2063 | Ga0400483_240978 | |||
| 2064 | Ga0400483_252208 | |||
| 2065 | Ga0400483_269943 | |||
| 2066 | Ga0400483_277286 | |||
| 2067 | Ga0400483_279635 | |||
| 2068 | Ga0400489_18813 | |||
| 2069 | Ga0400487_00528 | |||
| 2070 | Ga0400487_01707 | |||
| 2071 | Ga0400487_10993 | |||
| 2072 | Ga0400487_12856 | |||
| 2073 | Ga0400487_24791 | |||
| 2074 | Ga0400487_26365 | |||
| 2075 | Ga0400487_27362 | |||
| 2076 | Ga0400487_28448 | |||
| 2077 | Ga0400487_47735 | |||
| 2078 | Ga0439436_0000529 | |||
| 2079 | Ga0439436_0030612 | |||
| 2080 | Ga0439438_003655 | |||
| 2081 | Ga0439438_003712 | |||
| 2082 | Ga0439438_003849 | |||
| 2083 | Ga0439438_004132 | |||
| 2084 | Ga0439438_004546 | |||
| 2085 | Ga0439438_009436 | |||
| 2086 | Ga0439438_016363 | |||
| 2087 | Ga0439447_002115 | |||
| 2088 | Ga0439447_002684 | |||
| 2089 | Ga0439447_003500 | |||
| 2090 | Ga0439447_004605 | |||
| 2091 | Ga0439447_005034 | |||
| 2092 | Ga0439447_019764 | |||
| 2093 | Ga0439447_020417 | |||
| 2094 | Ga0439447_075981 | |||
| 2095 | Ga0439453_0069226 | |||
| 2096 | Ga0439461_0014356 | |||
| 2097 | Ga0439466_0003608 | |||
| 2098 | Ga0439466_0003822 | |||
| 2099 | Ga0439466_0004509 | |||
| 2100 | Ga0439466_0004750 | |||
| 2101 | Ga0439466_0005809 | |||
| 2102 | Ga0439466_0006690 | |||
| 2103 | Ga0439466_0013327 | |||
| 2104 | Ga0439466_0018538 | |||
| 2105 | Ga0439466_0023453 | |||
| 2106 | Ga0439466_0031287 | |||
| 2107 | Ga0439465_0003421 | |||
| 2108 | Ga0439465_0003829 | |||
| 2109 | Ga0451793_0038927 | |||
| 2110 | Ga0451800_1131212 | |||
| 2111 | Ga0451806_159937 | |||
| 2112 | Ga0451804_0897249 | |||
| 2113 | Ga0451807_0544911 | |||
| 2114 | Ga0451833_1047701 | |||
| 2115 | Ga0451837_1262131 | |||
| 2116 | Ga0451839_0080508 | |||
| 2117 | Ga0451839_1006830 | |||
| 2118 | Ga0451853_0100403 | |||
| 2119 | Ga0439437_008674 | |||
| 2120 | Ga0439441_093362 | |||
| 2121 | Ga0439445_0064853 | |||
| 2122 | Ga0439432_008802 | |||
| 2123 | Ga0439432_010106 | |||
| 2124 | Ga0439432_010683 | |||
| 2125 | Ga0439432_014095 | |||
| 2126 | Ga0439432_022493 | |||
| 2127 | Ga0439432_174202 | |||
| 2128 | Ga0439451_001759 | |||
| 2129 | Ga0439451_002045 | |||
| 2130 | Ga0439451_068680 | |||
| 2131 | Ga0439452_000281 | |||
| 2132 | Ga0439452_001961 | |||
| 2133 | Ga0439452_002545 | |||
| 2134 | Ga0439452_003098 | |||
| 2135 | Ga0439452_008330 | |||
| 2136 | Ga0439452_014216 | |||
| 2137 | Ga0439452_014793 | |||
| 2138 | Ga0439452_022476 | |||
| 2139 | Ga0439452_040643 | |||
| 2140 | Ga0439456_001502 | |||
| 2141 | Ga0439456_002365 | |||
| 2142 | Ga0439456_004937 | |||
| 2143 | Ga0439456_005217 | |||
| 2144 | Ga0439456_006370 | |||
| 2145 | Ga0439456_030949 | |||
| 2146 | Ga0439463_001607 | |||
| 2147 | Ga0439463_031117 | |||
| 2148 | Ga0439463_103281 | |||
| 2149 | Ga0450911_000007 | |||
| 2150 | Ga0450911_001914 | |||
| 2151 | Ga0450911_005729 | |||
| 2152 | Ga0450919_000544 | |||
| 2153 | Ga0450922_007945 | |||
| 2154 | Ga0450890_000530 | |||
| 2155 | Ga0450891_023800 | |||
| 2156 | Ga0450894_016168 | |||
| 2157 | Ga0450902_004861 | |||
| 2158 | Ga0450902_013218 | |||
| 2159 | Ga0450902_016614 | |||
| 2160 | Ga0450903_001531 | |||
| 2161 | Ga0450904_000805 | |||
| 2162 | Ga0450905_003240 | |||
| 2163 | Ga0450907_001033 | |||
| 2164 | Ga0450907_002172 | |||
| 2165 | Ga0450907_031409 | |||
| 2166 | Ga0450910_000567 | |||
| 2167 | Ga0439446_0000462 | |||
| 2168 | Ga0439446_0001926 | |||
| 2169 | Ga0439446_0002731 | |||
| 2170 | Ga0439446_0026451 | |||
| 2171 | Ga0439446_0030081 | |||
| 2172 | Ga0450908_010965 | |||
| 2173 | Ga0450909_000392 | |||
| 2174 | Ga0450909_001201 | |||
| 2175 | Ga0439434_0001710 | |||
| 2176 | Ga0439434_0009966 | |||
| 2177 | Ga0439434_0012388 | |||
| 2178 | Ga0439459_0004195 | |||
| 2179 | Ga0439464_0004162 | |||
| 2180 | Ga0439464_0148996 | |||
| 2181 | Ga0439460_0002183 | |||
| 2182 | Ga0439460_0010656 | |||
| 2183 | Ga0450916_042978 | |||
| 2184 | Ga0450918_007806 | |||
| 2185 | Ga0450893_0010040 | |||
| 2186 | Ga0451577_0000091 | |||
| 2187 | Ga0451577_0048206 | |||
| 2188 | Ga0451577_0212114 | |||
| 2189 | Ga0439440_0005213 | |||
| 2190 | Ga0453684_0000632 | |||
| 2191 | Ga0453684_0003509 | |||
| 2192 | Ga0453684_0322089 | |||
| 2193 | Ga0453684_0335614 | |||
| 2194 | Ga0453684_0780456 | |||
| 2195 | Ga0466957_0101227 | |||
| 2196 | Ga0451576_1266277 | |||
| 2197 | Ga0495617_000225 | |||
| 2198 | Ga0495617_000424 | |||
| 2199 | Ga0495617_001533 | |||
| 2200 | Ga0495617_003852 | |||
| 2201 | Ga0495617_019207 | |||
| 2202 | Ga0495617_021058 | |||
| 2203 | Ga0495617_042975 | |||
| 2204 | Ga0495617_057819 | |||
| 2205 | Ga0495627_000423 | |||
| 2206 | Ga0495627_000451 | |||
| 2207 | Ga0495627_000569 | |||
| 2208 | Ga0495627_006643 | |||
| 2209 | Ga0495627_007874 | |||
| 2210 | Ga0495627_017726 | |||
| 2211 | Ga0495592_0133179 | |||
| 2212 | Ga0495603_0053164 | |||
| 2213 | Ga0495603_0111262 | |||
| 2214 | Ga0495603_0126308 | |||
| 2215 | Ga0495590_0007646 | |||
| 2216 | Ga0495590_0019871 | |||
| 2217 | Ga0495590_0038874 | |||
| 2218 | Ga0495590_0091246 | |||
| 2219 | Ga0495591_000822 | |||
| 2220 | Ga0495591_000971 | |||
| 2221 | Ga0495591_001928 | |||
| 2222 | Ga0495591_005086 | |||
| 2223 | Ga0495591_006137 | |||
| 2224 | Ga0495591_006343 | |||
| 2225 | Ga0495591_006460 | |||
| 2226 | Ga0495591_007307 | |||
| 2227 | Ga0495591_009065 | |||
| 2228 | Ga0495591_013233 | |||
| 2229 | Ga0495591_021981 | |||
| 2230 | Ga0495638_0000146 | |||
| 2231 | Ga0495638_0022371 | |||
| 2232 | Ga0495638_0030350 | |||
| 2233 | Ga0495638_0031046 | |||
| 2234 | Ga0495638_0053800 | |||
| 2235 | Ga0495638_0099568 | |||
| 2236 | Ga0495638_0209596 | |||
| 2237 | Ga0495641_0139615 | |||
| 2238 | Ga0495653_0014639 | |||
| 2239 | Ga0495653_0014669 | |||
| 2240 | Ga0495653_0031142 | |||
| 2241 | Ga0495653_0105883 | |||
| 2242 | Ga0495650_0001128 | |||
| 2243 | Ga0495650_0001933 | |||
| 2244 | Ga0495650_0003282 | |||
| 2245 | Ga0495650_0005168 | |||
| 2246 | Ga0495650_0008618 | |||
| 2247 | Ga0495650_0009821 | |||
| 2248 | Ga0495650_0014936 | |||
| 2249 | Ga0495650_0023743 | |||
| 2250 | Ga0495650_0030328 | |||
| 2251 | Ga0495650_0032981 | |||
| 2252 | Ga0495650_0193152 | |||
| 2253 | Ga0495605_0000336 | |||
| 2254 | Ga0495605_0000831 | |||
| 2255 | Ga0495605_0000880 | |||
| 2256 | Ga0495605_0000903 | |||
| 2257 | Ga0495605_0001530 | |||
| 2258 | Ga0495605_0005834 | |||
| 2259 | Ga0495605_0006152 | |||
| 2260 | Ga0495605_0010787 | |||
| 2261 | Ga0495605_0010841 | |||
| 2262 | Ga0495605_0011420 | |||
| 2263 | Ga0495605_0017962 | |||
| 2264 | Ga0495605_0049839 | |||
| 2265 | Ga0495605_0097476 | |||
| 2266 | Ga0495605_0152092 | |||
| 2267 | Ga0495605_0229670 | |||
| 2268 | Ga0495639_0000158 | |||
| 2269 | Ga0495639_0094586 | |||
| 2270 | Ga0495584_0006126 | |||
| 2271 | Ga0495584_0007034 | |||
| 2272 | Ga0495584_0008147 | |||
| 2273 | Ga0495584_0019573 | |||
| 2274 | Ga0495584_0022709 | |||
| 2275 | Ga0495584_0026072 | |||
| 2276 | Ga0495584_0028197 | |||
| 2277 | Ga0495584_0039576 | |||
| 2278 | Ga0495584_0069598 | |||
| 2279 | Ga0495585_0001234 | |||
| 2280 | Ga0495585_0008120 | |||
| 2281 | Ga0495585_0008710 | |||
| 2282 | Ga0495585_0009359 | |||
| 2283 | Ga0495585_0010239 | |||
| 2284 | Ga0495585_0028763 | |||
| 2285 | Ga0495585_0063726 | |||
| 2286 | Ga0495585_0066197 | |||
| 2287 | Ga0495585_0095118 | |||
| 2288 | Ga0495585_0096440 | |||
| 2289 | Ga0495594_0000612 | |||
| 2290 | Ga0495594_0011583 | |||
| 2291 | Ga0495594_0032442 | |||
| 2292 | Ga0495594_0081468 | |||
| 2293 | Ga0495594_0588995 | |||
| 2294 | Ga0495596_0023295 | |||
| 2295 | Ga0495596_0059715 | |||
| 2296 | Ga0495596_0161569 | |||
| 2297 | Ga0495607_0000869 | |||
| 2298 | Ga0495607_0001347 | |||
| 2299 | Ga0495607_0001549 | |||
| 2300 | Ga0495607_0001613 | |||
| 2301 | Ga0495607_0001842 | |||
| 2302 | Ga0495607_0002165 | |||
| 2303 | Ga0495607_0006360 | |||
| 2304 | Ga0495607_0007352 | |||
| 2305 | Ga0495607_0009030 | |||
| 2306 | Ga0495607_0012101 | |||
| 2307 | Ga0495607_0038125 | |||
| 2308 | Ga0495607_0050742 | |||
| 2309 | Ga0495607_0081189 | |||
| 2310 | Ga0495607_0094312 | |||
| 2311 | Ga0495607_0110787 | |||
| 2312 | Ga0495607_0113088 | |||
| 2313 | Ga0495607_0125997 | |||
| 2314 | Ga0495607_0163472 | |||
| 2315 | Ga0495607_0178747 | |||
| 2316 | Ga0495607_0290422 | |||
| 2317 | Ga0495583_0000521 | |||
| 2318 | Ga0495583_0001354 | |||
| 2319 | Ga0495583_0001828 | |||
| 2320 | Ga0495583_0002363 | |||
| 2321 | Ga0495583_0006262 | |||
| 2322 | Ga0495583_0008207 | |||
| 2323 | Ga0495583_0008548 | |||
| 2324 | Ga0495583_0019607 | |||
| 2325 | Ga0495583_0040105 | |||
| 2326 | Ga0495583_0223962 | |||
| 2327 | Ga0495606_0001384 | |||
| 2328 | Ga0495606_0001423 | |||
| 2329 | Ga0495606_0001894 | |||
| 2330 | Ga0495606_0002172 | |||
| 2331 | Ga0495606_0002276 | |||
| 2332 | Ga0495606_0005372 | |||
| 2333 | Ga0495606_0008218 | |||
| 2334 | Ga0495606_0014967 | |||
| 2335 | Ga0495606_0017185 | |||
| 2336 | Ga0495606_0128897 | |||
| 2337 | Ga0495606_0129762 | |||
| 2338 | Ga0495606_0186292 | |||
| 2339 | Ga0495606_0248639 | |||
| 2340 | Ga0495606_0358245 | |||
| 2341 | Ga0495610_0001026 | |||
| 2342 | Ga0495610_0004516 | |||
| 2343 | Ga0495610_0009001 | |||
| 2344 | Ga0495610_0009088 | |||
| 2345 | Ga0495610_0010838 | |||
| 2346 | Ga0495610_0011192 | |||
| 2347 | Ga0495610_0014996 | |||
| 2348 | Ga0495610_0022797 | |||
| 2349 | Ga0495610_0060516 | |||
| 2350 | Ga0495610_0135586 | |||
| 2351 | Ga0495610_0217429 | |||
| 2352 | Ga0495616_0005283 | |||
| 2353 | Ga0495616_0007521 | |||
| 2354 | Ga0495616_0009442 | |||
| 2355 | Ga0495616_0012444 | |||
| 2356 | Ga0495616_0016626 | |||
| 2357 | Ga0495616_0052948 | |||
| 2358 | Ga0495616_0073936 | |||
| 2359 | Ga0495616_0145134 | |||
| 2360 | Ga0495616_0249953 | |||
| 2361 | Ga0495616_0388951 | |||
| 2362 | Ga0495620_0000878 | |||
| 2363 | Ga0495620_0001742 | |||
| 2364 | Ga0495620_0002259 | |||
| 2365 | Ga0495620_0002585 | |||
| 2366 | Ga0495620_0002844 | |||
| 2367 | Ga0495620_0007056 | |||
| 2368 | Ga0495620_0021421 | |||
| 2369 | Ga0495620_0022999 | |||
| 2370 | Ga0495630_0016649 | |||
| 2371 | Ga0495630_0438011 | |||
| 2372 | Ga0495631_0000478 | |||
| 2373 | Ga0495631_0000774 | |||
| 2374 | Ga0495631_0001335 | |||
| 2375 | Ga0495631_0001760 | |||
| 2376 | Ga0495631_0005026 | |||
| 2377 | Ga0495631_0015739 | |||
| 2378 | Ga0495631_0034124 | |||
| 2379 | Ga0495631_0050780 | |||
| 2380 | Ga0495631_0217353 | |||
| 2381 | Ga0495632_0001147 | |||
| 2382 | Ga0495632_0002357 | |||
| 2383 | Ga0495632_0003511 | |||
| 2384 | Ga0495632_0007235 | |||
| 2385 | Ga0495632_0008307 | |||
| 2386 | Ga0495632_0008784 | |||
| 2387 | Ga0495632_0009540 | |||
| 2388 | Ga0495632_0011026 | |||
| 2389 | Ga0495632_0011532 | |||
| 2390 | Ga0495632_0040650 | |||
| 2391 | Ga0495632_0099337 | |||
| 2392 | Ga0495637_0003252 | |||
| 2393 | Ga0495637_0006397 | |||
| 2394 | Ga0495637_0006846 | |||
| 2395 | Ga0495637_0007301 | |||
| 2396 | Ga0495637_0007578 | |||
| 2397 | Ga0495637_0010254 | |||
| 2398 | Ga0495637_0011839 | |||
| 2399 | Ga0495637_0013088 | |||
| 2400 | Ga0495637_0018886 | |||
| 2401 | Ga0495637_0020192 | |||
| 2402 | Ga0495637_0035066 | |||
| 2403 | Ga0495637_0050801 | |||
| 2404 | Ga0495637_0148696 | |||
| 2405 | Ga0495643_0000421 | |||
| 2406 | Ga0495643_0004499 | |||
| 2407 | Ga0495643_0009458 | |||
| 2408 | Ga0495643_0036989 | |||
| 2409 | Ga0495643_0052582 | |||
| 2410 | Ga0495643_0074771 | |||
| 2411 | Ga0495643_0119586 | |||
| 2412 | Ga0495644_0015663 | |||
| 2413 | Ga0495644_0058964 | |||
| 2414 | Ga0495644_0098017 | |||
| 2415 | Ga0495648_0004823 | |||
| 2416 | Ga0495648_0005023 | |||
| 2417 | Ga0495648_0011986 | |||
| 2418 | Ga0495648_0013468 | |||
| 2419 | Ga0495648_0014011 | |||
| 2420 | Ga0495648_0017468 | |||
| 2421 | Ga0495648_0023252 | |||
| 2422 | Ga0495648_0023803 | |||
| 2423 | Ga0495648_0038246 | |||
| 2424 | Ga0495648_0039520 | |||
| 2425 | Ga0495648_0041480 | |||
| 2426 | Ga0495648_0069769 | |||
| 2427 | Ga0495648_0077013 | |||
| 2428 | Ga0495666_0012928 | |||
| 2429 | Ga0495666_0026972 | |||
| 2430 | Ga0495666_0096513 | |||
| 2431 | Ga0495642_0003041 | |||
| 2432 | Ga0495642_0004114 | |||
| 2433 | Ga0495652_0291527 | |||
| 2434 | Ga0495654_0000672 | |||
| 2435 | Ga0495654_0000875 | |||
| 2436 | Ga0495654_0006669 | |||
| 2437 | Ga0495654_0006958 | |||
| 2438 | Ga0495654_0007483 | |||
| 2439 | Ga0495654_0015065 | |||
| 2440 | Ga0495654_0019786 | |||
| 2441 | Ga0495654_0023494 | |||
| 2442 | Ga0495654_0040871 | |||
| 2443 | Ga0495654_0043771 | |||
| 2444 | Ga0495654_0157262 | |||
| 2445 | Ga0495654_0249085 | |||
| 2446 | Ga0495587_0018557 | |||
| 2447 | Ga0495587_0175391 | |||
| 2448 | Ga0495587_0366128 | |||
| 2449 | Ga0495609_0000011 | |||
| 2450 | Ga0495609_0000349 | |||
| 2451 | Ga0495609_0000784 | |||
| 2452 | Ga0495609_0005802 | |||
| 2453 | Ga0495609_0008532 | |||
| 2454 | Ga0495609_0009845 | |||
| 2455 | Ga0495609_0011414 | |||
| 2456 | Ga0495609_0117644 | |||
| 2457 | Ga0495597_0000221 | |||
| 2458 | Ga0495597_0007884 | |||
| 2459 | Ga0495597_0008152 | |||
| 2460 | Ga0495597_0050003 | |||
| 2461 | Ga0495597_0142939 | |||
| 2462 | Ga0495597_0285027 | |||
| 2463 | Ga0495645_0139290 | |||
| 2464 | Ga0495622_0004041 | |||
| 2465 | Ga0495622_0004514 | |||
| 2466 | Ga0495622_0004608 | |||
| 2467 | Ga0495622_0009876 | |||
| 2468 | Ga0495622_0015519 | |||
| 2469 | Ga0495633_0000287 | |||
| 2470 | Ga0495633_0024742 | |||
| 2471 | Ga0495656_0062158 | |||
| 2472 | Ga0495668_0004341 | |||
| 2473 | Ga0495668_0033511 | |||
| 2474 | Ga0495668_0035932 | |||
| 2475 | Ga0495668_0066635 | |||
| 2476 | Ga0495668_0119052 | |||
| 2477 | Ga0495668_0282987 | |||
| 2478 | Ga0495634_0012371 | |||
| 2479 | Ga0495611_0000001 | |||
| 2480 | Ga0495611_0000674 | |||
| 2481 | Ga0495611_0000679 | |||
| 2482 | Ga0495611_0001919 | |||
| 2483 | Ga0495611_0005044 | |||
| 2484 | Ga0495611_0010711 | |||
| 2485 | Ga0495611_0013643 | |||
| 2486 | Ga0495611_0061830 | |||
| 2487 | Ga0495625_0000001 | |||
| 2488 | Ga0495625_0000187 | |||
| 2489 | Ga0495625_0001286 | |||
| 2490 | Ga0495625_0014956 | |||
| 2491 | Ga0495625_0018168 | |||
| 2492 | Ga0495625_0031785 | |||
| 2493 | Ga0495625_0050696 | |||
| 2494 | Ga0495625_0075383 | |||
| 2495 | Ga0495625_0115313 | |||
| 2496 | Ga0495625_0289041 | |||
| 2497 | Ga0495635_0011871 | |||
| 2498 | Ga0495635_0564495 | |||
| 2499 | Ga0495659_0002188 | |||
| 2500 | Ga0495659_0005793 | |||
| 2501 | Ga0495659_0215745 | |||
| 2502 | Ga0495661_0000028 | |||
| 2503 | Ga0495661_0000477 | |||
| 2504 | Ga0495661_0000596 | |||
| 2505 | Ga0495661_0001003 | |||
| 2506 | Ga0495661_0004293 | |||
| 2507 | Ga0495661_0006585 | |||
| 2508 | Ga0495661_0021576 | |||
| 2509 | Ga0495661_0078677 | |||
| 2510 | Ga0495661_0100984 | |||
| 2511 | Ga0495661_0339396 | |||
| 2512 | Ga0495588_0027874 | |||
| 2513 | Ga0495599_0870536 | |||
| 2514 | Ga0495623_0011027 | |||
| 2515 | Ga0495646_0091142 | |||
| 2516 | Ga0495658_0656894 | |||
| 2517 | Ga0495669_0018630 | |||
| 2518 | Ga0495613_0028299 | |||
| 2519 | Ga0495613_0107369 | |||
| 2520 | Ga0495613_0111379 | |||
| 2521 | Ga0495624_0010386 | |||
| 2522 | Ga0495670_0004101 | |||
| 2523 | Ga0495670_0005209 | |||
| 2524 | Ga0495670_0005708 | |||
| 2525 | Ga0495670_0005850 | |||
| 2526 | Ga0495670_0014500 | |||
| 2527 | Ga0495670_0029246 | |||
| 2528 | Ga0495670_0060659 | |||
| 2529 | Ga0495670_0229965 | |||
| 2530 | Ga0495670_0241272 | |||
| 2531 | Ga0495670_0474541 | |||
| 2532 | Ga0495671_0000512 | |||
| 2533 | Ga0495671_0000650 | |||
| 2534 | Ga0495671_0001180 | |||
| 2535 | Ga0495671_0002553 | |||
| 2536 | Ga0495671_0007066 | |||
| 2537 | Ga0495671_0013002 | |||
| 2538 | Ga0495671_0039219 | |||
| 2539 | Ga0495671_0057617 | |||
| 2540 | Ga0495671_0065688 | |||
| 2541 | Ga0495671_0074970 | |||
| 2542 | Ga0495671_0404403 | |||
| 2543 | Ga0495649_0003758 | |||
| 2544 | Ga0495649_0006713 | |||
| 2545 | Ga0495649_0007221 | |||
| 2546 | Ga0495649_0007939 | |||
| 2547 | Ga0495649_0016821 | |||
| 2548 | Ga0495649_0022992 | |||
| 2549 | Ga0495649_0027233 | |||
| 2550 | Ga0495649_0045228 | |||
| 2551 | Ga0495649_0081859 | |||
| 2552 | Ga0495589_0000236 | |||
| 2553 | Ga0495589_0005797 | |||
| 2554 | Ga0495589_0006835 | |||
| 2555 | Ga0495589_0009516 | |||
| 2556 | Ga0495589_0018838 | |||
| 2557 | Ga0495589_0041537 | |||
| 2558 | Ga0495589_0043186 | |||
| 2559 | Ga0495600_0060865 | |||
| 2560 | Ga0495600_0423426 | |||
| 2561 | Ga0495660_0000888 | |||
| 2562 | Ga0495660_0001210 | |||
| 2563 | Ga0495660_0001273 | |||
| 2564 | Ga0495660_0001456 | |||
| 2565 | Ga0495660_0001754 | |||
| 2566 | Ga0495660_0004981 | |||
| 2567 | Ga0495660_0014627 | |||
| 2568 | Ga0495660_0015804 | |||
| 2569 | Ga0495660_0020626 | |||
| 2570 | Ga0495660_0023983 | |||
| 2571 | Ga0495660_0031294 | |||
| 2572 | Ga0495660_0052001 | |||
| 2573 | Ga0495660_0124149 | |||
| 2574 | Ga0495660_0158845 | |||
| 2575 | Ga0495660_0195623 | |||
| 2576 | Ga0495581_0100939 | |||
| 2577 | Ga0495604_0014492 | |||
| 2578 | Ga0495604_0081315 | |||
| 2579 | Ga0495674_0022886 | |||
| 2580 | Ga0495672_0001999 | |||
| 2581 | Ga0495672_0010991 | |||
| 2582 | Ga0495672_0011802 | |||
| 2583 | Ga0495672_0015180 | |||
| 2584 | Ga0495672_0022913 | |||
| 2585 | Ga0495672_0031266 | |||
| 2586 | Ga0495672_0050816 | |||
| 2587 | Ga0495672_0215969 | |||
| 2588 | Ga0495676_0000508 | |||
| 2589 | Ga0495676_0088878 | |||
| 2590 | Ga0495676_0462796 | |||
| 2591 | Ga0495680_0016282 | |||
| 2592 | Ga0495680_0020798 | |||
| 2593 | Ga0495680_0022963 | |||
| 2594 | Ga0495683_0000053 | |||
| 2595 | Ga0495683_0000216 | |||
| 2596 | Ga0495683_0000279 | |||
| 2597 | Ga0495683_0001237 | |||
| 2598 | Ga0495683_0016482 | |||
| 2599 | Ga0495683_0019039 | |||
| 2600 | Ga0495683_0022999 | |||
| 2601 | Ga0495683_0023793 | |||
| 2602 | Ga0495683_0101430 | |||
| 2603 | Ga0495687_000698 | |||
| 2604 | Ga0495687_008412 | |||
| 2605 | Ga0495677_0004418 | |||
| 2606 | Ga0495679_000004 | |||
| 2607 | Ga0495679_000075 | |||
| 2608 | Ga0495679_002285 | |||
| 2609 | Ga0495679_007665 | |||
| 2610 | Ga0495679_012854 | |||
| 2611 | Ga0495679_015325 | |||
| 2612 | Ga0495679_066151 | |||
| 2613 | Ga0495685_009223 | |||
| 2614 | Ga0495685_060550 | |||
| 2615 | Ga0495673_0000202 | |||
| 2616 | Ga0495673_0000670 | |||
| 2617 | Ga0495673_0000938 | |||
| 2618 | Ga0495673_0001468 | |||
| 2619 | Ga0495673_0001495 | |||
| 2620 | Ga0495673_0002985 | |||
| 2621 | Ga0495673_0006031 | |||
| 2622 | Ga0495673_0006159 | |||
| 2623 | Ga0495673_0006807 | |||
| 2624 | Ga0495673_0007204 | |||
| 2625 | Ga0495673_0007237 | |||
| 2626 | Ga0495673_0009407 | |||
| 2627 | Ga0495673_0085181 | |||
| 2628 | Ga0495673_0110247 | |||
| 2629 | Ga0495673_0117471 | |||
| 2630 | Ga0495673_0140076 | |||
| 2631 | Ga0495673_0154008 | |||
| 2632 | Ga0495673_0174084 | |||
| 2633 | Ga0495673_0198969 | |||
| 2634 | Ga0495681_0000588 | |||
| 2635 | Ga0495681_0005805 | |||
| 2636 | Ga0495681_0012384 | |||
| 2637 | Ga0495681_0016233 | |||
| 2638 | Ga0495681_0024804 | |||
| 2639 | Ga0495681_0025435 | |||
| 2640 | Ga0495681_0098844 | |||
| 2641 | Ga0495686_0000017 | |||
| 2642 | Ga0495686_0002215 | |||
| 2643 | Ga0495686_0011962 | |||
| 2644 | Ga0495686_0097455 | |||
| 2645 | Ga0495686_0125614 | |||
| 2646 | Ga0495686_0142964 | |||
| 2647 | Ga0495686_0168419 | |||
| 2648 | Ga0495686_0359417 | |||
| 2649 | Ga0495593_0017034 | |||
| 2650 | Ga0495593_0041728 | |||
| 2651 | Ga0495602_0089939 | |||
| 2652 | Ga0495626_0000250 | |||
| 2653 | Ga0495626_0002158 | |||
| 2654 | Ga0495626_0007151 | |||
| 2655 | Ga0495626_0007269 | |||
| 2656 | Ga0495626_0010027 | |||
| 2657 | Ga0495626_0030432 | |||
| 2658 | Ga0496102_0017499 | |||
| 2659 | Ga0496102_0117760 | |||
| 2660 | Ga0496103_0008923 | |||
| 2661 | Ga0496103_0253436 | |||
| 2662 | Ga0496106_0037962 | |||
| 2663 | Ga0496107_0162336 | |||
| 2664 | Ga0496110_0090019 | |||
| 2665 | Ga0496110_0162260 | |||
| 2666 | Ga0496110_0254903 | |||
| 2667 | Ga0496111_0913089 | |||
| 2668 | Ga0496112_0057022 | |||
| 2669 | Ga0496112_0177019 | |||
| 2670 | Ga0496116_0001102 | |||
| 2671 | Ga0496116_0013194 | |||
| 2672 | Ga0496116_0034340 | |||
| 2673 | Ga0496116_0065312 | |||
| 2674 | Ga0496116_0071479 | |||
| 2675 | Ga0496116_0098826 | |||
| 2676 | Ga0496117_0021272 | |||
| 2677 | Ga0496117_0027159 | |||
| 2678 | Ga0496117_0058529 | |||
| 2679 | Ga0496117_0072139 | |||
| 2680 | Ga0496117_0091291 | |||
| 2681 | Ga0496117_0156079 | |||
| 2682 | Ga0496118_0001453 | |||
| 2683 | Ga0496118_0006791 | |||
| 2684 | Ga0496118_0021458 | |||
| 2685 | Ga0496118_0032911 | |||
| 2686 | Ga0496118_0048363 | |||
| 2687 | Ga0496118_0062394 | |||
| 2688 | Ga0496118_0088186 | |||
| 2689 | Ga0496118_0102212 | |||
| 2690 | Ga0496118_0182075 | |||
| 2691 | Ga0496119_0060964 | |||
| 2692 | Ga0496121_0000045 | |||
| 2693 | Ga0496121_0002035 | |||
| 2694 | Ga0496121_0003471 | |||
| 2695 | Ga0496121_0010893 | |||
| 2696 | Ga0496121_0019796 | |||
| 2697 | Ga0496121_0040850 | |||
| 2698 | Ga0496121_0068269 | |||
| 2699 | Ga0496121_0094767 | |||
| 2700 | Ga0496121_0141135 | |||
| 2701 | Ga0496121_0151570 | |||
| 2702 | Ga0496121_0309715 | |||
| 2703 | Ga0496122_0006421 | |||
| 2704 | Ga0496122_0018887 | |||
| 2705 | Ga0496122_0021949 | |||
| 2706 | Ga0496122_0038971 | |||
| 2707 | Ga0496122_0074412 | |||
| 2708 | Ga0496122_0116839 | |||
| 2709 | Ga0496123_0005038 | |||
| 2710 | Ga0496123_0010414 | |||
| 2711 | Ga0496123_0015208 | |||
| 2712 | Ga0496123_0065283 | |||
| 2713 | Ga0496123_0073614 | |||
| 2714 | Ga0496124_0000382 | |||
| 2715 | Ga0496124_0010622 | |||
| 2716 | Ga0496124_0064826 | |||
| 2717 | Ga0496124_0104705 | |||
| 2718 | Ga0496124_0198824 | |||
| 2719 | Ga0496124_0372807 | |||
| 2720 | Ga0496125_0003559 | |||
| 2721 | Ga0496125_0037071 | |||
| 2722 | Ga0496125_0097850 | |||
| 2723 | Ga0496126_0089264 | |||
| 2724 | Ga0496126_0126292 | |||
| 2725 | Ga0496126_0185169 | |||
| 2726 | Ga0495678_000362 | |||
| 2727 | Ga0495678_000688 | |||
| 2728 | Ga0495678_001023 | |||
| 2729 | Ga0495678_007338 | |||
| 2730 | Ga0495678_007420 | |||
| 2731 | Ga0495678_010350 | |||
| 2732 | Ga0495678_029227 | |||
| 2733 | Ga0495678_052788 | |||
| 2734 | Ga0495678_061123 | |||
| 2735 | Ga0495678_115305 | |||
| 2736 | Ga0495678_213151 | |||
| 2737 | Ga0495682_0000344 | |||
| 2738 | Ga0495682_0001672 | |||
| 2739 | Ga0495682_0004097 | |||
| 2740 | Ga0495682_0008461 | |||
| 2741 | Ga0495682_0012546 | |||
| 2742 | Ga0495682_0130514 | |||
| 2743 | Ga0501316_024797 | |||
| 2744 | Ga0501320_061501 | |||
| 2745 | Ga0501323_016353 | |||
| 2746 | Ga0501031_0267062 | |||
| 2747 | Ga0501032_0004655 | |||
| 2748 | Ga0501032_0076983 | |||
| 2749 | Ga0501034_0021013 | |||
| 2750 | Ga0501034_0097710 | |||
| 2751 | Ga0501034_0360119 | |||
| 2752 | Ga0501034_0991496 | |||
| 2753 | Ga0501037_0024665 | |||
| 2754 | Ga0501038_0010418 | |||
| 2755 | Ga0501038_0139820 | |||
| 2756 | Ga0501038_0849692 | |||
| 2757 | Ga0501039_0467428 | |||
| 2758 | Ga0501039_0475462 | |||
| 2759 | Ga0501043_0004238 | |||
| 2760 | Ga0501198_019209 | |||
| 2761 | Ga0501227_044139 | |||
| 2762 | Ga0501259_012650 | |||
| 2763 | Ga0501079_1277675 | |||
| 2764 | Ga0501080_0000333 | |||
| 2765 | Ga0501083_0173004 | |||
| 2766 | Ga0501241_003001 | |||
| 2767 | Ga0501241_121705 | |||
| 2768 | Ga0501241_158194 | |||
| 2769 | Ga0501269_041519 | |||
| 2770 | Ga0501035_0317279 | |||
| 2771 | Ga0501204_008163 | |||
| 2772 | Ga0501226_000022 | |||
| 2773 | Ga0501226_011206 | |||
| 2774 | nmdc:mga03683_294116_c1 | |||
| 2775 | nmdc:mga08y16_1346074_c1 | |||
| 2776 | Ga0495619_0476001 | |||
| 2777 | Ga0500643_000075 | |||
| 2778 | Ga0500555_007694 | |||
| 2779 | Ga0500562_055900 | |||
| 2780 | Ga0500618_008559 | |||
| 2781 | Ga0500573_0052705 | |||
| 2782 | Ga0500586_106454 | |||
| 2783 | Ga0500633_0055414 | |||
| 2784 | Ga0500645_004544 | |||
| 2785 | Ga0501084_1042293 | |||
| 2786 | 2595446632 | |||
| 2787 | 2595451876 | |||
| 2788 | 2599504320 | |||
| 2789 | 2599613610 | |||
| 2790 | 2599933419 | |||
| 2791 | 2599994247 | |||
| 2792 | 2600023542 | |||
| 2793 | 2600030656 | |||
| 2794 | 2600037013 | |||
| 2795 | 2600042436 | |||
| 2796 | 2600060499 | |||
| 2797 | 2600065598 | |||
| 2798 | 2600078282 | |||
| 2799 | 2600360463 | |||
| 2800 | 2671129075 | |||
| 2801 | 2721026742 | |||
| 2802 | 2735837704 | |||
| 2803 | 2738715871 | |||
| 2804 | 2739228309 | |||
| 2805 | 2747947854 | |||
| 2806 | 2765577926 | |||
| 2807 | 2794595944 | |||
| 2808 | 2842859282 | |||
| 2809 | 2842919519 | |||
| 2810 | 2884341284 | |||
| 2811 | 2894510720 | |||
| 2812 | 2895502561 | |||
| 2813 | 2895514110 | |||
| 2814 | 2895524412 | |||
| 2815 | 2895526509 | |||
| 2816 | 2919404950 | |||
| 2817 | 2919460944 | |||
| 2818 | 2923589981 | |||
| 2819 | 2931374141 | |||
| 2820 | 2941472736 | |||
| 2821 | 2953998016 | |||
| 2822 | 2989396456 | |||
| 2823 | 8056144928 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lkn-assembly2.cif.gz_D | the pilb(n-terminal_p70s mutant)-pilz complex (semet) | 0.9758 | 12 | 118 |
| 3dsg-assembly1.cif.gz_A | xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity | 0.9598 | 12 | 107 |
| 4fou-assembly1.cif.gz_C | structure of the pilz-fimx(eal domain)-c-di-gmp complex responsible for the regulation of bacterial type iv pilus biogenesis | 0.9553 | 12 | 107 |
| 3dsg-assembly3.cif.gz_C | xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity | 0.9543 | 12 | 107 |
| 7lkn-assembly2.cif.gz_D | the pilb(n-terminal_p70s mutant)-pilz complex (semet) | 0.9497 | 12 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dsgA00 | Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains | 0.9585 | 12 | 107 | 2.40.10.220 |
| 3dsgA00 | Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains | 0.9382 | 12 | 107 | 2.40.10.220 |
| af_Q95XS0_332_432_2.30.30.140 | Mainly Beta;Roll;SH3 type barrels.; | 0.6826 | 48 | 76 | 2.30.30.140 |
| af_I1LW27_291_355_2.30.30.1040 | Mainly Beta;Roll;SH3 type barrels.; | 0.6622 | 46 | 92 | 2.30.30.1040 |
| af_K7UKA6_315_388_2.30.30.1040 | Mainly Beta;Roll;SH3 type barrels.; | 0.6523 | 45 | 92 | 2.30.30.1040 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L8MPR7-F1-model_v4 | deleted | 1.001 | 16 | 118 |
|
| AF-A0A355JQG9-F1-model_v4 | deleted | 0.9987 | 16 | 118 |
|
| AF-A0A0S2FSN1-F1-model_v4 | deleted | 0.9937 | 14 | 118 |
|
| AF-A0A2E6LZS8-F1-model_v4 | Pilus assembly protein PilZ | 0.9919 | 10 | 118 |
GO:0035438
|
| AF-L8MPR7-F1-model_v4 | deleted | 0.9918 | 16 | 118 |
|