F493714

General Info

Members Datasets Scaffolds Average Seq Length
1405 333 1405 60

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_101578144|Ga0070712_1015781442
Length 58
Sequence MATPKRKTTKSKSRMRAASWKAQVPTYSECPQCRQAKLPHRVCANCGYYAGREVIEVE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
213 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
214 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
220 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
223 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
226 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
227 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
228 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
229 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
331 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.57
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005718 3300003203 Bacteria 5745
2 Ga0058859_11795127 3300004798 Unclassified 557
3 Ga0058861_11455258 3300004800 Unclassified 555
4 Ga0058860_12045871 3300004801 Unclassified 774
5 Ga0065707_10447275 3300005295 Bacteria 804
6 Ga0065707_10647491 3300005295 Unclassified 665
7 Ga0065707_10798277 3300005295 Unclassified 600
8 Ga0065707_10811341 3300005295 Unclassified 595
9 Ga0065707_10899081 3300005295 Unclassified 567
10 Ga0070676_10231868 3300005328 Bacteria 1224
11 Ga0070683_101643253 3300005329 Bacteria 618
12 Ga0070690_100080310 3300005330 Bacteria 2133
13 Ga0070690_100229097 3300005330 Unclassified 1306
14 Ga0070690_100361137 3300005330 Unclassified 1057
15 Ga0070670_100612048 3300005331 Unclassified 975
16 Ga0070670_101120898 3300005331 Bacteria 718
17 Ga0070670_101210189 3300005331 Bacteria 690
18 Ga0070670_102147213 3300005331 Bacteria 515
19 Ga0070677_10107393 3300005333 Unclassified 1241
20 Ga0070677_10130548 3300005333 Bacteria 1146
21 Ga0068869_100121141 3300005334 Bacteria 2001
22 Ga0068869_100226774 3300005334 Bacteria 1483
23 Ga0068869_100444365 3300005334 Bacteria 1074
24 Ga0068869_100661792 3300005334 Unclassified 887
25 Ga0070666_11263627 3300005335 Unclassified 550
26 Ga0070680_100010742 3300005336 Bacteria 7068
27 Ga0070680_100080904 3300005336 Bacteria 2680
28 Ga0070680_100178369 3300005336 Bacteria 1789
29 Ga0070680_100350323 3300005336 Unclassified 1256
30 Ga0070680_100606565 3300005336 Bacteria 940
31 Ga0070680_101080731 3300005336 Unclassified 693
32 Ga0070680_101398053 3300005336 Unclassified 606
33 Ga0070680_101671446 3300005336 Bacteria 552
34 Ga0068868_100432847 3300005338 Bacteria 1141
35 Ga0068868_100489975 3300005338 Bacteria 1075
36 Ga0068868_102355034 3300005338 Archaea 508
37 Ga0070689_100109712 3300005340 Bacteria 2193
38 Ga0070689_100250396 3300005340 Bacteria 1462
39 Ga0070689_100522362 3300005340 Unclassified 1019
40 Ga0070689_100697425 3300005340 Bacteria 886
41 Ga0070689_101348922 3300005340 Bacteria 643
42 Ga0070691_10022470 3300005341 Bacteria 2927
43 Ga0070691_10624160 3300005341 Bacteria 639
44 Ga0070691_10655873 3300005341 Unclassified 625
45 Ga0070687_100795674 3300005343 Unclassified 669
46 Ga0070661_101743426 3300005344 Bacteria 528
47 Ga0070692_10106340 3300005345 Bacteria 1546
48 Ga0070692_10900442 3300005345 Unclassified 612
49 Ga0070692_11200575 3300005345 Bacteria 540
50 Ga0070668_100530667 3300005347 Bacteria 1022
51 Ga0070668_100911853 3300005347 Bacteria 786
52 Ga0070668_101611380 3300005347 Unclassified 595
53 Ga0070668_102003149 3300005347 Bacteria 534
54 Ga0070669_100011353 3300005353 Bacteria 6323
55 Ga0070669_100085539 3300005353 Bacteria 2355
56 Ga0070669_100671395 3300005353 Unclassified 873
57 Ga0070669_100763694 3300005353 Bacteria 820
58 Ga0070669_100808900 3300005353 Bacteria 797
59 Ga0070669_101770421 3300005353 Bacteria 539
60 Ga0070675_100369425 3300005354 Bacteria 1275
61 Ga0070675_100477797 3300005354 Bacteria 1120
62 Ga0070675_100884974 3300005354 Bacteria 818
63 Ga0070675_101051946 3300005354 Bacteria 748
64 Ga0070675_101202434 3300005354 Bacteria 698
65 Ga0070671_100263373 3300005355 Bacteria 1465
66 Ga0070674_100143173 3300005356 Unclassified 1797
67 Ga0070674_100931995 3300005356 Unclassified 758
68 Ga0070674_101177653 3300005356 Unclassified 679
69 Ga0070674_102046848 3300005356 Unclassified 522
70 Ga0070673_100919423 3300005364 Bacteria 812
71 Ga0070673_101485705 3300005364 Unclassified 639
72 Ga0070688_100424762 3300005365 Bacteria 989
73 Ga0070688_100786747 3300005365 Bacteria 743
74 Ga0070667_101741439 3300005367 Unclassified 586
75 Ga0070667_101770821 3300005367 Unclassified 581
76 Ga0070703_10134544 3300005406 Unclassified 912
77 Ga0070703_10251337 3300005406 Archaea 717
78 Ga0070709_10577749 3300005434 Unclassified 863
79 Ga0070701_10001616 3300005438 Bacteria 8408
80 Ga0070701_10006095 3300005438 Bacteria 5045
81 Ga0070701_10026821 3300005438 Unclassified 2815
82 Ga0070701_10921502 3300005438 Bacteria 604
83 Ga0070711_101688470 3300005439 Bacteria 555
84 Ga0070705_100012970 3300005440 Bacteria 4251
85 Ga0070705_100036281 3300005440 Bacteria 2771
86 Ga0070705_100069802 3300005440 Bacteria 2119
87 Ga0070705_100119407 3300005440 Bacteria 1700
88 Ga0070705_100602650 3300005440 Bacteria 850
89 Ga0070705_101007000 3300005440 Bacteria 677
90 Ga0070705_101203952 3300005440 Unclassified 624
91 Ga0070705_101532471 3300005440 Unclassified 559
92 Ga0070700_100197428 3300005441 Bacteria 1411
93 Ga0070700_100318471 3300005441 Unclassified 1142
94 Ga0070700_100613254 3300005441 Unclassified 854
95 Ga0070694_100035687 3300005444 Bacteria 3289
96 Ga0070694_100129765 3300005444 Bacteria 1819
97 Ga0070694_100194389 3300005444 Bacteria 1508
98 Ga0070694_100508102 3300005444 Unclassified 960
99 Ga0070694_100794339 3300005444 Unclassified 776
100 Ga0070694_100979982 3300005444 Unclassified 701
101 Ga0070708_100005576 3300005445 Bacteria 9970
102 Ga0070708_100016115 3300005445 Bacteria 6193
103 Ga0070708_100021250 3300005445 Bacteria 5485
104 Ga0070708_100137553 3300005445 Bacteria 2264
105 Ga0070708_100155712 3300005445 Bacteria 2127
106 Ga0070708_100250767 3300005445 Bacteria 1663
107 Ga0070708_100504292 3300005445 Bacteria 1141
108 Ga0070708_100528826 3300005445 Bacteria 1112
109 Ga0070663_100619416 3300005455 Bacteria 912
110 Ga0070678_100636972 3300005456 Unclassified 955
111 Ga0070678_100899406 3300005456 Bacteria 809
112 Ga0070678_102188112 3300005456 Unclassified 524
113 Ga0070662_100107594 3300005457 Bacteria 2120
114 Ga0070662_100515812 3300005457 Bacteria 998
115 Ga0070662_100524449 3300005457 Bacteria 990
116 Ga0070662_101601339 3300005457 Bacteria 562
117 Ga0070681_10900426 3300005458 Unclassified 803
118 Ga0070681_11346219 3300005458 Bacteria 637
119 Ga0068867_100495878 3300005459 Unclassified 1049
120 Ga0068867_100632494 3300005459 Bacteria 937
121 Ga0068867_100965907 3300005459 Bacteria 770
122 Ga0068867_100983571 3300005459 Unclassified 764
123 Ga0068867_101075144 3300005459 Bacteria 733
124 Ga0068867_101174979 3300005459 Bacteria 704
125 Ga0068867_101775630 3300005459 Bacteria 580
126 Ga0070685_10470786 3300005466 Unclassified 884
127 Ga0070706_100016480 3300005467 Bacteria 6829
128 Ga0070706_100017851 3300005467 Bacteria 6546
129 Ga0070706_100056505 3300005467 Bacteria 3622
130 Ga0070706_100106278 3300005467 Bacteria 2611
131 Ga0070706_100367299 3300005467 Bacteria 1341
132 Ga0070706_101449580 3300005467 Archaea 628
133 Ga0070706_101546945 3300005467 Bacteria 606
134 Ga0070707_100001814 3300005468 Bacteria 20536
135 Ga0070707_100022014 3300005468 Bacteria 6027
136 Ga0070707_100027660 3300005468 Bacteria 5394
137 Ga0070707_100171862 3300005468 Bacteria 2112
138 Ga0070707_100196892 3300005468 Bacteria 1964
139 Ga0070707_100701544 3300005468 Unclassified 975
140 Ga0070707_101197555 3300005468 Unclassified 726
141 Ga0070707_102272550 3300005468 Bacteria 510
142 Ga0070698_100028962 3300005471 Bacteria 5749
143 Ga0070698_100032614 3300005471 Bacteria 5394
144 Ga0070698_100213911 3300005471 Bacteria 1862
145 Ga0070698_100544732 3300005471 Bacteria 1100
146 Ga0070698_100563937 3300005471 Bacteria 1078
147 Ga0070698_100842409 3300005471 Unclassified 862
148 Ga0070698_100900754 3300005471 Bacteria 830
149 Ga0070698_101001716 3300005471 Bacteria 783
150 Ga0070698_101885350 3300005471 Bacteria 551
151 Ga0070699_100003712 3300005518 Bacteria 13498
152 Ga0070699_100026125 3300005518 Bacteria 5036
153 Ga0070699_100055428 3300005518 Bacteria 3432
154 Ga0070699_100220864 3300005518 Bacteria 1688
155 Ga0070699_100306541 3300005518 Bacteria 1425
156 Ga0070699_100401661 3300005518 Bacteria 1239
157 Ga0070699_100670260 3300005518 Bacteria 947
158 Ga0070699_101073498 3300005518 Bacteria 739
159 Ga0070699_102138165 3300005518 Bacteria 511
160 Ga0070679_100215202 3300005530 Bacteria 1884
161 Ga0070679_100442136 3300005530 Bacteria 1245
162 Ga0070697_100006636 3300005536 Bacteria 8972
163 Ga0070697_100027823 3300005536 Bacteria 4525
164 Ga0070697_100048682 3300005536 Bacteria 3437
165 Ga0070697_100193515 3300005536 Bacteria 1727
166 Ga0070697_100368889 3300005536 Bacteria 1242
167 Ga0070697_100615502 3300005536 Unclassified 955
168 Ga0070697_101603794 3300005536 Unclassified 582
169 Ga0070697_101845688 3300005536 Bacteria 541
170 Ga0070672_100591129 3300005543 Unclassified 966
171 Ga0070672_101315004 3300005543 Unclassified 646
172 Ga0070672_102090301 3300005543 Bacteria 510
173 Ga0070672_102101795 3300005543 Unclassified 509
174 Ga0070686_100097901 3300005544 Bacteria 1976
175 Ga0070695_100018512 3300005545 Bacteria 4230
176 Ga0070695_100460859 3300005545 Unclassified 976
177 Ga0070695_100686496 3300005545 Bacteria 811
178 Ga0070695_100693430 3300005545 Bacteria 808
179 Ga0070695_100888848 3300005545 Bacteria 719
180 Ga0070695_101337861 3300005545 Unclassified 593
181 Ga0070695_101600988 3300005545 Bacteria 544
182 Ga0070696_100033512 3300005546 Bacteria 3529
183 Ga0070696_100051820 3300005546 Bacteria 2855
184 Ga0070696_100084510 3300005546 Bacteria 2252
185 Ga0070696_100174074 3300005546 Bacteria 1593
186 Ga0070696_100833929 3300005546 Unclassified 761
187 Ga0070696_100918411 3300005546 Bacteria 727
188 Ga0070696_100997688 3300005546 Unclassified 699
189 Ga0070693_100446264 3300005547 Unclassified 907
190 Ga0070693_100536666 3300005547 Bacteria 835
191 Ga0070665_101316652 3300005548 Bacteria 732
192 Ga0070704_100079166 3300005549 Bacteria 2413
193 Ga0070704_100100065 3300005549 Bacteria 2182
194 Ga0070704_100215883 3300005549 Bacteria 1557
195 Ga0070704_100292971 3300005549 Bacteria 1353
196 Ga0070704_100361065 3300005549 Bacteria 1229
197 Ga0070704_100642708 3300005549 Bacteria 936
198 Ga0070704_100709164 3300005549 Bacteria 893
199 Ga0070704_100861967 3300005549 Bacteria 812
200 Ga0070704_101248262 3300005549 Unclassified 679
201 Ga0070664_100377040 3300005564 Bacteria 1294
202 Ga0070664_101407566 3300005564 Bacteria 659
203 Ga0068857_100008888 3300005577 Bacteria 8701
204 Ga0068857_100022549 3300005577 Bacteria 5539
205 Ga0068857_100414555 3300005577 Bacteria 1255
206 Ga0068857_102329133 3300005577 Unclassified 526
207 Ga0068854_100288782 3300005578 Bacteria 1323
208 Ga0068854_101978653 3300005578 Bacteria 537
209 Ga0068854_102265572 3300005578 Unclassified 503
210 Ga0070702_100145158 3300005615 Bacteria 1516
211 Ga0070702_100209721 3300005615 Bacteria 1296
212 Ga0070702_100241203 3300005615 Bacteria 1220
213 Ga0070702_100622820 3300005615 Unclassified 812
214 Ga0068852_100927547 3300005616 Bacteria 888
215 Ga0068852_101218359 3300005616 Unclassified 774
216 Ga0068859_100103779 3300005617 Bacteria 2901
217 Ga0068859_100269041 3300005617 Bacteria 1796
218 Ga0068859_100376399 3300005617 Bacteria 1515
219 Ga0068859_100647500 3300005617 Unclassified 1149
220 Ga0068859_100838216 3300005617 Bacteria 1006
221 Ga0068859_100877402 3300005617 Unclassified 983
222 Ga0068866_10080217 3300005718 Unclassified 1750
223 Ga0068866_10141704 3300005718 Bacteria 1381
224 Ga0068866_10459164 3300005718 Unclassified 835
225 Ga0068861_100221451 3300005719 Bacteria 1600
226 Ga0068861_100276339 3300005719 Bacteria 1445
227 Ga0068861_100318492 3300005719 Unclassified 1354
228 Ga0068861_101075005 3300005719 Unclassified 772
229 Ga0068870_10083911 3300005840 Bacteria 1767
230 Ga0068870_10380778 3300005840 Bacteria 913
231 Ga0068870_10402549 3300005840 Bacteria 891
232 Ga0068870_10659226 3300005840 Bacteria 718
233 Ga0068870_10927887 3300005840 Bacteria 617
234 Ga0068863_100011309 3300005841 Bacteria 8644
235 Ga0068863_100525279 3300005841 Bacteria 1167
236 Ga0068863_101661965 3300005841 Unclassified 648
237 Ga0068858_100765507 3300005842 Unclassified 941
238 Ga0068858_100881667 3300005842 Bacteria 875
239 Ga0068858_101127741 3300005842 Archaea 770
240 Ga0068858_101163483 3300005842 Unclassified 758
241 Ga0068858_101816019 3300005842 Bacteria 602
242 Ga0068858_102110885 3300005842 Bacteria 557
243 Ga0068860_100034349 3300005843 Bacteria 4863
244 Ga0068860_100104055 3300005843 Bacteria 2710
245 Ga0068860_100149434 3300005843 Bacteria 2249
246 Ga0068860_100250057 3300005843 Unclassified 1726
247 Ga0068860_102717625 3300005843 Unclassified 513
248 Ga0068862_100176280 3300005844 Bacteria 1916
249 Ga0068862_100220729 3300005844 Unclassified 1716
250 Ga0068862_100449708 3300005844 Bacteria 1214
251 Ga0068862_100473794 3300005844 Bacteria 1184
252 Ga0068862_101204277 3300005844 Bacteria 756
253 Ga0068862_101923803 3300005844 Bacteria 602
254 Ga0068862_102292214 3300005844 Bacteria 551
255 Ga0068862_102444356 3300005844 Bacteria 534
256 Ga0081455_10265850 3300005937 Bacteria 1247
257 Ga0081455_11061684 3300005937 Bacteria 501
258 Ga0081538_10008492 3300005981 Bacteria 8703
259 Ga0081540_1047381 3300005983 Bacteria 2162
260 Ga0081539_10000005 3300005985 Bacteria 549026
261 Ga0075364_10470794 3300006051 Unclassified 859
262 Ga0075432_10012112 3300006058 Bacteria 2932
263 Ga0075432_10106937 3300006058 Bacteria 1039
264 Ga0075432_10421363 3300006058 Unclassified 580
265 Ga0070712_100001268 3300006175 Bacteria 15245
266 Ga0070712_101578144 3300006175 Unclassified 574
267 Ga0075362_10366518 3300006177 Unclassified 723
268 Ga0075362_10641142 3300006177 Unclassified 551
269 Ga0097621_102311210 3300006237 Unclassified 514
270 Ga0068871_100516751 3300006358 Bacteria 1078
271 Ga0075428_100001135 3300006844 Bacteria 28454
272 Ga0075428_100003079 3300006844 Bacteria 18190
273 Ga0075428_100018174 3300006844 Bacteria 7768
274 Ga0075428_100106340 3300006844 Bacteria 3059
275 Ga0075428_100122547 3300006844 Bacteria 2830
276 Ga0075428_100178170 3300006844 Bacteria 2302
277 Ga0075428_100227781 3300006844 Bacteria 2012
278 Ga0075428_100243000 3300006844 Bacteria 1942
279 Ga0075428_100243522 3300006844 Bacteria 1940
280 Ga0075428_100333054 3300006844 Bacteria 1630
281 Ga0075428_100393261 3300006844 Bacteria 1486
282 Ga0075428_100496803 3300006844 Bacteria 1305
283 Ga0075428_101011558 3300006844 Bacteria 880
284 Ga0075428_101236705 3300006844 Bacteria 786
285 Ga0075428_102169510 3300006844 Bacteria 573
286 Ga0075430_100001340 3300006846 Bacteria 19902
287 Ga0075430_100002045 3300006846 Bacteria 16630
288 Ga0075430_100002763 3300006846 Bacteria 14666
289 Ga0075430_100005430 3300006846 Bacteria 10771
290 Ga0075430_100025650 3300006846 Bacteria 5016
291 Ga0075430_100065995 3300006846 Bacteria 3039
292 Ga0075430_100069337 3300006846 Bacteria 2958
293 Ga0075430_100138873 3300006846 Bacteria 2024
294 Ga0075430_100232884 3300006846 Bacteria 1527
295 Ga0075430_100383901 3300006846 Bacteria 1159
296 Ga0075430_100610670 3300006846 Bacteria 900
297 Ga0075430_100761743 3300006846 Bacteria 798
298 Ga0075430_100900687 3300006846 Bacteria 729
299 Ga0075430_101064710 3300006846 Bacteria 666
300 Ga0075430_101382797 3300006846 Unclassified 579
301 Ga0075430_101504496 3300006846 Bacteria 553
302 Ga0075430_101809414 3300006846 Unclassified 501
303 Ga0075431_100000979 3300006847 Bacteria 25398
304 Ga0075431_100001536 3300006847 Bacteria 21378
305 Ga0075431_100003073 3300006847 Bacteria 16166
306 Ga0075431_100004644 3300006847 Bacteria 13486
307 Ga0075431_100014242 3300006847 Bacteria 8040
308 Ga0075431_100014740 3300006847 Bacteria 7913
309 Ga0075431_100016025 3300006847 Bacteria 7607
310 Ga0075431_100043128 3300006847 Bacteria 4655
311 Ga0075431_100192094 3300006847 Unclassified 2092
312 Ga0075431_100201701 3300006847 Bacteria 2035
313 Ga0075431_100201719 3300006847 Bacteria 2035
314 Ga0075431_100228742 3300006847 Bacteria 1895
315 Ga0075431_100231258 3300006847 Bacteria 1883
316 Ga0075431_100262199 3300006847 Bacteria 1753
317 Ga0075431_100574680 3300006847 Bacteria 1113
318 Ga0075431_100608682 3300006847 Bacteria 1076
319 Ga0075431_100778765 3300006847 Bacteria 931
320 Ga0075431_101089514 3300006847 Unclassified 764
321 Ga0075433_10000843 3300006852 Bacteria 21508
322 Ga0075433_10001978 3300006852 Bacteria 15408
323 Ga0075433_10020652 3300006852 Bacteria 5511
324 Ga0075433_10046762 3300006852 Bacteria 3764
325 Ga0075433_10104968 3300006852 Bacteria 2503
326 Ga0075433_10113620 3300006852 Bacteria 2402
327 Ga0075433_10145980 3300006852 Bacteria 2103
328 Ga0075433_10169761 3300006852 Bacteria 1941
329 Ga0075433_10184321 3300006852 Bacteria 1857
330 Ga0075433_10246264 3300006852 Bacteria 1586
331 Ga0075433_10257330 3300006852 Bacteria 1548
332 Ga0075433_10273850 3300006852 Bacteria 1496
333 Ga0075433_10365416 3300006852 Bacteria 1274
334 Ga0075433_10465579 3300006852 Bacteria 1114
335 Ga0075433_10547306 3300006852 Bacteria 1018
336 Ga0075433_10787991 3300006852 Unclassified 831
337 Ga0075433_10893015 3300006852 Bacteria 775
338 Ga0075433_11130085 3300006852 Unclassified 681
339 Ga0075433_11279044 3300006852 Bacteria 636
340 Ga0075434_100007867 3300006871 Bacteria 9875
341 Ga0075434_100015436 3300006871 Bacteria 7323
342 Ga0075434_100022870 3300006871 Bacteria 6086
343 Ga0075434_100074069 3300006871 Bacteria 3398
344 Ga0075434_100089126 3300006871 Bacteria 3087
345 Ga0075434_100138100 3300006871 Bacteria 2457
346 Ga0075434_100149064 3300006871 Bacteria 2359
347 Ga0075434_100156856 3300006871 Bacteria 2295
348 Ga0075434_100168479 3300006871 Bacteria 2210
349 Ga0075434_100201064 3300006871 Bacteria 2012
350 Ga0075434_100226172 3300006871 Bacteria 1891
351 Ga0075434_100451718 3300006871 Bacteria 1306
352 Ga0075434_100527779 3300006871 Bacteria 1201
353 Ga0075434_100766454 3300006871 Unclassified 982
354 Ga0075434_101798243 3300006871 Bacteria 620
355 Ga0075429_100001419 3300006880 Bacteria 19650
356 Ga0075429_100003531 3300006880 Bacteria 13321
357 Ga0075429_100007424 3300006880 Bacteria 9514
358 Ga0075429_100015210 3300006880 Bacteria 6670
359 Ga0075429_100022158 3300006880 Bacteria 5510
360 Ga0075429_100032442 3300006880 Bacteria 4540
361 Ga0075429_100056673 3300006880 Bacteria 3411
362 Ga0075429_100099708 3300006880 Bacteria 2534
363 Ga0075429_100121030 3300006880 Bacteria 2288
364 Ga0075429_100151331 3300006880 Bacteria 2032
365 Ga0075429_100202440 3300006880 Bacteria 1740
366 Ga0075429_100274250 3300006880 Bacteria 1477
367 Ga0075429_100286574 3300006880 Bacteria 1442
368 Ga0075429_100322515 3300006880 Bacteria 1352
369 Ga0075429_100535419 3300006880 Bacteria 1026
370 Ga0075429_101319141 3300006880 Unclassified 629
371 Ga0075429_101323003 3300006880 Unclassified 628
372 Ga0068865_100189139 3300006881 Bacteria 1591
373 Ga0068865_100557241 3300006881 Archaea 963
374 Ga0068865_100622299 3300006881 Bacteria 915
375 Ga0068865_100851949 3300006881 Unclassified 790
376 Ga0075436_100012211 3300006914 Bacteria 5884
377 Ga0075436_100056238 3300006914 Bacteria 2718
378 Ga0075436_100105652 3300006914 Bacteria 1964
379 Ga0075436_100118077 3300006914 Bacteria 1854
380 Ga0075436_100198558 3300006914 Bacteria 1420
381 Ga0075436_100549300 3300006914 Bacteria 848
382 Ga0097620_100103784 3300006931 Bacteria 2901
383 Ga0097620_100269028 3300006931 Bacteria 1796
384 Ga0097620_100376397 3300006931 Bacteria 1515
385 Ga0097620_100647470 3300006931 Unclassified 1149
386 Ga0097620_100838216 3300006931 Bacteria 1006
387 Ga0075435_100006118 3300007076 Bacteria 8483
388 Ga0075435_100009348 3300007076 Bacteria 7091
389 Ga0075435_100031981 3300007076 Bacteria 4152
390 Ga0075435_100032981 3300007076 Bacteria 4092
391 Ga0075435_100070959 3300007076 Bacteria 2844
392 Ga0075435_100093578 3300007076 Bacteria 2483
393 Ga0075435_100195443 3300007076 Bacteria 1713
394 Ga0075435_100258800 3300007076 Bacteria 1482
395 Ga0075435_100497673 3300007076 Bacteria 1054
396 Ga0075435_100694459 3300007076 Unclassified 884
397 Ga0075435_100811156 3300007076 Bacteria 815
398 Ga0075435_101024759 3300007076 Bacteria 721
399 Ga0075435_101226319 3300007076 Bacteria 656
400 Ga0075435_101607804 3300007076 Bacteria 570
401 Ga0099794_10002353 3300007265 Bacteria 6957
402 Ga0099794_10002967 3300007265 Bacteria 6399
403 Ga0099794_10061636 3300007265 Bacteria 1823
404 Ga0099794_10641368 3300007265 Unclassified 564
405 Ga0099794_10765305 3300007265 Bacteria 516
406 Ga0111539_10001754 3300009094 Bacteria 28812
407 Ga0111539_10011574 3300009094 Bacteria 11071
408 Ga0111539_10018154 3300009094 Bacteria 8713
409 Ga0111539_10234200 3300009094 Unclassified 2138
410 Ga0111539_10519357 3300009094 Bacteria 1387
411 Ga0111539_10806922 3300009094 Unclassified 1092
412 Ga0111539_11147067 3300009094 Unclassified 903
413 Ga0111539_11201682 3300009094 Bacteria 881
414 Ga0111539_11711924 3300009094 Unclassified 729
415 Ga0111539_11847091 3300009094 Bacteria 701
416 Ga0111539_11961995 3300009094 Unclassified 679
417 Ga0111539_11968069 3300009094 Bacteria 678
418 Ga0111539_12586310 3300009094 Bacteria 588
419 Ga0105247_10263132 3300009101 Unclassified 1183
420 Ga0114129_10000216 3300009147 Bacteria 63856
421 Ga0114129_10000675 3300009147 Bacteria 42956
422 Ga0114129_10000716 3300009147 Bacteria 41962
423 Ga0114129_10002865 3300009147 Bacteria 24129
424 Ga0114129_10005463 3300009147 Bacteria 17964
425 Ga0114129_10007742 3300009147 Bacteria 15286
426 Ga0114129_10010144 3300009147 Bacteria 13429
427 Ga0114129_10015203 3300009147 Bacteria 10956
428 Ga0114129_10018905 3300009147 Bacteria 9816
429 Ga0114129_10024080 3300009147 Bacteria 8627
430 Ga0114129_10035705 3300009147 Bacteria 7021
431 Ga0114129_10042391 3300009147 Bacteria 6409
432 Ga0114129_10161252 3300009147 Bacteria 3063
433 Ga0114129_10199859 3300009147 Bacteria 2708
434 Ga0114129_10200112 3300009147 Bacteria 2706
435 Ga0114129_10221893 3300009147 Bacteria 2549
436 Ga0114129_10277113 3300009147 Bacteria 2242
437 Ga0114129_10395187 3300009147 Unclassified 1823
438 Ga0114129_10413753 3300009147 Bacteria 1775
439 Ga0114129_10568163 3300009147 Bacteria 1473
440 Ga0114129_10583895 3300009147 Bacteria 1450
441 Ga0114129_10751048 3300009147 Bacteria 1249
442 Ga0114129_10812656 3300009147 Bacteria 1192
443 Ga0114129_10814483 3300009147 Bacteria 1190
444 Ga0114129_10984355 3300009147 Unclassified 1063
445 Ga0114129_11293496 3300009147 Bacteria 904
446 Ga0114129_11360250 3300009147 Unclassified 878
447 Ga0114129_11835151 3300009147 Unclassified 736
448 Ga0114129_13005162 3300009147 Unclassified 554
449 Ga0105243_10010062 3300009148 Bacteria 7192
450 Ga0105243_10188242 3300009148 Bacteria 1801
451 Ga0105243_10316311 3300009148 Unclassified 1421
452 Ga0105243_11843306 3300009148 Unclassified 637
453 Ga0105243_11966992 3300009148 Bacteria 618
454 Ga0105241_10089672 3300009174 Bacteria 2423
455 Ga0105241_11725112 3300009174 Bacteria 609
456 Ga0105241_12347566 3300009174 Unclassified 531
457 Ga0105242_10007316 3300009176 Bacteria 8501
458 Ga0105242_10369628 3300009176 Bacteria 1330
459 Ga0105242_10515389 3300009176 Bacteria 1140
460 Ga0105248_10095738 3300009177 Bacteria 3342
461 Ga0105248_12652635 3300009177 Unclassified 571
462 Ga0105237_11513625 3300009545 Bacteria 678
463 Ga0105238_11572809 3300009551 Bacteria 687
464 Ga0105249_10040450 3300009553 Bacteria 4235
465 Ga0105249_10096464 3300009553 Bacteria 2774
466 Ga0105249_10419996 3300009553 Bacteria 1371
467 Ga0105249_10747540 3300009553 Unclassified 1040
468 Ga0105249_10772388 3300009553 Bacteria 1024
469 Ga0105249_11063464 3300009553 Bacteria 879
470 Ga0105249_11215373 3300009553 Bacteria 825
471 Ga0105249_11495040 3300009553 Bacteria 748
472 Ga0105249_11990528 3300009553 Bacteria 654
473 Ga0105249_12450731 3300009553 Unclassified 594
474 Ga0105239_10579215 3300010375 Bacteria 1279
475 Ga0105246_12074396 3300011119 Archaea 550
476 Ga0157371_10561960 3300013102 Bacteria 846
477 Ga0157374_10140541 3300013296 Bacteria 2344
478 Ga0157378_10144374 3300013297 Bacteria 2212
479 Ga0157378_10148846 3300013297 Bacteria 2180
480 Ga0157378_10676683 3300013297 Unclassified 1049
481 Ga0157378_11963687 3300013297 Unclassified 635
482 Ga0163162_10089299 3300013306 Bacteria 3162
483 Ga0163162_10281103 3300013306 Bacteria 1796
484 Ga0163162_10479706 3300013306 Bacteria 1375
485 Ga0163162_11336249 3300013306 Unclassified 815
486 Ga0163162_11944991 3300013306 Bacteria 673
487 Ga0163162_12888041 3300013306 Unclassified 553
488 Ga0157375_10365282 3300013308 Bacteria 1609
489 Ga0157375_10502312 3300013308 Unclassified 1377
490 Ga0157375_11381743 3300013308 Unclassified 829
491 Ga0157375_11425884 3300013308 Bacteria 816
492 Ga0163163_11584434 3300014325 Bacteria 716
493 Ga0163163_11763462 3300014325 Bacteria 679
494 Ga0157380_10012811 3300014326 Bacteria 6093
495 Ga0157380_11252282 3300014326 Bacteria 787
496 Ga0157380_11262628 3300014326 Unclassified 784
497 Ga0157380_11669675 3300014326 Bacteria 694
498 Ga0157380_11781637 3300014326 Unclassified 675
499 Ga0157380_12364832 3300014326 Bacteria 596
500 Ga0157380_12482058 3300014326 Bacteria 584
501 Ga0157377_10905265 3300014745 Bacteria 660
502 Ga0157379_10263328 3300014968 Unclassified 1567
503 Ga0157379_10342888 3300014968 Bacteria 1367
504 Ga0157379_10408297 3300014968 Unclassified 1249
505 Ga0157376_10366069 3300014969 Bacteria 1384
506 Ga0157376_11959727 3300014969 Bacteria 623
507 Ga0157376_12516474 3300014969 Unclassified 554
508 Ga0163161_10275653 3300017792 Unclassified 1318
509 Ga0163161_10372776 3300017792 Bacteria 1139
510 Ga0163161_10735901 3300017792 Unclassified 824
511 Ga0163161_11039582 3300017792 Bacteria 701
512 Ga0207653_10017883 3300025885 Bacteria 2233
513 Ga0207653_10056547 3300025885 Bacteria 1316
514 Ga0207653_10174455 3300025885 Bacteria 802
515 Ga0207653_10406129 3300025885 Unclassified 534
516 Ga0207682_10039855 3300025893 Bacteria 1911
517 Ga0207642_10103688 3300025899 Bacteria 1433
518 Ga0207710_10093146 3300025900 Bacteria 1413
519 Ga0207710_10379410 3300025900 Bacteria 723
520 Ga0207688_10173884 3300025901 Bacteria 1281
521 Ga0207688_10259532 3300025901 Unclassified 1054
522 Ga0207680_10140445 3300025903 Unclassified 1601
523 Ga0207680_10947020 3300025903 Bacteria 617
524 Ga0207680_11172761 3300025903 Bacteria 548
525 Ga0207685_10697662 3300025905 Bacteria 552
526 Ga0207699_10198827 3300025906 Unclassified 1357
527 Ga0207643_10149260 3300025908 Bacteria 1400
528 Ga0207643_10155577 3300025908 Bacteria 1373
529 Ga0207643_10171496 3300025908 Archaea 1309
530 Ga0207643_10391337 3300025908 Bacteria 878
531 Ga0207684_10001250 3300025910 Bacteria 28183
532 Ga0207684_10018301 3300025910 Bacteria 5996
533 Ga0207684_10145913 3300025910 Bacteria 2035
534 Ga0207684_10167659 3300025910 Bacteria 1893
535 Ga0207684_10170085 3300025910 Bacteria 1878
536 Ga0207684_10315993 3300025910 Bacteria 1346
537 Ga0207684_10479095 3300025910 Bacteria 1067
538 Ga0207684_10758209 3300025910 Bacteria 822
539 Ga0207684_10948524 3300025910 Bacteria 721
540 Ga0207654_10205454 3300025911 Bacteria 1299
541 Ga0207707_11080304 3300025912 Bacteria 655
542 Ga0207693_10001797 3300025915 Bacteria 18804
543 Ga0207660_10020589 3300025917 Bacteria 4429
544 Ga0207660_10076680 3300025917 Bacteria 2445
545 Ga0207660_10143385 3300025917 Bacteria 1828
546 Ga0207660_10493473 3300025917 Bacteria 993
547 Ga0207660_11058195 3300025917 Unclassified 661
548 Ga0207660_11376146 3300025917 Unclassified 572
549 Ga0207662_10110357 3300025918 Unclassified 1714
550 Ga0207649_10297175 3300025920 Bacteria 1179
551 Ga0207652_10154746 3300025921 Bacteria 2054
552 Ga0207646_10000298 3300025922 Bacteria 67489
553 Ga0207646_10002725 3300025922 Bacteria 20683
554 Ga0207646_10011610 3300025922 Bacteria 8517
555 Ga0207646_10028658 3300025922 Bacteria 5066
556 Ga0207646_10108266 3300025922 Bacteria 2493
557 Ga0207646_10124147 3300025922 Bacteria 2321
558 Ga0207646_11348033 3300025922 Bacteria 622
559 Ga0207681_10013004 3300025923 Bacteria 5145
560 Ga0207681_10226847 3300025923 Bacteria 1448
561 Ga0207681_10644239 3300025923 Bacteria 878
562 Ga0207681_10728413 3300025923 Unclassified 826
563 Ga0207681_11819793 3300025923 Unclassified 508
564 Ga0207694_11097811 3300025924 Bacteria 673
565 Ga0207659_10084675 3300025926 Bacteria 2353
566 Ga0207659_10892434 3300025926 Bacteria 764
567 Ga0207659_11244622 3300025926 Bacteria 639
568 Ga0207687_10428488 3300025927 Archaea 1093
569 Ga0207690_10323632 3300025932 Bacteria 1213
570 Ga0207706_10039941 3300025933 Bacteria 4160
571 Ga0207706_10103116 3300025933 Bacteria 2509
572 Ga0207706_10295414 3300025933 Bacteria 1412
573 Ga0207706_10448080 3300025933 Bacteria 1117
574 Ga0207706_10788815 3300025933 Bacteria 808
575 Ga0207686_10092567 3300025934 Bacteria 1999
576 Ga0207686_10418887 3300025934 Bacteria 1024
577 Ga0207709_10009745 3300025935 Bacteria 5295
578 Ga0207709_10114164 3300025935 Bacteria 1812
579 Ga0207709_10198351 3300025935 Bacteria 1431
580 Ga0207709_10267548 3300025935 Bacteria 1256
581 Ga0207670_10134960 3300025936 Bacteria 1813
582 Ga0207670_11203801 3300025936 Bacteria 641
583 Ga0207669_10002819 3300025937 Bacteria 7451
584 Ga0207669_10694042 3300025937 Unclassified 836
585 Ga0207669_11087110 3300025937 Bacteria 675
586 Ga0207669_11322104 3300025937 Bacteria 613
587 Ga0207704_10547977 3300025938 Bacteria 939
588 Ga0207704_10790383 3300025938 Unclassified 792
589 Ga0207704_10979807 3300025938 Archaea 714
590 Ga0207704_11569822 3300025938 Unclassified 565
591 Ga0207665_10467870 3300025939 Bacteria 970
592 Ga0207691_10018385 3300025940 Bacteria 6623
593 Ga0207691_11385314 3300025940 Bacteria 578
594 Ga0207691_11427519 3300025940 Bacteria 568
595 Ga0207711_10262659 3300025941 Bacteria 1587
596 Ga0207689_10017977 3300025942 Bacteria 5969
597 Ga0207689_10861608 3300025942 Bacteria 764
598 Ga0207661_10796406 3300025944 Bacteria 870
599 Ga0207679_11332113 3300025945 Bacteria 659
600 Ga0207712_10039637 3300025961 Bacteria 3229
601 Ga0207712_10065205 3300025961 Bacteria 2599
602 Ga0207712_10294793 3300025961 Unclassified 1329
603 Ga0207712_11101464 3300025961 Bacteria 707
604 Ga0207712_11322542 3300025961 Unclassified 644
605 Ga0207668_10056024 3300025972 Bacteria 2744
606 Ga0207668_10336720 3300025972 Bacteria 1257
607 Ga0207640_10302985 3300025981 Unclassified 1265
608 Ga0207677_10412597 3300026023 Bacteria 1148
609 Ga0207703_11274917 3300026035 Bacteria 707
610 Ga0207703_11324665 3300026035 Archaea 693
611 Ga0207703_11466203 3300026035 Unclassified 656
612 Ga0207678_10540301 3300026067 Bacteria 1019
613 Ga0207708_10070499 3300026075 Bacteria 2676
614 Ga0207708_10118052 3300026075 Bacteria 2065
615 Ga0207708_10144577 3300026075 Bacteria 1868
616 Ga0207708_10299100 3300026075 Bacteria 1308
617 Ga0207708_10322081 3300026075 Bacteria 1262
618 Ga0207708_10704847 3300026075 Unclassified 863
619 Ga0207708_10956063 3300026075 Bacteria 743
620 Ga0207708_11263138 3300026075 Bacteria 646
621 Ga0207641_10298159 3300026088 Bacteria 1522
622 Ga0207641_10499569 3300026088 Bacteria 1181
623 Ga0207641_10594614 3300026088 Bacteria 1083
624 Ga0207641_11798391 3300026088 Unclassified 614
625 Ga0207648_10172648 3300026089 Bacteria 1911
626 Ga0207648_10182739 3300026089 Bacteria 1856
627 Ga0207648_10400569 3300026089 Bacteria 1243
628 Ga0207648_10941849 3300026089 Bacteria 808
629 Ga0207648_11703534 3300026089 Bacteria 592
630 Ga0207676_11048110 3300026095 Bacteria 805
631 Ga0207674_10009097 3300026116 Bacteria 11398
632 Ga0207674_10026837 3300026116 Bacteria 6109
633 Ga0207674_10143310 3300026116 Bacteria 2348
634 Ga0207674_12006178 3300026116 Unclassified 543
635 Ga0207675_100036637 3300026118 Bacteria 4575
636 Ga0207675_100166659 3300026118 Bacteria 2104
637 Ga0207675_100231606 3300026118 Bacteria 1782
638 Ga0207675_102057957 3300026118 Unclassified 588
639 Ga0207675_102371264 3300026118 Bacteria 543
640 Ga0207683_10074332 3300026121 Bacteria 3007
641 Ga0207683_10469550 3300026121 Bacteria 1161
642 Ga0207683_10556269 3300026121 Bacteria 1061
643 Ga0207698_10349105 3300026142 Unclassified 1397
644 Ga0209969_1085366 3300027360 Unclassified 506
645 Ga0209999_1085370 3300027543 Unclassified 610
646 Ga0209970_1006010 3300027614 Bacteria 1991
647 Ga0209983_1029238 3300027665 Bacteria 1171
648 Ga0209588_1030636 3300027671 Bacteria 1719
649 Ga0209588_1105923 3300027671 Bacteria 904
650 Ga0209588_1190941 3300027671 Bacteria 640
651 Ga0209588_1262696 3300027671 Unclassified 525
652 Ga0209971_1003272 3300027682 Bacteria 3850
653 Ga0209971_1046567 3300027682 Unclassified 1046
654 Ga0209971_1070487 3300027682 Bacteria 848
655 Ga0209971_1103539 3300027682 Bacteria 697
656 Ga0209966_1013086 3300027695 Bacteria 1531
657 Ga0209966_1039891 3300027695 Bacteria 976
658 Ga0209998_10008211 3300027717 Bacteria 2167
659 Ga0209974_10011233 3300027876 Bacteria 3014
660 Ga0209974_10293449 3300027876 Bacteria 621
661 Ga0207428_10000176 3300027907 Bacteria 89634
662 Ga0207428_10000781 3300027907 Bacteria 36098
663 Ga0207428_10004655 3300027907 Bacteria 12995
664 Ga0207428_10048517 3300027907 Bacteria 3406
665 Ga0207428_10074240 3300027907 Bacteria 2667
666 Ga0207428_10254327 3300027907 Bacteria 1309
667 Ga0207428_11005567 3300027907 Unclassified 586
668 Ga0207428_11275236 3300027907 Bacteria 510
669 Ga0207428_11318857 3300027907 Unclassified 500
670 Ga0268265_10203094 3300028380 Bacteria 1721
671 Ga0268265_10437182 3300028380 Bacteria 1219
672 Ga0268265_11209523 3300028380 Unclassified 753
673 Ga0268265_11411912 3300028380 Archaea 698
674 Ga0268265_11546409 3300028380 Unclassified 668
675 Ga0268265_11832109 3300028380 Bacteria 613
676 Ga0268265_12270289 3300028380 Bacteria 549
677 Ga0268264_10068325 3300028381 Bacteria 3002
678 Ga0268264_10103322 3300028381 Bacteria 2481
679 Ga0268264_10308422 3300028381 Unclassified 1492
680 Ga0268264_10870069 3300028381 Bacteria 903
681 Ga0268264_11310466 3300028381 Unclassified 734
682 Ga0307408_100060906 3300031548 Bacteria 2753
683 Ga0307408_100159079 3300031548 Unclassified 1792
684 Ga0307408_100267404 3300031548 Bacteria 1418
685 Ga0307408_100273097 3300031548 Bacteria 1404
686 Ga0307408_100275578 3300031548 Bacteria 1398
687 Ga0307408_100339673 3300031548 Unclassified 1271
688 Ga0307408_100364120 3300031548 Bacteria 1231
689 Ga0307408_100364548 3300031548 Bacteria 1230
690 Ga0307408_100394172 3300031548 Bacteria 1187
691 Ga0307408_101231911 3300031548 Unclassified 699
692 Ga0307408_101334011 3300031548 Bacteria 673
693 Ga0307408_101948325 3300031548 Bacteria 564
694 Ga0316578_10170351 3300031728 Bacteria 1312
695 Ga0307405_10159272 3300031731 Bacteria 1597
696 Ga0307405_10654895 3300031731 Bacteria 864
697 Ga0307405_12075545 3300031731 Unclassified 510
698 Ga0316577_10010268 3300031733 Bacteria 5050
699 Ga0307413_10160339 3300031824 Bacteria 1579
700 Ga0307413_10726973 3300031824 Bacteria 827
701 Ga0307410_10029895 3300031852 Bacteria 3475
702 Ga0307410_10453612 3300031852 Bacteria 1046
703 Ga0307410_11065420 3300031852 Bacteria 699
704 Ga0307410_11642931 3300031852 Unclassified 568
705 Ga0307410_11737208 3300031852 Unclassified 553
706 Ga0307410_11950363 3300031852 Unclassified 523
707 Ga0307406_10215121 3300031901 Bacteria 1424
708 Ga0307406_10414435 3300031901 Bacteria 1071
709 Ga0307406_11432937 3300031901 Bacteria 606
710 Ga0307406_11955477 3300031901 Bacteria 523
711 Ga0307407_10536933 3300031903 Bacteria 862
712 Ga0307407_11032500 3300031903 Unclassified 636
713 Ga0307407_11623564 3300031903 Bacteria 513
714 Ga0307412_11246766 3300031911 Bacteria 667
715 Ga0307412_11801569 3300031911 Bacteria 563
716 Ga0307412_12185693 3300031911 Unclassified 515
717 Ga0307409_100024576 3300031995 Bacteria 4205
718 Ga0307409_100044761 3300031995 Bacteria 3336
719 Ga0307409_100375040 3300031995 Bacteria 1350
720 Ga0307409_100727497 3300031995 Bacteria 994
721 Ga0307409_101603700 3300031995 Bacteria 679
722 Ga0307409_101716943 3300031995 Bacteria 657
723 Ga0307409_102504004 3300031995 Bacteria 545
724 Ga0307416_100044347 3300032002 Bacteria 3491
725 Ga0307416_100266650 3300032002 Bacteria 1678
726 Ga0307416_100441919 3300032002 Bacteria 1351
727 Ga0307416_100664259 3300032002 Unclassified 1128
728 Ga0307416_101683045 3300032002 Bacteria 739
729 Ga0307416_101757393 3300032002 Unclassified 724
730 Ga0307414_10045212 3300032004 Bacteria 3014
731 Ga0307414_10295473 3300032004 Bacteria 1368
732 Ga0307411_10311622 3300032005 Bacteria 1267
733 Ga0307411_10318764 3300032005 Bacteria 1254
734 Ga0307411_10464116 3300032005 Bacteria 1062
735 Ga0307411_11205138 3300032005 Bacteria 686
736 Ga0307411_12143818 3300032005 Bacteria 523
737 Ga0307415_100144131 3300032126 Bacteria 1824
738 Ga0307415_100322885 3300032126 Bacteria 1288
739 Ga0307415_100847439 3300032126 Bacteria 838
740 Ga0307415_101174051 3300032126 Bacteria 722
741 Ga0316580_10172176 3300032139 Bacteria 665
742 Ga0373930_0005852 3300034816 Bacteria 2059
743 Ga0373948_0016663 3300034817 Bacteria 1361
744 Ga0373948_0030107 3300034817 Bacteria 1090
745 Ga0373950_0028497 3300034818 Bacteria 1024
746 Ga0373958_0079484 3300034819 Bacteria 740
747 Ga0373928_0009053 3300035084 Bacteria 1943
748 Ga0373929_0112210 3300035085 Bacteria 698
749 Ga0373940_0003750 3300035088 Bacteria 3138
750 Ga0373940_0014053 3300035088 Bacteria 1947
751 Ga0373940_0214227 3300035088 Bacteria 638
752 Ga0373949_0007945 3300035090 Bacteria 2324
753 Ga0373949_0034496 3300035090 Bacteria 1220
754 Ga0373932_0019437 3300035112 Bacteria 1770
755 Ga0373939_0005698 3300035114 Bacteria 2970
756 Ga0373939_0011421 3300035114 Bacteria 2240
757 Ga0373939_0057142 3300035114 Bacteria 1230
758 Ga0373939_0483861 3300035114 Bacteria 526
759 Ga0373939_0509287 3300035114 Bacteria 515
760 Ga0373960_0128905 3300035121 Unclassified 846
761 Ga0373943_0253067 3300035170 Bacteria 990
762 Ga0373946_0580398 3300035171 Unclassified 580
763 Ga0373961_0379683 3300035241 Bacteria 538
764 Ga0373962_0035765 3300035242 Bacteria 1380
765 Ga0373962_0322815 3300035242 Unclassified 552
766 Ga0373962_0328211 3300035242 Bacteria 548
767 Ga0373931_0025696 3300035691 Bacteria 2991
768 Ga0373931_0028904 3300035691 Bacteria 2842
769 Ga0373931_0552096 3300035691 Unclassified 748
770 Ga0373931_0813431 3300035691 Bacteria 624
771 Ga0373947_0241933 3300035725 Unclassified 1191
772 Ga0373937_1712756 3300036401 Bacteria 575
773 Ga0316584_0927831 3300036712 Bacteria 585
774 Ga0395899_0126457 3300037312 Bacteria 1828
775 Ga0395900_0002079 3300037418 Bacteria 22453
776 Ga0395900_0242885 3300037418 Bacteria 1805
777 Ga0395898_0046862 3300037466 Bacteria 4245
778 Ga0395898_1274718 3300037466 Bacteria 665
779 Ga0395905_0130949 3300037471 Bacteria 2359
780 Ga0395905_0139864 3300037471 Bacteria 2278
781 Ga0395905_0844582 3300037471 Unclassified 819
782 Ga0395901_0001177 3300038443 Bacteria 27791
783 Ga0395901_0176099 3300038443 Bacteria 2244
784 Ga0242420_020273 3300038996 Bacteria 1182
785 Ga0242420_099773 3300038996 Bacteria 617
786 Ga0439439_0118106 3300041406 Bacteria 738
787 Ga0439453_0094376 3300041408 Bacteria 660
788 Ga0439453_0162166 3300041408 Bacteria 536
789 Ga0439461_0090063 3300041410 Bacteria 735
790 Ga0451807_0181735 3300041486 Unclassified 960
791 Ga0451807_0779600 3300041486 Unclassified 542
792 Ga0451807_1410496 3300041486 Archaea 763
793 Ga0439431_0084275 3300041997 Unclassified 860
794 Ga0439431_0175529 3300041997 Bacteria 617
795 Ga0439433_0001765 3300041999 Bacteria 4488
796 Ga0439433_0121970 3300041999 Unclassified 658
797 Ga0439441_144495 3300042001 Bacteria 558
798 Ga0439442_065831 3300042002 Unclassified 770
799 Ga0439449_0203202 3300042007 Bacteria 742
800 Ga0439449_0345116 3300042007 Unclassified 563
801 Ga0439449_0382617 3300042007 Unclassified 534
802 Ga0439450_036305 3300042008 Bacteria 1128
803 Ga0439450_081339 3300042008 Bacteria 806
804 Ga0439451_056827 3300042009 Bacteria 783
805 Ga0439462_0041172 3300042015 Bacteria 1233
806 Ga0450919_025999 3300042121 Unclassified 665
807 Ga0450920_037922 3300042122 Bacteria 958
808 Ga0450920_089054 3300042122 Bacteria 636
809 Ga0450923_054352 3300042125 Unclassified 865
810 Ga0450923_125858 3300042125 Bacteria 607
811 Ga0450894_013771 3300042131 Bacteria 1064
812 Ga0450896_017122 3300042133 Bacteria 1045
813 Ga0439446_0155222 3300042156 Unclassified 754
814 Ga0439446_0157530 3300042156 Bacteria 749
815 Ga0439446_0225511 3300042156 Bacteria 640
816 Ga0439446_0313940 3300042156 Bacteria 552
817 Ga0439434_0050385 3300042435 Bacteria 1290
818 Ga0439434_0255791 3300042435 Bacteria 599
819 Ga0439435_0212737 3300042436 Bacteria 641
820 Ga0439444_0013165 3300042437 Bacteria 1367
821 Ga0439464_0087724 3300042439 Unclassified 935
822 Ga0439464_0332078 3300042439 Bacteria 500
823 Ga0439460_0071619 3300042461 Bacteria 1075
824 Ga0439460_0211041 3300042461 Bacteria 664
825 Ga0439460_0244493 3300042461 Unclassified 619
826 Ga0451577_0003798 3300042876 Bacteria 16437
827 Ga0451577_0241557 3300042876 Bacteria 1634
828 Ga0451577_0607730 3300042876 Unclassified 992
829 Ga0451577_0682905 3300042876 Bacteria 930
830 Ga0439440_0140295 3300042993 Bacteria 686
831 Ga0453683_0044184 3300044673 Bacteria 2795
832 Ga0453683_0218621 3300044673 Bacteria 1211
833 Ga0453683_0446692 3300044673 Bacteria 836
834 Ga0453684_0055373 3300044712 Bacteria 5156
835 Ga0453684_0087483 3300044712 Bacteria 3861
836 Ga0453684_0379824 3300044712 Bacteria 1587
837 Ga0453684_0590051 3300044712 Bacteria 1219
838 Ga0451576_0017424 3300045051 Bacteria 7898
839 Ga0451576_0027337 3300045051 Bacteria 6129
840 Ga0451576_0132764 3300045051 Bacteria 2595
841 Ga0451576_0151484 3300045051 Bacteria 2419
842 Ga0451576_0181962 3300045051 Bacteria 2194
843 Ga0451576_0225968 3300045051 Bacteria 1955
844 Ga0451576_0242115 3300045051 Bacteria 1884
845 Ga0451576_0462105 3300045051 Bacteria 1333
846 Ga0451576_0758699 3300045051 Bacteria 1019
847 Ga0451576_0808547 3300045051 Bacteria 984
848 Ga0451576_1870878 3300045051 Unclassified 620
849 Ga0495592_0251658 3300046454 Bacteria 1167
850 Ga0495603_0561514 3300046455 Unclassified 653
851 Ga0495603_0652759 3300046455 Unclassified 602
852 Ga0495629_0384579 3300046459 Bacteria 955
853 Ga0495580_0022267 3300046472 Bacteria 4665
854 Ga0495582_0049698 3300046473 Bacteria 2309
855 Ga0495639_0313536 3300046475 Unclassified 784
856 Ga0495584_0150657 3300046491 Bacteria 1182
857 Ga0495585_0309630 3300046492 Unclassified 775
858 Ga0495594_0035822 3300046499 Bacteria 2705
859 Ga0495594_0101325 3300046499 Bacteria 1620
860 Ga0495608_0360732 3300046511 Bacteria 893
861 Ga0495618_0727901 3300046514 Bacteria 582
862 Ga0495628_0069593 3300046516 Bacteria 2745
863 Ga0495630_1451992 3300046517 Bacteria 515
864 Ga0495642_0002373 3300046528 Bacteria 7675
865 Ga0495642_0049597 3300046528 Bacteria 1725
866 Ga0495642_0104636 3300046528 Unclassified 1207
867 Ga0495652_0242493 3300046529 Unclassified 1340
868 Ga0495640_0301537 3300046533 Bacteria 995
869 Ga0495598_0247502 3300046537 Bacteria 659
870 Ga0495598_0368179 3300046537 Bacteria 556
871 Ga0495598_0371083 3300046537 Bacteria 554
872 Ga0495656_0068037 3300046615 Bacteria 1573
873 Ga0495656_0468247 3300046615 Bacteria 665
874 Ga0495625_0547707 3300046660 Bacteria 701
875 Ga0495659_0010679 3300046664 Bacteria 2953
876 Ga0495659_0049413 3300046664 Bacteria 1527
877 Ga0495659_0160332 3300046664 Bacteria 908
878 Ga0495659_0196738 3300046664 Bacteria 825
879 Ga0495599_0085970 3300046678 Bacteria 1964
880 Ga0495658_0132284 3300046683 Bacteria 1519
881 Ga0495669_0014804 3300046684 Bacteria 3337
882 Ga0495669_0014835 3300046684 Bacteria 3333
883 Ga0495669_0227115 3300046684 Bacteria 895
884 Ga0495669_0304188 3300046684 Unclassified 769
885 Ga0495669_0653626 3300046684 Bacteria 511
886 Ga0495613_0399207 3300046689 Unclassified 938
887 Ga0495670_0819661 3300046691 Bacteria 508
888 Ga0495581_0503074 3300047315 Bacteria 704
889 Ga0495636_0268934 3300047318 Bacteria 792
890 Ga0495636_0276640 3300047318 Bacteria 781
891 Ga0495680_0526878 3300047322 Bacteria 799
892 Ga0496100_0049101 3300048903 Bacteria 2727
893 Ga0496101_0056536 3300048904 Bacteria 2837
894 Ga0496102_0015235 3300048905 Bacteria 6694
895 Ga0496102_0924655 3300048905 Bacteria 794
896 Ga0496103_0059659 3300048906 Bacteria 2370
897 Ga0496104_0195490 3300048907 Bacteria 1935
898 Ga0496104_0875400 3300048907 Bacteria 803
899 Ga0496104_1093088 3300048907 Bacteria 701
900 Ga0496105_0255983 3300048908 Bacteria 1417
901 Ga0496106_0270654 3300048909 Bacteria 1360
902 Ga0496106_0747442 3300048909 Bacteria 778
903 Ga0496107_0113152 3300048910 Bacteria 1996
904 Ga0496108_0190791 3300048911 Bacteria 1776
905 Ga0496108_1175204 3300048911 Bacteria 650
906 Ga0496112_0724441 3300048915 Bacteria 922
907 Ga0496113_1386942 3300048916 Bacteria 545
908 Ga0496113_1421039 3300048916 Bacteria 537
909 Ga0496114_0446641 3300048917 Bacteria 1145
910 Ga0496115_1322520 3300048918 Unclassified 536
911 Ga0501297_032835 3300049520 Bacteria 699
912 Ga0501031_0002847 3300049568 Bacteria 11044
913 Ga0501031_0184746 3300049568 Bacteria 1362
914 Ga0501031_0366538 3300049568 Unclassified 932
915 Ga0501031_0592498 3300049568 Bacteria 713
916 Ga0501031_0643859 3300049568 Bacteria 681
917 Ga0501032_0072896 3300049569 Bacteria 2288
918 Ga0501033_0027258 3300049570 Bacteria 4296
919 Ga0501033_0040174 3300049570 Bacteria 3493
920 Ga0501033_0046480 3300049570 Bacteria 3227
921 Ga0501033_0093240 3300049570 Bacteria 2202
922 Ga0501033_0413609 3300049570 Unclassified 940
923 Ga0501033_0431276 3300049570 Bacteria 917
924 Ga0501033_0707116 3300049570 Unclassified 685
925 Ga0501036_0006593 3300049572 Bacteria 9431
926 Ga0501036_0006916 3300049572 Bacteria 9221
927 Ga0501036_0101003 3300049572 Bacteria 2440
928 Ga0501036_0219481 3300049572 Bacteria 1597
929 Ga0501036_0223019 3300049572 Bacteria 1583
930 Ga0501036_0387714 3300049572 Bacteria 1166
931 Ga0501036_0460004 3300049572 Bacteria 1060
932 Ga0501036_0535303 3300049572 Bacteria 974
933 Ga0501036_0623985 3300049572 Bacteria 893
934 Ga0501036_0911274 3300049572 Unclassified 721
935 Ga0501036_0942067 3300049572 Bacteria 708
936 Ga0501036_1093132 3300049572 Bacteria 651
937 Ga0501037_0472699 3300049573 Bacteria 853
938 Ga0501037_0656759 3300049573 Archaea 700
939 Ga0501038_0000908 3300049574 Bacteria 26224
940 Ga0501038_0050187 3300049574 Bacteria 3606
941 Ga0501038_0099045 3300049574 Bacteria 2430
942 Ga0501038_0113781 3300049574 Bacteria 2239
943 Ga0501038_0473604 3300049574 Bacteria 960
944 Ga0501038_0712992 3300049574 Bacteria 751
945 Ga0501039_0000591 3300049575 Bacteria 26211
946 Ga0501039_0030213 3300049575 Bacteria 4177
947 Ga0501039_0050669 3300049575 Bacteria 3213
948 Ga0501039_0124808 3300049575 Bacteria 2019
949 Ga0501039_0211767 3300049575 Bacteria 1524
950 Ga0501039_0259381 3300049575 Bacteria 1366
951 Ga0501039_0417415 3300049575 Bacteria 1054
952 Ga0501039_0606347 3300049575 Bacteria 858
953 Ga0501039_0712899 3300049575 Bacteria 784
954 Ga0501040_0000838 3300049576 Bacteria 19253
955 Ga0501040_0016800 3300049576 Bacteria 4852
956 Ga0501040_0041399 3300049576 Bacteria 3138
957 Ga0501040_0069175 3300049576 Bacteria 2435
958 Ga0501040_0099155 3300049576 Bacteria 2031
959 Ga0501040_0153938 3300049576 Bacteria 1623
960 Ga0501040_0326060 3300049576 Bacteria 1098
961 Ga0501040_0381651 3300049576 Bacteria 1011
962 Ga0501040_0430324 3300049576 Unclassified 949
963 Ga0501040_0601354 3300049576 Unclassified 794
964 Ga0501040_0642022 3300049576 Unclassified 767
965 Ga0501040_0645722 3300049576 Bacteria 765
966 Ga0501040_0823449 3300049576 Unclassified 672
967 Ga0501040_1208717 3300049576 Bacteria 548
968 Ga0501041_0018129 3300049577 Bacteria 4192
969 Ga0501041_0022081 3300049577 Bacteria 3810
970 Ga0501041_0025272 3300049577 Bacteria 3570
971 Ga0501041_0037188 3300049577 Bacteria 2949
972 Ga0501041_0107195 3300049577 Bacteria 1732
973 Ga0501041_0109780 3300049577 Bacteria 1711
974 Ga0501041_0129408 3300049577 Bacteria 1572
975 Ga0501041_0210857 3300049577 Bacteria 1218
976 Ga0501041_0253571 3300049577 Bacteria 1106
977 Ga0501041_0595573 3300049577 Bacteria 705
978 Ga0501041_0755948 3300049577 Bacteria 623
979 Ga0501041_0856749 3300049577 Unclassified 583
980 Ga0501041_1005807 3300049577 Unclassified 536
981 Ga0501042_0001801 3300049578 Bacteria 12831
982 Ga0501042_0026046 3300049578 Bacteria 4111
983 Ga0501042_0027646 3300049578 Bacteria 3989
984 Ga0501042_0054890 3300049578 Bacteria 2842
985 Ga0501042_0060865 3300049578 Bacteria 2697
986 Ga0501042_0075715 3300049578 Bacteria 2408
987 Ga0501042_0174686 3300049578 Bacteria 1550
988 Ga0501042_0230596 3300049578 Bacteria 1336
989 Ga0501042_0606438 3300049578 Bacteria 796
990 Ga0501042_0787233 3300049578 Bacteria 692
991 Ga0501042_0809287 3300049578 Unclassified 682
992 Ga0501042_1027650 3300049578 Unclassified 601
993 Ga0501042_1146885 3300049578 Bacteria 567
994 Ga0501043_0018220 3300049579 Bacteria 5505
995 Ga0501043_0043387 3300049579 Bacteria 3535
996 Ga0501043_0060928 3300049579 Bacteria 2963
997 Ga0501043_0485457 3300049579 Bacteria 925
998 Ga0501043_0784563 3300049579 Bacteria 690
999 Ga0501043_0960645 3300049579 Unclassified 610
1000 Ga0501043_0963649 3300049579 Bacteria 609
1001 Ga0501043_1235803 3300049579 Unclassified 523
1002 Ga0501046_0000373 3300049580 Bacteria 45356
1003 Ga0501046_0018535 3300049580 Bacteria 5788
1004 Ga0501046_0094197 3300049580 Bacteria 2302
1005 Ga0501046_0109742 3300049580 Bacteria 2109
1006 Ga0501046_0115512 3300049580 Bacteria 2047
1007 Ga0501046_0143906 3300049580 Unclassified 1802
1008 Ga0501046_0217908 3300049580 Bacteria 1415
1009 Ga0501046_0222627 3300049580 Unclassified 1396
1010 Ga0501046_0351384 3300049580 Bacteria 1070
1011 Ga0501046_0422581 3300049580 Bacteria 961
1012 Ga0501046_0459182 3300049580 Bacteria 915
1013 Ga0501047_0693553 3300049581 Unclassified 836
1014 Ga0501048_0006097 3300049582 Bacteria 9183
1015 Ga0501048_0021170 3300049582 Bacteria 4761
1016 Ga0501048_0026116 3300049582 Bacteria 4253
1017 Ga0501048_0056962 3300049582 Bacteria 2772
1018 Ga0501048_0074278 3300049582 Bacteria 2399
1019 Ga0501048_0082151 3300049582 Bacteria 2273
1020 Ga0501048_0275012 3300049582 Unclassified 1197
1021 Ga0501048_0356297 3300049582 Bacteria 1044
1022 Ga0501048_0695143 3300049582 Unclassified 730
1023 Ga0501048_0705000 3300049582 Bacteria 725
1024 Ga0501048_0737559 3300049582 Bacteria 707
1025 Ga0501048_0852959 3300049582 Bacteria 655
1026 Ga0501048_1036702 3300049582 Unclassified 590
1027 Ga0501048_1096127 3300049582 Bacteria 573
1028 Ga0501048_1141675 3300049582 Unclassified 560
1029 Ga0501067_0082641 3300049583 Bacteria 1781
1030 Ga0501067_0339696 3300049583 Bacteria 837
1031 Ga0501068_0002133 3300049584 Bacteria 10536
1032 Ga0501068_0049800 3300049584 Bacteria 2531
1033 Ga0501068_0288854 3300049584 Bacteria 1049
1034 Ga0501068_0435299 3300049584 Unclassified 847
1035 Ga0501068_0516374 3300049584 Bacteria 775
1036 Ga0501068_0533014 3300049584 Bacteria 763
1037 Ga0501068_0620682 3300049584 Bacteria 705
1038 Ga0501069_0060340 3300049585 Bacteria 2117
1039 Ga0501069_0136617 3300049585 Bacteria 1405
1040 Ga0501069_0140635 3300049585 Bacteria 1385
1041 Ga0501069_0160220 3300049585 Bacteria 1296
1042 Ga0501069_0497645 3300049585 Unclassified 727
1043 Ga0501069_0524058 3300049585 Bacteria 708
1044 Ga0501069_0570453 3300049585 Bacteria 678
1045 Ga0501069_0614865 3300049585 Bacteria 653
1046 Ga0501070_0247259 3300049586 Bacteria 1459
1047 Ga0501070_0412669 3300049586 Bacteria 1091
1048 Ga0501070_1305520 3300049586 Bacteria 554
1049 Ga0501070_1402106 3300049586 Bacteria 531
1050 Ga0501071_0000085 3300049587 Bacteria 34269
1051 Ga0501071_0021943 3300049587 Bacteria 4451
1052 Ga0501071_0039780 3300049587 Bacteria 3364
1053 Ga0501071_0048313 3300049587 Bacteria 3060
1054 Ga0501071_0080864 3300049587 Bacteria 2377
1055 Ga0501071_0094149 3300049587 Bacteria 2203
1056 Ga0501071_0161043 3300049587 Bacteria 1677
1057 Ga0501071_0206021 3300049587 Bacteria 1478
1058 Ga0501071_0270118 3300049587 Bacteria 1286
1059 Ga0501071_0320337 3300049587 Unclassified 1177
1060 Ga0501071_0717398 3300049587 Bacteria 770
1061 Ga0501071_0803545 3300049587 Unclassified 725
1062 Ga0501071_1071783 3300049587 Bacteria 623
1063 Ga0501071_1263762 3300049587 Bacteria 570
1064 Ga0501072_0000073 3300049588 Bacteria 72845
1065 Ga0501072_0009683 3300049588 Bacteria 7327
1066 Ga0501072_0017526 3300049588 Bacteria 5504
1067 Ga0501072_0030003 3300049588 Bacteria 4250
1068 Ga0501072_0030970 3300049588 Bacteria 4185
1069 Ga0501072_0034295 3300049588 Bacteria 3977
1070 Ga0501072_0037862 3300049588 Bacteria 3783
1071 Ga0501072_0089887 3300049588 Bacteria 2438
1072 Ga0501072_0162370 3300049588 Bacteria 1782
1073 Ga0501072_0206709 3300049588 Bacteria 1565
1074 Ga0501072_0226440 3300049588 Bacteria 1490
1075 Ga0501072_0794330 3300049588 Bacteria 741
1076 Ga0501072_0934306 3300049588 Bacteria 677
1077 Ga0501072_1591068 3300049588 Unclassified 504
1078 Ga0501073_0003505 3300049589 Bacteria 11778
1079 Ga0501073_0083595 3300049589 Bacteria 2221
1080 Ga0501073_0105546 3300049589 Bacteria 1955
1081 Ga0501073_0415283 3300049589 Archaea 930
1082 Ga0501073_0572946 3300049589 Bacteria 780
1083 Ga0501073_0937529 3300049589 Unclassified 596
1084 Ga0501073_1165050 3300049589 Unclassified 529
1085 Ga0501074_0011073 3300049590 Bacteria 6547
1086 Ga0501074_0125030 3300049590 Bacteria 1839
1087 Ga0501074_0184931 3300049590 Bacteria 1486
1088 Ga0501074_0200476 3300049590 Bacteria 1422
1089 Ga0501074_0251955 3300049590 Bacteria 1256
1090 Ga0501074_0270496 3300049590 Bacteria 1208
1091 Ga0501074_1002364 3300049590 Bacteria 587
1092 Ga0501074_1162626 3300049590 Bacteria 541
1093 Ga0501075_0000001 3300049591 Bacteria 229051
1094 Ga0501075_0000203 3300049591 Bacteria 31603
1095 Ga0501075_0005249 3300049591 Bacteria 8860
1096 Ga0501075_0008197 3300049591 Bacteria 7277
1097 Ga0501075_0016522 3300049591 Bacteria 5318
1098 Ga0501075_0029642 3300049591 Bacteria 4048
1099 Ga0501075_0092658 3300049591 Bacteria 2293
1100 Ga0501075_0135379 3300049591 Bacteria 1877
1101 Ga0501075_0140042 3300049591 Bacteria 1843
1102 Ga0501075_0203484 3300049591 Unclassified 1510
1103 Ga0501075_0432947 3300049591 Bacteria 1003
1104 Ga0501075_0512674 3300049591 Unclassified 915
1105 Ga0501075_0548564 3300049591 Unclassified 882
1106 Ga0501075_0684590 3300049591 Bacteria 781
1107 Ga0501075_0742691 3300049591 Bacteria 747
1108 Ga0501075_1144703 3300049591 Bacteria 591
1109 Ga0501075_1357215 3300049591 Bacteria 538
1110 Ga0501075_1357242 3300049591 Bacteria 538
1111 Ga0501076_0000001 3300049592 Bacteria 173877
1112 Ga0501076_0000204 3300049592 Bacteria 35673
1113 Ga0501076_0004772 3300049592 Bacteria 9675
1114 Ga0501076_0016179 3300049592 Bacteria 5649
1115 Ga0501076_0063200 3300049592 Bacteria 2949
1116 Ga0501076_0086738 3300049592 Bacteria 2516
1117 Ga0501076_0087477 3300049592 Bacteria 2505
1118 Ga0501076_0112850 3300049592 Bacteria 2198
1119 Ga0501076_0198143 3300049592 Bacteria 1639
1120 Ga0501076_0241981 3300049592 Bacteria 1476
1121 Ga0501076_0264205 3300049592 Bacteria 1409
1122 Ga0501076_0272455 3300049592 Bacteria 1386
1123 Ga0501076_0438132 3300049592 Bacteria 1076
1124 Ga0501076_0484232 3300049592 Bacteria 1019
1125 Ga0501076_1027332 3300049592 Bacteria 679
1126 Ga0501076_1237776 3300049592 Bacteria 614
1127 Ga0501076_1307212 3300049592 Bacteria 596
1128 Ga0501076_1513577 3300049592 Unclassified 551
1129 Ga0501077_0000023 3300049593 Bacteria 77383
1130 Ga0501077_0002236 3300049593 Bacteria 11670
1131 Ga0501077_0018424 3300049593 Bacteria 4418
1132 Ga0501077_0024326 3300049593 Bacteria 3845
1133 Ga0501077_0043270 3300049593 Bacteria 2863
1134 Ga0501077_0098918 3300049593 Bacteria 1849
1135 Ga0501077_0105770 3300049593 Bacteria 1783
1136 Ga0501077_0142415 3300049593 Bacteria 1520
1137 Ga0501077_0209153 3300049593 Bacteria 1240
1138 Ga0501077_0293138 3300049593 Bacteria 1036
1139 Ga0501077_0428999 3300049593 Bacteria 846
1140 Ga0501077_0525195 3300049593 Bacteria 759
1141 Ga0501077_0748770 3300049593 Unclassified 628
1142 Ga0501077_0854795 3300049593 Bacteria 585
1143 Ga0501079_0000015 3300049741 Bacteria 67161
1144 Ga0501079_0008303 3300049741 Bacteria 7869
1145 Ga0501079_0019240 3300049741 Bacteria 5215
1146 Ga0501079_0030730 3300049741 Bacteria 4128
1147 Ga0501079_0039747 3300049741 Bacteria 3629
1148 Ga0501079_0098002 3300049741 Bacteria 2273
1149 Ga0501079_0101630 3300049741 Bacteria 2230
1150 Ga0501079_0106216 3300049741 Bacteria 2178
1151 Ga0501079_0166120 3300049741 Bacteria 1721
1152 Ga0501079_0302171 3300049741 Bacteria 1252
1153 Ga0501079_0347095 3300049741 Bacteria 1163
1154 Ga0501079_0694103 3300049741 Bacteria 801
1155 Ga0501079_0823674 3300049741 Bacteria 731
1156 Ga0501079_0864585 3300049741 Bacteria 712
1157 Ga0501079_1355241 3300049741 Bacteria 560
1158 Ga0501080_0000495 3300049742 Bacteria 30778
1159 Ga0501080_0077069 3300049742 Bacteria 3100
1160 Ga0501080_0249558 3300049742 Bacteria 1618
1161 Ga0501080_0308141 3300049742 Bacteria 1435
1162 Ga0501080_0343306 3300049742 Bacteria 1349
1163 Ga0501080_0552385 3300049742 Bacteria 1026
1164 Ga0501080_0604583 3300049742 Bacteria 973
1165 Ga0501080_1055663 3300049742 Bacteria 703
1166 Ga0501080_1172237 3300049742 Unclassified 661
1167 Ga0501080_1208003 3300049742 Bacteria 650
1168 Ga0501081_0000365 3300049743 Bacteria 24614
1169 Ga0501081_0006407 3300049743 Bacteria 7637
1170 Ga0501081_0012148 3300049743 Bacteria 5648
1171 Ga0501081_0039713 3300049743 Bacteria 3221
1172 Ga0501081_0096947 3300049743 Bacteria 2080
1173 Ga0501081_0109343 3300049743 Bacteria 1961
1174 Ga0501081_0119693 3300049743 Bacteria 1874
1175 Ga0501081_0141062 3300049743 Bacteria 1727
1176 Ga0501081_0147285 3300049743 Bacteria 1690
1177 Ga0501081_0267697 3300049743 Bacteria 1249
1178 Ga0501081_0503240 3300049743 Bacteria 903
1179 Ga0501081_0525973 3300049743 Bacteria 882
1180 Ga0501081_0558213 3300049743 Bacteria 856
1181 Ga0501081_0568634 3300049743 Bacteria 847
1182 Ga0501081_0640626 3300049743 Bacteria 796
1183 Ga0501081_0651182 3300049743 Bacteria 790
1184 Ga0501081_1375673 3300049743 Bacteria 536
1185 Ga0501083_0004245 3300049744 Bacteria 10088
1186 Ga0501083_0209448 3300049744 Bacteria 1271
1187 Ga0501083_0354183 3300049744 Archaea 954
1188 Ga0501083_0394669 3300049744 Unclassified 900
1189 Ga0501083_0673006 3300049744 Unclassified 673
1190 Ga0501083_0680076 3300049744 Unclassified 669
1191 Ga0501035_0005644 3300049822 Bacteria 11816
1192 Ga0501035_0087387 3300049822 Bacteria 2748
1193 Ga0501035_0228494 3300049822 Bacteria 1586
1194 Ga0501035_0487021 3300049822 Bacteria 1017
1195 Ga0501035_0587050 3300049822 Bacteria 909
1196 Ga0501035_1383656 3300049822 Bacteria 540
1197 Ga0501044_0499342 3300049823 Archaea 1118
1198 Ga0501044_0847408 3300049823 Unclassified 791
1199 Ga0501045_0002402 3300049824 Bacteria 12732
1200 Ga0501045_0017156 3300049824 Bacteria 5142
1201 Ga0501045_0061585 3300049824 Bacteria 2753
1202 Ga0501045_0066216 3300049824 Bacteria 2653
1203 Ga0501045_0101164 3300049824 Bacteria 2133
1204 Ga0501045_0263016 3300049824 Bacteria 1284
1205 Ga0501045_0504104 3300049824 Bacteria 899
1206 Ga0501045_0647605 3300049824 Bacteria 781
1207 Ga0501045_0689629 3300049824 Bacteria 754
1208 Ga0501045_0704968 3300049824 Unclassified 745
1209 Ga0501045_0834639 3300049824 Bacteria 678
1210 Ga0501045_0993620 3300049824 Bacteria 615
1211 Ga0501045_1064483 3300049824 Unclassified 592
1212 Ga0501045_1395238 3300049824 Bacteria 509
1213 nmdc:mga03683_319005_c1 3300050489 Bacteria 731
1214 nmdc:mga05p37_105950_c1 3300050507 Bacteria 3458
1215 nmdc:mga05p37_1141540_c1 3300050507 Bacteria 811
1216 nmdc:mga05p37_141373_c1 3300050507 Bacteria 2949
1217 nmdc:mga05p37_14142_c1 3300050507 Bacteria 9579
1218 nmdc:mga05p37_149820_c1 3300050507 Bacteria 2855
1219 nmdc:mga05p37_15776_c1 3300050507 Bacteria 9085
1220 nmdc:mga05p37_178658_c1 3300050507 Bacteria 2584
1221 nmdc:mga05p37_1907024_c1 3300050507 Unclassified 567
1222 nmdc:mga05p37_22462_c1 3300050507 Bacteria 7650
1223 nmdc:mga05p37_2290_c1 3300050507 Bacteria 22323
1224 nmdc:mga05p37_242621_c1 3300050507 Bacteria 2165
1225 nmdc:mga05p37_244533_c1 3300050507 Bacteria 2155
1226 nmdc:mga05p37_261019_c1 3300050507 Bacteria 2073
1227 nmdc:mga05p37_265419_c1 3300050507 Bacteria 2053
1228 nmdc:mga05p37_308597_c1 3300050507 Bacteria 1876
1229 nmdc:mga05p37_3105_c1 3300050507 Bacteria 19299
1230 nmdc:mga05p37_3324_c1 3300050507 Bacteria 18759
1231 nmdc:mga05p37_35957_c1 3300050507 Bacteria 6078
1232 nmdc:mga05p37_47935_c1 3300050507 Bacteria 5254
1233 nmdc:mga05p37_6486_c1 3300050507 Bacteria 13804
1234 nmdc:mga05p37_76832_c1 3300050507 Bacteria 4111
1235 nmdc:mga05p37_836_c2 3300050507 Bacteria 33929
1236 nmdc:mga05p37_882829_c1 3300050507 Bacteria 967
1237 nmdc:mga05p37_89705_c1 3300050507 Bacteria 3789
1238 nmdc:mga09592_1018260_c1 3300050508 Bacteria 692
1239 nmdc:mga09592_1207398_c1 3300050508 Bacteria 625
1240 nmdc:mga09592_122150_c1 3300050508 Bacteria 2238
1241 nmdc:mga09592_125425_c1 3300050508 Bacteria 2207
1242 nmdc:mga09592_1602684_c1 3300050508 Unclassified 527
1243 nmdc:mga09592_177564_c1 3300050508 Bacteria 1842
1244 nmdc:mga09592_239823_c1 3300050508 Bacteria 1571
1245 nmdc:mga09592_2612_c2 3300050508 Bacteria 8050
1246 nmdc:mga09592_298497_c1 3300050508 Bacteria 1397
1247 nmdc:mga09592_326528_c1 3300050508 Bacteria 1329
1248 nmdc:mga09592_341551_c1 3300050508 Bacteria 1296
1249 nmdc:mga09592_45738_c1 3300050508 Bacteria 3687
1250 nmdc:mga09592_47873_c1 3300050508 Bacteria 3603
1251 nmdc:mga09592_5329_c1 3300050508 Bacteria 10456
1252 nmdc:mga09592_58861_c1 3300050508 Bacteria 3248
1253 nmdc:mga09592_8305_c1 3300050508 Bacteria 8443
1254 nmdc:mga09592_866098_c1 3300050508 Bacteria 761
1255 nmdc:mga09592_8854_c1 3300050508 Bacteria 8187
1256 nmdc:mga09592_891217_c1 3300050508 Unclassified 748
1257 nmdc:mga0qj67_1051386_c1 3300050509 Bacteria 637
1258 nmdc:mga0qj67_12454_c1 3300050509 Bacteria 6407
1259 nmdc:mga0qj67_13842_c1 3300050509 Bacteria 6089
1260 nmdc:mga0qj67_1573_c1 3300050509 Bacteria 16047
1261 nmdc:mga0qj67_18226_c1 3300050509 Bacteria 5349
1262 nmdc:mga0qj67_255095_c1 3300050509 Bacteria 1423
1263 nmdc:mga0qj67_29613_c1 3300050509 Bacteria 4253
1264 nmdc:mga0qj67_4295_c1 3300050509 Bacteria 10324
1265 nmdc:mga0qj67_511310_c1 3300050509 Bacteria 965
1266 nmdc:mga0qj67_595071_c1 3300050509 Bacteria 885
1267 nmdc:mga0qj67_700242_c1 3300050509 Bacteria 806
1268 nmdc:mga06r32_1044488_c1 3300050510 Bacteria 768
1269 nmdc:mga06r32_1173_c1 3300050510 Bacteria 23604
1270 nmdc:mga06r32_17184_c1 3300050510 Bacteria 6603
1271 nmdc:mga06r32_197848_c1 3300050510 Unclassified 1997
1272 nmdc:mga06r32_20770_c1 3300050510 Bacteria 6050
1273 nmdc:mga06r32_24044_c1 3300050510 Bacteria 5649
1274 nmdc:mga06r32_28722_c1 3300050510 Bacteria 5208
1275 nmdc:mga06r32_30181_c1 3300050510 Bacteria 5087
1276 nmdc:mga06r32_398369_c1 3300050510 Bacteria 1359
1277 nmdc:mga06r32_41253_c1 3300050510 Bacteria 4384
1278 nmdc:mga06r32_4932_c1 3300050510 Bacteria 12028
1279 nmdc:mga06r32_5168_c1 3300050510 Bacteria 11728
1280 nmdc:mga06r32_61804_c1 3300050510 Bacteria 3607
1281 nmdc:mga06r32_631476_c1 3300050510 Unclassified 1040
1282 nmdc:mga06r32_723514_c1 3300050510 Bacteria 960
1283 nmdc:mga08y16_1033616_c1 3300050511 Bacteria 800
1284 nmdc:mga08y16_122216_c1 3300050511 Bacteria 2709
1285 nmdc:mga08y16_1234399_c1 3300050511 Unclassified 717
1286 nmdc:mga08y16_1549550_c1 3300050511 Bacteria 622
1287 nmdc:mga08y16_1556162_c1 3300050511 Bacteria 620
1288 nmdc:mga08y16_1693073_c1 3300050511 Bacteria 588
1289 nmdc:mga08y16_1758203_c1 3300050511 Unclassified 574
1290 nmdc:mga08y16_207451_c1 3300050511 Bacteria 2030
1291 nmdc:mga08y16_8112_c1 3300050511 Bacteria 10979
1292 nmdc:mga08y16_882569_c1 3300050511 Unclassified 882
1293 nmdc:mga08y16_890_c1 3300050511 Bacteria 28805
1294 nmdc:mga08y16_92047_c1 3300050511 Bacteria 3160
1295 nmdc:mga08y16_965146_c1 3300050511 Unclassified 834
1296 nmdc:mga0n895_16383_c1 3300050512 Bacteria 6799
1297 nmdc:mga0n895_1744987_c1 3300050512 Bacteria 584
1298 nmdc:mga0n895_184593_c1 3300050512 Bacteria 2117
1299 nmdc:mga0n895_243969_c1 3300050512 Bacteria 1823
1300 nmdc:mga0n895_270373_c1 3300050512 Bacteria 1724
1301 nmdc:mga0n895_320442_c1 3300050512 Bacteria 1571
1302 nmdc:mga0n895_34437_c1 3300050512 Bacteria 4874
1303 nmdc:mga0n895_46390_c1 3300050512 Bacteria 4245
1304 nmdc:mga0n895_476_c1 3300050512 Bacteria 26971
1305 nmdc:mga0n895_52812_c1 3300050512 Bacteria 3991
1306 nmdc:mga0n895_5367_c1 3300050512 Bacteria 10690
1307 nmdc:mga0n895_563344_c1 3300050512 Bacteria 1144
1308 nmdc:mga0n895_83006_c1 3300050512 Bacteria 3195
1309 nmdc:mga0n895_875390_c1 3300050512 Bacteria 885
1310 nmdc:mga0n895_910253_c1 3300050512 Bacteria 865
1311 nmdc:mga0n895_98908_c1 3300050512 Bacteria 2925
1312 nmdc:mga0rr50_1178391_c1 3300050513 Bacteria 651
1313 nmdc:mga0rr50_1441157_c1 3300050513 Bacteria 583
1314 nmdc:mga0rr50_1583644_c1 3300050513 Bacteria 553
1315 nmdc:mga0rr50_1736437_c1 3300050513 Bacteria 526
1316 nmdc:mga0rr50_178954_c1 3300050513 Bacteria 1732
1317 nmdc:mga0rr50_1815144_c1 3300050513 Bacteria 513
1318 nmdc:mga0rr50_3101_c1 3300050513 Bacteria 9508
1319 nmdc:mga0rr50_318536_c1 3300050513 Bacteria 1303
1320 nmdc:mga0rr50_372345_c1 3300050513 Bacteria 1203
1321 nmdc:mga0rr50_47555_c1 3300050513 Bacteria 3165
1322 nmdc:mga0rr50_584_c1 3300050513 Bacteria 19562
1323 nmdc:mga0rr50_597251_c1 3300050513 Unclassified 941
1324 nmdc:mga0rr50_63014_c1 3300050513 Bacteria 2799
1325 nmdc:mga0rr50_85335_c1 3300050513 Bacteria 2447
1326 nmdc:mga08x19_140039_c1 3300050514 Unclassified 1633
1327 nmdc:mga08x19_16809_c1 3300050514 Bacteria 4468
1328 nmdc:mga08x19_199753_c1 3300050514 Bacteria 1370
1329 nmdc:mga08x19_227797_c1 3300050514 Unclassified 1282
1330 nmdc:mga08x19_28073_c1 3300050514 Bacteria 3523
1331 nmdc:mga08x19_54943_c1 3300050514 Bacteria 2565
1332 nmdc:mga08x19_777773_c1 3300050514 Bacteria 680
1333 nmdc:mga0a205_118104_c1 3300050515 Bacteria 2551
1334 nmdc:mga0a205_132310_c1 3300050515 Bacteria 2395
1335 nmdc:mga0a205_133614_c1 3300050515 Bacteria 1051
1336 nmdc:mga0a205_1343287_c1 3300050515 Unclassified 562
1337 nmdc:mga0a205_1399953_c1 3300050515 Bacteria 547
1338 nmdc:mga0a205_14771_c1 3300050515 Bacteria 7286
1339 nmdc:mga0a205_1477_c1 3300050515 Bacteria 15134
1340 nmdc:mga0a205_181638_c1 3300050515 Bacteria 1998
1341 nmdc:mga0a205_236057_c1 3300050515 Bacteria 1710
1342 nmdc:mga0a205_26209_c1 3300050515 Bacteria 5556
1343 nmdc:mga0a205_279624_c1 3300050515 Bacteria 1544
1344 nmdc:mga0a205_332422_c1 3300050515 Bacteria 1389
1345 nmdc:mga0a205_3386_c1 3300050515 Bacteria 14213
1346 nmdc:mga0a205_42095_c1 3300050515 Bacteria 4400
1347 nmdc:mga0a205_425776_c1 3300050515 Bacteria 1189
1348 nmdc:mga0a205_47434_c1 3300050515 Bacteria 4145
1349 nmdc:mga0a205_51012_c1 3300050515 Bacteria 3994
1350 nmdc:mga0a205_680432_c1 3300050515 Unclassified 879
1351 nmdc:mga0a205_72229_c1 3300050515 Bacteria 3333
1352 Ga0495601_0003900 3300053077 Bacteria 8584
1353 Ga0495619_0216536 3300053085 Unclassified 1326
1354 Ga0500646_0122819 3300053090 Bacteria 837
1355 Ga0500593_231067 3300053117 Bacteria 641
1356 Ga0501084_0000142 3300054114 Bacteria 54295
1357 Ga0501084_0007079 3300054114 Bacteria 9240
1358 Ga0501084_0022882 3300054114 Bacteria 5215
1359 Ga0501084_0048477 3300054114 Bacteria 3556
1360 Ga0501084_0145604 3300054114 Bacteria 1995
1361 Ga0501084_0162614 3300054114 Bacteria 1883
1362 Ga0501084_0208280 3300054114 Bacteria 1650
1363 Ga0501084_0268895 3300054114 Bacteria 1439
1364 Ga0501084_0304687 3300054114 Bacteria 1346
1365 Ga0501084_0310863 3300054114 Bacteria 1331
1366 Ga0501084_0480740 3300054114 Bacteria 1050
1367 Ga0501084_0522633 3300054114 Bacteria 1003
1368 Ga0501084_0588177 3300054114 Bacteria 940
1369 Ga0501084_0757718 3300054114 Bacteria 818
1370 Ga0501084_1007879 3300054114 Unclassified 700
1371 Ga0501084_1053911 3300054114 Bacteria 683
1372 Ga0501084_1469257 3300054114 Unclassified 571
1373 Ga0501084_1779567 3300054114 Bacteria 514
1374 Ga0590075_003592 3300059424 Bacteria 3682
1375 Ga0590075_007469 3300059424 Bacteria 2598
1376 Ga0590077_100993 3300059426 Unclassified 674
1377 Ga0501082_0000718 3300060353 Bacteria 29158
1378 Ga0501082_0001168 3300060353 Bacteria 23100
1379 Ga0501082_0022184 3300060353 Bacteria 5472
1380 Ga0501082_0039393 3300060353 Bacteria 4076
1381 Ga0501082_0045311 3300060353 Bacteria 3793
1382 Ga0501082_0046077 3300060353 Bacteria 3760
1383 Ga0501082_0093845 3300060353 Bacteria 2593
1384 Ga0501082_0119293 3300060353 Bacteria 2286
1385 Ga0501082_0321936 3300060353 Bacteria 1347
1386 Ga0501082_0324828 3300060353 Bacteria 1341
1387 Ga0501082_0326447 3300060353 Bacteria 1337
1388 Ga0501082_0492974 3300060353 Bacteria 1071
1389 Ga0501082_0496942 3300060353 Bacteria 1066
1390 Ga0501082_1117137 3300060353 Unclassified 689
1391 Ga0501082_1151084 3300060353 Unclassified 678
1392 Ga0501082_2033003 3300060353 Unclassified 501
1393 Ga0530510_0000002 3300061734 Bacteria 284155
1394 Ga0530510_0009908 3300061734 Bacteria 6688
1395 Ga0530510_0011372 3300061734 Bacteria 6246
1396 Ga0530510_0035548 3300061734 Bacteria 3591
1397 Ga0530510_0079292 3300061734 Bacteria 2388
1398 Ga0530510_0137270 3300061734 Bacteria 1801
1399 Ga0530510_0165848 3300061734 Bacteria 1635
1400 Ga0530510_0213786 3300061734 Bacteria 1433
1401 Ga0530510_0225581 3300061734 Bacteria 1393
1402 Ga0530510_0302176 3300061734 Bacteria 1197
1403 Ga0530510_0474876 3300061734 Bacteria 947
1404 Ga0530510_0773285 3300061734 Bacteria 732
1405 Ga0530510_1392468 3300061734 Bacteria 538

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0253067 Ga0373943_0253067_103_276 57
2 3300035171 Ga0373946_0580398 Ga0373946_0580398_214_387 57
3 3300035725 Ga0373947_0241933 Ga0373947_0241933_56_229 57
4 3300046455 Ga0495603_0652759 Ga0495603_0652759_52_225 57
5 3300046473 Ga0495582_0049698 Ga0495582_0049698_1109_1282 57
6 3300046683 Ga0495658_0132284 Ga0495658_0132284_859_1032 57
7 3300047315 Ga0495581_0503074 Ga0495581_0503074_352_525 57
8 3300006175 Ga0070712_101578144 Ga0070712_1015781442 58
9 3300046454 Ga0495592_0251658 Ga0495592_0251658_275_451 58
10 3300046459 Ga0495629_0384579 Ga0495629_0384579_95_271 58
11 3300046511 Ga0495608_0360732 Ga0495608_0360732_449_625 58
12 3300046514 Ga0495618_0727901 Ga0495618_0727901_47_223 58
13 3300046516 Ga0495628_0069593 Ga0495628_0069593_2184_2360 58
14 3300046517 Ga0495630_1451992 Ga0495630_1451992_329_505 58
15 3300046529 Ga0495652_0242493 Ga0495652_0242493_108_284 58
16 3300046678 Ga0495599_0085970 Ga0495599_0085970_1135_1311 58
17 3300046689 Ga0495613_0399207 Ga0495613_0399207_618_794 58
18 3300048907 Ga0496104_0195490 Ga0496104_0195490_396_572 58
19 3300048918 Ga0496115_1322520 Ga0496115_1322520_214_390 58
20 3300053077 Ga0495601_0003900 Ga0495601_0003900_3982_4158 58
21 3300053085 Ga0495619_0216536 Ga0495619_0216536_90_266 58
22 3300005578 Ga0068854_102265572 Ga0068854_1022655722 59
23 3300005615 Ga0070702_100622820 Ga0070702_1006228202 59
24 3300005843 Ga0068860_100149434 Ga0068860_1001494342 59
25 3300006846 Ga0075430_101064710 Ga0075430_1010647102 59
26 3300014325 Ga0163163_11584434 Ga0163163_115844342 59
27 3300025922 Ga0207646_10000298 Ga0207646_100002984 59
28 3300036401 Ga0373937_1712756 Ga0373937_1712756_47_226 59
29 3300044712 Ga0453684_0590051 Ga0453684_0590051_854_1033 59
30 3300003203 JGI25406J46586_10005718 JGI25406J46586_100057183 60
31 3300004798 Ga0058859_11795127 Ga0058859_117951271 60
32 3300004800 Ga0058861_11455258 Ga0058861_114552582 60
33 3300004801 Ga0058860_12045871 Ga0058860_120458712 60
34 3300005295 Ga0065707_10447275 Ga0065707_104472752 60
35 3300005295 Ga0065707_10647491 Ga0065707_106474912 60
36 3300005295 Ga0065707_10798277 Ga0065707_107982772 60
37 3300005295 Ga0065707_10811341 Ga0065707_108113412 60
38 3300005295 Ga0065707_10899081 Ga0065707_108990811 60
39 3300005328 Ga0070676_10231868 Ga0070676_102318682 60
40 3300005329 Ga0070683_101643253 Ga0070683_1016432532 60
41 3300005330 Ga0070690_100080310 Ga0070690_1000803103 60
42 3300005330 Ga0070690_100229097 Ga0070690_1002290972 60
43 3300005330 Ga0070690_100361137 Ga0070690_1003611372 60
44 3300005331 Ga0070670_100612048 Ga0070670_1006120482 60
45 3300005331 Ga0070670_101120898 Ga0070670_1011208982 60
46 3300005331 Ga0070670_101210189 Ga0070670_1012101892 60
47 3300005331 Ga0070670_102147213 Ga0070670_1021472131 60
48 3300005333 Ga0070677_10107393 Ga0070677_101073931 60
49 3300005333 Ga0070677_10130548 Ga0070677_101305482 60
50 3300005334 Ga0068869_100121141 Ga0068869_1001211411 60
51 3300005334 Ga0068869_100226774 Ga0068869_1002267743 60
52 3300005334 Ga0068869_100444365 Ga0068869_1004443652 60
53 3300005334 Ga0068869_100661792 Ga0068869_1006617922 60
54 3300005335 Ga0070666_11263627 Ga0070666_112636271 60
55 3300005336 Ga0070680_100010742 Ga0070680_1000107428 60
56 3300005336 Ga0070680_100080904 Ga0070680_1000809042 60
57 3300005336 Ga0070680_100178369 Ga0070680_1001783693 60
58 3300005336 Ga0070680_100350323 Ga0070680_1003503231 60
59 3300005336 Ga0070680_100606565 Ga0070680_1006065652 60
60 3300005336 Ga0070680_101080731 Ga0070680_1010807312 60
61 3300005336 Ga0070680_101398053 Ga0070680_1013980532 60
62 3300005336 Ga0070680_101671446 Ga0070680_1016714462 60
63 3300005338 Ga0068868_100432847 Ga0068868_1004328472 60
64 3300005338 Ga0068868_100489975 Ga0068868_1004899752 60
65 3300005338 Ga0068868_102355034 Ga0068868_1023550341 60
66 3300005340 Ga0070689_100109712 Ga0070689_1001097122 60
67 3300005340 Ga0070689_100250396 Ga0070689_1002503962 60
68 3300005340 Ga0070689_100522362 Ga0070689_1005223622 60
69 3300005340 Ga0070689_100697425 Ga0070689_1006974252 60
70 3300005340 Ga0070689_101348922 Ga0070689_1013489222 60
71 3300005341 Ga0070691_10022470 Ga0070691_100224704 60
72 3300005341 Ga0070691_10624160 Ga0070691_106241602 60
73 3300005341 Ga0070691_10655873 Ga0070691_106558732 60
74 3300005343 Ga0070687_100795674 Ga0070687_1007956742 60
75 3300005344 Ga0070661_101743426 Ga0070661_1017434262 60
76 3300005345 Ga0070692_10106340 Ga0070692_101063403 60
77 3300005345 Ga0070692_10900442 Ga0070692_109004421 60
78 3300005345 Ga0070692_11200575 Ga0070692_112005751 60
79 3300005347 Ga0070668_100530667 Ga0070668_1005306671 60
80 3300005347 Ga0070668_100911853 Ga0070668_1009118531 60
81 3300005347 Ga0070668_101611380 Ga0070668_1016113801 60
82 3300005347 Ga0070668_102003149 Ga0070668_1020031492 60
83 3300005353 Ga0070669_100011353 Ga0070669_1000113532 60
84 3300005353 Ga0070669_100085539 Ga0070669_1000855392 60
85 3300005353 Ga0070669_100671395 Ga0070669_1006713952 60
86 3300005353 Ga0070669_100763694 Ga0070669_1007636941 60
87 3300005353 Ga0070669_100808900 Ga0070669_1008089001 60
88 3300005353 Ga0070669_101770421 Ga0070669_1017704212 60
89 3300005354 Ga0070675_100369425 Ga0070675_1003694252 60
90 3300005354 Ga0070675_100477797 Ga0070675_1004777972 60
91 3300005354 Ga0070675_100884974 Ga0070675_1008849742 60
92 3300005354 Ga0070675_101051946 Ga0070675_1010519462 60
93 3300005354 Ga0070675_101202434 Ga0070675_1012024342 60
94 3300005355 Ga0070671_100263373 Ga0070671_1002633731 60
95 3300005356 Ga0070674_100143173 Ga0070674_1001431732 60
96 3300005356 Ga0070674_100931995 Ga0070674_1009319952 60
97 3300005356 Ga0070674_101177653 Ga0070674_1011776532 60
98 3300005356 Ga0070674_102046848 Ga0070674_1020468481 60
99 3300005364 Ga0070673_100919423 Ga0070673_1009194232 60
100 3300005364 Ga0070673_101485705 Ga0070673_1014857052 60
101 3300005365 Ga0070688_100424762 Ga0070688_1004247622 60
102 3300005365 Ga0070688_100786747 Ga0070688_1007867472 60
103 3300005367 Ga0070667_101741439 Ga0070667_1017414391 60
104 3300005367 Ga0070667_101770821 Ga0070667_1017708212 60
105 3300005406 Ga0070703_10134544 Ga0070703_101345441 60
106 3300005406 Ga0070703_10251337 Ga0070703_102513372 60
107 3300005434 Ga0070709_10577749 Ga0070709_105777491 60
108 3300005438 Ga0070701_10001616 Ga0070701_100016164 60
109 3300005438 Ga0070701_10006095 Ga0070701_100060953 60
110 3300005438 Ga0070701_10026821 Ga0070701_100268212 60
111 3300005438 Ga0070701_10921502 Ga0070701_109215022 60
112 3300005439 Ga0070711_101688470 Ga0070711_1016884702 60
113 3300005440 Ga0070705_100012970 Ga0070705_1000129703 60
114 3300005440 Ga0070705_100036281 Ga0070705_1000362815 60
115 3300005440 Ga0070705_100069802 Ga0070705_1000698021 60
116 3300005440 Ga0070705_100119407 Ga0070705_1001194072 60
117 3300005440 Ga0070705_100602650 Ga0070705_1006026501 60
118 3300005440 Ga0070705_101007000 Ga0070705_1010070002 60
119 3300005440 Ga0070705_101203952 Ga0070705_1012039521 60
120 3300005440 Ga0070705_101532471 Ga0070705_1015324712 60
121 3300005441 Ga0070700_100197428 Ga0070700_1001974282 60
122 3300005441 Ga0070700_100318471 Ga0070700_1003184712 60
123 3300005441 Ga0070700_100613254 Ga0070700_1006132541 60
124 3300005444 Ga0070694_100035687 Ga0070694_1000356873 60
125 3300005444 Ga0070694_100129765 Ga0070694_1001297653 60
126 3300005444 Ga0070694_100194389 Ga0070694_1001943893 60
127 3300005444 Ga0070694_100508102 Ga0070694_1005081022 60
128 3300005444 Ga0070694_100794339 Ga0070694_1007943391 60
129 3300005444 Ga0070694_100979982 Ga0070694_1009799822 60
130 3300005445 Ga0070708_100005576 Ga0070708_1000055763 60
131 3300005445 Ga0070708_100016115 Ga0070708_1000161157 60
132 3300005445 Ga0070708_100021250 Ga0070708_1000212507 60
133 3300005445 Ga0070708_100137553 Ga0070708_1001375533 60
134 3300005445 Ga0070708_100155712 Ga0070708_1001557124 60
135 3300005445 Ga0070708_100250767 Ga0070708_1002507673 60
136 3300005445 Ga0070708_100504292 Ga0070708_1005042923 60
137 3300005445 Ga0070708_100528826 Ga0070708_1005288262 60
138 3300005455 Ga0070663_100619416 Ga0070663_1006194162 60
139 3300005456 Ga0070678_100636972 Ga0070678_1006369722 60
140 3300005456 Ga0070678_100899406 Ga0070678_1008994062 60
141 3300005456 Ga0070678_102188112 Ga0070678_1021881122 60
142 3300005457 Ga0070662_100107594 Ga0070662_1001075942 60
143 3300005457 Ga0070662_100515812 Ga0070662_1005158122 60
144 3300005457 Ga0070662_100524449 Ga0070662_1005244491 60
145 3300005457 Ga0070662_101601339 Ga0070662_1016013392 60
146 3300005458 Ga0070681_10900426 Ga0070681_109004261 60
147 3300005458 Ga0070681_11346219 Ga0070681_113462192 60
148 3300005459 Ga0068867_100495878 Ga0068867_1004958781 60
149 3300005459 Ga0068867_100632494 Ga0068867_1006324941 60
150 3300005459 Ga0068867_100965907 Ga0068867_1009659072 60
151 3300005459 Ga0068867_100983571 Ga0068867_1009835711 60
152 3300005459 Ga0068867_101075144 Ga0068867_1010751442 60
153 3300005459 Ga0068867_101174979 Ga0068867_1011749792 60
154 3300005459 Ga0068867_101775630 Ga0068867_1017756301 60
155 3300005466 Ga0070685_10470786 Ga0070685_104707862 60
156 3300005467 Ga0070706_100016480 Ga0070706_1000164804 60
157 3300005467 Ga0070706_100017851 Ga0070706_1000178518 60
158 3300005467 Ga0070706_100056505 Ga0070706_1000565053 60
159 3300005467 Ga0070706_100106278 Ga0070706_1001062784 60
160 3300005467 Ga0070706_100367299 Ga0070706_1003672993 60
161 3300005467 Ga0070706_101449580 Ga0070706_1014495801 60
162 3300005467 Ga0070706_101546945 Ga0070706_1015469452 60
163 3300005468 Ga0070707_100001814 Ga0070707_1000018147 60
164 3300005468 Ga0070707_100022014 Ga0070707_1000220142 60
165 3300005468 Ga0070707_100027660 Ga0070707_1000276605 60
166 3300005468 Ga0070707_100171862 Ga0070707_1001718622 60
167 3300005468 Ga0070707_100196892 Ga0070707_1001968923 60
168 3300005468 Ga0070707_100701544 Ga0070707_1007015442 60
169 3300005468 Ga0070707_101197555 Ga0070707_1011975551 60
170 3300005468 Ga0070707_102272550 Ga0070707_1022725502 60
171 3300005471 Ga0070698_100028962 Ga0070698_1000289622 60
172 3300005471 Ga0070698_100032614 Ga0070698_1000326146 60
173 3300005471 Ga0070698_100213911 Ga0070698_1002139113 60
174 3300005471 Ga0070698_100544732 Ga0070698_1005447322 60
175 3300005471 Ga0070698_100563937 Ga0070698_1005639372 60
176 3300005471 Ga0070698_100842409 Ga0070698_1008424092 60
177 3300005471 Ga0070698_100900754 Ga0070698_1009007541 60
178 3300005471 Ga0070698_101001716 Ga0070698_1010017161 60
179 3300005471 Ga0070698_101885350 Ga0070698_1018853501 60
180 3300005518 Ga0070699_100003712 Ga0070699_10000371213 60
181 3300005518 Ga0070699_100026125 Ga0070699_1000261255 60
182 3300005518 Ga0070699_100055428 Ga0070699_1000554284 60
183 3300005518 Ga0070699_100220864 Ga0070699_1002208642 60
184 3300005518 Ga0070699_100306541 Ga0070699_1003065411 60
185 3300005518 Ga0070699_100401661 Ga0070699_1004016611 60
186 3300005518 Ga0070699_100670260 Ga0070699_1006702602 60
187 3300005518 Ga0070699_101073498 Ga0070699_1010734982 60
188 3300005518 Ga0070699_102138165 Ga0070699_1021381652 60
189 3300005530 Ga0070679_100215202 Ga0070679_1002152022 60
190 3300005530 Ga0070679_100442136 Ga0070679_1004421361 60
191 3300005536 Ga0070697_100006636 Ga0070697_10000663610 60
192 3300005536 Ga0070697_100027823 Ga0070697_1000278233 60
193 3300005536 Ga0070697_100048682 Ga0070697_1000486823 60
194 3300005536 Ga0070697_100193515 Ga0070697_1001935153 60
195 3300005536 Ga0070697_100368889 Ga0070697_1003688893 60
196 3300005536 Ga0070697_100615502 Ga0070697_1006155022 60
197 3300005536 Ga0070697_101603794 Ga0070697_1016037941 60
198 3300005536 Ga0070697_101845688 Ga0070697_1018456882 60
199 3300005543 Ga0070672_100591129 Ga0070672_1005911292 60
200 3300005543 Ga0070672_101315004 Ga0070672_1013150042 60
201 3300005543 Ga0070672_102090301 Ga0070672_1020903012 60
202 3300005543 Ga0070672_102101795 Ga0070672_1021017952 60
203 3300005544 Ga0070686_100097901 Ga0070686_1000979013 60
204 3300005545 Ga0070695_100018512 Ga0070695_1000185125 60
205 3300005545 Ga0070695_100460859 Ga0070695_1004608592 60
206 3300005545 Ga0070695_100686496 Ga0070695_1006864962 60
207 3300005545 Ga0070695_100693430 Ga0070695_1006934302 60
208 3300005545 Ga0070695_100888848 Ga0070695_1008888482 60
209 3300005545 Ga0070695_101337861 Ga0070695_1013378612 60
210 3300005545 Ga0070695_101600988 Ga0070695_1016009882 60
211 3300005546 Ga0070696_100033512 Ga0070696_1000335124 60
212 3300005546 Ga0070696_100051820 Ga0070696_1000518203 60
213 3300005546 Ga0070696_100084510 Ga0070696_1000845101 60
214 3300005546 Ga0070696_100174074 Ga0070696_1001740743 60
215 3300005546 Ga0070696_100833929 Ga0070696_1008339291 60
216 3300005546 Ga0070696_100918411 Ga0070696_1009184112 60
217 3300005546 Ga0070696_100997688 Ga0070696_1009976882 60
218 3300005547 Ga0070693_100446264 Ga0070693_1004462642 60
219 3300005547 Ga0070693_100536666 Ga0070693_1005366661 60
220 3300005548 Ga0070665_101316652 Ga0070665_1013166522 60
221 3300005549 Ga0070704_100079166 Ga0070704_1000791662 60
222 3300005549 Ga0070704_100100065 Ga0070704_1001000652 60
223 3300005549 Ga0070704_100215883 Ga0070704_1002158832 60
224 3300005549 Ga0070704_100292971 Ga0070704_1002929712 60
225 3300005549 Ga0070704_100361065 Ga0070704_1003610652 60
226 3300005549 Ga0070704_100642708 Ga0070704_1006427082 60
227 3300005549 Ga0070704_100709164 Ga0070704_1007091642 60
228 3300005549 Ga0070704_100861967 Ga0070704_1008619671 60
229 3300005549 Ga0070704_101248262 Ga0070704_1012482622 60
230 3300005564 Ga0070664_100377040 Ga0070664_1003770402 60
231 3300005564 Ga0070664_101407566 Ga0070664_1014075662 60
232 3300005577 Ga0068857_100008888 Ga0068857_1000088886 60
233 3300005577 Ga0068857_100022549 Ga0068857_1000225494 60
234 3300005577 Ga0068857_100414555 Ga0068857_1004145552 60
235 3300005577 Ga0068857_102329133 Ga0068857_1023291332 60
236 3300005578 Ga0068854_100288782 Ga0068854_1002887821 60
237 3300005578 Ga0068854_101978653 Ga0068854_1019786531 60
238 3300005615 Ga0070702_100145158 Ga0070702_1001451581 60
239 3300005615 Ga0070702_100209721 Ga0070702_1002097212 60
240 3300005615 Ga0070702_100241203 Ga0070702_1002412033 60
241 3300005616 Ga0068852_100927547 Ga0068852_1009275472 60
242 3300005616 Ga0068852_101218359 Ga0068852_1012183592 60
243 3300005617 Ga0068859_100103779 Ga0068859_1001037793 60
244 3300005617 Ga0068859_100269041 Ga0068859_1002690412 60
245 3300005617 Ga0068859_100376399 Ga0068859_1003763992 60
246 3300005617 Ga0068859_100647500 Ga0068859_1006475002 60
247 3300005617 Ga0068859_100838216 Ga0068859_1008382162 60
248 3300005617 Ga0068859_100877402 Ga0068859_1008774022 60
249 3300005718 Ga0068866_10080217 Ga0068866_100802173 60
250 3300005718 Ga0068866_10141704 Ga0068866_101417042 60
251 3300005718 Ga0068866_10459164 Ga0068866_104591642 60
252 3300005719 Ga0068861_100221451 Ga0068861_1002214513 60
253 3300005719 Ga0068861_100276339 Ga0068861_1002763392 60
254 3300005719 Ga0068861_100318492 Ga0068861_1003184922 60
255 3300005719 Ga0068861_101075005 Ga0068861_1010750051 60
256 3300005840 Ga0068870_10083911 Ga0068870_100839112 60
257 3300005840 Ga0068870_10380778 Ga0068870_103807782 60
258 3300005840 Ga0068870_10402549 Ga0068870_104025492 60
259 3300005840 Ga0068870_10659226 Ga0068870_106592261 60
260 3300005840 Ga0068870_10927887 Ga0068870_109278872 60
261 3300005841 Ga0068863_100011309 Ga0068863_1000113099 60
262 3300005841 Ga0068863_100525279 Ga0068863_1005252792 60
263 3300005841 Ga0068863_101661965 Ga0068863_1016619652 60
264 3300005842 Ga0068858_100765507 Ga0068858_1007655072 60
265 3300005842 Ga0068858_100881667 Ga0068858_1008816672 60
266 3300005842 Ga0068858_101127741 Ga0068858_1011277412 60
267 3300005842 Ga0068858_101163483 Ga0068858_1011634832 60
268 3300005842 Ga0068858_101816019 Ga0068858_1018160192 60
269 3300005842 Ga0068858_102110885 Ga0068858_1021108852 60
270 3300005843 Ga0068860_100034349 Ga0068860_1000343494 60
271 3300005843 Ga0068860_100104055 Ga0068860_1001040552 60
272 3300005843 Ga0068860_100250057 Ga0068860_1002500572 60
273 3300005843 Ga0068860_102717625 Ga0068860_1027176251 60
274 3300005844 Ga0068862_100176280 Ga0068862_1001762803 60
275 3300005844 Ga0068862_100220729 Ga0068862_1002207292 60
276 3300005844 Ga0068862_100449708 Ga0068862_1004497082 60
277 3300005844 Ga0068862_100473794 Ga0068862_1004737942 60
278 3300005844 Ga0068862_101204277 Ga0068862_1012042772 60
279 3300005844 Ga0068862_101923803 Ga0068862_1019238032 60
280 3300005844 Ga0068862_102292214 Ga0068862_1022922142 60
281 3300005844 Ga0068862_102444356 Ga0068862_1024443562 60
282 3300005937 Ga0081455_10265850 Ga0081455_102658502 60
283 3300005937 Ga0081455_11061684 Ga0081455_110616842 60
284 3300005981 Ga0081538_10008492 Ga0081538_1000849211 60
285 3300005983 Ga0081540_1047381 Ga0081540_10473811 60
286 3300005985 Ga0081539_10000005 Ga0081539_10000005269 60
287 3300006051 Ga0075364_10470794 Ga0075364_104707941 60
288 3300006058 Ga0075432_10012112 Ga0075432_100121124 60
289 3300006058 Ga0075432_10106937 Ga0075432_101069372 60
290 3300006058 Ga0075432_10421363 Ga0075432_104213632 60
291 3300006175 Ga0070712_100001268 Ga0070712_10000126812 60
292 3300006177 Ga0075362_10366518 Ga0075362_103665182 60
293 3300006177 Ga0075362_10641142 Ga0075362_106411422 60
294 3300006237 Ga0097621_102311210 Ga0097621_1023112102 60
295 3300006358 Ga0068871_100516751 Ga0068871_1005167512 60
296 3300006844 Ga0075428_100001135 Ga0075428_1000011352 60
297 3300006844 Ga0075428_100003079 Ga0075428_10000307916 60
298 3300006844 Ga0075428_100018174 Ga0075428_1000181746 60
299 3300006844 Ga0075428_100106340 Ga0075428_1001063402 60
300 3300006844 Ga0075428_100122547 Ga0075428_1001225474 60
301 3300006844 Ga0075428_100178170 Ga0075428_1001781702 60
302 3300006844 Ga0075428_100227781 Ga0075428_1002277813 60
303 3300006844 Ga0075428_100243000 Ga0075428_1002430003 60
304 3300006844 Ga0075428_100243522 Ga0075428_1002435222 60
305 3300006844 Ga0075428_100333054 Ga0075428_1003330542 60
306 3300006844 Ga0075428_100393261 Ga0075428_1003932613 60
307 3300006844 Ga0075428_100496803 Ga0075428_1004968032 60
308 3300006844 Ga0075428_101011558 Ga0075428_1010115581 60
309 3300006844 Ga0075428_101236705 Ga0075428_1012367051 60
310 3300006844 Ga0075428_102169510 Ga0075428_1021695101 60
311 3300006846 Ga0075430_100001340 Ga0075430_1000013408 60
312 3300006846 Ga0075430_100002045 Ga0075430_1000020454 60
313 3300006846 Ga0075430_100002763 Ga0075430_10000276313 60
314 3300006846 Ga0075430_100005430 Ga0075430_1000054305 60
315 3300006846 Ga0075430_100025650 Ga0075430_1000256509 60
316 3300006846 Ga0075430_100065995 Ga0075430_1000659953 60
317 3300006846 Ga0075430_100069337 Ga0075430_1000693374 60
318 3300006846 Ga0075430_100138873 Ga0075430_1001388732 60
319 3300006846 Ga0075430_100232884 Ga0075430_1002328843 60
320 3300006846 Ga0075430_100383901 Ga0075430_1003839012 60
321 3300006846 Ga0075430_100610670 Ga0075430_1006106702 60
322 3300006846 Ga0075430_100761743 Ga0075430_1007617432 60
323 3300006846 Ga0075430_100900687 Ga0075430_1009006872 60
324 3300006846 Ga0075430_101382797 Ga0075430_1013827972 60
325 3300006846 Ga0075430_101504496 Ga0075430_1015044962 60
326 3300006846 Ga0075430_101809414 Ga0075430_1018094142 60
327 3300006847 Ga0075431_100000979 Ga0075431_10000097912 60
328 3300006847 Ga0075431_100001536 Ga0075431_1000015367 60
329 3300006847 Ga0075431_100003073 Ga0075431_1000030735 60
330 3300006847 Ga0075431_100004644 Ga0075431_10000464416 60
331 3300006847 Ga0075431_100014242 Ga0075431_10001424210 60
332 3300006847 Ga0075431_100014740 Ga0075431_1000147402 60
333 3300006847 Ga0075431_100016025 Ga0075431_1000160259 60
334 3300006847 Ga0075431_100043128 Ga0075431_1000431285 60
335 3300006847 Ga0075431_100192094 Ga0075431_1001920943 60
336 3300006847 Ga0075431_100201701 Ga0075431_1002017012 60
337 3300006847 Ga0075431_100201719 Ga0075431_1002017192 60
338 3300006847 Ga0075431_100228742 Ga0075431_1002287423 60
339 3300006847 Ga0075431_100231258 Ga0075431_1002312582 60
340 3300006847 Ga0075431_100262199 Ga0075431_1002621992 60
341 3300006847 Ga0075431_100574680 Ga0075431_1005746802 60
342 3300006847 Ga0075431_100608682 Ga0075431_1006086822 60
343 3300006847 Ga0075431_100778765 Ga0075431_1007787652 60
344 3300006847 Ga0075431_101089514 Ga0075431_1010895142 60
345 3300006852 Ga0075433_10000843 Ga0075433_1000084327 60
346 3300006852 Ga0075433_10001978 Ga0075433_100019784 60
347 3300006852 Ga0075433_10020652 Ga0075433_100206522 60
348 3300006852 Ga0075433_10046762 Ga0075433_100467623 60
349 3300006852 Ga0075433_10104968 Ga0075433_101049684 60
350 3300006852 Ga0075433_10113620 Ga0075433_101136204 60
351 3300006852 Ga0075433_10145980 Ga0075433_101459802 60
352 3300006852 Ga0075433_10169761 Ga0075433_101697612 60
353 3300006852 Ga0075433_10184321 Ga0075433_101843212 60
354 3300006852 Ga0075433_10246264 Ga0075433_102462642 60
355 3300006852 Ga0075433_10257330 Ga0075433_102573302 60
356 3300006852 Ga0075433_10273850 Ga0075433_102738503 60
357 3300006852 Ga0075433_10365416 Ga0075433_103654162 60
358 3300006852 Ga0075433_10465579 Ga0075433_104655793 60
359 3300006852 Ga0075433_10547306 Ga0075433_105473062 60
360 3300006852 Ga0075433_10787991 Ga0075433_107879912 60
361 3300006852 Ga0075433_10893015 Ga0075433_108930152 60
362 3300006852 Ga0075433_11130085 Ga0075433_111300852 60
363 3300006852 Ga0075433_11279044 Ga0075433_112790441 60
364 3300006871 Ga0075434_100007867 Ga0075434_1000078676 60
365 3300006871 Ga0075434_100015436 Ga0075434_1000154369 60
366 3300006871 Ga0075434_100022870 Ga0075434_1000228704 60
367 3300006871 Ga0075434_100074069 Ga0075434_1000740693 60
368 3300006871 Ga0075434_100089126 Ga0075434_1000891264 60
369 3300006871 Ga0075434_100138100 Ga0075434_1001381003 60
370 3300006871 Ga0075434_100149064 Ga0075434_1001490642 60
371 3300006871 Ga0075434_100156856 Ga0075434_1001568563 60
372 3300006871 Ga0075434_100168479 Ga0075434_1001684792 60
373 3300006871 Ga0075434_100201064 Ga0075434_1002010643 60
374 3300006871 Ga0075434_100226172 Ga0075434_1002261722 60
375 3300006871 Ga0075434_100451718 Ga0075434_1004517182 60
376 3300006871 Ga0075434_100527779 Ga0075434_1005277792 60
377 3300006871 Ga0075434_100766454 Ga0075434_1007664542 60
378 3300006871 Ga0075434_101798243 Ga0075434_1017982432 60
379 3300006880 Ga0075429_100001419 Ga0075429_1000014192 60
380 3300006880 Ga0075429_100003531 Ga0075429_10000353117 60
381 3300006880 Ga0075429_100007424 Ga0075429_1000074246 60
382 3300006880 Ga0075429_100015210 Ga0075429_1000152105 60
383 3300006880 Ga0075429_100022158 Ga0075429_1000221586 60
384 3300006880 Ga0075429_100032442 Ga0075429_1000324423 60
385 3300006880 Ga0075429_100056673 Ga0075429_1000566734 60
386 3300006880 Ga0075429_100099708 Ga0075429_1000997084 60
387 3300006880 Ga0075429_100121030 Ga0075429_1001210301 60
388 3300006880 Ga0075429_100151331 Ga0075429_1001513313 60
389 3300006880 Ga0075429_100202440 Ga0075429_1002024401 60
390 3300006880 Ga0075429_100274250 Ga0075429_1002742502 60
391 3300006880 Ga0075429_100286574 Ga0075429_1002865742 60
392 3300006880 Ga0075429_100322515 Ga0075429_1003225151 60
393 3300006880 Ga0075429_100535419 Ga0075429_1005354192 60
394 3300006880 Ga0075429_101319141 Ga0075429_1013191412 60
395 3300006880 Ga0075429_101323003 Ga0075429_1013230031 60
396 3300006881 Ga0068865_100189139 Ga0068865_1001891392 60
397 3300006881 Ga0068865_100557241 Ga0068865_1005572412 60
398 3300006881 Ga0068865_100622299 Ga0068865_1006222992 60
399 3300006881 Ga0068865_100851949 Ga0068865_1008519492 60
400 3300006914 Ga0075436_100012211 Ga0075436_1000122113 60
401 3300006914 Ga0075436_100056238 Ga0075436_1000562384 60
402 3300006914 Ga0075436_100105652 Ga0075436_1001056522 60
403 3300006914 Ga0075436_100118077 Ga0075436_1001180773 60
404 3300006914 Ga0075436_100198558 Ga0075436_1001985583 60
405 3300006914 Ga0075436_100549300 Ga0075436_1005493002 60
406 3300006931 Ga0097620_100103784 Ga0097620_1001037842 60
407 3300006931 Ga0097620_100269028 Ga0097620_1002690282 60
408 3300006931 Ga0097620_100376397 Ga0097620_1003763972 60
409 3300006931 Ga0097620_100647470 Ga0097620_1006474702 60
410 3300006931 Ga0097620_100838216 Ga0097620_1008382162 60
411 3300007076 Ga0075435_100006118 Ga0075435_1000061187 60
412 3300007076 Ga0075435_100009348 Ga0075435_1000093486 60
413 3300007076 Ga0075435_100031981 Ga0075435_1000319815 60
414 3300007076 Ga0075435_100032981 Ga0075435_1000329816 60
415 3300007076 Ga0075435_100070959 Ga0075435_1000709593 60
416 3300007076 Ga0075435_100093578 Ga0075435_1000935782 60
417 3300007076 Ga0075435_100195443 Ga0075435_1001954433 60
418 3300007076 Ga0075435_100258800 Ga0075435_1002588003 60
419 3300007076 Ga0075435_100497673 Ga0075435_1004976732 60
420 3300007076 Ga0075435_100694459 Ga0075435_1006944592 60
421 3300007076 Ga0075435_100811156 Ga0075435_1008111562 60
422 3300007076 Ga0075435_101024759 Ga0075435_1010247592 60
423 3300007076 Ga0075435_101226319 Ga0075435_1012263191 60
424 3300007076 Ga0075435_101607804 Ga0075435_1016078041 60
425 3300007265 Ga0099794_10002353 Ga0099794_100023534 60
426 3300007265 Ga0099794_10002967 Ga0099794_100029677 60
427 3300007265 Ga0099794_10061636 Ga0099794_100616362 60
428 3300007265 Ga0099794_10641368 Ga0099794_106413681 60
429 3300007265 Ga0099794_10765305 Ga0099794_107653052 60
430 3300009094 Ga0111539_10001754 Ga0111539_1000175416 60
431 3300009094 Ga0111539_10011574 Ga0111539_100115747 60
432 3300009094 Ga0111539_10018154 Ga0111539_100181548 60
433 3300009094 Ga0111539_10234200 Ga0111539_102342002 60
434 3300009094 Ga0111539_10519357 Ga0111539_105193573 60
435 3300009094 Ga0111539_10806922 Ga0111539_108069222 60
436 3300009094 Ga0111539_11147067 Ga0111539_111470672 60
437 3300009094 Ga0111539_11201682 Ga0111539_112016821 60
438 3300009094 Ga0111539_11711924 Ga0111539_117119242 60
439 3300009094 Ga0111539_11847091 Ga0111539_118470912 60
440 3300009094 Ga0111539_11961995 Ga0111539_119619952 60
441 3300009094 Ga0111539_11968069 Ga0111539_119680692 60
442 3300009094 Ga0111539_12586310 Ga0111539_125863102 60
443 3300009101 Ga0105247_10263132 Ga0105247_102631322 60
444 3300009147 Ga0114129_10000216 Ga0114129_100002166 60
445 3300009147 Ga0114129_10000675 Ga0114129_1000067531 60
446 3300009147 Ga0114129_10000716 Ga0114129_1000071629 60
447 3300009147 Ga0114129_10002865 Ga0114129_1000286511 60
448 3300009147 Ga0114129_10005463 Ga0114129_100054635 60
449 3300009147 Ga0114129_10007742 Ga0114129_1000774218 60
450 3300009147 Ga0114129_10010144 Ga0114129_1001014414 60
451 3300009147 Ga0114129_10015203 Ga0114129_100152036 60
452 3300009147 Ga0114129_10018905 Ga0114129_100189059 60
453 3300009147 Ga0114129_10024080 Ga0114129_1002408012 60
454 3300009147 Ga0114129_10035705 Ga0114129_100357059 60
455 3300009147 Ga0114129_10042391 Ga0114129_100423914 60
456 3300009147 Ga0114129_10161252 Ga0114129_101612523 60
457 3300009147 Ga0114129_10199859 Ga0114129_101998593 60
458 3300009147 Ga0114129_10200112 Ga0114129_102001123 60
459 3300009147 Ga0114129_10221893 Ga0114129_102218933 60
460 3300009147 Ga0114129_10277113 Ga0114129_102771133 60
461 3300009147 Ga0114129_10395187 Ga0114129_103951873 60
462 3300009147 Ga0114129_10413753 Ga0114129_104137532 60
463 3300009147 Ga0114129_10568163 Ga0114129_105681633 60
464 3300009147 Ga0114129_10583895 Ga0114129_105838953 60
465 3300009147 Ga0114129_10751048 Ga0114129_107510481 60
466 3300009147 Ga0114129_10812656 Ga0114129_108126562 60
467 3300009147 Ga0114129_10814483 Ga0114129_108144832 60
468 3300009147 Ga0114129_10984355 Ga0114129_109843551 60
469 3300009147 Ga0114129_11293496 Ga0114129_112934961 60
470 3300009147 Ga0114129_11360250 Ga0114129_113602502 60
471 3300009147 Ga0114129_11835151 Ga0114129_118351512 60
472 3300009147 Ga0114129_13005162 Ga0114129_130051622 60
473 3300009148 Ga0105243_10010062 Ga0105243_100100622 60
474 3300009148 Ga0105243_10188242 Ga0105243_101882423 60
475 3300009148 Ga0105243_10316311 Ga0105243_103163112 60
476 3300009148 Ga0105243_11843306 Ga0105243_118433062 60
477 3300009148 Ga0105243_11966992 Ga0105243_119669922 60
478 3300009174 Ga0105241_10089672 Ga0105241_100896722 60
479 3300009174 Ga0105241_11725112 Ga0105241_117251122 60
480 3300009174 Ga0105241_12347566 Ga0105241_123475662 60
481 3300009176 Ga0105242_10007316 Ga0105242_100073166 60
482 3300009176 Ga0105242_10369628 Ga0105242_103696281 60
483 3300009176 Ga0105242_10515389 Ga0105242_105153892 60
484 3300009177 Ga0105248_10095738 Ga0105248_100957383 60
485 3300009177 Ga0105248_12652635 Ga0105248_126526351 60
486 3300009545 Ga0105237_11513625 Ga0105237_115136252 60
487 3300009551 Ga0105238_11572809 Ga0105238_115728092 60
488 3300009553 Ga0105249_10040450 Ga0105249_100404503 60
489 3300009553 Ga0105249_10096464 Ga0105249_100964644 60
490 3300009553 Ga0105249_10419996 Ga0105249_104199962 60
491 3300009553 Ga0105249_10747540 Ga0105249_107475402 60
492 3300009553 Ga0105249_10772388 Ga0105249_107723882 60
493 3300009553 Ga0105249_11063464 Ga0105249_110634642 60
494 3300009553 Ga0105249_11215373 Ga0105249_112153731 60
495 3300009553 Ga0105249_11495040 Ga0105249_114950402 60
496 3300009553 Ga0105249_11990528 Ga0105249_119905282 60
497 3300009553 Ga0105249_12450731 Ga0105249_124507311 60
498 3300010375 Ga0105239_10579215 Ga0105239_105792152 60
499 3300011119 Ga0105246_12074396 Ga0105246_120743962 60
500 3300013102 Ga0157371_10561960 Ga0157371_105619602 60
501 3300013296 Ga0157374_10140541 Ga0157374_101405413 60
502 3300013297 Ga0157378_10144374 Ga0157378_101443742 60
503 3300013297 Ga0157378_10148846 Ga0157378_101488462 60
504 3300013297 Ga0157378_10676683 Ga0157378_106766831 60
505 3300013297 Ga0157378_11963687 Ga0157378_119636872 60
506 3300013306 Ga0163162_10089299 Ga0163162_100892993 60
507 3300013306 Ga0163162_10281103 Ga0163162_102811033 60
508 3300013306 Ga0163162_10479706 Ga0163162_104797062 60
509 3300013306 Ga0163162_11336249 Ga0163162_113362492 60
510 3300013306 Ga0163162_11944991 Ga0163162_119449912 60
511 3300013306 Ga0163162_12888041 Ga0163162_128880411 60
512 3300013308 Ga0157375_10365282 Ga0157375_103652822 60
513 3300013308 Ga0157375_10502312 Ga0157375_105023122 60
514 3300013308 Ga0157375_11381743 Ga0157375_113817432 60
515 3300013308 Ga0157375_11425884 Ga0157375_114258841 60
516 3300014325 Ga0163163_11763462 Ga0163163_117634622 60
517 3300014326 Ga0157380_10012811 Ga0157380_100128115 60
518 3300014326 Ga0157380_11252282 Ga0157380_112522822 60
519 3300014326 Ga0157380_11262628 Ga0157380_112626282 60
520 3300014326 Ga0157380_11669675 Ga0157380_116696752 60
521 3300014326 Ga0157380_11781637 Ga0157380_117816372 60
522 3300014326 Ga0157380_12364832 Ga0157380_123648322 60
523 3300014326 Ga0157380_12482058 Ga0157380_124820582 60
524 3300014745 Ga0157377_10905265 Ga0157377_109052652 60
525 3300014968 Ga0157379_10263328 Ga0157379_102633282 60
526 3300014968 Ga0157379_10342888 Ga0157379_103428882 60
527 3300014968 Ga0157379_10408297 Ga0157379_104082972 60
528 3300014969 Ga0157376_10366069 Ga0157376_103660692 60
529 3300014969 Ga0157376_11959727 Ga0157376_119597272 60
530 3300014969 Ga0157376_12516474 Ga0157376_125164742 60
531 3300017792 Ga0163161_10275653 Ga0163161_102756532 60
532 3300017792 Ga0163161_10372776 Ga0163161_103727761 60
533 3300017792 Ga0163161_10735901 Ga0163161_107359012 60
534 3300017792 Ga0163161_11039582 Ga0163161_110395822 60
535 3300025885 Ga0207653_10017883 Ga0207653_100178832 60
536 3300025885 Ga0207653_10056547 Ga0207653_100565472 60
537 3300025885 Ga0207653_10174455 Ga0207653_101744552 60
538 3300025885 Ga0207653_10406129 Ga0207653_104061292 60
539 3300025893 Ga0207682_10039855 Ga0207682_100398553 60
540 3300025899 Ga0207642_10103688 Ga0207642_101036882 60
541 3300025900 Ga0207710_10093146 Ga0207710_100931462 60
542 3300025900 Ga0207710_10379410 Ga0207710_103794103 60
543 3300025901 Ga0207688_10173884 Ga0207688_101738842 60
544 3300025901 Ga0207688_10259532 Ga0207688_102595322 60
545 3300025903 Ga0207680_10140445 Ga0207680_101404454 60
546 3300025903 Ga0207680_10947020 Ga0207680_109470202 60
547 3300025903 Ga0207680_11172761 Ga0207680_111727612 60
548 3300025905 Ga0207685_10697662 Ga0207685_106976622 60
549 3300025906 Ga0207699_10198827 Ga0207699_101988273 60
550 3300025908 Ga0207643_10149260 Ga0207643_101492602 60
551 3300025908 Ga0207643_10155577 Ga0207643_101555772 60
552 3300025908 Ga0207643_10171496 Ga0207643_101714962 60
553 3300025908 Ga0207643_10391337 Ga0207643_103913371 60
554 3300025910 Ga0207684_10001250 Ga0207684_1000125021 60
555 3300025910 Ga0207684_10018301 Ga0207684_100183013 60
556 3300025910 Ga0207684_10145913 Ga0207684_101459133 60
557 3300025910 Ga0207684_10167659 Ga0207684_101676591 60
558 3300025910 Ga0207684_10170085 Ga0207684_101700852 60
559 3300025910 Ga0207684_10315993 Ga0207684_103159933 60
560 3300025910 Ga0207684_10479095 Ga0207684_104790952 60
561 3300025910 Ga0207684_10758209 Ga0207684_107582092 60
562 3300025910 Ga0207684_10948524 Ga0207684_109485242 60
563 3300025911 Ga0207654_10205454 Ga0207654_102054542 60
564 3300025912 Ga0207707_11080304 Ga0207707_110803042 60
565 3300025915 Ga0207693_10001797 Ga0207693_1000179714 60
566 3300025917 Ga0207660_10020589 Ga0207660_100205893 60
567 3300025917 Ga0207660_10076680 Ga0207660_100766803 60
568 3300025917 Ga0207660_10143385 Ga0207660_101433851 60
569 3300025917 Ga0207660_10493473 Ga0207660_104934732 60
570 3300025917 Ga0207660_11058195 Ga0207660_110581952 60
571 3300025917 Ga0207660_11376146 Ga0207660_113761462 60
572 3300025918 Ga0207662_10110357 Ga0207662_101103572 60
573 3300025920 Ga0207649_10297175 Ga0207649_102971752 60
574 3300025921 Ga0207652_10154746 Ga0207652_101547462 60
575 3300025922 Ga0207646_10002725 Ga0207646_100027252 60
576 3300025922 Ga0207646_10011610 Ga0207646_1001161010 60
577 3300025922 Ga0207646_10028658 Ga0207646_100286582 60
578 3300025922 Ga0207646_10108266 Ga0207646_101082663 60
579 3300025922 Ga0207646_10124147 Ga0207646_101241473 60
580 3300025922 Ga0207646_11348033 Ga0207646_113480332 60
581 3300025923 Ga0207681_10013004 Ga0207681_100130042 60
582 3300025923 Ga0207681_10226847 Ga0207681_102268472 60
583 3300025923 Ga0207681_10644239 Ga0207681_106442392 60
584 3300025923 Ga0207681_10728413 Ga0207681_107284131 60
585 3300025923 Ga0207681_11819793 Ga0207681_118197931 60
586 3300025924 Ga0207694_11097811 Ga0207694_110978112 60
587 3300025926 Ga0207659_10084675 Ga0207659_100846753 60
588 3300025926 Ga0207659_10892434 Ga0207659_108924342 60
589 3300025926 Ga0207659_11244622 Ga0207659_112446221 60
590 3300025927 Ga0207687_10428488 Ga0207687_104284881 60
591 3300025932 Ga0207690_10323632 Ga0207690_103236322 60
592 3300025933 Ga0207706_10039941 Ga0207706_100399414 60
593 3300025933 Ga0207706_10103116 Ga0207706_101031164 60
594 3300025933 Ga0207706_10295414 Ga0207706_102954142 60
595 3300025933 Ga0207706_10448080 Ga0207706_104480802 60
596 3300025933 Ga0207706_10788815 Ga0207706_107888152 60
597 3300025934 Ga0207686_10092567 Ga0207686_100925672 60
598 3300025934 Ga0207686_10418887 Ga0207686_104188872 60
599 3300025935 Ga0207709_10009745 Ga0207709_100097454 60
600 3300025935 Ga0207709_10114164 Ga0207709_101141643 60
601 3300025935 Ga0207709_10198351 Ga0207709_101983512 60
602 3300025935 Ga0207709_10267548 Ga0207709_102675484 60
603 3300025936 Ga0207670_10134960 Ga0207670_101349603 60
604 3300025936 Ga0207670_11203801 Ga0207670_112038012 60
605 3300025937 Ga0207669_10002819 Ga0207669_100028193 60
606 3300025937 Ga0207669_10694042 Ga0207669_106940422 60
607 3300025937 Ga0207669_11087110 Ga0207669_110871102 60
608 3300025937 Ga0207669_11322104 Ga0207669_113221042 60
609 3300025938 Ga0207704_10547977 Ga0207704_105479772 60
610 3300025938 Ga0207704_10790383 Ga0207704_107903832 60
611 3300025938 Ga0207704_10979807 Ga0207704_109798072 60
612 3300025938 Ga0207704_11569822 Ga0207704_115698222 60
613 3300025939 Ga0207665_10467870 Ga0207665_104678702 60
614 3300025940 Ga0207691_10018385 Ga0207691_100183851 60
615 3300025940 Ga0207691_11385314 Ga0207691_113853141 60
616 3300025940 Ga0207691_11427519 Ga0207691_114275192 60
617 3300025941 Ga0207711_10262659 Ga0207711_102626593 60
618 3300025942 Ga0207689_10017977 Ga0207689_100179772 60
619 3300025942 Ga0207689_10861608 Ga0207689_108616082 60
620 3300025944 Ga0207661_10796406 Ga0207661_107964062 60
621 3300025945 Ga0207679_11332113 Ga0207679_113321131 60
622 3300025961 Ga0207712_10039637 Ga0207712_100396375 60
623 3300025961 Ga0207712_10065205 Ga0207712_100652052 60
624 3300025961 Ga0207712_10294793 Ga0207712_102947932 60
625 3300025961 Ga0207712_11101464 Ga0207712_111014642 60
626 3300025961 Ga0207712_11322542 Ga0207712_113225422 60
627 3300025972 Ga0207668_10056024 Ga0207668_100560242 60
628 3300025972 Ga0207668_10336720 Ga0207668_103367202 60
629 3300025981 Ga0207640_10302985 Ga0207640_103029853 60
630 3300026023 Ga0207677_10412597 Ga0207677_104125972 60
631 3300026035 Ga0207703_11274917 Ga0207703_112749172 60
632 3300026035 Ga0207703_11324665 Ga0207703_113246652 60
633 3300026035 Ga0207703_11466203 Ga0207703_114662032 60
634 3300026067 Ga0207678_10540301 Ga0207678_105403012 60
635 3300026075 Ga0207708_10070499 Ga0207708_100704994 60
636 3300026075 Ga0207708_10118052 Ga0207708_101180522 60
637 3300026075 Ga0207708_10144577 Ga0207708_101445772 60
638 3300026075 Ga0207708_10299100 Ga0207708_102991003 60
639 3300026075 Ga0207708_10322081 Ga0207708_103220812 60
640 3300026075 Ga0207708_10704847 Ga0207708_107048472 60
641 3300026075 Ga0207708_10956063 Ga0207708_109560631 60
642 3300026075 Ga0207708_11263138 Ga0207708_112631382 60
643 3300026088 Ga0207641_10298159 Ga0207641_102981593 60
644 3300026088 Ga0207641_10499569 Ga0207641_104995692 60
645 3300026088 Ga0207641_10594614 Ga0207641_105946142 60
646 3300026088 Ga0207641_11798391 Ga0207641_117983911 60
647 3300026089 Ga0207648_10172648 Ga0207648_101726483 60
648 3300026089 Ga0207648_10182739 Ga0207648_101827392 60
649 3300026089 Ga0207648_10400569 Ga0207648_104005692 60
650 3300026089 Ga0207648_10941849 Ga0207648_109418492 60
651 3300026089 Ga0207648_11703534 Ga0207648_117035342 60
652 3300026095 Ga0207676_11048110 Ga0207676_110481102 60
653 3300026116 Ga0207674_10009097 Ga0207674_100090978 60
654 3300026116 Ga0207674_10026837 Ga0207674_100268374 60
655 3300026116 Ga0207674_10143310 Ga0207674_101433103 60
656 3300026116 Ga0207674_12006178 Ga0207674_120061782 60
657 3300026118 Ga0207675_100036637 Ga0207675_1000366374 60
658 3300026118 Ga0207675_100166659 Ga0207675_1001666592 60
659 3300026118 Ga0207675_100231606 Ga0207675_1002316062 60
660 3300026118 Ga0207675_102057957 Ga0207675_1020579572 60
661 3300026118 Ga0207675_102371264 Ga0207675_1023712642 60
662 3300026121 Ga0207683_10074332 Ga0207683_100743323 60
663 3300026121 Ga0207683_10469550 Ga0207683_104695502 60
664 3300026121 Ga0207683_10556269 Ga0207683_105562692 60
665 3300026142 Ga0207698_10349105 Ga0207698_103491053 60
666 3300027360 Ga0209969_1085366 Ga0209969_10853661 60
667 3300027543 Ga0209999_1085370 Ga0209999_10853701 60
668 3300027614 Ga0209970_1006010 Ga0209970_10060102 60
669 3300027665 Ga0209983_1029238 Ga0209983_10292382 60
670 3300027671 Ga0209588_1030636 Ga0209588_10306363 60
671 3300027671 Ga0209588_1105923 Ga0209588_11059232 60
672 3300027671 Ga0209588_1190941 Ga0209588_11909412 60
673 3300027671 Ga0209588_1262696 Ga0209588_12626962 60
674 3300027682 Ga0209971_1003272 Ga0209971_10032725 60
675 3300027682 Ga0209971_1046567 Ga0209971_10465672 60
676 3300027682 Ga0209971_1070487 Ga0209971_10704872 60
677 3300027682 Ga0209971_1103539 Ga0209971_11035392 60
678 3300027695 Ga0209966_1013086 Ga0209966_10130862 60
679 3300027695 Ga0209966_1039891 Ga0209966_10398912 60
680 3300027717 Ga0209998_10008211 Ga0209998_100082113 60
681 3300027876 Ga0209974_10011233 Ga0209974_100112333 60
682 3300027876 Ga0209974_10293449 Ga0209974_102934491 60
683 3300027907 Ga0207428_10000176 Ga0207428_1000017610 60
684 3300027907 Ga0207428_10000781 Ga0207428_1000078114 60
685 3300027907 Ga0207428_10004655 Ga0207428_100046558 60
686 3300027907 Ga0207428_10048517 Ga0207428_100485174 60
687 3300027907 Ga0207428_10074240 Ga0207428_100742402 60
688 3300027907 Ga0207428_10254327 Ga0207428_102543271 60
689 3300027907 Ga0207428_11005567 Ga0207428_110055671 60
690 3300027907 Ga0207428_11275236 Ga0207428_112752361 60
691 3300027907 Ga0207428_11318857 Ga0207428_113188572 60
692 3300028380 Ga0268265_10203094 Ga0268265_102030942 60
693 3300028380 Ga0268265_10437182 Ga0268265_104371822 60
694 3300028380 Ga0268265_11209523 Ga0268265_112095231 60
695 3300028380 Ga0268265_11411912 Ga0268265_114119121 60
696 3300028380 Ga0268265_11546409 Ga0268265_115464092 60
697 3300028380 Ga0268265_11832109 Ga0268265_118321092 60
698 3300028380 Ga0268265_12270289 Ga0268265_122702892 60
699 3300028381 Ga0268264_10068325 Ga0268264_100683254 60
700 3300028381 Ga0268264_10103322 Ga0268264_101033222 60
701 3300028381 Ga0268264_10308422 Ga0268264_103084222 60
702 3300028381 Ga0268264_10870069 Ga0268264_108700691 60
703 3300028381 Ga0268264_11310466 Ga0268264_113104662 60
704 3300031548 Ga0307408_100060906 Ga0307408_1000609062 60
705 3300031548 Ga0307408_100159079 Ga0307408_1001590792 60
706 3300031548 Ga0307408_100267404 Ga0307408_1002674042 60
707 3300031548 Ga0307408_100273097 Ga0307408_1002730973 60
708 3300031548 Ga0307408_100275578 Ga0307408_1002755782 60
709 3300031548 Ga0307408_100339673 Ga0307408_1003396733 60
710 3300031548 Ga0307408_100364120 Ga0307408_1003641202 60
711 3300031548 Ga0307408_100364548 Ga0307408_1003645482 60
712 3300031548 Ga0307408_100394172 Ga0307408_1003941722 60
713 3300031548 Ga0307408_101231911 Ga0307408_1012319111 60
714 3300031548 Ga0307408_101334011 Ga0307408_1013340112 60
715 3300031548 Ga0307408_101948325 Ga0307408_1019483252 60
716 3300031728 Ga0316578_10170351 Ga0316578_101703512 60
717 3300031731 Ga0307405_10159272 Ga0307405_101592722 60
718 3300031731 Ga0307405_10654895 Ga0307405_106548952 60
719 3300031731 Ga0307405_12075545 Ga0307405_120755451 60
720 3300031733 Ga0316577_10010268 Ga0316577_100102685 60
721 3300031824 Ga0307413_10160339 Ga0307413_101603391 60
722 3300031824 Ga0307413_10726973 Ga0307413_107269732 60
723 3300031852 Ga0307410_10029895 Ga0307410_100298954 60
724 3300031852 Ga0307410_10453612 Ga0307410_104536122 60
725 3300031852 Ga0307410_11065420 Ga0307410_110654202 60
726 3300031852 Ga0307410_11642931 Ga0307410_116429312 60
727 3300031852 Ga0307410_11737208 Ga0307410_117372081 60
728 3300031852 Ga0307410_11950363 Ga0307410_119503632 60
729 3300031901 Ga0307406_10215121 Ga0307406_102151211 60
730 3300031901 Ga0307406_10414435 Ga0307406_104144352 60
731 3300031901 Ga0307406_11432937 Ga0307406_114329372 60
732 3300031901 Ga0307406_11955477 Ga0307406_119554771 60
733 3300031903 Ga0307407_10536933 Ga0307407_105369332 60
734 3300031903 Ga0307407_11032500 Ga0307407_110325002 60
735 3300031903 Ga0307407_11623564 Ga0307407_116235642 60
736 3300031911 Ga0307412_11246766 Ga0307412_112467662 60
737 3300031911 Ga0307412_11801569 Ga0307412_118015692 60
738 3300031911 Ga0307412_12185693 Ga0307412_121856931 60
739 3300031995 Ga0307409_100024576 Ga0307409_1000245763 60
740 3300031995 Ga0307409_100044761 Ga0307409_1000447612 60
741 3300031995 Ga0307409_100375040 Ga0307409_1003750402 60
742 3300031995 Ga0307409_100727497 Ga0307409_1007274972 60
743 3300031995 Ga0307409_101603700 Ga0307409_1016037002 60
744 3300031995 Ga0307409_101716943 Ga0307409_1017169432 60
745 3300031995 Ga0307409_102504004 Ga0307409_1025040042 60
746 3300032002 Ga0307416_100044347 Ga0307416_1000443474 60
747 3300032002 Ga0307416_100266650 Ga0307416_1002666502 60
748 3300032002 Ga0307416_100441919 Ga0307416_1004419192 60
749 3300032002 Ga0307416_100664259 Ga0307416_1006642593 60
750 3300032002 Ga0307416_101683045 Ga0307416_1016830452 60
751 3300032002 Ga0307416_101757393 Ga0307416_1017573932 60
752 3300032004 Ga0307414_10045212 Ga0307414_100452122 60
753 3300032004 Ga0307414_10295473 Ga0307414_102954732 60
754 3300032005 Ga0307411_10311622 Ga0307411_103116222 60
755 3300032005 Ga0307411_10318764 Ga0307411_103187642 60
756 3300032005 Ga0307411_10464116 Ga0307411_104641162 60
757 3300032005 Ga0307411_11205138 Ga0307411_112051382 60
758 3300032005 Ga0307411_12143818 Ga0307411_121438182 60
759 3300032126 Ga0307415_100144131 Ga0307415_1001441312 60
760 3300032126 Ga0307415_100322885 Ga0307415_1003228853 60
761 3300032126 Ga0307415_100847439 Ga0307415_1008474392 60
762 3300032126 Ga0307415_101174051 Ga0307415_1011740511 60
763 3300032139 Ga0316580_10172176 Ga0316580_101721762 60
764 3300034816 Ga0373930_0005852 Ga0373930_0005852_466_648 60
765 3300034817 Ga0373948_0016663 Ga0373948_0016663_1154_1336 60
766 3300034817 Ga0373948_0030107 Ga0373948_0030107_741_923 60
767 3300034818 Ga0373950_0028497 Ga0373950_0028497_218_400 60
768 3300034819 Ga0373958_0079484 Ga0373958_0079484_497_679 60
769 3300035084 Ga0373928_0009053 Ga0373928_0009053_931_1113 60
770 3300035085 Ga0373929_0112210 Ga0373929_0112210_27_209 60
771 3300035088 Ga0373940_0003750 Ga0373940_0003750_591_773 60
772 3300035088 Ga0373940_0014053 Ga0373940_0014053_1114_1296 60
773 3300035088 Ga0373940_0214227 Ga0373940_0214227_217_399 60
774 3300035090 Ga0373949_0007945 Ga0373949_0007945_448_630 60
775 3300035090 Ga0373949_0034496 Ga0373949_0034496_650_832 60
776 3300035112 Ga0373932_0019437 Ga0373932_0019437_463_645 60
777 3300035114 Ga0373939_0005698 Ga0373939_0005698_1418_1600 60
778 3300035114 Ga0373939_0011421 Ga0373939_0011421_1516_1698 60
779 3300035114 Ga0373939_0057142 Ga0373939_0057142_45_227 60
780 3300035114 Ga0373939_0483861 Ga0373939_0483861_265_447 60
781 3300035114 Ga0373939_0509287 Ga0373939_0509287_171_353 60
782 3300035121 Ga0373960_0128905 Ga0373960_0128905_150_332 60
783 3300035241 Ga0373961_0379683 Ga0373961_0379683_124_306 60
784 3300035242 Ga0373962_0035765 Ga0373962_0035765_788_970 60
785 3300035242 Ga0373962_0322815 Ga0373962_0322815_340_522 60
786 3300035242 Ga0373962_0328211 Ga0373962_0328211_239_421 60
787 3300035691 Ga0373931_0025696 Ga0373931_0025696_1430_1612 60
788 3300035691 Ga0373931_0028904 Ga0373931_0028904_903_1085 60
789 3300035691 Ga0373931_0552096 Ga0373931_0552096_311_493 60
790 3300035691 Ga0373931_0813431 Ga0373931_0813431_193_375 60
791 3300036712 Ga0316584_0927831 Ga0316584_0927831_168_356 60
792 3300037312 Ga0395899_0126457 Ga0395899_0126457_574_756 60
793 3300037418 Ga0395900_0002079 Ga0395900_0002079_20360_20542 60
794 3300037418 Ga0395900_0242885 Ga0395900_0242885_705_887 60
795 3300037466 Ga0395898_0046862 Ga0395898_0046862_2094_2276 60
796 3300037466 Ga0395898_1274718 Ga0395898_1274718_131_313 60
797 3300037471 Ga0395905_0130949 Ga0395905_0130949_2120_2302 60
798 3300037471 Ga0395905_0139864 Ga0395905_0139864_363_545 60
799 3300037471 Ga0395905_0844582 Ga0395905_0844582_569_751 60
800 3300038443 Ga0395901_0001177 Ga0395901_0001177_11423_11605 60
801 3300038443 Ga0395901_0176099 Ga0395901_0176099_1529_1711 60
802 3300038996 Ga0242420_020273 Ga0242420_020273_862_1044 60
803 3300038996 Ga0242420_099773 Ga0242420_099773_325_507 60
804 3300041406 Ga0439439_0118106 Ga0439439_0118106_358_540 60
805 3300041408 Ga0439453_0094376 Ga0439453_0094376_207_389 60
806 3300041408 Ga0439453_0162166 Ga0439453_0162166_312_494 60
807 3300041410 Ga0439461_0090063 Ga0439461_0090063_424_606 60
808 3300041486 Ga0451807_0181735 Ga0451807_0181735_746_928 60
809 3300041486 Ga0451807_0779600 Ga0451807_0779600_101_283 60
810 3300041486 Ga0451807_1410496 Ga0451807_1410496_412_594 60
811 3300041997 Ga0439431_0084275 Ga0439431_0084275_92_274 60
812 3300041997 Ga0439431_0175529 Ga0439431_0175529_189_371 60
813 3300041999 Ga0439433_0001765 Ga0439433_0001765_312_494 60
814 3300041999 Ga0439433_0121970 Ga0439433_0121970_14_196 60
815 3300042001 Ga0439441_144495 Ga0439441_144495_327_509 60
816 3300042002 Ga0439442_065831 Ga0439442_065831_511_693 60
817 3300042007 Ga0439449_0203202 Ga0439449_0203202_414_596 60
818 3300042007 Ga0439449_0345116 Ga0439449_0345116_311_493 60
819 3300042007 Ga0439449_0382617 Ga0439449_0382617_18_200 60
820 3300042008 Ga0439450_036305 Ga0439450_036305_692_874 60
821 3300042008 Ga0439450_081339 Ga0439450_081339_58_240 60
822 3300042009 Ga0439451_056827 Ga0439451_056827_527_709 60
823 3300042015 Ga0439462_0041172 Ga0439462_0041172_393_575 60
824 3300042121 Ga0450919_025999 Ga0450919_025999_299_481 60
825 3300042122 Ga0450920_037922 Ga0450920_037922_624_806 60
826 3300042122 Ga0450920_089054 Ga0450920_089054_306_488 60
827 3300042125 Ga0450923_054352 Ga0450923_054352_50_232 60
828 3300042125 Ga0450923_125858 Ga0450923_125858_334_516 60
829 3300042131 Ga0450894_013771 Ga0450894_013771_721_903 60
830 3300042133 Ga0450896_017122 Ga0450896_017122_655_837 60
831 3300042156 Ga0439446_0155222 Ga0439446_0155222_64_246 60
832 3300042156 Ga0439446_0157530 Ga0439446_0157530_350_532 60
833 3300042156 Ga0439446_0225511 Ga0439446_0225511_65_247 60
834 3300042156 Ga0439446_0313940 Ga0439446_0313940_226_408 60
835 3300042435 Ga0439434_0050385 Ga0439434_0050385_260_442 60
836 3300042435 Ga0439434_0255791 Ga0439434_0255791_297_479 60
837 3300042436 Ga0439435_0212737 Ga0439435_0212737_162_344 60
838 3300042437 Ga0439444_0013165 Ga0439444_0013165_271_453 60
839 3300042439 Ga0439464_0087724 Ga0439464_0087724_713_895 60
840 3300042439 Ga0439464_0332078 Ga0439464_0332078_76_258 60
841 3300042461 Ga0439460_0071619 Ga0439460_0071619_239_421 60
842 3300042461 Ga0439460_0211041 Ga0439460_0211041_243_425 60
843 3300042461 Ga0439460_0244493 Ga0439460_0244493_10_192 60
844 3300042876 Ga0451577_0003798 Ga0451577_0003798_1605_1787 60
845 3300042876 Ga0451577_0241557 Ga0451577_0241557_762_944 60
846 3300042876 Ga0451577_0607730 Ga0451577_0607730_593_775 60
847 3300042876 Ga0451577_0682905 Ga0451577_0682905_155_337 60
848 3300042993 Ga0439440_0140295 Ga0439440_0140295_283_465 60
849 3300044673 Ga0453683_0044184 Ga0453683_0044184_2550_2732 60
850 3300044673 Ga0453683_0218621 Ga0453683_0218621_906_1088 60
851 3300044673 Ga0453683_0446692 Ga0453683_0446692_187_369 60
852 3300044712 Ga0453684_0055373 Ga0453684_0055373_910_1092 60
853 3300044712 Ga0453684_0087483 Ga0453684_0087483_328_510 60
854 3300044712 Ga0453684_0379824 Ga0453684_0379824_1121_1303 60
855 3300045051 Ga0451576_0017424 Ga0451576_0017424_2951_3133 60
856 3300045051 Ga0451576_0027337 Ga0451576_0027337_5457_5639 60
857 3300045051 Ga0451576_0132764 Ga0451576_0132764_580_762 60
858 3300045051 Ga0451576_0151484 Ga0451576_0151484_1214_1396 60
859 3300045051 Ga0451576_0181962 Ga0451576_0181962_1033_1215 60
860 3300045051 Ga0451576_0225968 Ga0451576_0225968_129_311 60
861 3300045051 Ga0451576_0242115 Ga0451576_0242115_72_254 60
862 3300045051 Ga0451576_0462105 Ga0451576_0462105_853_1035 60
863 3300045051 Ga0451576_0758699 Ga0451576_0758699_163_345 60
864 3300045051 Ga0451576_0808547 Ga0451576_0808547_37_219 60
865 3300045051 Ga0451576_1870878 Ga0451576_1870878_428_610 60
866 3300046455 Ga0495603_0561514 Ga0495603_0561514_202_384 60
867 3300046472 Ga0495580_0022267 Ga0495580_0022267_3824_4006 60
868 3300046475 Ga0495639_0313536 Ga0495639_0313536_333_515 60
869 3300046491 Ga0495584_0150657 Ga0495584_0150657_802_984 60
870 3300046492 Ga0495585_0309630 Ga0495585_0309630_522_704 60
871 3300046499 Ga0495594_0035822 Ga0495594_0035822_711_893 60
872 3300046499 Ga0495594_0101325 Ga0495594_0101325_1265_1447 60
873 3300046528 Ga0495642_0002373 Ga0495642_0002373_5864_6046 60
874 3300046528 Ga0495642_0049597 Ga0495642_0049597_1021_1203 60
875 3300046528 Ga0495642_0104636 Ga0495642_0104636_234_416 60
876 3300046533 Ga0495640_0301537 Ga0495640_0301537_370_552 60
877 3300046537 Ga0495598_0247502 Ga0495598_0247502_256_438 60
878 3300046537 Ga0495598_0368179 Ga0495598_0368179_311_493 60
879 3300046537 Ga0495598_0371083 Ga0495598_0371083_73_255 60
880 3300046615 Ga0495656_0068037 Ga0495656_0068037_380_562 60
881 3300046615 Ga0495656_0468247 Ga0495656_0468247_206_388 60
882 3300046660 Ga0495625_0547707 Ga0495625_0547707_425_607 60
883 3300046664 Ga0495659_0010679 Ga0495659_0010679_2439_2621 60
884 3300046664 Ga0495659_0049413 Ga0495659_0049413_110_292 60
885 3300046664 Ga0495659_0160332 Ga0495659_0160332_322_504 60
886 3300046664 Ga0495659_0196738 Ga0495659_0196738_625_807 60
887 3300046684 Ga0495669_0014804 Ga0495669_0014804_2346_2528 60
888 3300046684 Ga0495669_0014835 Ga0495669_0014835_2667_2849 60
889 3300046684 Ga0495669_0227115 Ga0495669_0227115_591_773 60
890 3300046684 Ga0495669_0304188 Ga0495669_0304188_543_725 60
891 3300046684 Ga0495669_0653626 Ga0495669_0653626_173_355 60
892 3300046691 Ga0495670_0819661 Ga0495670_0819661_230_412 60
893 3300047318 Ga0495636_0268934 Ga0495636_0268934_310_492 60
894 3300047318 Ga0495636_0276640 Ga0495636_0276640_409_591 60
895 3300047322 Ga0495680_0526878 Ga0495680_0526878_251_433 60
896 3300048903 Ga0496100_0049101 Ga0496100_0049101_752_934 60
897 3300048904 Ga0496101_0056536 Ga0496101_0056536_877_1059 60
898 3300048905 Ga0496102_0015235 Ga0496102_0015235_3353_3535 60
899 3300048905 Ga0496102_0924655 Ga0496102_0924655_107_289 60
900 3300048906 Ga0496103_0059659 Ga0496103_0059659_288_470 60
901 3300048907 Ga0496104_0875400 Ga0496104_0875400_197_379 60
902 3300048907 Ga0496104_1093088 Ga0496104_1093088_258_440 60
903 3300048908 Ga0496105_0255983 Ga0496105_0255983_698_880 60
904 3300048909 Ga0496106_0270654 Ga0496106_0270654_636_818 60
905 3300048909 Ga0496106_0747442 Ga0496106_0747442_175_357 60
906 3300048910 Ga0496107_0113152 Ga0496107_0113152_1531_1713 60
907 3300048911 Ga0496108_0190791 Ga0496108_0190791_700_882 60
908 3300048911 Ga0496108_1175204 Ga0496108_1175204_273_455 60
909 3300048915 Ga0496112_0724441 Ga0496112_0724441_285_467 60
910 3300048916 Ga0496113_1386942 Ga0496113_1386942_195_377 60
911 3300048916 Ga0496113_1421039 Ga0496113_1421039_97_279 60
912 3300048917 Ga0496114_0446641 Ga0496114_0446641_709_891 60
913 3300049520 Ga0501297_032835 Ga0501297_032835_446_628 60
914 3300049568 Ga0501031_0002847 Ga0501031_0002847_9505_9687 60
915 3300049568 Ga0501031_0184746 Ga0501031_0184746_1113_1295 60
916 3300049568 Ga0501031_0366538 Ga0501031_0366538_69_251 60
917 3300049568 Ga0501031_0592498 Ga0501031_0592498_444_626 60
918 3300049568 Ga0501031_0643859 Ga0501031_0643859_388_570 60
919 3300049569 Ga0501032_0072896 Ga0501032_0072896_1761_1943 60
920 3300049570 Ga0501033_0027258 Ga0501033_0027258_3232_3414 60
921 3300049570 Ga0501033_0040174 Ga0501033_0040174_533_715 60
922 3300049570 Ga0501033_0046480 Ga0501033_0046480_2673_2855 60
923 3300049570 Ga0501033_0093240 Ga0501033_0093240_1063_1245 60
924 3300049570 Ga0501033_0413609 Ga0501033_0413609_470_652 60
925 3300049570 Ga0501033_0431276 Ga0501033_0431276_387_569 60
926 3300049570 Ga0501033_0707116 Ga0501033_0707116_479_661 60
927 3300049572 Ga0501036_0006593 Ga0501036_0006593_452_634 60
928 3300049572 Ga0501036_0006916 Ga0501036_0006916_8004_8186 60
929 3300049572 Ga0501036_0101003 Ga0501036_0101003_1200_1382 60
930 3300049572 Ga0501036_0219481 Ga0501036_0219481_323_508 60
931 3300049572 Ga0501036_0223019 Ga0501036_0223019_209_391 60
932 3300049572 Ga0501036_0387714 Ga0501036_0387714_176_361 60
933 3300049572 Ga0501036_0460004 Ga0501036_0460004_224_406 60
934 3300049572 Ga0501036_0535303 Ga0501036_0535303_109_291 60
935 3300049572 Ga0501036_0623985 Ga0501036_0623985_483_665 60
936 3300049572 Ga0501036_0911274 Ga0501036_0911274_67_249 60
937 3300049572 Ga0501036_0942067 Ga0501036_0942067_477_659 60
938 3300049572 Ga0501036_1093132 Ga0501036_1093132_178_360 60
939 3300049573 Ga0501037_0472699 Ga0501037_0472699_166_348 60
940 3300049573 Ga0501037_0656759 Ga0501037_0656759_507_689 60
941 3300049574 Ga0501038_0000908 Ga0501038_0000908_4278_4460 60
942 3300049574 Ga0501038_0050187 Ga0501038_0050187_2383_2565 60
943 3300049574 Ga0501038_0099045 Ga0501038_0099045_1595_1777 60
944 3300049574 Ga0501038_0113781 Ga0501038_0113781_1728_1910 60
945 3300049574 Ga0501038_0473604 Ga0501038_0473604_508_690 60
946 3300049574 Ga0501038_0712992 Ga0501038_0712992_187_369 60
947 3300049575 Ga0501039_0000591 Ga0501039_0000591_10460_10642 60
948 3300049575 Ga0501039_0030213 Ga0501039_0030213_728_910 60
949 3300049575 Ga0501039_0050669 Ga0501039_0050669_633_815 60
950 3300049575 Ga0501039_0124808 Ga0501039_0124808_1228_1410 60
951 3300049575 Ga0501039_0211767 Ga0501039_0211767_538_720 60
952 3300049575 Ga0501039_0259381 Ga0501039_0259381_665_850 60
953 3300049575 Ga0501039_0417415 Ga0501039_0417415_238_420 60
954 3300049575 Ga0501039_0606347 Ga0501039_0606347_664_846 60
955 3300049575 Ga0501039_0712899 Ga0501039_0712899_504_686 60
956 3300049576 Ga0501040_0000838 Ga0501040_0000838_449_631 60
957 3300049576 Ga0501040_0016800 Ga0501040_0016800_3773_3955 60
958 3300049576 Ga0501040_0041399 Ga0501040_0041399_1674_1856 60
959 3300049576 Ga0501040_0069175 Ga0501040_0069175_1609_1791 60
960 3300049576 Ga0501040_0099155 Ga0501040_0099155_971_1153 60
961 3300049576 Ga0501040_0153938 Ga0501040_0153938_988_1170 60
962 3300049576 Ga0501040_0326060 Ga0501040_0326060_337_519 60
963 3300049576 Ga0501040_0381651 Ga0501040_0381651_809_994 60
964 3300049576 Ga0501040_0430324 Ga0501040_0430324_517_699 60
965 3300049576 Ga0501040_0601354 Ga0501040_0601354_52_234 60
966 3300049576 Ga0501040_0642022 Ga0501040_0642022_336_518 60
967 3300049576 Ga0501040_0645722 Ga0501040_0645722_317_499 60
968 3300049576 Ga0501040_0823449 Ga0501040_0823449_66_248 60
969 3300049576 Ga0501040_1208717 Ga0501040_1208717_133_315 60
970 3300049577 Ga0501041_0018129 Ga0501041_0018129_1354_1536 60
971 3300049577 Ga0501041_0022081 Ga0501041_0022081_1306_1488 60
972 3300049577 Ga0501041_0025272 Ga0501041_0025272_417_599 60
973 3300049577 Ga0501041_0037188 Ga0501041_0037188_1653_1835 60
974 3300049577 Ga0501041_0107195 Ga0501041_0107195_1528_1710 60
975 3300049577 Ga0501041_0109780 Ga0501041_0109780_809_991 60
976 3300049577 Ga0501041_0129408 Ga0501041_0129408_820_1002 60
977 3300049577 Ga0501041_0210857 Ga0501041_0210857_48_230 60
978 3300049577 Ga0501041_0253571 Ga0501041_0253571_506_688 60
979 3300049577 Ga0501041_0595573 Ga0501041_0595573_353_535 60
980 3300049577 Ga0501041_0755948 Ga0501041_0755948_381_563 60
981 3300049577 Ga0501041_0856749 Ga0501041_0856749_317_499 60
982 3300049577 Ga0501041_1005807 Ga0501041_1005807_20_202 60
983 3300049578 Ga0501042_0001801 Ga0501042_0001801_3636_3818 60
984 3300049578 Ga0501042_0026046 Ga0501042_0026046_1486_1668 60
985 3300049578 Ga0501042_0027646 Ga0501042_0027646_2145_2327 60
986 3300049578 Ga0501042_0054890 Ga0501042_0054890_1087_1269 60
987 3300049578 Ga0501042_0060865 Ga0501042_0060865_1151_1333 60
988 3300049578 Ga0501042_0075715 Ga0501042_0075715_1981_2163 60
989 3300049578 Ga0501042_0174686 Ga0501042_0174686_1318_1500 60
990 3300049578 Ga0501042_0230596 Ga0501042_0230596_997_1179 60
991 3300049578 Ga0501042_0606438 Ga0501042_0606438_95_277 60
992 3300049578 Ga0501042_0787233 Ga0501042_0787233_182_364 60
993 3300049578 Ga0501042_0809287 Ga0501042_0809287_317_499 60
994 3300049578 Ga0501042_1027650 Ga0501042_1027650_90_272 60
995 3300049578 Ga0501042_1146885 Ga0501042_1146885_294_476 60
996 3300049579 Ga0501043_0018220 Ga0501043_0018220_3481_3663 60
997 3300049579 Ga0501043_0043387 Ga0501043_0043387_256_438 60
998 3300049579 Ga0501043_0060928 Ga0501043_0060928_2430_2612 60
999 3300049579 Ga0501043_0485457 Ga0501043_0485457_520_702 60
1000 3300049579 Ga0501043_0784563 Ga0501043_0784563_111_293 60
1001 3300049579 Ga0501043_0960645 Ga0501043_0960645_180_362 60
1002 3300049579 Ga0501043_0963649 Ga0501043_0963649_292_474 60
1003 3300049579 Ga0501043_1235803 Ga0501043_1235803_133_315 60
1004 3300049580 Ga0501046_0000373 Ga0501046_0000373_43954_44136 60
1005 3300049580 Ga0501046_0018535 Ga0501046_0018535_2878_3060 60
1006 3300049580 Ga0501046_0094197 Ga0501046_0094197_1451_1633 60
1007 3300049580 Ga0501046_0109742 Ga0501046_0109742_1399_1581 60
1008 3300049580 Ga0501046_0115512 Ga0501046_0115512_1245_1427 60
1009 3300049580 Ga0501046_0143906 Ga0501046_0143906_25_207 60
1010 3300049580 Ga0501046_0217908 Ga0501046_0217908_28_210 60
1011 3300049580 Ga0501046_0222627 Ga0501046_0222627_870_1052 60
1012 3300049580 Ga0501046_0351384 Ga0501046_0351384_499_681 60
1013 3300049580 Ga0501046_0422581 Ga0501046_0422581_141_323 60
1014 3300049580 Ga0501046_0459182 Ga0501046_0459182_658_840 60
1015 3300049581 Ga0501047_0693553 Ga0501047_0693553_599_781 60
1016 3300049582 Ga0501048_0006097 Ga0501048_0006097_8031_8213 60
1017 3300049582 Ga0501048_0021170 Ga0501048_0021170_797_979 60
1018 3300049582 Ga0501048_0026116 Ga0501048_0026116_3536_3718 60
1019 3300049582 Ga0501048_0056962 Ga0501048_0056962_667_849 60
1020 3300049582 Ga0501048_0074278 Ga0501048_0074278_2149_2331 60
1021 3300049582 Ga0501048_0082151 Ga0501048_0082151_672_854 60
1022 3300049582 Ga0501048_0275012 Ga0501048_0275012_985_1167 60
1023 3300049582 Ga0501048_0356297 Ga0501048_0356297_454_636 60
1024 3300049582 Ga0501048_0695143 Ga0501048_0695143_313_495 60
1025 3300049582 Ga0501048_0705000 Ga0501048_0705000_490_672 60
1026 3300049582 Ga0501048_0737559 Ga0501048_0737559_341_523 60
1027 3300049582 Ga0501048_0852959 Ga0501048_0852959_362_565 60
1028 3300049582 Ga0501048_1036702 Ga0501048_1036702_398_580 60
1029 3300049582 Ga0501048_1096127 Ga0501048_1096127_228_410 60
1030 3300049582 Ga0501048_1141675 Ga0501048_1141675_151_333 60
1031 3300049583 Ga0501067_0082641 Ga0501067_0082641_1072_1254 60
1032 3300049583 Ga0501067_0339696 Ga0501067_0339696_346_528 60
1033 3300049584 Ga0501068_0002133 Ga0501068_0002133_10117_10299 60
1034 3300049584 Ga0501068_0049800 Ga0501068_0049800_1135_1317 60
1035 3300049584 Ga0501068_0288854 Ga0501068_0288854_375_557 60
1036 3300049584 Ga0501068_0435299 Ga0501068_0435299_494_676 60
1037 3300049584 Ga0501068_0516374 Ga0501068_0516374_412_594 60
1038 3300049584 Ga0501068_0533014 Ga0501068_0533014_430_612 60
1039 3300049584 Ga0501068_0620682 Ga0501068_0620682_214_396 60
1040 3300049585 Ga0501069_0060340 Ga0501069_0060340_316_498 60
1041 3300049585 Ga0501069_0136617 Ga0501069_0136617_466_648 60
1042 3300049585 Ga0501069_0140635 Ga0501069_0140635_363_545 60
1043 3300049585 Ga0501069_0160220 Ga0501069_0160220_63_245 60
1044 3300049585 Ga0501069_0497645 Ga0501069_0497645_13_195 60
1045 3300049585 Ga0501069_0524058 Ga0501069_0524058_318_500 60
1046 3300049585 Ga0501069_0570453 Ga0501069_0570453_227_409 60
1047 3300049585 Ga0501069_0614865 Ga0501069_0614865_303_485 60
1048 3300049586 Ga0501070_0247259 Ga0501070_0247259_742_924 60
1049 3300049586 Ga0501070_0412669 Ga0501070_0412669_646_828 60
1050 3300049586 Ga0501070_1305520 Ga0501070_1305520_115_297 60
1051 3300049586 Ga0501070_1402106 Ga0501070_1402106_32_214 60
1052 3300049587 Ga0501071_0000085 Ga0501071_0000085_31587_31769 60
1053 3300049587 Ga0501071_0021943 Ga0501071_0021943_1176_1358 60
1054 3300049587 Ga0501071_0039780 Ga0501071_0039780_2273_2455 60
1055 3300049587 Ga0501071_0048313 Ga0501071_0048313_2084_2266 60
1056 3300049587 Ga0501071_0080864 Ga0501071_0080864_1593_1775 60
1057 3300049587 Ga0501071_0094149 Ga0501071_0094149_933_1115 60
1058 3300049587 Ga0501071_0161043 Ga0501071_0161043_1341_1523 60
1059 3300049587 Ga0501071_0206021 Ga0501071_0206021_51_236 60
1060 3300049587 Ga0501071_0270118 Ga0501071_0270118_736_918 60
1061 3300049587 Ga0501071_0320337 Ga0501071_0320337_742_924 60
1062 3300049587 Ga0501071_0717398 Ga0501071_0717398_298_480 60
1063 3300049587 Ga0501071_0803545 Ga0501071_0803545_443_625 60
1064 3300049587 Ga0501071_1071783 Ga0501071_1071783_238_420 60
1065 3300049587 Ga0501071_1263762 Ga0501071_1263762_206_388 60
1066 3300049588 Ga0501072_0000073 Ga0501072_0000073_60857_61039 60
1067 3300049588 Ga0501072_0009683 Ga0501072_0009683_320_502 60
1068 3300049588 Ga0501072_0017526 Ga0501072_0017526_2980_3162 60
1069 3300049588 Ga0501072_0030003 Ga0501072_0030003_2435_2617 60
1070 3300049588 Ga0501072_0030970 Ga0501072_0030970_1233_1415 60
1071 3300049588 Ga0501072_0034295 Ga0501072_0034295_2464_2646 60
1072 3300049588 Ga0501072_0037862 Ga0501072_0037862_1722_1904 60
1073 3300049588 Ga0501072_0089887 Ga0501072_0089887_736_918 60
1074 3300049588 Ga0501072_0162370 Ga0501072_0162370_1117_1299 60
1075 3300049588 Ga0501072_0206709 Ga0501072_0206709_1129_1311 60
1076 3300049588 Ga0501072_0226440 Ga0501072_0226440_851_1033 60
1077 3300049588 Ga0501072_0794330 Ga0501072_0794330_122_304 60
1078 3300049588 Ga0501072_0934306 Ga0501072_0934306_212_394 60
1079 3300049588 Ga0501072_1591068 Ga0501072_1591068_287_469 60
1080 3300049589 Ga0501073_0003505 Ga0501073_0003505_4131_4313 60
1081 3300049589 Ga0501073_0083595 Ga0501073_0083595_1853_2035 60
1082 3300049589 Ga0501073_0105546 Ga0501073_0105546_1289_1471 60
1083 3300049589 Ga0501073_0415283 Ga0501073_0415283_386_568 60
1084 3300049589 Ga0501073_0572946 Ga0501073_0572946_128_310 60
1085 3300049589 Ga0501073_0937529 Ga0501073_0937529_272_454 60
1086 3300049589 Ga0501073_1165050 Ga0501073_1165050_17_199 60
1087 3300049590 Ga0501074_0011073 Ga0501074_0011073_1992_2174 60
1088 3300049590 Ga0501074_0125030 Ga0501074_0125030_10_192 60
1089 3300049590 Ga0501074_0184931 Ga0501074_0184931_951_1133 60
1090 3300049590 Ga0501074_0200476 Ga0501074_0200476_902_1084 60
1091 3300049590 Ga0501074_0251955 Ga0501074_0251955_91_273 60
1092 3300049590 Ga0501074_0270496 Ga0501074_0270496_595_777 60
1093 3300049590 Ga0501074_1002364 Ga0501074_1002364_198_380 60
1094 3300049590 Ga0501074_1162626 Ga0501074_1162626_227_409 60
1095 3300049591 Ga0501075_0000001 Ga0501075_0000001_27403_27585 60
1096 3300049591 Ga0501075_0000203 Ga0501075_0000203_30696_30878 60
1097 3300049591 Ga0501075_0005249 Ga0501075_0005249_2947_3129 60
1098 3300049591 Ga0501075_0008197 Ga0501075_0008197_2592_2774 60
1099 3300049591 Ga0501075_0016522 Ga0501075_0016522_3895_4077 60
1100 3300049591 Ga0501075_0029642 Ga0501075_0029642_738_920 60
1101 3300049591 Ga0501075_0092658 Ga0501075_0092658_1444_1626 60
1102 3300049591 Ga0501075_0135379 Ga0501075_0135379_1578_1760 60
1103 3300049591 Ga0501075_0140042 Ga0501075_0140042_1625_1807 60
1104 3300049591 Ga0501075_0203484 Ga0501075_0203484_769_951 60
1105 3300049591 Ga0501075_0432947 Ga0501075_0432947_701_883 60
1106 3300049591 Ga0501075_0512674 Ga0501075_0512674_688_870 60
1107 3300049591 Ga0501075_0548564 Ga0501075_0548564_277_459 60
1108 3300049591 Ga0501075_0684590 Ga0501075_0684590_142_324 60
1109 3300049591 Ga0501075_0742691 Ga0501075_0742691_184_366 60
1110 3300049591 Ga0501075_1144703 Ga0501075_1144703_379_561 60
1111 3300049591 Ga0501075_1357215 Ga0501075_1357215_235_417 60
1112 3300049591 Ga0501075_1357242 Ga0501075_1357242_248_430 60
1113 3300049592 Ga0501076_0000001 Ga0501076_0000001_117584_117766 60
1114 3300049592 Ga0501076_0000204 Ga0501076_0000204_6447_6629 60
1115 3300049592 Ga0501076_0004772 Ga0501076_0004772_3797_3979 60
1116 3300049592 Ga0501076_0016179 Ga0501076_0016179_1056_1238 60
1117 3300049592 Ga0501076_0063200 Ga0501076_0063200_1315_1497 60
1118 3300049592 Ga0501076_0086738 Ga0501076_0086738_1722_1907 60
1119 3300049592 Ga0501076_0087477 Ga0501076_0087477_624_806 60
1120 3300049592 Ga0501076_0112850 Ga0501076_0112850_1238_1420 60
1121 3300049592 Ga0501076_0198143 Ga0501076_0198143_1303_1485 60
1122 3300049592 Ga0501076_0241981 Ga0501076_0241981_664_846 60
1123 3300049592 Ga0501076_0264205 Ga0501076_0264205_1197_1379 60
1124 3300049592 Ga0501076_0272455 Ga0501076_0272455_640_822 60
1125 3300049592 Ga0501076_0438132 Ga0501076_0438132_666_848 60
1126 3300049592 Ga0501076_0484232 Ga0501076_0484232_362_544 60
1127 3300049592 Ga0501076_1027332 Ga0501076_1027332_327_509 60
1128 3300049592 Ga0501076_1237776 Ga0501076_1237776_275_457 60
1129 3300049592 Ga0501076_1307212 Ga0501076_1307212_244_426 60
1130 3300049592 Ga0501076_1513577 Ga0501076_1513577_87_269 60
1131 3300049593 Ga0501077_0000023 Ga0501077_0000023_31111_31293 60
1132 3300049593 Ga0501077_0002236 Ga0501077_0002236_337_519 60
1133 3300049593 Ga0501077_0018424 Ga0501077_0018424_2886_3068 60
1134 3300049593 Ga0501077_0024326 Ga0501077_0024326_1334_1516 60
1135 3300049593 Ga0501077_0043270 Ga0501077_0043270_1324_1506 60
1136 3300049593 Ga0501077_0098918 Ga0501077_0098918_471_653 60
1137 3300049593 Ga0501077_0105770 Ga0501077_0105770_242_424 60
1138 3300049593 Ga0501077_0142415 Ga0501077_0142415_438_620 60
1139 3300049593 Ga0501077_0209153 Ga0501077_0209153_729_911 60
1140 3300049593 Ga0501077_0293138 Ga0501077_0293138_67_249 60
1141 3300049593 Ga0501077_0428999 Ga0501077_0428999_67_249 60
1142 3300049593 Ga0501077_0525195 Ga0501077_0525195_186_368 60
1143 3300049593 Ga0501077_0748770 Ga0501077_0748770_32_214 60
1144 3300049593 Ga0501077_0854795 Ga0501077_0854795_38_220 60
1145 3300049741 Ga0501079_0000015 Ga0501079_0000015_32170_32352 60
1146 3300049741 Ga0501079_0008303 Ga0501079_0008303_7615_7797 60
1147 3300049741 Ga0501079_0019240 Ga0501079_0019240_1916_2098 60
1148 3300049741 Ga0501079_0030730 Ga0501079_0030730_551_733 60
1149 3300049741 Ga0501079_0039747 Ga0501079_0039747_3123_3305 60
1150 3300049741 Ga0501079_0098002 Ga0501079_0098002_265_447 60
1151 3300049741 Ga0501079_0101630 Ga0501079_0101630_1335_1517 60
1152 3300049741 Ga0501079_0106216 Ga0501079_0106216_675_857 60
1153 3300049741 Ga0501079_0166120 Ga0501079_0166120_1354_1536 60
1154 3300049741 Ga0501079_0302171 Ga0501079_0302171_769_951 60
1155 3300049741 Ga0501079_0347095 Ga0501079_0347095_501_683 60
1156 3300049741 Ga0501079_0694103 Ga0501079_0694103_370_552 60
1157 3300049741 Ga0501079_0823674 Ga0501079_0823674_454_636 60
1158 3300049741 Ga0501079_0864585 Ga0501079_0864585_442_624 60
1159 3300049741 Ga0501079_1355241 Ga0501079_1355241_364_546 60
1160 3300049742 Ga0501080_0000495 Ga0501080_0000495_2930_3112 60
1161 3300049742 Ga0501080_0077069 Ga0501080_0077069_2579_2761 60
1162 3300049742 Ga0501080_0249558 Ga0501080_0249558_1252_1434 60
1163 3300049742 Ga0501080_0308141 Ga0501080_0308141_1151_1333 60
1164 3300049742 Ga0501080_0343306 Ga0501080_0343306_128_310 60
1165 3300049742 Ga0501080_0552385 Ga0501080_0552385_685_867 60
1166 3300049742 Ga0501080_0604583 Ga0501080_0604583_656_838 60
1167 3300049742 Ga0501080_1055663 Ga0501080_1055663_112_294 60
1168 3300049742 Ga0501080_1172237 Ga0501080_1172237_382_564 60
1169 3300049742 Ga0501080_1208003 Ga0501080_1208003_123_305 60
1170 3300049743 Ga0501081_0000365 Ga0501081_0000365_45_227 60
1171 3300049743 Ga0501081_0006407 Ga0501081_0006407_6954_7136 60
1172 3300049743 Ga0501081_0012148 Ga0501081_0012148_1677_1859 60
1173 3300049743 Ga0501081_0039713 Ga0501081_0039713_2524_2706 60
1174 3300049743 Ga0501081_0096947 Ga0501081_0096947_1363_1545 60
1175 3300049743 Ga0501081_0109343 Ga0501081_0109343_473_655 60
1176 3300049743 Ga0501081_0119693 Ga0501081_0119693_223_405 60
1177 3300049743 Ga0501081_0141062 Ga0501081_0141062_755_937 60
1178 3300049743 Ga0501081_0147285 Ga0501081_0147285_36_218 60
1179 3300049743 Ga0501081_0267697 Ga0501081_0267697_28_210 60
1180 3300049743 Ga0501081_0503240 Ga0501081_0503240_82_264 60
1181 3300049743 Ga0501081_0525973 Ga0501081_0525973_190_372 60
1182 3300049743 Ga0501081_0558213 Ga0501081_0558213_438_620 60
1183 3300049743 Ga0501081_0568634 Ga0501081_0568634_412_594 60
1184 3300049743 Ga0501081_0640626 Ga0501081_0640626_468_650 60
1185 3300049743 Ga0501081_0651182 Ga0501081_0651182_231_413 60
1186 3300049743 Ga0501081_1375673 Ga0501081_1375673_156_338 60
1187 3300049744 Ga0501083_0004245 Ga0501083_0004245_9117_9299 60
1188 3300049744 Ga0501083_0209448 Ga0501083_0209448_58_240 60
1189 3300049744 Ga0501083_0354183 Ga0501083_0354183_376_558 60
1190 3300049744 Ga0501083_0394669 Ga0501083_0394669_33_215 60
1191 3300049744 Ga0501083_0673006 Ga0501083_0673006_76_258 60
1192 3300049744 Ga0501083_0680076 Ga0501083_0680076_360_542 60
1193 3300049822 Ga0501035_0005644 Ga0501035_0005644_2635_2817 60
1194 3300049822 Ga0501035_0087387 Ga0501035_0087387_1439_1621 60
1195 3300049822 Ga0501035_0228494 Ga0501035_0228494_402_584 60
1196 3300049822 Ga0501035_0487021 Ga0501035_0487021_409_591 60
1197 3300049822 Ga0501035_0587050 Ga0501035_0587050_557_739 60
1198 3300049822 Ga0501035_1383656 Ga0501035_1383656_65_247 60
1199 3300049823 Ga0501044_0499342 Ga0501044_0499342_271_453 60
1200 3300049823 Ga0501044_0847408 Ga0501044_0847408_274_456 60
1201 3300049824 Ga0501045_0002402 Ga0501045_0002402_9061_9243 60
1202 3300049824 Ga0501045_0017156 Ga0501045_0017156_645_827 60
1203 3300049824 Ga0501045_0061585 Ga0501045_0061585_312_494 60
1204 3300049824 Ga0501045_0066216 Ga0501045_0066216_564_746 60
1205 3300049824 Ga0501045_0101164 Ga0501045_0101164_523_705 60
1206 3300049824 Ga0501045_0263016 Ga0501045_0263016_441_623 60
1207 3300049824 Ga0501045_0504104 Ga0501045_0504104_243_425 60
1208 3300049824 Ga0501045_0647605 Ga0501045_0647605_210_395 60
1209 3300049824 Ga0501045_0689629 Ga0501045_0689629_404_586 60
1210 3300049824 Ga0501045_0704968 Ga0501045_0704968_173_355 60
1211 3300049824 Ga0501045_0834639 Ga0501045_0834639_416_598 60
1212 3300049824 Ga0501045_0993620 Ga0501045_0993620_375_557 60
1213 3300049824 Ga0501045_1064483 Ga0501045_1064483_94_276 60
1214 3300049824 Ga0501045_1395238 Ga0501045_1395238_223_405 60
1215 3300050489 nmdc:mga03683_319005_c1 nmdc:mga03683_319005_c1_327_509 60
1216 3300050507 nmdc:mga05p37_105950_c1 nmdc:mga05p37_105950_c1_1975_2157 60
1217 3300050507 nmdc:mga05p37_1141540_c1 nmdc:mga05p37_1141540_c1_14_196 60
1218 3300050507 nmdc:mga05p37_141373_c1 nmdc:mga05p37_141373_c1_1069_1251 60
1219 3300050507 nmdc:mga05p37_14142_c1 nmdc:mga05p37_14142_c1_4522_4704 60
1220 3300050507 nmdc:mga05p37_149820_c1 nmdc:mga05p37_149820_c1_1811_1993 60
1221 3300050507 nmdc:mga05p37_15776_c1 nmdc:mga05p37_15776_c1_1867_2049 60
1222 3300050507 nmdc:mga05p37_178658_c1 nmdc:mga05p37_178658_c1_215_397 60
1223 3300050507 nmdc:mga05p37_1907024_c1 nmdc:mga05p37_1907024_c1_305_487 60
1224 3300050507 nmdc:mga05p37_22462_c1 nmdc:mga05p37_22462_c1_3892_4074 60
1225 3300050507 nmdc:mga05p37_2290_c1 nmdc:mga05p37_2290_c1_14370_14552 60
1226 3300050507 nmdc:mga05p37_242621_c1 nmdc:mga05p37_242621_c1_1262_1444 60
1227 3300050507 nmdc:mga05p37_244533_c1 nmdc:mga05p37_244533_c1_998_1180 60
1228 3300050507 nmdc:mga05p37_261019_c1 nmdc:mga05p37_261019_c1_313_495 60
1229 3300050507 nmdc:mga05p37_265419_c1 nmdc:mga05p37_265419_c1_125_307 60
1230 3300050507 nmdc:mga05p37_308597_c1 nmdc:mga05p37_308597_c1_591_773 60
1231 3300050507 nmdc:mga05p37_3105_c1 nmdc:mga05p37_3105_c1_13449_13631 60
1232 3300050507 nmdc:mga05p37_3324_c1 nmdc:mga05p37_3324_c1_8828_9010 60
1233 3300050507 nmdc:mga05p37_35957_c1 nmdc:mga05p37_35957_c1_3925_4107 60
1234 3300050507 nmdc:mga05p37_47935_c1 nmdc:mga05p37_47935_c1_2554_2736 60
1235 3300050507 nmdc:mga05p37_6486_c1 nmdc:mga05p37_6486_c1_7889_8071 60
1236 3300050507 nmdc:mga05p37_76832_c1 nmdc:mga05p37_76832_c1_1008_1190 60
1237 3300050507 nmdc:mga05p37_836_c2 nmdc:mga05p37_836_c2_25183_25365 60
1238 3300050507 nmdc:mga05p37_882829_c1 nmdc:mga05p37_882829_c1_633_815 60
1239 3300050507 nmdc:mga05p37_89705_c1 nmdc:mga05p37_89705_c1_132_314 60
1240 3300050508 nmdc:mga09592_1018260_c1 nmdc:mga09592_1018260_c1_180_362 60
1241 3300050508 nmdc:mga09592_1207398_c1 nmdc:mga09592_1207398_c1_313_495 60
1242 3300050508 nmdc:mga09592_122150_c1 nmdc:mga09592_122150_c1_556_738 60
1243 3300050508 nmdc:mga09592_125425_c1 nmdc:mga09592_125425_c1_1581_1763 60
1244 3300050508 nmdc:mga09592_1602684_c1 nmdc:mga09592_1602684_c1_257_439 60
1245 3300050508 nmdc:mga09592_177564_c1 nmdc:mga09592_177564_c1_815_997 60
1246 3300050508 nmdc:mga09592_239823_c1 nmdc:mga09592_239823_c1_116_298 60
1247 3300050508 nmdc:mga09592_2612_c2 nmdc:mga09592_2612_c2_3300_3482 60
1248 3300050508 nmdc:mga09592_298497_c1 nmdc:mga09592_298497_c1_90_272 60
1249 3300050508 nmdc:mga09592_326528_c1 nmdc:mga09592_326528_c1_521_703 60
1250 3300050508 nmdc:mga09592_341551_c1 nmdc:mga09592_341551_c1_414_596 60
1251 3300050508 nmdc:mga09592_45738_c1 nmdc:mga09592_45738_c1_2039_2221 60
1252 3300050508 nmdc:mga09592_47873_c1 nmdc:mga09592_47873_c1_2757_2939 60
1253 3300050508 nmdc:mga09592_5329_c1 nmdc:mga09592_5329_c1_1995_2177 60
1254 3300050508 nmdc:mga09592_58861_c1 nmdc:mga09592_58861_c1_2738_2920 60
1255 3300050508 nmdc:mga09592_8305_c1 nmdc:mga09592_8305_c1_2096_2278 60
1256 3300050508 nmdc:mga09592_866098_c1 nmdc:mga09592_866098_c1_187_369 60
1257 3300050508 nmdc:mga09592_8854_c1 nmdc:mga09592_8854_c1_2278_2460 60
1258 3300050508 nmdc:mga09592_891217_c1 nmdc:mga09592_891217_c1_447_629 60
1259 3300050509 nmdc:mga0qj67_1051386_c1 nmdc:mga0qj67_1051386_c1_256_438 60
1260 3300050509 nmdc:mga0qj67_12454_c1 nmdc:mga0qj67_12454_c1_2393_2575 60
1261 3300050509 nmdc:mga0qj67_13842_c1 nmdc:mga0qj67_13842_c1_4675_4857 60
1262 3300050509 nmdc:mga0qj67_1573_c1 nmdc:mga0qj67_1573_c1_13501_13683 60
1263 3300050509 nmdc:mga0qj67_18226_c1 nmdc:mga0qj67_18226_c1_366_548 60
1264 3300050509 nmdc:mga0qj67_255095_c1 nmdc:mga0qj67_255095_c1_849_1031 60
1265 3300050509 nmdc:mga0qj67_29613_c1 nmdc:mga0qj67_29613_c1_1362_1544 60
1266 3300050509 nmdc:mga0qj67_4295_c1 nmdc:mga0qj67_4295_c1_3174_3356 60
1267 3300050509 nmdc:mga0qj67_511310_c1 nmdc:mga0qj67_511310_c1_463_645 60
1268 3300050509 nmdc:mga0qj67_595071_c1 nmdc:mga0qj67_595071_c1_429_611 60
1269 3300050509 nmdc:mga0qj67_700242_c1 nmdc:mga0qj67_700242_c1_93_275 60
1270 3300050510 nmdc:mga06r32_1044488_c1 nmdc:mga06r32_1044488_c1_349_531 60
1271 3300050510 nmdc:mga06r32_1173_c1 nmdc:mga06r32_1173_c1_7553_7735 60
1272 3300050510 nmdc:mga06r32_17184_c1 nmdc:mga06r32_17184_c1_2923_3105 60
1273 3300050510 nmdc:mga06r32_197848_c1 nmdc:mga06r32_197848_c1_639_821 60
1274 3300050510 nmdc:mga06r32_20770_c1 nmdc:mga06r32_20770_c1_1977_2159 60
1275 3300050510 nmdc:mga06r32_24044_c1 nmdc:mga06r32_24044_c1_2265_2447 60
1276 3300050510 nmdc:mga06r32_28722_c1 nmdc:mga06r32_28722_c1_2306_2488 60
1277 3300050510 nmdc:mga06r32_30181_c1 nmdc:mga06r32_30181_c1_4567_4749 60
1278 3300050510 nmdc:mga06r32_398369_c1 nmdc:mga06r32_398369_c1_727_909 60
1279 3300050510 nmdc:mga06r32_41253_c1 nmdc:mga06r32_41253_c1_3968_4150 60
1280 3300050510 nmdc:mga06r32_4932_c1 nmdc:mga06r32_4932_c1_3641_3823 60
1281 3300050510 nmdc:mga06r32_5168_c1 nmdc:mga06r32_5168_c1_3751_3933 60
1282 3300050510 nmdc:mga06r32_61804_c1 nmdc:mga06r32_61804_c1_2071_2253 60
1283 3300050510 nmdc:mga06r32_631476_c1 nmdc:mga06r32_631476_c1_453_635 60
1284 3300050510 nmdc:mga06r32_723514_c1 nmdc:mga06r32_723514_c1_697_879 60
1285 3300050511 nmdc:mga08y16_1033616_c1 nmdc:mga08y16_1033616_c1_167_349 60
1286 3300050511 nmdc:mga08y16_122216_c1 nmdc:mga08y16_122216_c1_1416_1598 60
1287 3300050511 nmdc:mga08y16_1234399_c1 nmdc:mga08y16_1234399_c1_269_451 60
1288 3300050511 nmdc:mga08y16_1549550_c1 nmdc:mga08y16_1549550_c1_389_571 60
1289 3300050511 nmdc:mga08y16_1556162_c1 nmdc:mga08y16_1556162_c1_31_213 60
1290 3300050511 nmdc:mga08y16_1693073_c1 nmdc:mga08y16_1693073_c1_352_534 60
1291 3300050511 nmdc:mga08y16_1758203_c1 nmdc:mga08y16_1758203_c1_343_525 60
1292 3300050511 nmdc:mga08y16_207451_c1 nmdc:mga08y16_207451_c1_869_1051 60
1293 3300050511 nmdc:mga08y16_8112_c1 nmdc:mga08y16_8112_c1_2602_2784 60
1294 3300050511 nmdc:mga08y16_882569_c1 nmdc:mga08y16_882569_c1_58_240 60
1295 3300050511 nmdc:mga08y16_890_c1 nmdc:mga08y16_890_c1_10321_10503 60
1296 3300050511 nmdc:mga08y16_92047_c1 nmdc:mga08y16_92047_c1_240_422 60
1297 3300050511 nmdc:mga08y16_965146_c1 nmdc:mga08y16_965146_c1_496_678 60
1298 3300050512 nmdc:mga0n895_16383_c1 nmdc:mga0n895_16383_c1_6213_6395 60
1299 3300050512 nmdc:mga0n895_1744987_c1 nmdc:mga0n895_1744987_c1_342_524 60
1300 3300050512 nmdc:mga0n895_184593_c1 nmdc:mga0n895_184593_c1_184_366 60
1301 3300050512 nmdc:mga0n895_243969_c1 nmdc:mga0n895_243969_c1_217_399 60
1302 3300050512 nmdc:mga0n895_270373_c1 nmdc:mga0n895_270373_c1_396_578 60
1303 3300050512 nmdc:mga0n895_320442_c1 nmdc:mga0n895_320442_c1_418_600 60
1304 3300050512 nmdc:mga0n895_34437_c1 nmdc:mga0n895_34437_c1_2574_2756 60
1305 3300050512 nmdc:mga0n895_46390_c1 nmdc:mga0n895_46390_c1_3029_3211 60
1306 3300050512 nmdc:mga0n895_476_c1 nmdc:mga0n895_476_c1_5041_5223 60
1307 3300050512 nmdc:mga0n895_52812_c1 nmdc:mga0n895_52812_c1_3144_3326 60
1308 3300050512 nmdc:mga0n895_5367_c1 nmdc:mga0n895_5367_c1_8577_8759 60
1309 3300050512 nmdc:mga0n895_563344_c1 nmdc:mga0n895_563344_c1_467_649 60
1310 3300050512 nmdc:mga0n895_83006_c1 nmdc:mga0n895_83006_c1_196_378 60
1311 3300050512 nmdc:mga0n895_875390_c1 nmdc:mga0n895_875390_c1_67_249 60
1312 3300050512 nmdc:mga0n895_910253_c1 nmdc:mga0n895_910253_c1_449_631 60
1313 3300050512 nmdc:mga0n895_98908_c1 nmdc:mga0n895_98908_c1_1289_1471 60
1314 3300050513 nmdc:mga0rr50_1178391_c1 nmdc:mga0rr50_1178391_c1_162_344 60
1315 3300050513 nmdc:mga0rr50_1441157_c1 nmdc:mga0rr50_1441157_c1_104_286 60
1316 3300050513 nmdc:mga0rr50_1583644_c1 nmdc:mga0rr50_1583644_c1_317_499 60
1317 3300050513 nmdc:mga0rr50_1736437_c1 nmdc:mga0rr50_1736437_c1_221_403 60
1318 3300050513 nmdc:mga0rr50_178954_c1 nmdc:mga0rr50_178954_c1_1005_1187 60
1319 3300050513 nmdc:mga0rr50_1815144_c1 nmdc:mga0rr50_1815144_c1_321_503 60
1320 3300050513 nmdc:mga0rr50_3101_c1 nmdc:mga0rr50_3101_c1_5817_5999 60
1321 3300050513 nmdc:mga0rr50_318536_c1 nmdc:mga0rr50_318536_c1_360_542 60
1322 3300050513 nmdc:mga0rr50_372345_c1 nmdc:mga0rr50_372345_c1_23_205 60
1323 3300050513 nmdc:mga0rr50_47555_c1 nmdc:mga0rr50_47555_c1_2052_2234 60
1324 3300050513 nmdc:mga0rr50_584_c1 nmdc:mga0rr50_584_c1_14069_14251 60
1325 3300050513 nmdc:mga0rr50_597251_c1 nmdc:mga0rr50_597251_c1_305_487 60
1326 3300050513 nmdc:mga0rr50_63014_c1 nmdc:mga0rr50_63014_c1_1821_2003 60
1327 3300050513 nmdc:mga0rr50_85335_c1 nmdc:mga0rr50_85335_c1_1821_2003 60
1328 3300050514 nmdc:mga08x19_140039_c1 nmdc:mga08x19_140039_c1_620_802 60
1329 3300050514 nmdc:mga08x19_16809_c1 nmdc:mga08x19_16809_c1_3856_4038 60
1330 3300050514 nmdc:mga08x19_199753_c1 nmdc:mga08x19_199753_c1_925_1107 60
1331 3300050514 nmdc:mga08x19_227797_c1 nmdc:mga08x19_227797_c1_479_661 60
1332 3300050514 nmdc:mga08x19_28073_c1 nmdc:mga08x19_28073_c1_2035_2217 60
1333 3300050514 nmdc:mga08x19_54943_c1 nmdc:mga08x19_54943_c1_1344_1526 60
1334 3300050514 nmdc:mga08x19_777773_c1 nmdc:mga08x19_777773_c1_433_615 60
1335 3300050515 nmdc:mga0a205_118104_c1 nmdc:mga0a205_118104_c1_1800_1982 60
1336 3300050515 nmdc:mga0a205_132310_c1 nmdc:mga0a205_132310_c1_1744_1926 60
1337 3300050515 nmdc:mga0a205_133614_c1 nmdc:mga0a205_133614_c1_394_576 60
1338 3300050515 nmdc:mga0a205_1343287_c1 nmdc:mga0a205_1343287_c1_42_224 60
1339 3300050515 nmdc:mga0a205_1399953_c1 nmdc:mga0a205_1399953_c1_134_316 60
1340 3300050515 nmdc:mga0a205_14771_c1 nmdc:mga0a205_14771_c1_3937_4119 60
1341 3300050515 nmdc:mga0a205_1477_c1 nmdc:mga0a205_1477_c1_12615_12797 60
1342 3300050515 nmdc:mga0a205_181638_c1 nmdc:mga0a205_181638_c1_1040_1222 60
1343 3300050515 nmdc:mga0a205_236057_c1 nmdc:mga0a205_236057_c1_253_435 60
1344 3300050515 nmdc:mga0a205_26209_c1 nmdc:mga0a205_26209_c1_3701_3883 60
1345 3300050515 nmdc:mga0a205_279624_c1 nmdc:mga0a205_279624_c1_957_1139 60
1346 3300050515 nmdc:mga0a205_332422_c1 nmdc:mga0a205_332422_c1_1134_1316 60
1347 3300050515 nmdc:mga0a205_3386_c1 nmdc:mga0a205_3386_c1_4730_4912 60
1348 3300050515 nmdc:mga0a205_42095_c1 nmdc:mga0a205_42095_c1_1159_1341 60
1349 3300050515 nmdc:mga0a205_425776_c1 nmdc:mga0a205_425776_c1_747_929 60
1350 3300050515 nmdc:mga0a205_47434_c1 nmdc:mga0a205_47434_c1_1440_1622 60
1351 3300050515 nmdc:mga0a205_51012_c1 nmdc:mga0a205_51012_c1_2813_2995 60
1352 3300050515 nmdc:mga0a205_680432_c1 nmdc:mga0a205_680432_c1_311_493 60
1353 3300050515 nmdc:mga0a205_72229_c1 nmdc:mga0a205_72229_c1_1810_1992 60
1354 3300053090 Ga0500646_0122819 Ga0500646_0122819_189_371 60
1355 3300053117 Ga0500593_231067 Ga0500593_231067_243_425 60
1356 3300054114 Ga0501084_0000142 Ga0501084_0000142_32826_33008 60
1357 3300054114 Ga0501084_0007079 Ga0501084_0007079_6036_6218 60
1358 3300054114 Ga0501084_0022882 Ga0501084_0022882_2641_2823 60
1359 3300054114 Ga0501084_0048477 Ga0501084_0048477_1187_1369 60
1360 3300054114 Ga0501084_0145604 Ga0501084_0145604_1294_1476 60
1361 3300054114 Ga0501084_0162614 Ga0501084_0162614_33_215 60
1362 3300054114 Ga0501084_0208280 Ga0501084_0208280_1447_1629 60
1363 3300054114 Ga0501084_0268895 Ga0501084_0268895_1053_1235 60
1364 3300054114 Ga0501084_0304687 Ga0501084_0304687_542_724 60
1365 3300054114 Ga0501084_0310863 Ga0501084_0310863_721_903 60
1366 3300054114 Ga0501084_0480740 Ga0501084_0480740_536_718 60
1367 3300054114 Ga0501084_0522633 Ga0501084_0522633_653_835 60
1368 3300054114 Ga0501084_0588177 Ga0501084_0588177_10_192 60
1369 3300054114 Ga0501084_0757718 Ga0501084_0757718_311_493 60
1370 3300054114 Ga0501084_1007879 Ga0501084_1007879_338_520 60
1371 3300054114 Ga0501084_1053911 Ga0501084_1053911_154_336 60
1372 3300054114 Ga0501084_1469257 Ga0501084_1469257_297_479 60
1373 3300054114 Ga0501084_1779567 Ga0501084_1779567_263_445 60
1374 3300059424 Ga0590075_003592 Ga0590075_003592_1993_2175 60
1375 3300059424 Ga0590075_007469 Ga0590075_007469_1317_1499 60
1376 3300059426 Ga0590077_100993 Ga0590077_100993_124_306 60
1377 3300060353 Ga0501082_0000718 Ga0501082_0000718_18887_19069 60
1378 3300060353 Ga0501082_0001168 Ga0501082_0001168_615_797 60
1379 3300060353 Ga0501082_0022184 Ga0501082_0022184_2871_3053 60
1380 3300060353 Ga0501082_0039393 Ga0501082_0039393_2497_2679 60
1381 3300060353 Ga0501082_0045311 Ga0501082_0045311_2199_2381 60
1382 3300060353 Ga0501082_0046077 Ga0501082_0046077_402_584 60
1383 3300060353 Ga0501082_0093845 Ga0501082_0093845_889_1071 60
1384 3300060353 Ga0501082_0119293 Ga0501082_0119293_902_1084 60
1385 3300060353 Ga0501082_0321936 Ga0501082_0321936_59_241 60
1386 3300060353 Ga0501082_0324828 Ga0501082_0324828_836_1018 60
1387 3300060353 Ga0501082_0326447 Ga0501082_0326447_227_409 60
1388 3300060353 Ga0501082_0492974 Ga0501082_0492974_497_679 60
1389 3300060353 Ga0501082_0496942 Ga0501082_0496942_121_306 60
1390 3300060353 Ga0501082_1117137 Ga0501082_1117137_335_517 60
1391 3300060353 Ga0501082_1151084 Ga0501082_1151084_231_413 60
1392 3300060353 Ga0501082_2033003 Ga0501082_2033003_232_414 60
1393 3300061734 Ga0530510_0000002 Ga0530510_0000002_199658_199840 60
1394 3300061734 Ga0530510_0009908 Ga0530510_0009908_3185_3367 60
1395 3300061734 Ga0530510_0011372 Ga0530510_0011372_1118_1300 60
1396 3300061734 Ga0530510_0035548 Ga0530510_0035548_2431_2613 60
1397 3300061734 Ga0530510_0079292 Ga0530510_0079292_942_1124 60
1398 3300061734 Ga0530510_0137270 Ga0530510_0137270_154_336 60
1399 3300061734 Ga0530510_0165848 Ga0530510_0165848_555_737 60
1400 3300061734 Ga0530510_0213786 Ga0530510_0213786_542_724 60
1401 3300061734 Ga0530510_0225581 Ga0530510_0225581_1170_1352 60
1402 3300061734 Ga0530510_0302176 Ga0530510_0302176_573_755 60
1403 3300061734 Ga0530510_0474876 Ga0530510_0474876_203_385 60
1404 3300061734 Ga0530510_0773285 Ga0530510_0773285_525_707 60
1405 3300061734 Ga0530510_1392468 Ga0530510_1392468_133_315 60

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01783

Ribosomal_L32p

Ribosomal L32p protein family

2

57

0.98

Feature Viewer

pLDDT pTM Quality
80.79 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map