metagRoot

F493712

General Info

Members	Datasets	Scaffolds	Average Seq Length
1404	709	2808	218

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|8019638758\|8019640084
Length	215
Sequence	YHCDAARSFRPLWMLEEMGLPYELKMLPFPPRVFAKEYLALNPLGTIPFMVDGETKMTESSGICHYLGIKHGPKTPLMVGPEDPAYGAFVNWMYFSDATLTFPQTLVLRYTQLEPEERRNPQVAGDYAKWFLGRLRAVEAATANTEALCAGRFTAADIVIGYALRLADTIGLAKDFGPNVAAYWARLQQRDGFKRAVAAEQQAGVEQNVAPRVRA

Samples

	Sample ID	Description	Type	Environment
1	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
2	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
3	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
4	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
5	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
6	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
7	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
8	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
9	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
10	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
11	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
12	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
13	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
14	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
15	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
16	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
17	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
18	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
19	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
20	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
21	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
22	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
23	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
24	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
25	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
26	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
27	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
28	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
29	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
30	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
31	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
32	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
33	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
34	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
35	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
36	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
37	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
38	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
39	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
40	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
41	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
42	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
43	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
44	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
45	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
46	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
47	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
48	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
49	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
50	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
51	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
52	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
53	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
54	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
55	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
56	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
57	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
58	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
59	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
60	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
61	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
62	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
63	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
64	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
65	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
66	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
67	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
68	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
69	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
70	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
71	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
72	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
73	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
74	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
75	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
76	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
77	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
78	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
79	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
80	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
81	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
82	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
83	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
84	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
86	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
87	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
88	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
89	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
90	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
91	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
92	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
93	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
94	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
95	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
96	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
97	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
98	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
99	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
100	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
101	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
102	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
103	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
104	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
105	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
106	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
107	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
108	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
109	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
110	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
111	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
112	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
113	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
114	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
115	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
116	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
117	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
118	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
119	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
120	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
121	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
122	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
123	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
124	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
125	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
126	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
127	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
128	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
129	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
130	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
131	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
132	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
137	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
140	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
141	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
143	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
209	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
210	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
211	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
212	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
213	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
217	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
218	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
219	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
220	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
221	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
222	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
223	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
224	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
225	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
226	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
227	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
228	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
229	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
230	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
231	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
232	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
233	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
234	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
235	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
236	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
237	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
238	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
239	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
240	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
241	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
242	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
243	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
244	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
245	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
246	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
247	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
248	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
249	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
250	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
251	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
252	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
253	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
254	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
255	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
256	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
257	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
258	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
259	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
260	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
261	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
262	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
263	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
264	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
265	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
266	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
267	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
268	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
269	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
270	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
271	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
272	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
273	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
274	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
275	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
276	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
277	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
278	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
279	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
280	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
281	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
282	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
283	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
284	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
285	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
286	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
287	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
288	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
289	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
290	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
291	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
292	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
293	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
294	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
295	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
296	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
297	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
298	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
299	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
300	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
301	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
302	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
303	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
304	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
305	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
306	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
307	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
308	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
309	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
310	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
311	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
312	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
313	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
314	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
315	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
316	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
317	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
318	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
319	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
320	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
321	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
322	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
323	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
324	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
325	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
326	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
327	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
328	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
329	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
330	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
331	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
332	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
333	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
334	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
335	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
336	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
337	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
338	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
339	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
340	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
341	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
342	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
343	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
344	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
345	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
346	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
347	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
348	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
349	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
350	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
351	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
352	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
353	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
354	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
355	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
356	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
357	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
358	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
359	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
360	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
361	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
362	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
363	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
364	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
365	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
366	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
367	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
368	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
369	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
370	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
371	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
372	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
373	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
374	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
375	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
376	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
377	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
378	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
379	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
380	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
381	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
382	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
383	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
384	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
385	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
386	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
387	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
388	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
389	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
390	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
391	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
392	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
393	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
394	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
395	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
396	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
397	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
398	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
399	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
400	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
401	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
402	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
403	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
404	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
405	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
406	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
407	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
408	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
409	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
410	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
411	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
412	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
413	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
414	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
415	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
416	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
417	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
418	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
419	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
420	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
421	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
422	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
423	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
424	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
425	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
426	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
427	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
428	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
429	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
430	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
431	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
432	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
433	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
434	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
435	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
436	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
437	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
438	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
439	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
440	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
441	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
442	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
443	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
444	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
445	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
446	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
447	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
448	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
449	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
450	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
451	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
452	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
453	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
454	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
455	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
456	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
457	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
458	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
459	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
460	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
461	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
462	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
463	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
464	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
465	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
466	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
467	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
468	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
469	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
470	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
471	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
472	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
473	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
474	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
475	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
476	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
477	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
478	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
479	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
480	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
481	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
482	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
483	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
484	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
485	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
486	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
487	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
488	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
489	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
490	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
491	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
492	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
493	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
494	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
495	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
496	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
497	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
498	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
499	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
500	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
501	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
502	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
503	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
504	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
505	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
506	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
507	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
508	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
509	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
510	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
511	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
512	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
513	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
514	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
515	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
516	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
517	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
518	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
519	2791355199
520	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
521	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
522	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
523	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
524	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
525	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
526	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
527	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
528	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
529	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
530	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
531	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
532	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
533	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
534	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
535	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
536	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
537	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
538	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
539	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
540	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
541	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
542	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
543	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
544	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
545	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
546	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
547	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
548	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
549	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
550	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
551	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
552	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
553	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
554	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
555	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
556	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
557	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
558	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
559	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
560	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
561	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
562	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
563	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
564	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
565	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
566	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
567	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
568	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
569	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
570	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
571	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
572	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
573	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
574	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
575	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
576	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
577	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
578	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
579	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
580	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
581	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
582	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
583	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
584	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
585	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
586	2904699407
587	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
588	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
589	2906610324
590	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
591	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
592	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
593	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
594	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
595	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
596	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
597	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
598	2922368715
599	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
600	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
601	2922425934
602	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
603	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
604	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
605	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
606	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
607	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
608	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
609	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
610	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
611	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
612	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
613	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
614	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
615	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
616	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
617	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
618	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
619	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
620	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
621	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
622	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
623	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
624	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
625	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
626	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
627	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
628	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
629	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
630	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
631	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
632	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
633	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
634	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
635	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
636	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
637	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
638	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
639	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
640	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
641	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
642	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
643	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
644	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
645	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
646	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
647	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
648	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
649	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
650	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
651	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
652	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
653	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
654	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
655	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
656	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
657	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
658	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
659	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
660	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
661	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
662	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
663	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
664	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
665	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
666	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
667	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
668	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
669	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
670	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
671	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
672	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
673	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
674	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
675	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
676	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
677	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
678	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
679	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
680	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
681	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
682	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
683	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
684	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
685	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
686	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
687	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
688	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
689	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
690	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
691	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
692	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
693	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
694	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
695	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
696	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
697	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
698	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
699	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
700	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
701	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
702	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
703	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
704	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
705	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
706	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
707	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
708	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
709	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	84.35
Metatranscriptomes	0
Isolates	15.65

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.47
Nodule	13.53
Rhizoplane	4.99
Rhizosphere	60.9
Stem	0
Stem Tuber	0
Unclassified	0.07

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10000025	3300003203	Bacteria	74627
2	JGI25406J46586_10010961	3300003203	Bacteria	3990
3	JGI25406J46586_10132483	3300003203	Bacteria	730
4	JGI25153J46596_10001053	3300003215	Bacteria	16828
5	JGI25153J46596_10016554	3300003215	Bacteria	2945
6	JGI25153J46596_10020907	3300003215	Bacteria	2457
7	JGI25160J50197_1004345	3300003354	Bacteria	6144
8	JGI25160J50197_1011973	3300003354	Bacteria	3041
9	JGI25160J50197_1021190	3300003354	Bacteria	1939
10	JGI25404J52841_10001282	3300003659	Bacteria	4360
11	Ga0055539_1003255	3300003752	Bacteria	2302
12	Ga0055525_1010540	3300003759	Bacteria	779
13	Ga0055526_1029414	3300003771	Bacteria	1631
14	Ga0055534_1000094	3300003784	Bacteria	70029
15	Ga0055528_1000142	3300003790	Bacteria	58220
16	Ga0055528_1000250	3300003790	Bacteria	45479
17	Ga0055531_10007752	3300003794	Bacteria	5787
18	Ga0055543_1003112	3300004625	Bacteria	5079
19	Ga0065165_1003397	3300005262	Bacteria	11246
20	Ga0065165_1004811	3300005262	Bacteria	8044
21	Ga0065165_1023284	3300005262	Bacteria	2103
22	Ga0065165_1071404	3300005262	Bacteria	921
23	Ga0070658_10033728	3300005327	Bacteria	4119
24	Ga0070658_10036587	3300005327	Bacteria	3957
25	Ga0070658_10149741	3300005327	Bacteria	1953
26	Ga0070683_100127352	3300005329	Bacteria	2408
27	Ga0070683_100250389	3300005329	Bacteria	1685
28	Ga0070690_100617136	3300005330	Bacteria	825
29	Ga0068869_100062208	3300005334	Bacteria	2739
30	Ga0068869_100256481	3300005334	Bacteria	1399
31	Ga0070666_10290257	3300005335	Bacteria	1164
32	Ga0070680_100008965	3300005336	Bacteria	7669
33	Ga0070680_100074183	3300005336	Bacteria	2799
34	Ga0070680_100404389	3300005336	Bacteria	1164
35	Ga0068868_100099853	3300005338	Bacteria	2348
36	Ga0070660_100073554	3300005339	Bacteria	2672
37	Ga0070660_100277718	3300005339	Bacteria	1370
38	Ga0070689_100073045	3300005340	Bacteria	2681
39	Ga0070689_100360974	3300005340	Bacteria	1221
40	Ga0070691_10284048	3300005341	Bacteria	899
41	Ga0070661_100041392	3300005344	Bacteria	3363
42	Ga0070661_100162152	3300005344	Bacteria	1694
43	Ga0070661_100397745	3300005344	Bacteria	1089
44	Ga0070668_100051686	3300005347	Bacteria	3167
45	Ga0070668_100148217	3300005347	Bacteria	1895
46	Ga0070668_100194982	3300005347	Bacteria	1661
47	Ga0070668_100239198	3300005347	Bacteria	1503
48	Ga0070668_100391115	3300005347	Bacteria	1185
49	Ga0070675_100094521	3300005354	Bacteria	2508
50	Ga0070675_100142571	3300005354	Bacteria	2049
51	Ga0070675_100922895	3300005354	Bacteria	800
52	Ga0070671_100047693	3300005355	Bacteria	3562
53	Ga0070671_100066427	3300005355	Bacteria	3006
54	Ga0070671_100225302	3300005355	Bacteria	1591
55	Ga0070673_100410038	3300005364	Bacteria	1213
56	Ga0070688_100454941	3300005365	Bacteria	958
57	Ga0070659_100237923	3300005366	Bacteria	1506
58	Ga0070659_100292168	3300005366	Bacteria	1357
59	Ga0070659_100624434	3300005366	Bacteria	928
60	Ga0070667_100164065	3300005367	Bacteria	1958
61	Ga0070667_100799659	3300005367	Bacteria	875
62	Ga0070703_10024476	3300005406	Bacteria	1785
63	Ga0070709_10013501	3300005434	Bacteria	4595
64	Ga0070709_10158863	3300005434	Bacteria	1570
65	Ga0070714_100056350	3300005435	Bacteria	3362
66	Ga0070714_100060536	3300005435	Bacteria	3249
67	Ga0070714_100067441	3300005435	Bacteria	3085
68	Ga0070714_100355004	3300005435	Bacteria	1377
69	Ga0070714_100681874	3300005435	Bacteria	991
70	Ga0070713_100001063	3300005436	Bacteria	17550
71	Ga0070713_100014027	3300005436	Bacteria	5934
72	Ga0070713_100264199	3300005436	Bacteria	1574
73	Ga0070713_100281162	3300005436	Bacteria	1527
74	Ga0070713_100440119	3300005436	Bacteria	1223
75	Ga0070710_10000458	3300005437	Bacteria	19101
76	Ga0070710_10004438	3300005437	Bacteria	6637
77	Ga0070710_10020793	3300005437	Bacteria	3411
78	Ga0070710_10042114	3300005437	Bacteria	2523
79	Ga0070710_10059402	3300005437	Bacteria	2172
80	Ga0070711_100000499	3300005439	Bacteria	20475
81	Ga0070711_100007555	3300005439	Bacteria	6614
82	Ga0070711_100020804	3300005439	Bacteria	4234
83	Ga0070711_100077989	3300005439	Bacteria	2353
84	Ga0070711_100118634	3300005439	Bacteria	1953
85	Ga0070711_100243373	3300005439	Bacteria	1407
86	Ga0070700_100246792	3300005441	Bacteria	1279
87	Ga0070700_100302792	3300005441	Bacteria	1168
88	Ga0070663_100035716	3300005455	Bacteria	3450
89	Ga0070663_100036779	3300005455	Bacteria	3403
90	Ga0070663_100065282	3300005455	Bacteria	2634
91	Ga0070663_100066201	3300005455	Bacteria	2617
92	Ga0070663_100068026	3300005455	Bacteria	2585
93	Ga0070678_100116614	3300005456	Bacteria	2098
94	Ga0070678_100126432	3300005456	Bacteria	2024
95	Ga0070678_100127931	3300005456	Bacteria	2013
96	Ga0070678_100142650	3300005456	Bacteria	1919
97	Ga0070678_100201108	3300005456	Bacteria	1644
98	Ga0070678_100951070	3300005456	Bacteria	788
99	Ga0070662_100092212	3300005457	Bacteria	2276
100	Ga0070681_10009022	3300005458	Bacteria	9801
101	Ga0070681_10081803	3300005458	Bacteria	3185
102	Ga0070681_10338749	3300005458	Bacteria	1414
103	Ga0070685_10330526	3300005466	Bacteria	1036
104	Ga0070706_100083478	3300005467	Bacteria	2959
105	Ga0070706_100398660	3300005467	Bacteria	1281
106	Ga0070707_100449771	3300005468	Bacteria	1249
107	Ga0070707_100774873	3300005468	Bacteria	923
108	Ga0070698_100016263	3300005471	Bacteria	7854
109	Ga0070679_100040380	3300005530	Bacteria	4642
110	Ga0070679_100181092	3300005530	Bacteria	2079
111	Ga0070679_100393614	3300005530	Bacteria	1332
112	Ga0070679_100471621	3300005530	Bacteria	1199
113	Ga0070684_100010374	3300005535	Bacteria	7376
114	Ga0070684_100157494	3300005535	Bacteria	2059
115	Ga0068853_100268239	3300005539	Bacteria	1571
116	Ga0068853_100438746	3300005539	Bacteria	1227
117	Ga0068853_100460594	3300005539	Bacteria	1197
118	Ga0068853_100506903	3300005539	Bacteria	1140
119	Ga0068853_100714228	3300005539	Bacteria	957
120	Ga0070672_100166614	3300005543	Bacteria	1830
121	Ga0070672_100332529	3300005543	Bacteria	1293
122	Ga0070696_100744969	3300005546	Bacteria	802
123	Ga0070665_100023082	3300005548	Bacteria	6267
124	Ga0070665_100053972	3300005548	Bacteria	4031
125	Ga0070665_100111786	3300005548	Bacteria	2734
126	Ga0070665_100116106	3300005548	Bacteria	2679
127	Ga0070665_100141103	3300005548	Bacteria	2413
128	Ga0070665_100160566	3300005548	Bacteria	2249
129	Ga0070665_100315437	3300005548	Bacteria	1567
130	Ga0070665_100316988	3300005548	Bacteria	1563
131	Ga0070665_100410436	3300005548	Bacteria	1362
132	Ga0070665_100541858	3300005548	Bacteria	1176
133	Ga0068855_100146605	3300005563	Bacteria	2686
134	Ga0068855_100161385	3300005563	Bacteria	2544
135	Ga0068855_100421131	3300005563	Bacteria	1461
136	Ga0070664_100071597	3300005564	Bacteria	2971
137	Ga0070664_100085149	3300005564	Bacteria	2730
138	Ga0070664_100891991	3300005564	Bacteria	834
139	Ga0070664_101047009	3300005564	Bacteria	768
140	Ga0068857_100028158	3300005577	Bacteria	4956
141	Ga0068854_100224868	3300005578	Bacteria	1487
142	Ga0068854_100914822	3300005578	Bacteria	772
143	Ga0068856_100002906	3300005614	Bacteria	17546
144	Ga0068856_100153047	3300005614	Bacteria	2316
145	Ga0068856_100226390	3300005614	Bacteria	1885
146	Ga0068856_100274008	3300005614	Bacteria	1703
147	Ga0068856_100582914	3300005614	Bacteria	1140
148	Ga0070702_100241858	3300005615	Bacteria	1218
149	Ga0070702_100266288	3300005615	Bacteria	1169
150	Ga0068852_100042821	3300005616	Bacteria	3835
151	Ga0068852_100177828	3300005616	Bacteria	1999
152	Ga0068852_100198323	3300005616	Bacteria	1898
153	Ga0068852_100504080	3300005616	Bacteria	1206
154	Ga0068859_100713811	3300005617	Bacteria	1093
155	Ga0068859_100741304	3300005617	Bacteria	1071
156	Ga0068864_100068431	3300005618	Bacteria	3085
157	Ga0068864_100450296	3300005618	Bacteria	1231
158	Ga0068864_100571637	3300005618	Bacteria	1094
159	Ga0068866_10202591	3300005718	Bacteria	1187
160	Ga0068861_100573195	3300005719	Bacteria	1032
161	Ga0068851_10022504	3300005834	Bacteria	3072
162	Ga0068863_100200056	3300005841	Bacteria	1921
163	Ga0068858_100084643	3300005842	Bacteria	2949
164	Ga0068858_100119361	3300005842	Bacteria	2465
165	Ga0068858_100120366	3300005842	Bacteria	2455
166	Ga0068858_100299896	3300005842	Bacteria	1533
167	Ga0068858_100321724	3300005842	Bacteria	1478
168	Ga0068858_100381042	3300005842	Bacteria	1353
169	Ga0068858_100820655	3300005842	Bacteria	908
170	Ga0068860_100217281	3300005843	Bacteria	1855
171	Ga0068860_100536810	3300005843	Bacteria	1171
172	Ga0068862_100070510	3300005844	Bacteria	3017
173	Ga0068862_100600537	3300005844	Bacteria	1056
174	Ga0068862_100714893	3300005844	Bacteria	971
175	Ga0068862_100807154	3300005844	Bacteria	917
176	Ga0081455_10003943	3300005937	Bacteria	16856
177	Ga0081455_10070113	3300005937	Bacteria	2912
178	Ga0081455_10153403	3300005937	Bacteria	1774
179	Ga0081455_10379606	3300005937	Bacteria	988
180	Ga0081538_10042894	3300005981	Bacteria	2848
181	Ga0081540_1000015	3300005983	Bacteria	178704
182	Ga0081540_1004052	3300005983	Bacteria	11349
183	Ga0081540_1008988	3300005983	Bacteria	6912
184	Ga0081540_1010119	3300005983	Bacteria	6420
185	Ga0081540_1012837	3300005983	Bacteria	5479
186	Ga0081540_1013121	3300005983	Bacteria	5410
187	Ga0081540_1019585	3300005983	Bacteria	4105
188	Ga0081540_1028524	3300005983	Bacteria	3133
189	Ga0081540_1030614	3300005983	Bacteria	2977
190	Ga0081540_1038250	3300005983	Bacteria	2531
191	Ga0081540_1039520	3300005983	Bacteria	2473
192	Ga0081540_1056782	3300005983	Bacteria	1897
193	Ga0081540_1086965	3300005983	Bacteria	1387
194	Ga0081539_10000008	3300005985	Bacteria	525071
195	Ga0081539_10000530	3300005985	Bacteria	79454
196	Ga0081539_10028987	3300005985	Bacteria	3470
197	Ga0081539_10070606	3300005985	Bacteria	1874
198	Ga0081539_10074597	3300005985	Bacteria	1806
199	Ga0070717_10002595	3300006028	Bacteria	12755
200	Ga0070717_10047906	3300006028	Bacteria	3503
201	Ga0070717_10262564	3300006028	Bacteria	1528
202	Ga0070717_10773961	3300006028	Bacteria	873
203	Ga0075365_10010504	3300006038	Bacteria	5394
204	Ga0075365_10017471	3300006038	Bacteria	4389
205	Ga0075365_10118092	3300006038	Bacteria	1827
206	Ga0075365_10229250	3300006038	Bacteria	1303
207	Ga0075365_10290822	3300006038	Bacteria	1149
208	Ga0075368_10100146	3300006042	Bacteria	1189
209	Ga0075363_100026828	3300006048	Bacteria	2949
210	Ga0075363_100035917	3300006048	Bacteria	2596
211	Ga0075363_100096828	3300006048	Bacteria	1630
212	Ga0075363_100394456	3300006048	Bacteria	813
213	Ga0075364_10085804	3300006051	Bacteria	2085
214	Ga0075364_10204469	3300006051	Bacteria	1339
215	Ga0070715_10251562	3300006163	Bacteria	924
216	Ga0070716_100026054	3300006173	Bacteria	3127
217	Ga0070716_100147789	3300006173	Bacteria	1508
218	Ga0070716_100180002	3300006173	Bacteria	1387
219	Ga0070712_100021181	3300006175	Bacteria	4265
220	Ga0070712_100253372	3300006175	Bacteria	1408
221	Ga0070712_100271612	3300006175	Bacteria	1362
222	Ga0070712_100485527	3300006175	Bacteria	1033
223	Ga0075362_10084204	3300006177	Bacteria	1469
224	Ga0075367_10021457	3300006178	Bacteria	3609
225	Ga0075367_10157503	3300006178	Bacteria	1411
226	Ga0075367_10227988	3300006178	Bacteria	1166
227	Ga0075369_10092669	3300006186	Bacteria	1349
228	Ga0075366_10000023	3300006195	Bacteria	53503
229	Ga0075366_10182645	3300006195	Bacteria	1274
230	Ga0075366_10309552	3300006195	Bacteria	967
231	Ga0097621_100165195	3300006237	Bacteria	1905
232	Ga0097621_100304830	3300006237	Bacteria	1408
233	Ga0075370_10000023	3300006353	Bacteria	54029
234	Ga0075370_10003134	3300006353	Bacteria	7807
235	Ga0075370_10024771	3300006353	Bacteria	3317
236	Ga0075370_10128884	3300006353	Bacteria	1476
237	Ga0068871_100029883	3300006358	Bacteria	4285
238	Ga0068871_100272184	3300006358	Bacteria	1480
239	Ga0068871_100605680	3300006358	Bacteria	997
240	Ga0075434_100008452	3300006871	Bacteria	9574
241	Ga0068865_100120736	3300006881	Bacteria	1948
242	Ga0068865_100540866	3300006881	Bacteria	977
243	Ga0075436_100056188	3300006914	Bacteria	2719
244	Ga0097620_100713765	3300006931	Bacteria	1093
245	Ga0097620_100741294	3300006931	Bacteria	1071
246	Ga0099824_1017101	3300006942	Bacteria	6386
247	Ga0099824_1019222	3300006942	Bacteria	5393
248	Ga0099822_1011516	3300006943	Bacteria	10763
249	Ga0099823_1104300	3300006944	Bacteria	838
250	Ga0099826_10016291	3300006948	Bacteria	5611
251	Ga0075435_100074540	3300007076	Bacteria	2777
252	Ga0075435_100088748	3300007076	Bacteria	2549
253	Ga0099794_10042126	3300007265	Bacteria	2176
254	Ga0099795_10155218	3300007788	Bacteria	940
255	Ga0105240_10010123	3300009093	Bacteria	13271
256	Ga0105240_10414541	3300009093	Bacteria	1514
257	Ga0105245_10135070	3300009098	Bacteria	2317
258	Ga0105245_10159148	3300009098	Bacteria	2142
259	Ga0105245_10256808	3300009098	Bacteria	1699
260	Ga0105245_10326889	3300009098	Bacteria	1512
261	Ga0105245_10349788	3300009098	Bacteria	1464
262	Ga0105245_10480999	3300009098	Bacteria	1255
263	Ga0105245_11028288	3300009098	Bacteria	869
264	Ga0105247_10017045	3300009101	Bacteria	4359
265	Ga0105247_10052139	3300009101	Bacteria	2521
266	Ga0105247_10157406	3300009101	Bacteria	1501
267	Ga0105247_10320858	3300009101	Bacteria	1081
268	Ga0105247_10692221	3300009101	Bacteria	766
269	Ga0114129_10656266	3300009147	Bacteria	1353
270	Ga0114129_11654203	3300009147	Bacteria	782
271	Ga0105243_10013471	3300009148	Bacteria	6185
272	Ga0105243_10181495	3300009148	Bacteria	1831
273	Ga0105243_10448895	3300009148	Bacteria	1209
274	Ga0105243_10529985	3300009148	Bacteria	1122
275	Ga0105241_10065113	3300009174	Bacteria	2816
276	Ga0105241_10104638	3300009174	Bacteria	2255
277	Ga0105241_10366909	3300009174	Bacteria	1254
278	Ga0105242_10115826	3300009176	Bacteria	2292
279	Ga0105242_10302078	3300009176	Bacteria	1461
280	Ga0105242_10631241	3300009176	Bacteria	1039
281	Ga0105248_10075179	3300009177	Bacteria	3797
282	Ga0105248_10106225	3300009177	Bacteria	3165
283	Ga0105248_10121596	3300009177	Bacteria	2945
284	Ga0105248_10225347	3300009177	Bacteria	2110
285	Ga0105248_10431490	3300009177	Bacteria	1484
286	Ga0105237_10005288	3300009545	Bacteria	14594
287	Ga0105237_10074630	3300009545	Bacteria	3383
288	Ga0105237_10083668	3300009545	Bacteria	3182
289	Ga0105237_10103378	3300009545	Bacteria	2841
290	Ga0105237_10149913	3300009545	Bacteria	2328
291	Ga0105238_10057156	3300009551	Bacteria	3912
292	Ga0105238_10111543	3300009551	Bacteria	2715
293	Ga0105238_10190524	3300009551	Bacteria	2027
294	Ga0105249_10188215	3300009553	Bacteria	2013
295	Ga0105249_10198248	3300009553	Bacteria	1963
296	Ga0105249_10294700	3300009553	Bacteria	1625
297	Ga0105249_10572235	3300009553	Bacteria	1182
298	Ga0105249_10665860	3300009553	Bacteria	1099
299	Ga0099796_10018443	3300010159	Bacteria	2096
300	Ga0105239_10039127	3300010375	Bacteria	5196
301	Ga0105239_10049788	3300010375	Bacteria	4595
302	Ga0105239_10082390	3300010375	Bacteria	3542
303	Ga0105239_10109820	3300010375	Bacteria	3057
304	Ga0105239_10125184	3300010375	Bacteria	2856
305	Ga0105239_10247717	3300010375	Bacteria	2001
306	Ga0105239_10392916	3300010375	Bacteria	1569
307	Ga0105239_10778131	3300010375	Bacteria	1096
308	Ga0105246_10143147	3300011119	Bacteria	1801
309	Ga0105246_10195675	3300011119	Bacteria	1568
310	Ga0105246_10307535	3300011119	Bacteria	1282
311	Ga0157370_10217600	3300013104	Bacteria	1770
312	Ga0157370_10482604	3300013104	Bacteria	1139
313	Ga0157369_10027626	3300013105	Bacteria	6287
314	Ga0157369_10049227	3300013105	Bacteria	4569
315	Ga0157369_10063445	3300013105	Bacteria	3980
316	Ga0157369_10412349	3300013105	Bacteria	1401
317	Ga0157369_11193315	3300013105	Bacteria	777
318	Ga0157374_10020186	3300013296	Bacteria	5908
319	Ga0157374_10185598	3300013296	Bacteria	2033
320	Ga0157378_10014275	3300013297	Bacteria	6955
321	Ga0157378_10252906	3300013297	Bacteria	1687
322	Ga0163162_10140419	3300013306	Bacteria	2529
323	Ga0163162_10352815	3300013306	Bacteria	1603
324	Ga0163162_10370866	3300013306	Bacteria	1564
325	Ga0163162_10462423	3300013306	Unclassified	1400
326	Ga0163162_10848997	3300013306	Bacteria	1028
327	Ga0157372_10138210	3300013307	Bacteria	2807
328	Ga0157372_10227784	3300013307	Bacteria	2161
329	Ga0157375_10029602	3300013308	Bacteria	5153
330	Ga0157375_10395172	3300013308	Bacteria	1549
331	Ga0157375_10524106	3300013308	Bacteria	1348
332	Ga0157375_10617344	3300013308	Bacteria	1242
333	Ga0163163_10075351	3300014325	Bacteria	3368
334	Ga0163163_10338941	3300014325	Bacteria	1559
335	Ga0163163_10464349	3300014325	Bacteria	1326
336	Ga0163163_11484716	3300014325	Bacteria	739
337	Ga0157380_10920152	3300014326	Bacteria	902
338	Ga0157379_10136035	3300014968	Bacteria	2214
339	Ga0157379_10268711	3300014968	Bacteria	1550
340	Ga0157379_10444901	3300014968	Bacteria	1195
341	Ga0157376_10019063	3300014969	Bacteria	5277
342	Ga0157376_11155923	3300014969	Bacteria	801
343	Ga0163161_10132090	3300017792	Bacteria	1884
344	Ga0163161_10315351	3300017792	Bacteria	1235
345	Ga0214544_1000003	3300021320	Bacteria	643752
346	Ga0214544_1019965	3300021320	Bacteria	4924
347	Ga0214544_1031334	3300021320	Bacteria	1761
348	Ga0214544_1038656	3300021320	Bacteria	1125
349	Ga0214542_1000003	3300021321	Bacteria	435700
350	Ga0214542_1022248	3300021321	Bacteria	4108
351	Ga0214542_1033171	3300021321	Bacteria	1762
352	Ga0214545_1000004	3300021324	Bacteria	453352
353	Ga0214545_1022952	3300021324	Bacteria	4238
354	Ga0214543_1000007	3300021327	Bacteria	414744
355	Ga0214543_1044168	3300021327	Bacteria	1051
356	Ga0213873_10009214	3300021358	Bacteria	2042
357	Ga0213872_10066397	3300021361	Bacteria	1629
358	Ga0213876_10001238	3300021384	Bacteria	16104
359	Ga0213876_10060050	3300021384	Bacteria	2006
360	Ga0213875_10024057	3300021388	Bacteria	2906
361	Ga0209563_100880	3300025230	Bacteria	8917
362	Ga0209677_100335	3300025253	Bacteria	30124
363	Ga0209148_1000568	3300025254	Bacteria	34536
364	Ga0209233_1012885	3300025261	Bacteria	2407
365	Ga0209565_1000025	3300025263	Bacteria	377969
366	Ga0207666_1027221	3300025271	Bacteria	864
367	Ga0209455_1001135	3300025272	Bacteria	12915
368	Ga0209455_1002774	3300025272	Bacteria	6553
369	Ga0209455_1003205	3300025272	Bacteria	5916
370	Ga0209455_1005900	3300025272	Bacteria	3699
371	Ga0209673_1000149	3300025273	Bacteria	148659
372	Ga0209675_1000017	3300025291	Bacteria	378002
373	Ga0209025_1031786	3300025294	Bacteria	2486
374	Ga0209564_1006569	3300025295	Bacteria	6241
375	Ga0209564_1012806	3300025295	Bacteria	3621
376	Ga0209758_1000015	3300025297	Bacteria	851943
377	Ga0209758_1000224	3300025297	Bacteria	121530
378	Ga0209758_1000692	3300025297	Bacteria	49946
379	Ga0209758_1001077	3300025297	Bacteria	35497
380	Ga0209758_1014765	3300025297	Bacteria	4119
381	Ga0209758_1019686	3300025297	Bacteria	3239
382	Ga0209758_1024622	3300025297	Bacteria	2675
383	Ga0207426_1000201	3300025302	Bacteria	143975
384	Ga0207426_1001489	3300025302	Bacteria	19173
385	Ga0207426_1023255	3300025302	Bacteria	2116
386	Ga0209051_1027890	3300025303	Bacteria	2241
387	Ga0209257_1000440	3300025304	Bacteria	79182
388	Ga0209257_1018309	3300025304	Bacteria	2703
389	Ga0209257_1032572	3300025304	Bacteria	1650
390	Ga0207697_10014252	3300025315	Bacteria	3301
391	Ga0207697_10077047	3300025315	Bacteria	1402
392	Ga0207656_10059917	3300025321	Bacteria	1667
393	Ga0207656_10148966	3300025321	Bacteria	1107
394	Ga0207656_10237093	3300025321	Bacteria	890
395	Ga0207692_10011784	3300025898	Bacteria	3735
396	Ga0207692_10036061	3300025898	Bacteria	2408
397	Ga0207692_10042229	3300025898	Bacteria	2262
398	Ga0207642_10047384	3300025899	Bacteria	1921
399	Ga0207642_10094416	3300025899	Bacteria	1486
400	Ga0207710_10005790	3300025900	Bacteria	5304
401	Ga0207710_10118834	3300025900	Bacteria	1261
402	Ga0207688_10208858	3300025901	Bacteria	1173
403	Ga0207647_10197252	3300025904	Bacteria	1165
404	Ga0207699_10006426	3300025906	Bacteria	5690
405	Ga0207699_10016966	3300025906	Bacteria	3821
406	Ga0207699_10085943	3300025906	Bacteria	1963
407	Ga0207699_10104530	3300025906	Bacteria	1804
408	Ga0207699_10125542	3300025906	Bacteria	1666
409	Ga0207645_10161367	3300025907	Bacteria	1467
410	Ga0207643_10091034	3300025908	Bacteria	1778
411	Ga0207705_10072712	3300025909	Bacteria	2494
412	Ga0207684_10104872	3300025910	Bacteria	2417
413	Ga0207654_10011536	3300025911	Bacteria	4510
414	Ga0207654_10053517	3300025911	Bacteria	2330
415	Ga0207707_10000873	3300025912	Bacteria	29451
416	Ga0207707_10006005	3300025912	Bacteria	10631
417	Ga0207707_10006066	3300025912	Bacteria	10575
418	Ga0207707_10048813	3300025912	Bacteria	3687
419	Ga0207707_10582495	3300025912	Bacteria	948
420	Ga0207695_10000065	3300025913	Bacteria	336949
421	Ga0207695_10132919	3300025913	Bacteria	2444
422	Ga0207695_10291309	3300025913	Bacteria	1525
423	Ga0207671_10013839	3300025914	Bacteria	6407
424	Ga0207671_10100385	3300025914	Bacteria	2191
425	Ga0207671_10137973	3300025914	Bacteria	1877
426	Ga0207671_10156401	3300025914	Bacteria	1763
427	Ga0207671_10157022	3300025914	Bacteria	1760
428	Ga0207671_10162140	3300025914	Bacteria	1732
429	Ga0207671_10359817	3300025914	Bacteria	1155
430	Ga0207693_10035489	3300025915	Bacteria	3931
431	Ga0207693_10039039	3300025915	Bacteria	3738
432	Ga0207693_10070880	3300025915	Bacteria	2727
433	Ga0207693_10098402	3300025915	Bacteria	2294
434	Ga0207663_10000278	3300025916	Bacteria	22310
435	Ga0207663_10003708	3300025916	Bacteria	7518
436	Ga0207663_10051506	3300025916	Bacteria	2564
437	Ga0207663_10221792	3300025916	Bacteria	1376
438	Ga0207660_10043100	3300025917	Bacteria	3170
439	Ga0207660_10133702	3300025917	Bacteria	1890
440	Ga0207660_10168777	3300025917	Bacteria	1692
441	Ga0207660_10364011	3300025917	Bacteria	1160
442	Ga0207657_10039812	3300025919	Bacteria	4172
443	Ga0207657_10052465	3300025919	Bacteria	3539
444	Ga0207657_10341560	3300025919	Bacteria	1182
445	Ga0207649_10062092	3300025920	Bacteria	2354
446	Ga0207649_10205473	3300025920	Bacteria	1394
447	Ga0207649_10214277	3300025920	Bacteria	1368
448	Ga0207652_10002442	3300025921	Bacteria	15688
449	Ga0207652_10059511	3300025921	Bacteria	3293
450	Ga0207652_10160785	3300025921	Bacteria	2013
451	Ga0207652_10233016	3300025921	Bacteria	1659
452	Ga0207652_10441373	3300025921	Bacteria	1173
453	Ga0207652_10578699	3300025921	Bacteria	1008
454	Ga0207652_10917231	3300025921	Bacteria	773
455	Ga0207646_10254550	3300025922	Bacteria	1587
456	Ga0207646_10680941	3300025922	Bacteria	920
457	Ga0207681_10225075	3300025923	Bacteria	1453
458	Ga0207694_10496859	3300025924	Bacteria	1021
459	Ga0207694_10556637	3300025924	Bacteria	963
460	Ga0207694_10825716	3300025924	Bacteria	783
461	Ga0207650_10343264	3300025925	Bacteria	1227
462	Ga0207659_10426074	3300025926	Bacteria	1114
463	Ga0207659_10989873	3300025926	Bacteria	723
464	Ga0207687_10087321	3300025927	Bacteria	2266
465	Ga0207687_10153588	3300025927	Bacteria	1759
466	Ga0207700_10025859	3300025928	Bacteria	4084
467	Ga0207700_10034244	3300025928	Bacteria	3645
468	Ga0207700_10061310	3300025928	Bacteria	2852
469	Ga0207700_10178416	3300025928	Bacteria	1777
470	Ga0207700_10366018	3300025928	Bacteria	1258
471	Ga0207700_10972786	3300025928	Bacteria	760
472	Ga0207664_10031129	3300025929	Bacteria	4079
473	Ga0207664_10061495	3300025929	Bacteria	2996
474	Ga0207664_10118227	3300025929	Bacteria	2214
475	Ga0207664_10131534	3300025929	Bacteria	2107
476	Ga0207664_10421336	3300025929	Bacteria	1189
477	Ga0207644_10728985	3300025931	Bacteria	827
478	Ga0207690_10114196	3300025932	Bacteria	1950
479	Ga0207690_10392964	3300025932	Bacteria	1104
480	Ga0207706_10079239	3300025933	Bacteria	2889
481	Ga0207706_10094495	3300025933	Bacteria	2630
482	Ga0207686_10090218	3300025934	Bacteria	2022
483	Ga0207709_10024513	3300025935	Bacteria	3446
484	Ga0207709_10060326	3300025935	Bacteria	2364
485	Ga0207670_10379301	3300025936	Bacteria	1126
486	Ga0207669_10012547	3300025937	Bacteria	4171
487	Ga0207704_10400100	3300025938	Bacteria	1083
488	Ga0207704_10499804	3300025938	Bacteria	980
489	Ga0207665_10001998	3300025939	Bacteria	13751
490	Ga0207665_10035117	3300025939	Bacteria	3326
491	Ga0207665_10067070	3300025939	Bacteria	2443
492	Ga0207665_10188922	3300025939	Bacteria	1495
493	Ga0207665_10194807	3300025939	Bacteria	1474
494	Ga0207665_10685840	3300025939	Bacteria	805
495	Ga0207691_10137665	3300025940	Bacteria	2153
496	Ga0207691_10166037	3300025940	Bacteria	1935
497	Ga0207691_10583721	3300025940	Bacteria	946
498	Ga0207711_10277784	3300025941	Bacteria	1542
499	Ga0207689_10072810	3300025942	Bacteria	2823
500	Ga0207661_10001746	3300025944	Bacteria	14879
501	Ga0207661_10008300	3300025944	Bacteria	7420
502	Ga0207661_10068495	3300025944	Bacteria	2890
503	Ga0207661_10346905	3300025944	Bacteria	1339
504	Ga0207679_10096264	3300025945	Bacteria	2303
505	Ga0207679_10365292	3300025945	Bacteria	1261
506	Ga0207679_10473550	3300025945	Bacteria	1114
507	Ga0207679_10493105	3300025945	Bacteria	1092
508	Ga0207679_10877441	3300025945	Bacteria	820
509	Ga0207667_10026352	3300025949	Bacteria	6354
510	Ga0207667_10161055	3300025949	Bacteria	2308
511	Ga0207667_10340578	3300025949	Bacteria	1530
512	Ga0207667_10351422	3300025949	Bacteria	1503
513	Ga0207667_10401648	3300025949	Bacteria	1395
514	Ga0207667_10549192	3300025949	Bacteria	1169
515	Ga0207712_10148836	3300025961	Bacteria	1806
516	Ga0207712_10336448	3300025961	Bacteria	1250
517	Ga0207668_10023696	3300025972	Bacteria	3950
518	Ga0207668_10041225	3300025972	Bacteria	3119
519	Ga0207668_10349746	3300025972	Bacteria	1235
520	Ga0207668_10628666	3300025972	Bacteria	938
521	Ga0207640_10124301	3300025981	Bacteria	1855
522	Ga0207640_10148229	3300025981	Bacteria	1720
523	Ga0207640_10635864	3300025981	Bacteria	907
524	Ga0207658_10550562	3300025986	Bacteria	1032
525	Ga0207677_10259954	3300026023	Bacteria	1415
526	Ga0207677_10748968	3300026023	Bacteria	871
527	Ga0207703_10031639	3300026035	Bacteria	4185
528	Ga0207703_10069474	3300026035	Bacteria	2905
529	Ga0207703_10087537	3300026035	Bacteria	2612
530	Ga0207703_10796992	3300026035	Bacteria	902
531	Ga0207639_10042213	3300026041	Bacteria	3417
532	Ga0207639_10101426	3300026041	Bacteria	2327
533	Ga0207639_10224212	3300026041	Bacteria	1625
534	Ga0207678_10037615	3300026067	Bacteria	4208
535	Ga0207678_10043060	3300026067	Bacteria	3908
536	Ga0207678_10049969	3300026067	Bacteria	3613
537	Ga0207678_10178229	3300026067	Bacteria	1815
538	Ga0207678_10193105	3300026067	Bacteria	1740
539	Ga0207678_10230713	3300026067	Bacteria	1585
540	Ga0207702_10000056	3300026078	Bacteria	131186
541	Ga0207702_10080270	3300026078	Bacteria	2830
542	Ga0207702_10563303	3300026078	Bacteria	1115
543	Ga0207702_10621407	3300026078	Bacteria	1061
544	Ga0207702_11114380	3300026078	Bacteria	783
545	Ga0207702_11374989	3300026078	Bacteria	700
546	Ga0207641_10165251	3300026088	Bacteria	2015
547	Ga0207648_10238771	3300026089	Bacteria	1618
548	Ga0207676_10127335	3300026095	Bacteria	2159
549	Ga0207676_10325026	3300026095	Bacteria	1413
550	Ga0207676_10714258	3300026095	Bacteria	972
551	Ga0207674_10039011	3300026116	Bacteria	4926
552	Ga0207674_10052364	3300026116	Bacteria	4163
553	Ga0207674_10184484	3300026116	Bacteria	2037
554	Ga0207674_10543011	3300026116	Bacteria	1123
555	Ga0207675_100235477	3300026118	Bacteria	1768
556	Ga0207675_100737351	3300026118	Bacteria	996
557	Ga0207675_101019511	3300026118	Bacteria	846
558	Ga0207683_10057419	3300026121	Bacteria	3417
559	Ga0207683_10063142	3300026121	Bacteria	3263
560	Ga0207683_10090990	3300026121	Bacteria	2718
561	Ga0207683_10436621	3300026121	Bacteria	1207
562	Ga0207683_10455812	3300026121	Bacteria	1179
563	Ga0207698_10027914	3300026142	Bacteria	4015
564	Ga0207698_10132246	3300026142	Bacteria	2134
565	Ga0207698_10811650	3300026142	Bacteria	938
566	Ga0209389_1000029	3300027296	Bacteria	140337
567	Ga0209389_1000064	3300027296	Bacteria	102177
568	Ga0209589_1000012	3300027357	Bacteria	229451
569	Ga0209589_1000013	3300027357	Bacteria	229273
570	Ga0209589_1000017	3300027357	Bacteria	215546
571	Ga0209489_100013	3300027361	Bacteria	229831
572	Ga0209489_100018	3300027361	Bacteria	215546
573	Ga0209489_104185	3300027361	Bacteria	26861
574	Ga0209700_100014	3300027363	Bacteria	299349
575	Ga0209700_100028	3300027363	Bacteria	215546
576	Ga0209282_1010452	3300027666	Bacteria	5876
577	Ga0209588_1008391	3300027671	Bacteria	3063
578	Ga0268266_10001379	3300028379	Bacteria	29260
579	Ga0268266_10024483	3300028379	Bacteria	5133
580	Ga0268266_10027336	3300028379	Bacteria	4851
581	Ga0268266_10096456	3300028379	Bacteria	2599
582	Ga0268266_10151639	3300028379	Bacteria	2089
583	Ga0268266_10249348	3300028379	Bacteria	1642
584	Ga0268265_10133584	3300028380	Bacteria	2066
585	Ga0268265_10175847	3300028380	Bacteria	1834
586	Ga0265337_1001016	3300028556	Bacteria	14567
587	Ga0265326_10009519	3300028558	Bacteria	2906
588	Ga0265319_1006520	3300028563	Bacteria	5393
589	Ga0265334_10000616	3300028573	Bacteria	17901
590	Ga0265318_10006486	3300028577	Bacteria	5383
591	Ga0265323_10000037	3300028653	Bacteria	71088
592	Ga0265336_10011252	3300028666	Bacteria	3048
593	Ga0307517_10002211	3300028786	Bacteria	31433
594	Ga0307515_10058001	3300028794	Bacteria	5588
595	Ga0265338_10000024	3300028800	Bacteria	297778
596	Ga0265324_10005335	3300029957	Bacteria	5573
597	Ga0307511_10155000	3300030521	Bacteria	1303
598	Ga0265329_10017015	3300031242	Bacteria	2510
599	Ga0265340_10011711	3300031247	Bacteria	4653
600	Ga0265340_10049472	3300031247	Bacteria	2041
601	Ga0265339_10000755	3300031249	Bacteria	24978
602	Ga0265331_10001816	3300031250	Bacteria	15135
603	Ga0265327_10000020	3300031251	Bacteria	424552
604	Ga0265327_10000617	3300031251	Bacteria	58669
605	Ga0307509_10067379	3300031507	Bacteria	3751
606	Ga0307509_10140316	3300031507	Bacteria	2353
607	Ga0307509_10488932	3300031507	Bacteria	917
608	Ga0307408_100105115	3300031548	Bacteria	2158
609	Ga0307508_10000005	3300031616	Bacteria	286511
610	Ga0307508_10178363	3300031616	Bacteria	1727
611	Ga0307508_10230929	3300031616	Bacteria	1448
612	Ga0265314_10003561	3300031711	Bacteria	15025
613	Ga0265314_10020860	3300031711	Bacteria	5052
614	Ga0307516_10003435	3300031730	Bacteria	20328
615	Ga0307516_10015603	3300031730	Bacteria	7985
616	Ga0307516_10169597	3300031730	Bacteria	1924
617	Ga0307516_10250631	3300031730	Bacteria	1465
618	Ga0307412_10293773	3300031911	Bacteria	1281
619	Ga0307412_10516351	3300031911	Bacteria	997
620	Ga0307412_10680704	3300031911	Bacteria	881
621	Ga0307416_100077379	3300032002	Bacteria	2794
622	Ga0307416_100099112	3300032002	Bacteria	2530
623	Ga0307416_100126407	3300032002	Bacteria	2291
624	Ga0307414_10285595	3300032004	Bacteria	1389
625	Ga0307507_10016859	3300033179	Bacteria	8451
626	Ga0307510_10010762	3300033180	Bacteria	10880
627	Ga0307510_10012252	3300033180	Bacteria	10166
628	Ga0307510_10031633	3300033180	Bacteria	5974
629	Ga0307510_10034639	3300033180	Bacteria	5651
630	Ga0307510_10051910	3300033180	Bacteria	4331
631	Ga0307510_10139657	3300033180	Bacteria	2070
632	Ga0307510_10257585	3300033180	Bacteria	1228
633	Ga0315911_1000018	3300033442	Bacteria	152089
634	Ga0373934_0015334	3300035086	Bacteria	2906
635	Ga0373923_0000901	3300035111	Bacteria	7922
636	Ga0373923_0017500	3300035111	Bacteria	2743
637	Ga0373932_0113484	3300035112	Bacteria	896
638	Ga0373936_0085468	3300035113	Bacteria	1317
639	Ga0373936_0115070	3300035113	Bacteria	1145
640	Ga0373953_0012429	3300035117	Bacteria	3015
641	Ga0373954_0109618	3300035118	Bacteria	1335
642	Ga0373954_0208082	3300035118	Bacteria	961
643	Ga0373956_0003778	3300035119	Bacteria	6095
644	Ga0373956_0004893	3300035119	Bacteria	5365
645	Ga0373957_0010485	3300035120	Bacteria	3064
646	Ga0373943_0002441	3300035170	Bacteria	8444
647	Ga0373943_0050195	3300035170	Bacteria	2049
648	Ga0373943_0100012	3300035170	Bacteria	1515
649	Ga0373946_0007827	3300035171	Bacteria	3923
650	Ga0373946_0027452	3300035171	Bacteria	2252
651	Ga0373955_0000389	3300035172	Bacteria	18586
652	Ga0373955_0018503	3300035172	Bacteria	3466
653	Ga0373955_0116979	3300035172	Bacteria	1546
654	Ga0373962_0046697	3300035242	Bacteria	1237
655	Ga0373924_0092436	3300035410	Bacteria	1295
656	Ga0373935_0000658	3300035692	Bacteria	18225
657	Ga0373935_0161605	3300035692	Bacteria	1527
658	Ga0373935_0593728	3300035692	Bacteria	809
659	Ga0373927_0000560	3300035695	Bacteria	28343
660	Ga0373927_0015311	3300035695	Bacteria	5065
661	Ga0373927_0020229	3300035695	Bacteria	4365
662	Ga0373927_0048036	3300035695	Bacteria	2760
663	Ga0373927_0056843	3300035695	Bacteria	2530
664	Ga0373927_0067249	3300035695	Bacteria	2318
665	Ga0373927_0228157	3300035695	Bacteria	1223
666	Ga0373933_0005146	3300035724	Bacteria	7135
667	Ga0373933_0258220	3300035724	Bacteria	1123
668	Ga0373947_0000855	3300035725	Bacteria	18377
669	Ga0373947_0011670	3300035725	Bacteria	5039
670	Ga0373947_0026426	3300035725	Bacteria	3392
671	Ga0373947_0230316	3300035725	Bacteria	1220
672	Ga0373937_0002280	3300036401	Bacteria	16022
673	Ga0373937_0040270	3300036401	Bacteria	4259
674	Ga0373925_0001497	3300037068	Bacteria	20025
675	Ga0373925_0082489	3300037068	Bacteria	2447
676	Ga0373925_0275322	3300037068	Bacteria	1355
677	Ga0373925_0689411	3300037068	Bacteria	842
678	Ga0395899_0452146	3300037312	Bacteria	841
679	Ga0395900_0000909	3300037418	Bacteria	38980
680	Ga0395900_0093472	3300037418	Bacteria	3089
681	Ga0395900_0115379	3300037418	Bacteria	2756
682	Ga0395900_0174764	3300037418	Bacteria	2185
683	Ga0395900_0306068	3300037418	Bacteria	1574
684	Ga0395898_0003767	3300037466	Bacteria	16795
685	Ga0395898_0004788	3300037466	Bacteria	14726
686	Ga0395898_0039866	3300037466	Bacteria	4647
687	Ga0395898_0143599	3300037466	Bacteria	2285
688	Ga0395898_0171086	3300037466	Bacteria	2077
689	Ga0395898_0524308	3300037466	Bacteria	1126
690	Ga0395905_0001674	3300037471	Bacteria	26140
691	Ga0395905_0051943	3300037471	Bacteria	3839
692	Ga0395905_0195571	3300037471	Bacteria	1896
693	Ga0395905_0328443	3300037471	Bacteria	1420
694	Ga0395905_0623463	3300037471	Bacteria	980
695	Ga0436364_1193931	3300037853	Bacteria	4113
696	Ga0436364_1234877	3300037853	Bacteria	1115
697	Ga0395901_0012230	3300038443	Bacteria	8711
698	Ga0395901_0046449	3300038443	Bacteria	4511
699	Ga0395901_0134222	3300038443	Bacteria	2601
700	Ga0395901_0143865	3300038443	Bacteria	2506
701	Ga0395901_0158627	3300038443	Bacteria	2376
702	Ga0395901_0483680	3300038443	Bacteria	1262
703	Ga0436365_0040127	3300039437	Bacteria	1082
704	Ga0436365_0354234	3300039437	Bacteria	2904
705	Ga0436365_0650112	3300039437	Bacteria	58550
706	Ga0436365_1456038	3300039437	Bacteria	1169
707	Ga0436360_0141248	3300039438	Bacteria	1396
708	Ga0436360_1343314	3300039438	Bacteria	2578
709	Ga0436361_0066472	3300039447	Bacteria	1122
710	Ga0436361_0506647	3300039447	Bacteria	3242
711	Ga0436363_0541254	3300039450	Bacteria	2124
712	Ga0436363_0829483	3300039450	Bacteria	1017
713	Ga0436362_0334157	3300039453	Bacteria	4357
714	Ga0436362_0730562	3300039453	Bacteria	1973
715	Ga0439465_0041751	3300041413	Bacteria	1486
716	Ga0451793_1703391	3300041452	Bacteria	1058
717	Ga0451802_2192171	3300041460	Bacteria	888
718	Ga0451839_1447752	3300041496	Bacteria	775
719	Ga0451841_1210968	3300041498	Bacteria	786
720	Ga0450923_029380	3300042125	Bacteria	1114
721	Ga0439446_0127149	3300042156	Bacteria	824
722	Ga0439434_0057598	3300042435	Bacteria	1212
723	Ga0450918_000038	3300042531	Bacteria	26462
724	Ga0466969_0018084	3300044656	Bacteria	3678
725	Ga0466972_0000103	3300044658	Bacteria	75095
726	Ga0466972_0108133	3300044658	Bacteria	1314
727	Ga0466965_0097072	3300044683	Bacteria	1504
728	Ga0466966_0000378	3300044684	Bacteria	29054
729	Ga0466966_0165474	3300044684	Bacteria	1345
730	Ga0466961_0000129	3300044693	Bacteria	50353
731	Ga0466963_0114080	3300044694	Bacteria	1856
732	Ga0466964_0039507	3300044706	Bacteria	1902
733	Ga0466964_0042069	3300044706	Bacteria	1850
734	Ga0466964_0175269	3300044706	Bacteria	1013
735	Ga0466971_0030424	3300044719	Bacteria	2416
736	Ga0466971_0268568	3300044719	Bacteria	815
737	Ga0466968_0009433	3300044735	Bacteria	3752
738	Ga0466968_0043478	3300044735	Bacteria	1902
739	Ga0466957_0230456	3300044842	Bacteria	1226
740	Ga0466960_0015239	3300044901	Bacteria	3310
741	Ga0466959_0009787	3300045049	Bacteria	6830
742	Ga0466967_0316448	3300045976	Bacteria	1504
743	Ga0495592_0002709	3300046454	Bacteria	12539
744	Ga0495592_0004892	3300046454	Bacteria	9860
745	Ga0495592_0081621	3300046454	Bacteria	2337
746	Ga0495603_0000096	3300046455	Bacteria	40566
747	Ga0495603_0030875	3300046455	Bacteria	3227
748	Ga0495603_0042126	3300046455	Bacteria	2730
749	Ga0495629_0000198	3300046459	Bacteria	53334
750	Ga0495629_0000250	3300046459	Bacteria	46648
751	Ga0495629_0007416	3300046459	Bacteria	8083
752	Ga0495638_0000170	3300046460	Bacteria	101629
753	Ga0495638_0001355	3300046460	Bacteria	22467
754	Ga0495638_0345815	3300046460	Bacteria	787
755	Ga0495641_0006863	3300046461	Bacteria	7278
756	Ga0495651_0022320	3300046462	Bacteria	4919
757	Ga0495651_0079051	3300046462	Bacteria	2486
758	Ga0495653_0013767	3300046463	Bacteria	6590
759	Ga0495653_0154436	3300046463	Bacteria	1600
760	Ga0495650_0009560	3300046471	Bacteria	5501
761	Ga0495650_0063097	3300046471	Bacteria	1479
762	Ga0495580_0000536	3300046472	Bacteria	32045
763	Ga0495580_0033871	3300046472	Bacteria	3678
764	Ga0495580_0132946	3300046472	Bacteria	1725
765	Ga0495580_0562270	3300046472	Bacteria	756
766	Ga0495582_0000021	3300046473	Bacteria	88264
767	Ga0495582_0078205	3300046473	Bacteria	1835
768	Ga0495582_0279664	3300046473	Bacteria	958
769	Ga0495605_0173885	3300046474	Bacteria	950
770	Ga0495605_0176283	3300046474	Bacteria	942
771	Ga0495639_0000030	3300046475	Bacteria	65832
772	Ga0495639_0002759	3300046475	Bacteria	7629
773	Ga0495639_0029736	3300046475	Bacteria	2425
774	Ga0495639_0072987	3300046475	Bacteria	1588
775	Ga0495662_0001107	3300046476	Bacteria	13265
776	Ga0495662_0070847	3300046476	Bacteria	1689
777	Ga0495664_0005671	3300046477	Bacteria	6869
778	Ga0495664_0008001	3300046477	Bacteria	5886
779	Ga0495664_0012522	3300046477	Bacteria	4805
780	Ga0495594_0000814	3300046499	Bacteria	16120
781	Ga0495594_0191211	3300046499	Bacteria	1166
782	Ga0495583_0000952	3300046506	Bacteria	33646
783	Ga0495606_0003362	3300046507	Bacteria	17052
784	Ga0495606_0003804	3300046507	Bacteria	15681
785	Ga0495606_0032539	3300046507	Bacteria	3611
786	Ga0495608_0034133	3300046511	Bacteria	3435
787	Ga0495608_0085855	3300046511	Bacteria	2040
788	Ga0495610_0106214	3300046512	Bacteria	1250
789	Ga0495616_0036694	3300046513	Bacteria	2528
790	Ga0495616_0066146	3300046513	Bacteria	1759
791	Ga0495616_0090848	3300046513	Bacteria	1446
792	Ga0495618_0014009	3300046514	Bacteria	4882
793	Ga0495618_0032517	3300046514	Bacteria	3267
794	Ga0495618_0055467	3300046514	Bacteria	2509
795	Ga0495618_0136664	3300046514	Bacteria	1568
796	Ga0495620_0064506	3300046515	Bacteria	1514
797	Ga0495628_0029466	3300046516	Bacteria	4450
798	Ga0495628_0041533	3300046516	Bacteria	3671
799	Ga0495628_0124863	3300046516	Bacteria	1972
800	Ga0495630_0002807	3300046517	Bacteria	12080
801	Ga0495630_0037283	3300046517	Bacteria	3635
802	Ga0495630_0214820	3300046517	Bacteria	1468
803	Ga0495631_0089520	3300046518	Bacteria	1325
804	Ga0495631_0179487	3300046518	Bacteria	907
805	Ga0495631_0197736	3300046518	Bacteria	860
806	Ga0495631_0218003	3300046518	Bacteria	815
807	Ga0495637_0159272	3300046520	Bacteria	847
808	Ga0495643_0013930	3300046522	Bacteria	4793
809	Ga0495643_0046013	3300046522	Bacteria	2367
810	Ga0495643_0260869	3300046522	Bacteria	805
811	Ga0495644_0039328	3300046523	Bacteria	1783
812	Ga0495644_0215376	3300046523	Bacteria	742
813	Ga0495648_0000751	3300046524	Bacteria	34631
814	Ga0495642_0009278	3300046528	Bacteria	3766
815	Ga0495652_0010027	3300046529	Bacteria	8585
816	Ga0495652_0012614	3300046529	Bacteria	7617
817	Ga0495652_0098050	3300046529	Bacteria	2383
818	Ga0495652_0472114	3300046529	Bacteria	875
819	Ga0495665_0000066	3300046531	Bacteria	43565
820	Ga0495665_0004296	3300046531	Bacteria	7703
821	Ga0495640_0002445	3300046533	Bacteria	14912
822	Ga0495640_0008110	3300046533	Bacteria	8251
823	Ga0495640_0028982	3300046533	Bacteria	3980
824	Ga0495640_0051218	3300046533	Bacteria	2839
825	Ga0495587_0004510	3300046536	Bacteria	9152
826	Ga0495587_0026435	3300046536	Bacteria	3540
827	Ga0495609_0018491	3300046538	Bacteria	3228
828	Ga0495597_0010157	3300046542	Bacteria	4612
829	Ga0495645_0033889	3300046543	Bacteria	3725
830	Ga0495645_0077499	3300046543	Bacteria	2390
831	Ga0495645_0114702	3300046543	Bacteria	1903
832	Ga0495622_0000531	3300046557	Bacteria	23002
833	Ga0495622_0010188	3300046557	Bacteria	4345
834	Ga0495622_0115428	3300046557	Bacteria	1228
835	Ga0495622_0125363	3300046557	Bacteria	1171
836	Ga0495633_0000663	3300046558	Bacteria	31797
837	Ga0495633_0116342	3300046558	Bacteria	1239
838	Ga0495667_0018582	3300046559	Bacteria	4694
839	Ga0495667_0018671	3300046559	Bacteria	4681
840	Ga0495667_0023780	3300046559	Bacteria	4127
841	Ga0495656_0022069	3300046615	Bacteria	2488
842	Ga0495656_0092992	3300046615	Bacteria	1382
843	Ga0495668_0102440	3300046616	Bacteria	1566
844	Ga0495668_0152121	3300046616	Bacteria	1267
845	Ga0495634_0000336	3300046642	Bacteria	45375
846	Ga0495634_0063617	3300046642	Bacteria	2448
847	Ga0495634_0124782	3300046642	Bacteria	1646
848	Ga0495611_0100496	3300046648	Bacteria	1343
849	Ga0495611_0211182	3300046648	Bacteria	904
850	Ga0495625_0001377	3300046660	Bacteria	29891
851	Ga0495625_0204710	3300046660	Bacteria	1300
852	Ga0495625_0462777	3300046660	Bacteria	781
853	Ga0495635_0000235	3300046663	Bacteria	35104
854	Ga0495635_0000318	3300046663	Bacteria	31064
855	Ga0495659_0010937	3300046664	Bacteria	2922
856	Ga0495661_0086188	3300046665	Bacteria	1798
857	Ga0495588_0001810	3300046674	Bacteria	9110
858	Ga0495657_0006114	3300046675	Bacteria	9435
859	Ga0495657_0007151	3300046675	Bacteria	8657
860	Ga0495657_0079743	3300046675	Bacteria	2119
861	Ga0495599_0001987	3300046678	Bacteria	11832
862	Ga0495599_0037617	3300046678	Bacteria	3040
863	Ga0495599_0215398	3300046678	Bacteria	1176
864	Ga0495599_0226741	3300046678	Bacteria	1142
865	Ga0495623_0032407	3300046679	Bacteria	3359
866	Ga0495623_0046142	3300046679	Bacteria	2766
867	Ga0495646_0034954	3300046680	Bacteria	3118
868	Ga0495646_0054587	3300046680	Bacteria	2402
869	Ga0495646_0083887	3300046680	Bacteria	1851
870	Ga0495647_0003479	3300046681	Bacteria	5037
871	Ga0495658_0004834	3300046683	Bacteria	6609
872	Ga0495658_0011635	3300046683	Bacteria	4432
873	Ga0495669_0002066	3300046684	Bacteria	8228
874	Ga0495669_0087106	3300046684	Bacteria	1439
875	Ga0495624_0003187	3300046690	Bacteria	12217
876	Ga0495624_0043224	3300046690	Bacteria	2875
877	Ga0495624_0085106	3300046690	Bacteria	1953
878	Ga0495624_0149734	3300046690	Bacteria	1428
879	Ga0495624_0326067	3300046690	Bacteria	924
880	Ga0495670_0215260	3300046691	Bacteria	1020
881	Ga0495671_0035874	3300046692	Bacteria	2516
882	Ga0495671_0158253	3300046692	Bacteria	1102
883	Ga0495671_0203165	3300046692	Bacteria	961
884	Ga0495671_0210406	3300046692	Bacteria	942
885	Ga0495671_0224475	3300046692	Bacteria	909
886	Ga0495649_0095841	3300046694	Bacteria	1579
887	Ga0495649_0122384	3300046694	Bacteria	1375
888	Ga0495589_0249806	3300046794	Bacteria	829
889	Ga0495600_0006925	3300046809	Bacteria	6916
890	Ga0495600_0014452	3300046809	Bacteria	4976
891	Ga0495600_0025067	3300046809	Bacteria	3843
892	Ga0495660_0077589	3300046810	Bacteria	1748
893	Ga0495581_0000047	3300047315	Bacteria	45397
894	Ga0495581_0056744	3300047315	Bacteria	2260
895	Ga0495581_0127837	3300047315	Bacteria	1480
896	Ga0495604_0020320	3300047317	Bacteria	5305
897	Ga0495604_0065053	3300047317	Bacteria	2777
898	Ga0495604_0183110	3300047317	Bacteria	1464
899	Ga0495674_0000101	3300047319	Bacteria	62646
900	Ga0495674_0086078	3300047319	Bacteria	2691
901	Ga0495674_0213843	3300047319	Bacteria	1596
902	Ga0495672_0048823	3300047320	Bacteria	2508
903	Ga0495672_0133445	3300047320	Bacteria	1304
904	Ga0495676_0007477	3300047321	Bacteria	10020
905	Ga0495676_0048707	3300047321	Bacteria	3414
906	Ga0495680_0005196	3300047322	Bacteria	12281
907	Ga0495680_0077698	3300047322	Bacteria	2513
908	Ga0495687_002122	3300047443	Bacteria	16603
909	Ga0495687_002238	3300047443	Bacteria	15954
910	Ga0495687_016690	3300047443	Bacteria	3686
911	Ga0495675_0001617	3300047444	Bacteria	13538
912	Ga0495675_0012041	3300047444	Bacteria	5436
913	Ga0495675_0043083	3300047444	Bacteria	2876
914	Ga0495675_0234742	3300047444	Bacteria	1106
915	Ga0495679_032566	3300047446	Bacteria	1671
916	Ga0495673_0006973	3300047469	Bacteria	6575
917	Ga0495684_0020800	3300047471	Bacteria	5056
918	Ga0495684_0111648	3300047471	Bacteria	2062
919	Ga0495684_0214914	3300047471	Bacteria	1412
920	Ga0495684_0360027	3300047471	Bacteria	1031
921	Ga0495686_0098453	3300047472	Bacteria	1767
922	Ga0495593_0000466	3300047673	Bacteria	22750
923	Ga0495593_0003308	3300047673	Bacteria	9658
924	Ga0495593_0067430	3300047673	Bacteria	1863
925	Ga0495593_0096606	3300047673	Bacteria	1518
926	Ga0495602_0078638	3300048088	Bacteria	2785
927	Ga0495602_0147187	3300048088	Bacteria	1856
928	Ga0495615_0019536	3300048090	Bacteria	1506
929	Ga0496100_0089483	3300048903	Bacteria	2097
930	Ga0496100_0099690	3300048903	Bacteria	1999
931	Ga0496100_0164084	3300048903	Bacteria	1594
932	Ga0496101_0030930	3300048904	Bacteria	3759
933	Ga0496101_0078897	3300048904	Bacteria	2430
934	Ga0496101_0094327	3300048904	Bacteria	2230
935	Ga0496101_0394634	3300048904	Bacteria	1089
936	Ga0496101_0500030	3300048904	Bacteria	960
937	Ga0496102_0009570	3300048905	Bacteria	8334
938	Ga0496102_0448613	3300048905	Bacteria	1210
939	Ga0496102_0464594	3300048905	Bacteria	1186
940	Ga0496102_0493538	3300048905	Bacteria	1146
941	Ga0496104_0009588	3300048907	Bacteria	8619
942	Ga0496104_0027346	3300048907	Bacteria	5278
943	Ga0496104_0114150	3300048907	Bacteria	2590
944	Ga0496104_0621880	3300048907	Bacteria	990
945	Ga0496105_0001253	3300048908	Bacteria	17719
946	Ga0496105_0024978	3300048908	Bacteria	4857
947	Ga0496105_0109654	3300048908	Bacteria	2278
948	Ga0496105_0354648	3300048908	Bacteria	1171
949	Ga0496106_0001870	3300048909	Bacteria	15762
950	Ga0496106_0028692	3300048909	Bacteria	4145
951	Ga0496106_0125374	3300048909	Bacteria	2010
952	Ga0496106_0551447	3300048909	Bacteria	925
953	Ga0496106_0560424	3300048909	Bacteria	917
954	Ga0496107_0017305	3300048910	Bacteria	5068
955	Ga0496107_0121658	3300048910	Bacteria	1923
956	Ga0496108_0005991	3300048911	Bacteria	9850
957	Ga0496108_0044916	3300048911	Bacteria	3689
958	Ga0496108_0086823	3300048911	Bacteria	2656
959	Ga0496108_0264081	3300048911	Bacteria	1498
960	Ga0496109_0018637	3300048912	Bacteria	6099
961	Ga0496109_0083691	3300048912	Bacteria	2942
962	Ga0496109_0300902	3300048912	Bacteria	1512
963	Ga0496109_0320622	3300048912	Bacteria	1462
964	Ga0496109_0469357	3300048912	Bacteria	1188
965	Ga0496110_0027411	3300048913	Bacteria	4884
966	Ga0496110_0330839	3300048913	Bacteria	1388
967	Ga0496110_0930010	3300048913	Bacteria	776
968	Ga0496110_1048650	3300048913	Bacteria	723
969	Ga0496111_0118125	3300048914	Bacteria	1957
970	Ga0496111_0133940	3300048914	Bacteria	1835
971	Ga0496111_0483769	3300048914	Bacteria	912
972	Ga0496111_0556014	3300048914	Bacteria	842
973	Ga0496111_0621664	3300048914	Bacteria	790
974	Ga0496111_0646093	3300048914	Bacteria	772
975	Ga0496112_0000008	3300048915	Bacteria	310323
976	Ga0496112_0015989	3300048915	Bacteria	7016
977	Ga0496112_0052125	3300048915	Bacteria	4015
978	Ga0496112_0055750	3300048915	Bacteria	3888
979	Ga0496112_0109960	3300048915	Bacteria	2726
980	Ga0496112_0458935	3300048915	Bacteria	1211
981	Ga0496112_0681401	3300048915	Bacteria	956
982	Ga0496113_0016980	3300048916	Bacteria	5040
983	Ga0496113_0134853	3300048916	Bacteria	1939
984	Ga0496113_0184359	3300048916	Bacteria	1655
985	Ga0496114_0031036	3300048917	Bacteria	4396
986	Ga0496114_0165682	3300048917	Bacteria	1924
987	Ga0496114_0168224	3300048917	Bacteria	1909
988	Ga0496114_0195633	3300048917	Bacteria	1770
989	Ga0496114_0338774	3300048917	Bacteria	1330
990	Ga0496115_0004351	3300048918	Bacteria	10249
991	Ga0496115_0022604	3300048918	Bacteria	4875
992	Ga0496115_0068161	3300048918	Bacteria	2880
993	Ga0496115_0122842	3300048918	Bacteria	2137
994	Ga0496115_0232668	3300048918	Bacteria	1519
995	Ga0496115_0587311	3300048918	Bacteria	887
996	Ga0496116_0049090	3300048919	Bacteria	2826
997	Ga0496116_0342855	3300048919	Bacteria	688
998	Ga0496118_0005557	3300048921	Bacteria	14287
999	Ga0496118_0010500	3300048921	Bacteria	9167
1000	Ga0496118_0294187	3300048921	Bacteria	895
1001	Ga0496119_0013508	3300048922	Bacteria	6495
1002	Ga0496120_0008859	3300048923	Bacteria	7215
1003	Ga0496120_0062629	3300048923	Bacteria	2072
1004	Ga0496121_0000194	3300048924	Bacteria	136324
1005	Ga0496121_0000716	3300048924	Bacteria	61451
1006	Ga0496121_0012296	3300048924	Bacteria	9367
1007	Ga0496121_0038962	3300048924	Bacteria	4198
1008	Ga0496121_0064181	3300048924	Bacteria	2995
1009	Ga0496121_0092266	3300048924	Bacteria	2361
1010	Ga0496121_0138712	3300048924	Bacteria	1807
1011	Ga0496121_0574394	3300048924	Bacteria	701
1012	Ga0496122_0053225	3300048925	Bacteria	3054
1013	Ga0496122_0124083	3300048925	Bacteria	1658
1014	Ga0496122_0324937	3300048925	Bacteria	816
1015	Ga0496124_0001529	3300048927	Bacteria	33656
1016	Ga0496124_0171268	3300048927	Bacteria	1681
1017	Ga0496124_0204198	3300048927	Bacteria	1500
1018	Ga0496124_0362207	3300048927	Bacteria	1021
1019	Ga0496125_0084491	3300048928	Bacteria	2410
1020	Ga0496125_0118962	3300048928	Bacteria	1890
1021	Ga0496125_0124424	3300048928	Bacteria	1831
1022	Ga0496125_0147576	3300048928	Bacteria	1622
1023	Ga0496125_0235014	3300048928	Bacteria	1169
1024	Ga0496126_0012633	3300048929	Bacteria	8640
1025	Ga0496126_0016855	3300048929	Bacteria	7293
1026	Ga0496126_0027262	3300048929	Bacteria	5459
1027	Ga0496126_0035700	3300048929	Bacteria	4656
1028	Ga0496126_0056813	3300048929	Bacteria	3536
1029	Ga0496126_0113840	3300048929	Bacteria	2354
1030	Ga0496126_0349337	3300048929	Bacteria	1210
1031	Ga0495678_015852	3300049459	Bacteria	3458
1032	Ga0495678_037686	3300049459	Bacteria	1962
1033	Ga0501031_0007226	3300049568	Bacteria	7247
1034	Ga0501032_0000305	3300049569	Bacteria	41459
1035	Ga0501033_0000139	3300049570	Bacteria	70209
1036	Ga0501034_0004098	3300049571	Bacteria	16356
1037	Ga0501036_0000150	3300049572	Bacteria	45519
1038	Ga0501036_0554371	3300049572	Bacteria	955
1039	Ga0501037_0000026	3300049573	Bacteria	142936
1040	Ga0501038_0000582	3300049574	Bacteria	32407
1041	Ga0501038_0435933	3300049574	Bacteria	1009
1042	Ga0501039_0000245	3300049575	Bacteria	39593
1043	Ga0501040_0000108	3300049576	Bacteria	42539
1044	Ga0501042_0001901	3300049578	Bacteria	12547
1045	Ga0501043_0000770	3300049579	Bacteria	28450
1046	Ga0501046_0000915	3300049580	Bacteria	28890
1047	Ga0501047_0000806	3300049581	Bacteria	32674
1048	Ga0501047_0256345	3300049581	Bacteria	1597
1049	Ga0501048_0028317	3300049582	Bacteria	4066
1050	Ga0501067_0028596	3300049583	Bacteria	3089
1051	Ga0501068_0023378	3300049584	Bacteria	3621
1052	Ga0501069_0015066	3300049585	Bacteria	4141
1053	Ga0501069_0098537	3300049585	Bacteria	1658
1054	Ga0501070_0000130	3300049586	Bacteria	67605
1055	Ga0501070_0022799	3300049586	Bacteria	5241
1056	Ga0501072_0031983	3300049588	Bacteria	4119
1057	Ga0501073_0023398	3300049589	Bacteria	4436
1058	Ga0501074_0005223	3300049590	Bacteria	9338
1059	Ga0501076_0079586	3300049592	Bacteria	2630
1060	Ga0501079_0089450	3300049741	Bacteria	2384
1061	Ga0501080_0001034	3300049742	Bacteria	22921
1062	Ga0501080_0115516	3300049742	Bacteria	2488
1063	Ga0501035_0000403	3300049822	Bacteria	49264
1064	Ga0501035_0289478	3300049822	Bacteria	1383
1065	Ga0501035_0468450	3300049822	Bacteria	1040
1066	Ga0501044_0000475	3300049823	Bacteria	48841
1067	Ga0501044_0053014	3300049823	Bacteria	4175
1068	Ga0501044_0348572	3300049823	Bacteria	1401
1069	Ga0501045_0013457	3300049824	Bacteria	5779
1070	nmdc:mga03683_10292_c2	3300050489	Bacteria	2690
1071	nmdc:mga03683_14_c1	3300050489	Bacteria	109157
1072	nmdc:mga03n38_17330_c1	3300050490	Bacteria	2819
1073	nmdc:mga03n38_181517_c1	3300050490	Bacteria	1078
1074	nmdc:mga00v17_187885_c1	3300050491	Bacteria	1334
1075	nmdc:mga00v17_67802_c1	3300050491	Bacteria	2205
1076	nmdc:mga00v17_7354_c1	3300050491	Bacteria	5870
1077	nmdc:mga0yw44_200149_c1	3300050492	Bacteria	1319
1078	nmdc:mga0yw44_32014_c1	3300050492	Bacteria	3062
1079	nmdc:mga0yw44_66862_c2	3300050492	Bacteria	1602
1080	nmdc:mga0yw44_82435_c1	3300050492	Bacteria	2018
1081	nmdc:mga0k408_25_c1	3300050493	Bacteria	96034
1082	nmdc:mga0k408_31706_c1	3300050493	Bacteria	3019
1083	nmdc:mga06z11_31203_c1	3300050494	Bacteria	2587
1084	nmdc:mga06z11_69145_c1	3300050494	Bacteria	1863
1085	nmdc:mga06z11_93702_c1	3300050494	Bacteria	1635
1086	nmdc:mga07m45_48866_c2	3300050496	Bacteria	2183
1087	nmdc:mga07m45_5124_c1	3300050496	Bacteria	6491
1088	nmdc:mga07m45_8_c1	3300050496	Bacteria	214050
1089	nmdc:mga05p37_228422_c1	3300050507	Bacteria	2243
1090	nmdc:mga09592_386122_c1	3300050508	Bacteria	1210
1091	nmdc:mga0n895_6061_c1	3300050512	Bacteria	10193
1092	nmdc:mga0n895_667211_c1	3300050512	Bacteria	1037
1093	nmdc:mga0n895_978150_c1	3300050512	Bacteria	828
1094	nmdc:mga0rr50_187966_c1	3300050513	Bacteria	1691
1095	nmdc:mga0rr50_237762_c1	3300050513	Bacteria	1509
1096	nmdc:mga0rr50_76385_c1	3300050513	Bacteria	2571
1097	nmdc:mga0sz30_311_c1	3300050516	Bacteria	18664
1098	nmdc:mga0sz30_56796_c2	3300050516	Bacteria	1364
1099	Ga0495601_0154422	3300053077	Bacteria	1499
1100	Ga0495601_0336794	3300053077	Bacteria	982
1101	Ga0495612_0020357	3300053078	Bacteria	2659
1102	Ga0495612_0024669	3300053078	Bacteria	2414
1103	Ga0495612_0077194	3300053078	Bacteria	1396
1104	Ga0500635_0051939	3300053080	Bacteria	1406
1105	Ga0500635_0075373	3300053080	Bacteria	1203
1106	Ga0495655_0004205	3300053083	Bacteria	2443
1107	Ga0495595_0025885	3300053084	Bacteria	2603
1108	Ga0495595_0247693	3300053084	Bacteria	892
1109	Ga0495619_0015721	3300053085	Bacteria	4792
1110	Ga0495619_0028950	3300053085	Bacteria	3575
1111	Ga0495619_0157215	3300053085	Bacteria	1569
1112	Ga0495619_0379247	3300053085	Bacteria	977
1113	Ga0500643_000062	3300053087	Bacteria	122407
1114	Ga0500647_0030103	3300053091	Bacteria	2577
1115	Ga0500583_0051279	3300053092	Bacteria	1916
1116	Ga0500566_0000065	3300053094	Bacteria	50325
1117	Ga0500566_0000364	3300053094	Bacteria	24722
1118	Ga0500566_0015975	3300053094	Bacteria	4408
1119	Ga0500640_038185	3300053095	Bacteria	2109
1120	Ga0500641_0019142	3300053096	Bacteria	2585
1121	Ga0500554_024471	3300053102	Bacteria	1711
1122	Ga0500555_000950	3300053103	Bacteria	10082
1123	Ga0500556_0016277	3300053104	Bacteria	2310
1124	Ga0500557_000073	3300053105	Bacteria	38711
1125	Ga0500569_009375	3300053109	Bacteria	2273
1126	Ga0500572_000160	3300053111	Bacteria	23287
1127	Ga0500572_021242	3300053111	Bacteria	1717
1128	Ga0500572_045491	3300053111	Bacteria	1290
1129	Ga0500594_0022587	3300053118	Bacteria	1588
1130	Ga0500594_0083925	3300053118	Bacteria	957
1131	Ga0500595_003091	3300053119	Bacteria	7889
1132	Ga0500595_013168	3300053119	Bacteria	3173
1133	Ga0500607_094030	3300053121	Bacteria	1502
1134	Ga0500608_184624	3300053122	Bacteria	879
1135	Ga0500621_126707	3300053126	Bacteria	983
1136	Ga0500642_0000434	3300053130	Bacteria	13450
1137	Ga0500642_0191341	3300053130	Bacteria	954
1138	Ga0500655_017792	3300053133	Bacteria	1317
1139	Ga0500655_046241	3300053133	Bacteria	861
1140	Ga0500658_0032986	3300053134	Bacteria	2033
1141	Ga0500559_0000211	3300053136	Bacteria	46800
1142	Ga0500559_0002662	3300053136	Bacteria	9092
1143	Ga0500559_0039563	3300053136	Bacteria	2051
1144	Ga0500561_0054107	3300053137	Bacteria	1105
1145	Ga0500564_123327	3300053138	Bacteria	1127
1146	Ga0500568_0041062	3300053139	Bacteria	1860
1147	Ga0500568_0094897	3300053139	Bacteria	1122
1148	Ga0500577_0085237	3300053142	Bacteria	1267
1149	Ga0500588_0099710	3300053146	Bacteria	1000
1150	Ga0500588_0132354	3300053146	Bacteria	889
1151	Ga0500590_006954	3300053148	Bacteria	5549
1152	Ga0500590_188996	3300053148	Bacteria	885
1153	Ga0500603_000437	3300053150	Bacteria	10798
1154	Ga0500603_020943	3300053150	Bacteria	1603
1155	Ga0500603_025105	3300053150	Bacteria	1496
1156	Ga0500603_081683	3300053150	Bacteria	937
1157	Ga0500604_0053325	3300053151	Bacteria	1254
1158	Ga0500616_0000034	3300053153	Bacteria	396651
1159	Ga0500620_007175	3300053155	Bacteria	2733
1160	Ga0500622_0027334	3300053156	Bacteria	3007
1161	Ga0500627_0069644	3300053158	Bacteria	1557
1162	Ga0500638_003863	3300053162	Bacteria	5650
1163	Ga0500638_165894	3300053162	Bacteria	967
1164	Ga0500638_184505	3300053162	Bacteria	897
1165	Ga0500638_211549	3300053162	Bacteria	812
1166	Ga0500639_117770	3300053163	Bacteria	1281
1167	Ga0500639_202512	3300053163	Bacteria	851
1168	Ga0500636_0013818	3300053177	Bacteria	4745
1169	Ga0500636_0044781	3300053177	Bacteria	2609
1170	Ga0500636_0064099	3300053177	Bacteria	2141
1171	Ga0500637_0000467	3300053178	Bacteria	15615
1172	Ga0500637_0003942	3300053178	Bacteria	6939
1173	Ga0500637_0261120	3300053178	Bacteria	961
1174	Ga0500625_011167	3300053729	Bacteria	4068
1175	Ga0500625_112752	3300053729	Bacteria	1112
1176	Ga0500645_046712	3300053730	Bacteria	1270
1177	Ga0500645_084180	3300053730	Bacteria	906
1178	Ga0500609_013649	3300053731	Bacteria	1099
1179	Ga0500596_003501	3300053735	Bacteria	2974
1180	Ga0500661_026284	3300055283	Bacteria	1028
1181	8019640084	8019638758	Bacteria	9062356
1182	2507504869	2507262055	Bacteria	8048963
1183	2508546224	2508501009	Bacteria	7784016
1184	2508695156	2508501042	Bacteria	8719808
1185	2509149823	2508501128	Bacteria	8613869
1186	2511398372	2511231028	Bacteria	8046582
1187	2513626734	2513237092	Bacteria	8341956
1188	2513639580	2513237094	Bacteria	8789602
1189	2513647934	2513237095	Bacteria	8976980
1190	2513658187	2513237096	Bacteria	8722461
1191	2513694963	2513237101	Bacteria	7952346
1192	2513702231	2513237102	Bacteria	7703324
1193	2513715738	2513237104	Bacteria	10034502
1194	2513860210	2513237137	Bacteria	9558895
1195	2513873885	2513237139	Bacteria	8737671
1196	2513889812	2513237141	Bacteria	8496279
1197	2513920321	2513237145	Bacteria	8979722
1198	2514012856	2513237161	Bacteria	8871253
1199	2515625838	2515154112	Bacteria	8294334
1200	2517102358	2517093001	Bacteria	9002274
1201	2517889256	2517572143	Bacteria	9484767
1202	2524435773	2524023205	Bacteria	8918781
1203	2524472059	2524023210	Bacteria	9029266
1204	2524536476	2524023228	Bacteria	10118060
1205	2528851616	2528768022	Bacteria	10457665
1206	2617351731	2617270735	Bacteria	9163226
1207	2617374087	2617270741	Bacteria	8201522
1208	2671121465	2667528175	Bacteria	7532676
1209	2723841989	2721755755	Bacteria	8322773
1210	2728754754	2728368998	Bacteria	8720350
1211	2745079070	2744054633	Bacteria	8678936
1212	2793063089	2791355196	Bacteria	7323613
1213	2793073227	2791355197	Bacteria	8420563
1214	2793077461
1215	2805915968	2802429603	Bacteria	8777136
1216	2818237308	2816332527	Bacteria	8933356
1217	2824602603	2824600985	Bacteria	8488197
1218	2824612617	2824609381	Bacteria	8672835
1219	2824621079	2824617872	Bacteria	8814715
1220	2824630086	2824626560	Bacteria	8813858
1221	2824637898	2824635225	Bacteria	8785348
1222	2824646351	2824644064	Bacteria	8743947
1223	2824654432	2824653114	Bacteria	8493680
1224	2824664757	2824661429	Bacteria	9877870
1225	2824674229	2824671348	Bacteria	8369588
1226	2824682067	2824679649	Bacteria	8248951
1227	2824690858	2824687955	Bacteria	8360029
1228	2824697623	2824696289	Bacteria	8335049
1229	2824710776	2824704595	Bacteria	9667483
1230	2824719115	2824714736	Bacteria	8717648
1231	2824726365	2824723954	Bacteria	8758240
1232	2824735331	2824732956	Bacteria	7810675
1233	2824749122	2824746037	Bacteria	7911610
1234	2824757085	2824753945	Bacteria	9787441
1235	2824768421	2824763712	Bacteria	9792355
1236	2824774913	2824773399	Bacteria	8360218
1237	2838124143	2838122688	Bacteria	8803140
1238	2841944490	2841941048	Bacteria	8688029
1239	2841951630	2841949485	Bacteria	8680857
1240	2841966044	2841957949	Bacteria	8652217
1241	2841969267	2841966195	Bacteria	8673214
1242	2841980333	2841974524	Bacteria	8931498
1243	2841985587	2841983080	Bacteria	8395090
1244	2842043854	2842038055	Bacteria	8002051
1245	2842052156	2842045827	Bacteria	8006841
1246	2844321850	2844315083	Bacteria	8138177
1247	2847931442	2847930680	Bacteria	9342022
1248	2847941781	2847939898	Bacteria	8606328
1249	2849082703	2849076700	Bacteria	7039503
1250	2857511597	2857509624	Bacteria	7472071
1251	2874596863	2874590934	Bacteria	8299676
1252	2874610400	2874604998	Bacteria	7834745
1253	2874617732	2874612657	Bacteria	8252029
1254	2874624448	2874620515	Bacteria	8290088
1255	2874636736	2874628541	Bacteria	8630250
1256	2874648668	2874645413	Bacteria	8214782
1257	2876769017	2876761206	Bacteria	10111113
1258	2876777327	2876771140	Bacteria	8287509
1259	2876825409	2876818435	Bacteria	8274608
1260	2879077658	2879074833	Bacteria	8279565
1261	2879087522	2879083081	Bacteria	8587928
1262	2879107253	2879099564	Bacteria	10442239
1263	2879111718	2879110137	Bacteria	8907982
1264	2879128632	2879127579	Bacteria	8294491
1265	2879143972	2879142872	Bacteria	8267021
1266	2881370975	2881364244	Bacteria	7710352
1267	2881665723	2881665667	Bacteria	8175609
1268	2885371372	2885366525	Bacteria	8326213
1269	2885376137	2885374607	Bacteria	8927485
1270	2885389529	2885383462	Bacteria	9473874
1271	2885415309	2885409591	Bacteria	9235467
1272	2888379935	2888378607	Bacteria	9652610
1273	2888391015	2888388044	Bacteria	7304136
1274	2888420744	2888419890	Bacteria	7857137
1275	2889035112	2889033259	Bacteria	9099371
1276	2903727600	2903727486	Bacteria	8281579
1277	2903755097	2903748898	Bacteria	9972761
1278	2903774188	2903768456	Bacteria	9749579
1279	2904672213	2904666416	Bacteria	8226587
1280	2904695166	2904690495	Bacteria	9412302
1281	2904709116
1282	2904716212	2904711408	Bacteria	9771557
1283	2906602910	2906602504	Bacteria	8295279
1284	2906613269
1285	2906633503	2906626472	Bacteria	8826946
1286	2906635442	2906635258	Bacteria	8601019
1287	2906649044	2906643746	Bacteria	8722424
1288	2906668573	2906660503	Bacteria	8595048
1289	2908747856	2908739725	Bacteria	8628932
1290	2908756818	2908756301	Bacteria	8864324
1291	2908776563	2908775508	Bacteria	8092255
1292	2922363371	2922361189	Bacteria	7436256
1293	2922378320
1294	2922388646	2922386360	Bacteria	7017218
1295	2922396603	2922393267	Bacteria	8285685
1296	2922433766
1297	2929622579	2929615660	Bacteria	9193770
1298	2929631203	2929624759	Bacteria	9339455
1299	2932786374	2932784394	Bacteria	9704911
1300	2932794660	2932794094	Bacteria	7915132
1301	2932805529	2932801729	Bacteria	7987968
1302	2932812551	2932809354	Bacteria	9135765
1303	2932822913	2932818245	Bacteria	9955613
1304	2932829612	2932828146	Bacteria	9745859
1305	2933584342	2933577622	Bacteria	9116884
1306	2935614931	2935608549	Bacteria	8203142
1307	2935618130	2935616580	Bacteria	9032984
1308	2935634808	2935630451	Bacteria	8169952
1309	2935641472	2935638405	Bacteria	10015038
1310	2935652959	2935648319	Bacteria	8801166
1311	2935661542	2935656913	Bacteria	8965014
1312	2935669470	2935665750	Bacteria	9571747
1313	2935677932	2935675223	Bacteria	9928132
1314	2935689619	2935684952	Bacteria	9590419
1315	2935701831	2935694250	Bacteria	9291695
1316	2935707295	2935703347	Bacteria	10242284
1317	2935717138	2935713505	Bacteria	9608509
1318	2935730028	2935722832	Bacteria	9608746
1319	2935738553	2935732158	Bacteria	9706831
1320	2935749199	2935741537	Bacteria	9707219
1321	2935756972	2935750917	Bacteria	9590372
1322	2935764416	2935760218	Bacteria	9817913
1323	2935772744	2935769743	Bacteria	7878163
1324	2935778119	2935777560	Bacteria	8077691
1325	2935787347	2935785616	Bacteria	7962367
1326	2935795865	2935793552	Bacteria	8012592
1327	2935804326	2935801545	Bacteria	9301974
1328	2935815410	2935810662	Bacteria	9401221
1329	2935826029	2935819856	Bacteria	8261050
1330	2935831203	2935827899	Bacteria	10038562
1331	2935841812	2935837841	Bacteria	9454360
1332	2935851648	2935847175	Bacteria	8228321
1333	2935856371	2935855204	Bacteria	9035059
1334	2935866297	2935864058	Bacteria	9784707
1335	2935874603	2935873716	Bacteria	9632195
1336	2935890353	2935883170	Bacteria	7964738
1337	2935910330	2935908558	Bacteria	8568796
1338	2935918384	2935916978	Bacteria	9113783
1339	2935927759	2935926038	Bacteria	8601059
1340	2935936369	2935934488	Bacteria	8602579
1341	2935944078	2935942939	Bacteria	8599779
1342	2935952515	2935951376	Bacteria	8602333
1343	2935962307	2935959822	Bacteria	7869783
1344	2935969355	2935967501	Bacteria	8603075
1345	2935977880	2935975950	Bacteria	8347125
1346	2935984817	2935984226	Bacteria	8302647
1347	2935994064	2935992306	Bacteria	9802711
1348	2936004925	2936002035	Bacteria	9362176
1349	2936015729	2936011229	Bacteria	8801034
1350	2936024363	2936019824	Bacteria	8804134
1351	2936031750	2936028420	Bacteria	8965941
1352	2936045065	2936037263	Bacteria	9446081
1353	2936051572	2936046547	Bacteria	8903709
1354	2936055988	2936055302	Bacteria	8785755
1355	2940562886	2940556831	Bacteria	9590747
1356	2941511862	2941507105	Bacteria	8166816
1357	2941519564	2941515067	Bacteria	8166720
1358	2941527744	2941523033	Bacteria	8169134
1359	2941532381	2941531003	Bacteria	7653939
1360	2941543885	2941538514	Bacteria	9402094
1361	2945972721	2945972063	Bacteria	6086495
1362	3005475494	3005474847	Bacteria	9259049
1363	3005509518	3005506211	Bacteria	6943378
1364	3005592724	3005587118	Bacteria	7794411
1365	3005602199	3005594810	Bacteria	8716512
1366	3005717953	3005710791	Bacteria	7622528
1367	3005724988	3005718088	Bacteria	8283608
1368	8006932695	8006926726	Bacteria	6749210
1369	8006935804	8006933436	Bacteria	10410654
1370	8006968274	8006964411	Bacteria	8966052
1371	8006975722	8006973647	Bacteria	10679141
1372	8006985989	8006984368	Bacteria	9651211
1373	8007002117	8006994254	Bacteria	8309700
1374	8016518596	8016511872	Bacteria	9921665
1375	8016526567	8016522445	Bacteria	8156687
1376	8016531646	8016530956	Bacteria	8155261
1377	8016544849	8016539877	Bacteria	8155419
1378	8016569915	8016566248	Bacteria	8158151
1379	8016582499	8016575299	Bacteria	8154085
1380	8016586784	8016583857	Bacteria	10421953
1381	8016603195	8016595262	Bacteria	8149947
1382	8016617998	8016613128	Bacteria	8794220
1383	8016623574	8016622563	Bacteria	7999408
1384	8016636057	8016630954	Bacteria	9217207
1385	8017058074	8017057580	Bacteria	10023680
1386	8019531474	8019530166	Bacteria	8155624
1387	8019540056	8019538911	Bacteria	7872763
1388	8019562985	8019555841	Bacteria	9642137
1389	8019573064	8019565922	Bacteria	9639779
1390	8019577661	8019576017	Bacteria	10049540
1391	8019595759	8019586578	Bacteria	10212056
1392	8019606003	8019597564	Bacteria	10041141
1393	8019622584	8019619141	Bacteria	9218857
1394	8019630524	8019629233	Bacteria	8687553
1395	8019652851	8019648815	Bacteria	10014479
1396	8019667352	8019659431	Bacteria	8577854
1397	8019677123	8019668869	Bacteria	8791617
1398	8019678858	8019678201	Bacteria	8863603
1399	8019696675	8019687851	Bacteria	8712826
1400	8055751030	8055742211	Bacteria	9226248
1401	8056676220	8056673599	Bacteria	7871253
1402	8056685139	8056681323	Bacteria	8472857
1403	8056693897	8056689827	Bacteria	6712655
1404	8056970944	8056967851	Bacteria	9038162
1405	JGI25406J46586_10000025
1406	JGI25406J46586_10010961
1407	JGI25406J46586_10132483
1408	JGI25153J46596_10001053
1409	JGI25153J46596_10016554
1410	JGI25153J46596_10020907
1411	JGI25160J50197_1004345
1412	JGI25160J50197_1011973
1413	JGI25160J50197_1021190
1414	JGI25404J52841_10001282
1415	Ga0055539_1003255
1416	Ga0055525_1010540
1417	Ga0055526_1029414
1418	Ga0055534_1000094
1419	Ga0055528_1000142
1420	Ga0055528_1000250
1421	Ga0055531_10007752
1422	Ga0055543_1003112
1423	Ga0065165_1003397
1424	Ga0065165_1004811
1425	Ga0065165_1023284
1426	Ga0065165_1071404
1427	Ga0070658_10033728
1428	Ga0070658_10036587
1429	Ga0070658_10149741
1430	Ga0070683_100127352
1431	Ga0070683_100250389
1432	Ga0070690_100617136
1433	Ga0068869_100062208
1434	Ga0068869_100256481
1435	Ga0070666_10290257
1436	Ga0070680_100008965
1437	Ga0070680_100074183
1438	Ga0070680_100404389
1439	Ga0068868_100099853
1440	Ga0070660_100073554
1441	Ga0070660_100277718
1442	Ga0070689_100073045
1443	Ga0070689_100360974
1444	Ga0070691_10284048
1445	Ga0070661_100041392
1446	Ga0070661_100162152
1447	Ga0070661_100397745
1448	Ga0070668_100051686
1449	Ga0070668_100148217
1450	Ga0070668_100194982
1451	Ga0070668_100239198
1452	Ga0070668_100391115
1453	Ga0070675_100094521
1454	Ga0070675_100142571
1455	Ga0070675_100922895
1456	Ga0070671_100047693
1457	Ga0070671_100066427
1458	Ga0070671_100225302
1459	Ga0070673_100410038
1460	Ga0070688_100454941
1461	Ga0070659_100237923
1462	Ga0070659_100292168
1463	Ga0070659_100624434
1464	Ga0070667_100164065
1465	Ga0070667_100799659
1466	Ga0070703_10024476
1467	Ga0070709_10013501
1468	Ga0070709_10158863
1469	Ga0070714_100056350
1470	Ga0070714_100060536
1471	Ga0070714_100067441
1472	Ga0070714_100355004
1473	Ga0070714_100681874
1474	Ga0070713_100001063
1475	Ga0070713_100014027
1476	Ga0070713_100264199
1477	Ga0070713_100281162
1478	Ga0070713_100440119
1479	Ga0070710_10000458
1480	Ga0070710_10004438
1481	Ga0070710_10020793
1482	Ga0070710_10042114
1483	Ga0070710_10059402
1484	Ga0070711_100000499
1485	Ga0070711_100007555
1486	Ga0070711_100020804
1487	Ga0070711_100077989
1488	Ga0070711_100118634
1489	Ga0070711_100243373
1490	Ga0070700_100246792
1491	Ga0070700_100302792
1492	Ga0070663_100035716
1493	Ga0070663_100036779
1494	Ga0070663_100065282
1495	Ga0070663_100066201
1496	Ga0070663_100068026
1497	Ga0070678_100116614
1498	Ga0070678_100126432
1499	Ga0070678_100127931
1500	Ga0070678_100142650
1501	Ga0070678_100201108
1502	Ga0070678_100951070
1503	Ga0070662_100092212
1504	Ga0070681_10009022
1505	Ga0070681_10081803
1506	Ga0070681_10338749
1507	Ga0070685_10330526
1508	Ga0070706_100083478
1509	Ga0070706_100398660
1510	Ga0070707_100449771
1511	Ga0070707_100774873
1512	Ga0070698_100016263
1513	Ga0070679_100040380
1514	Ga0070679_100181092
1515	Ga0070679_100393614
1516	Ga0070679_100471621
1517	Ga0070684_100010374
1518	Ga0070684_100157494
1519	Ga0068853_100268239
1520	Ga0068853_100438746
1521	Ga0068853_100460594
1522	Ga0068853_100506903
1523	Ga0068853_100714228
1524	Ga0070672_100166614
1525	Ga0070672_100332529
1526	Ga0070696_100744969
1527	Ga0070665_100023082
1528	Ga0070665_100053972
1529	Ga0070665_100111786
1530	Ga0070665_100116106
1531	Ga0070665_100141103
1532	Ga0070665_100160566
1533	Ga0070665_100315437
1534	Ga0070665_100316988
1535	Ga0070665_100410436
1536	Ga0070665_100541858
1537	Ga0068855_100146605
1538	Ga0068855_100161385
1539	Ga0068855_100421131
1540	Ga0070664_100071597
1541	Ga0070664_100085149
1542	Ga0070664_100891991
1543	Ga0070664_101047009
1544	Ga0068857_100028158
1545	Ga0068854_100224868
1546	Ga0068854_100914822
1547	Ga0068856_100002906
1548	Ga0068856_100153047
1549	Ga0068856_100226390
1550	Ga0068856_100274008
1551	Ga0068856_100582914
1552	Ga0070702_100241858
1553	Ga0070702_100266288
1554	Ga0068852_100042821
1555	Ga0068852_100177828
1556	Ga0068852_100198323
1557	Ga0068852_100504080
1558	Ga0068859_100713811
1559	Ga0068859_100741304
1560	Ga0068864_100068431
1561	Ga0068864_100450296
1562	Ga0068864_100571637
1563	Ga0068866_10202591
1564	Ga0068861_100573195
1565	Ga0068851_10022504
1566	Ga0068863_100200056
1567	Ga0068858_100084643
1568	Ga0068858_100119361
1569	Ga0068858_100120366
1570	Ga0068858_100299896
1571	Ga0068858_100321724
1572	Ga0068858_100381042
1573	Ga0068858_100820655
1574	Ga0068860_100217281
1575	Ga0068860_100536810
1576	Ga0068862_100070510
1577	Ga0068862_100600537
1578	Ga0068862_100714893
1579	Ga0068862_100807154
1580	Ga0081455_10003943
1581	Ga0081455_10070113
1582	Ga0081455_10153403
1583	Ga0081455_10379606
1584	Ga0081538_10042894
1585	Ga0081540_1000015
1586	Ga0081540_1004052
1587	Ga0081540_1008988
1588	Ga0081540_1010119
1589	Ga0081540_1012837
1590	Ga0081540_1013121
1591	Ga0081540_1019585
1592	Ga0081540_1028524
1593	Ga0081540_1030614
1594	Ga0081540_1038250
1595	Ga0081540_1039520
1596	Ga0081540_1056782
1597	Ga0081540_1086965
1598	Ga0081539_10000008
1599	Ga0081539_10000530
1600	Ga0081539_10028987
1601	Ga0081539_10070606
1602	Ga0081539_10074597
1603	Ga0070717_10002595
1604	Ga0070717_10047906
1605	Ga0070717_10262564
1606	Ga0070717_10773961
1607	Ga0075365_10010504
1608	Ga0075365_10017471
1609	Ga0075365_10118092
1610	Ga0075365_10229250
1611	Ga0075365_10290822
1612	Ga0075368_10100146
1613	Ga0075363_100026828
1614	Ga0075363_100035917
1615	Ga0075363_100096828
1616	Ga0075363_100394456
1617	Ga0075364_10085804
1618	Ga0075364_10204469
1619	Ga0070715_10251562
1620	Ga0070716_100026054
1621	Ga0070716_100147789
1622	Ga0070716_100180002
1623	Ga0070712_100021181
1624	Ga0070712_100253372
1625	Ga0070712_100271612
1626	Ga0070712_100485527
1627	Ga0075362_10084204
1628	Ga0075367_10021457
1629	Ga0075367_10157503
1630	Ga0075367_10227988
1631	Ga0075369_10092669
1632	Ga0075366_10000023
1633	Ga0075366_10182645
1634	Ga0075366_10309552
1635	Ga0097621_100165195
1636	Ga0097621_100304830
1637	Ga0075370_10000023
1638	Ga0075370_10003134
1639	Ga0075370_10024771
1640	Ga0075370_10128884
1641	Ga0068871_100029883
1642	Ga0068871_100272184
1643	Ga0068871_100605680
1644	Ga0075434_100008452
1645	Ga0068865_100120736
1646	Ga0068865_100540866
1647	Ga0075436_100056188
1648	Ga0097620_100713765
1649	Ga0097620_100741294
1650	Ga0099824_1017101
1651	Ga0099824_1019222
1652	Ga0099822_1011516
1653	Ga0099823_1104300
1654	Ga0099826_10016291
1655	Ga0075435_100074540
1656	Ga0075435_100088748
1657	Ga0099794_10042126
1658	Ga0099795_10155218
1659	Ga0105240_10010123
1660	Ga0105240_10414541
1661	Ga0105245_10135070
1662	Ga0105245_10159148
1663	Ga0105245_10256808
1664	Ga0105245_10326889
1665	Ga0105245_10349788
1666	Ga0105245_10480999
1667	Ga0105245_11028288
1668	Ga0105247_10017045
1669	Ga0105247_10052139
1670	Ga0105247_10157406
1671	Ga0105247_10320858
1672	Ga0105247_10692221
1673	Ga0114129_10656266
1674	Ga0114129_11654203
1675	Ga0105243_10013471
1676	Ga0105243_10181495
1677	Ga0105243_10448895
1678	Ga0105243_10529985
1679	Ga0105241_10065113
1680	Ga0105241_10104638
1681	Ga0105241_10366909
1682	Ga0105242_10115826
1683	Ga0105242_10302078
1684	Ga0105242_10631241
1685	Ga0105248_10075179
1686	Ga0105248_10106225
1687	Ga0105248_10121596
1688	Ga0105248_10225347
1689	Ga0105248_10431490
1690	Ga0105237_10005288
1691	Ga0105237_10074630
1692	Ga0105237_10083668
1693	Ga0105237_10103378
1694	Ga0105237_10149913
1695	Ga0105238_10057156
1696	Ga0105238_10111543
1697	Ga0105238_10190524
1698	Ga0105249_10188215
1699	Ga0105249_10198248
1700	Ga0105249_10294700
1701	Ga0105249_10572235
1702	Ga0105249_10665860
1703	Ga0099796_10018443
1704	Ga0105239_10039127
1705	Ga0105239_10049788
1706	Ga0105239_10082390
1707	Ga0105239_10109820
1708	Ga0105239_10125184
1709	Ga0105239_10247717
1710	Ga0105239_10392916
1711	Ga0105239_10778131
1712	Ga0105246_10143147
1713	Ga0105246_10195675
1714	Ga0105246_10307535
1715	Ga0157370_10217600
1716	Ga0157370_10482604
1717	Ga0157369_10027626
1718	Ga0157369_10049227
1719	Ga0157369_10063445
1720	Ga0157369_10412349
1721	Ga0157369_11193315
1722	Ga0157374_10020186
1723	Ga0157374_10185598
1724	Ga0157378_10014275
1725	Ga0157378_10252906
1726	Ga0163162_10140419
1727	Ga0163162_10352815
1728	Ga0163162_10370866
1729	Ga0163162_10462423
1730	Ga0163162_10848997
1731	Ga0157372_10138210
1732	Ga0157372_10227784
1733	Ga0157375_10029602
1734	Ga0157375_10395172
1735	Ga0157375_10524106
1736	Ga0157375_10617344
1737	Ga0163163_10075351
1738	Ga0163163_10338941
1739	Ga0163163_10464349
1740	Ga0163163_11484716
1741	Ga0157380_10920152
1742	Ga0157379_10136035
1743	Ga0157379_10268711
1744	Ga0157379_10444901
1745	Ga0157376_10019063
1746	Ga0157376_11155923
1747	Ga0163161_10132090
1748	Ga0163161_10315351
1749	Ga0214544_1000003
1750	Ga0214544_1019965
1751	Ga0214544_1031334
1752	Ga0214544_1038656
1753	Ga0214542_1000003
1754	Ga0214542_1022248
1755	Ga0214542_1033171
1756	Ga0214545_1000004
1757	Ga0214545_1022952
1758	Ga0214543_1000007
1759	Ga0214543_1044168
1760	Ga0213873_10009214
1761	Ga0213872_10066397
1762	Ga0213876_10001238
1763	Ga0213876_10060050
1764	Ga0213875_10024057
1765	Ga0209563_100880
1766	Ga0209677_100335
1767	Ga0209148_1000568
1768	Ga0209233_1012885
1769	Ga0209565_1000025
1770	Ga0207666_1027221
1771	Ga0209455_1001135
1772	Ga0209455_1002774
1773	Ga0209455_1003205
1774	Ga0209455_1005900
1775	Ga0209673_1000149
1776	Ga0209675_1000017
1777	Ga0209025_1031786
1778	Ga0209564_1006569
1779	Ga0209564_1012806
1780	Ga0209758_1000015
1781	Ga0209758_1000224
1782	Ga0209758_1000692
1783	Ga0209758_1001077
1784	Ga0209758_1014765
1785	Ga0209758_1019686
1786	Ga0209758_1024622
1787	Ga0207426_1000201
1788	Ga0207426_1001489
1789	Ga0207426_1023255
1790	Ga0209051_1027890
1791	Ga0209257_1000440
1792	Ga0209257_1018309
1793	Ga0209257_1032572
1794	Ga0207697_10014252
1795	Ga0207697_10077047
1796	Ga0207656_10059917
1797	Ga0207656_10148966
1798	Ga0207656_10237093
1799	Ga0207692_10011784
1800	Ga0207692_10036061
1801	Ga0207692_10042229
1802	Ga0207642_10047384
1803	Ga0207642_10094416
1804	Ga0207710_10005790
1805	Ga0207710_10118834
1806	Ga0207688_10208858
1807	Ga0207647_10197252
1808	Ga0207699_10006426
1809	Ga0207699_10016966
1810	Ga0207699_10085943
1811	Ga0207699_10104530
1812	Ga0207699_10125542
1813	Ga0207645_10161367
1814	Ga0207643_10091034
1815	Ga0207705_10072712
1816	Ga0207684_10104872
1817	Ga0207654_10011536
1818	Ga0207654_10053517
1819	Ga0207707_10000873
1820	Ga0207707_10006005
1821	Ga0207707_10006066
1822	Ga0207707_10048813
1823	Ga0207707_10582495
1824	Ga0207695_10000065
1825	Ga0207695_10132919
1826	Ga0207695_10291309
1827	Ga0207671_10013839
1828	Ga0207671_10100385
1829	Ga0207671_10137973
1830	Ga0207671_10156401
1831	Ga0207671_10157022
1832	Ga0207671_10162140
1833	Ga0207671_10359817
1834	Ga0207693_10035489
1835	Ga0207693_10039039
1836	Ga0207693_10070880
1837	Ga0207693_10098402
1838	Ga0207663_10000278
1839	Ga0207663_10003708
1840	Ga0207663_10051506
1841	Ga0207663_10221792
1842	Ga0207660_10043100
1843	Ga0207660_10133702
1844	Ga0207660_10168777
1845	Ga0207660_10364011
1846	Ga0207657_10039812
1847	Ga0207657_10052465
1848	Ga0207657_10341560
1849	Ga0207649_10062092
1850	Ga0207649_10205473
1851	Ga0207649_10214277
1852	Ga0207652_10002442
1853	Ga0207652_10059511
1854	Ga0207652_10160785
1855	Ga0207652_10233016
1856	Ga0207652_10441373
1857	Ga0207652_10578699
1858	Ga0207652_10917231
1859	Ga0207646_10254550
1860	Ga0207646_10680941
1861	Ga0207681_10225075
1862	Ga0207694_10496859
1863	Ga0207694_10556637
1864	Ga0207694_10825716
1865	Ga0207650_10343264
1866	Ga0207659_10426074
1867	Ga0207659_10989873
1868	Ga0207687_10087321
1869	Ga0207687_10153588
1870	Ga0207700_10025859
1871	Ga0207700_10034244
1872	Ga0207700_10061310
1873	Ga0207700_10178416
1874	Ga0207700_10366018
1875	Ga0207700_10972786
1876	Ga0207664_10031129
1877	Ga0207664_10061495
1878	Ga0207664_10118227
1879	Ga0207664_10131534
1880	Ga0207664_10421336
1881	Ga0207644_10728985
1882	Ga0207690_10114196
1883	Ga0207690_10392964
1884	Ga0207706_10079239
1885	Ga0207706_10094495
1886	Ga0207686_10090218
1887	Ga0207709_10024513
1888	Ga0207709_10060326
1889	Ga0207670_10379301
1890	Ga0207669_10012547
1891	Ga0207704_10400100
1892	Ga0207704_10499804
1893	Ga0207665_10001998
1894	Ga0207665_10035117
1895	Ga0207665_10067070
1896	Ga0207665_10188922
1897	Ga0207665_10194807
1898	Ga0207665_10685840
1899	Ga0207691_10137665
1900	Ga0207691_10166037
1901	Ga0207691_10583721
1902	Ga0207711_10277784
1903	Ga0207689_10072810
1904	Ga0207661_10001746
1905	Ga0207661_10008300
1906	Ga0207661_10068495
1907	Ga0207661_10346905
1908	Ga0207679_10096264
1909	Ga0207679_10365292
1910	Ga0207679_10473550
1911	Ga0207679_10493105
1912	Ga0207679_10877441
1913	Ga0207667_10026352
1914	Ga0207667_10161055
1915	Ga0207667_10340578
1916	Ga0207667_10351422
1917	Ga0207667_10401648
1918	Ga0207667_10549192
1919	Ga0207712_10148836
1920	Ga0207712_10336448
1921	Ga0207668_10023696
1922	Ga0207668_10041225
1923	Ga0207668_10349746
1924	Ga0207668_10628666
1925	Ga0207640_10124301
1926	Ga0207640_10148229
1927	Ga0207640_10635864
1928	Ga0207658_10550562
1929	Ga0207677_10259954
1930	Ga0207677_10748968
1931	Ga0207703_10031639
1932	Ga0207703_10069474
1933	Ga0207703_10087537
1934	Ga0207703_10796992
1935	Ga0207639_10042213
1936	Ga0207639_10101426
1937	Ga0207639_10224212
1938	Ga0207678_10037615
1939	Ga0207678_10043060
1940	Ga0207678_10049969
1941	Ga0207678_10178229
1942	Ga0207678_10193105
1943	Ga0207678_10230713
1944	Ga0207702_10000056
1945	Ga0207702_10080270
1946	Ga0207702_10563303
1947	Ga0207702_10621407
1948	Ga0207702_11114380
1949	Ga0207702_11374989
1950	Ga0207641_10165251
1951	Ga0207648_10238771
1952	Ga0207676_10127335
1953	Ga0207676_10325026
1954	Ga0207676_10714258
1955	Ga0207674_10039011
1956	Ga0207674_10052364
1957	Ga0207674_10184484
1958	Ga0207674_10543011
1959	Ga0207675_100235477
1960	Ga0207675_100737351
1961	Ga0207675_101019511
1962	Ga0207683_10057419
1963	Ga0207683_10063142
1964	Ga0207683_10090990
1965	Ga0207683_10436621
1966	Ga0207683_10455812
1967	Ga0207698_10027914
1968	Ga0207698_10132246
1969	Ga0207698_10811650
1970	Ga0209389_1000029
1971	Ga0209389_1000064
1972	Ga0209589_1000012
1973	Ga0209589_1000013
1974	Ga0209589_1000017
1975	Ga0209489_100013
1976	Ga0209489_100018
1977	Ga0209489_104185
1978	Ga0209700_100014
1979	Ga0209700_100028
1980	Ga0209282_1010452
1981	Ga0209588_1008391
1982	Ga0268266_10001379
1983	Ga0268266_10024483
1984	Ga0268266_10027336
1985	Ga0268266_10096456
1986	Ga0268266_10151639
1987	Ga0268266_10249348
1988	Ga0268265_10133584
1989	Ga0268265_10175847
1990	Ga0265337_1001016
1991	Ga0265326_10009519
1992	Ga0265319_1006520
1993	Ga0265334_10000616
1994	Ga0265318_10006486
1995	Ga0265323_10000037
1996	Ga0265336_10011252
1997	Ga0307517_10002211
1998	Ga0307515_10058001
1999	Ga0265338_10000024
2000	Ga0265324_10005335
2001	Ga0307511_10155000
2002	Ga0265329_10017015
2003	Ga0265340_10011711
2004	Ga0265340_10049472
2005	Ga0265339_10000755
2006	Ga0265331_10001816
2007	Ga0265327_10000020
2008	Ga0265327_10000617
2009	Ga0307509_10067379
2010	Ga0307509_10140316
2011	Ga0307509_10488932
2012	Ga0307408_100105115
2013	Ga0307508_10000005
2014	Ga0307508_10178363
2015	Ga0307508_10230929
2016	Ga0265314_10003561
2017	Ga0265314_10020860
2018	Ga0307516_10003435
2019	Ga0307516_10015603
2020	Ga0307516_10169597
2021	Ga0307516_10250631
2022	Ga0307412_10293773
2023	Ga0307412_10516351
2024	Ga0307412_10680704
2025	Ga0307416_100077379
2026	Ga0307416_100099112
2027	Ga0307416_100126407
2028	Ga0307414_10285595
2029	Ga0307507_10016859
2030	Ga0307510_10010762
2031	Ga0307510_10012252
2032	Ga0307510_10031633
2033	Ga0307510_10034639
2034	Ga0307510_10051910
2035	Ga0307510_10139657
2036	Ga0307510_10257585
2037	Ga0315911_1000018
2038	Ga0373934_0015334
2039	Ga0373923_0000901
2040	Ga0373923_0017500
2041	Ga0373932_0113484
2042	Ga0373936_0085468
2043	Ga0373936_0115070
2044	Ga0373953_0012429
2045	Ga0373954_0109618
2046	Ga0373954_0208082
2047	Ga0373956_0003778
2048	Ga0373956_0004893
2049	Ga0373957_0010485
2050	Ga0373943_0002441
2051	Ga0373943_0050195
2052	Ga0373943_0100012
2053	Ga0373946_0007827
2054	Ga0373946_0027452
2055	Ga0373955_0000389
2056	Ga0373955_0018503
2057	Ga0373955_0116979
2058	Ga0373962_0046697
2059	Ga0373924_0092436
2060	Ga0373935_0000658
2061	Ga0373935_0161605
2062	Ga0373935_0593728
2063	Ga0373927_0000560
2064	Ga0373927_0015311
2065	Ga0373927_0020229
2066	Ga0373927_0048036
2067	Ga0373927_0056843
2068	Ga0373927_0067249
2069	Ga0373927_0228157
2070	Ga0373933_0005146
2071	Ga0373933_0258220
2072	Ga0373947_0000855
2073	Ga0373947_0011670
2074	Ga0373947_0026426
2075	Ga0373947_0230316
2076	Ga0373937_0002280
2077	Ga0373937_0040270
2078	Ga0373925_0001497
2079	Ga0373925_0082489
2080	Ga0373925_0275322
2081	Ga0373925_0689411
2082	Ga0395899_0452146
2083	Ga0395900_0000909
2084	Ga0395900_0093472
2085	Ga0395900_0115379
2086	Ga0395900_0174764
2087	Ga0395900_0306068
2088	Ga0395898_0003767
2089	Ga0395898_0004788
2090	Ga0395898_0039866
2091	Ga0395898_0143599
2092	Ga0395898_0171086
2093	Ga0395898_0524308
2094	Ga0395905_0001674
2095	Ga0395905_0051943
2096	Ga0395905_0195571
2097	Ga0395905_0328443
2098	Ga0395905_0623463
2099	Ga0436364_1193931
2100	Ga0436364_1234877
2101	Ga0395901_0012230
2102	Ga0395901_0046449
2103	Ga0395901_0134222
2104	Ga0395901_0143865
2105	Ga0395901_0158627
2106	Ga0395901_0483680
2107	Ga0436365_0040127
2108	Ga0436365_0354234
2109	Ga0436365_0650112
2110	Ga0436365_1456038
2111	Ga0436360_0141248
2112	Ga0436360_1343314
2113	Ga0436361_0066472
2114	Ga0436361_0506647
2115	Ga0436363_0541254
2116	Ga0436363_0829483
2117	Ga0436362_0334157
2118	Ga0436362_0730562
2119	Ga0439465_0041751
2120	Ga0451793_1703391
2121	Ga0451802_2192171
2122	Ga0451839_1447752
2123	Ga0451841_1210968
2124	Ga0450923_029380
2125	Ga0439446_0127149
2126	Ga0439434_0057598
2127	Ga0450918_000038
2128	Ga0466969_0018084
2129	Ga0466972_0000103
2130	Ga0466972_0108133
2131	Ga0466965_0097072
2132	Ga0466966_0000378
2133	Ga0466966_0165474
2134	Ga0466961_0000129
2135	Ga0466963_0114080
2136	Ga0466964_0039507
2137	Ga0466964_0042069
2138	Ga0466964_0175269
2139	Ga0466971_0030424
2140	Ga0466971_0268568
2141	Ga0466968_0009433
2142	Ga0466968_0043478
2143	Ga0466957_0230456
2144	Ga0466960_0015239
2145	Ga0466959_0009787
2146	Ga0466967_0316448
2147	Ga0495592_0002709
2148	Ga0495592_0004892
2149	Ga0495592_0081621
2150	Ga0495603_0000096
2151	Ga0495603_0030875
2152	Ga0495603_0042126
2153	Ga0495629_0000198
2154	Ga0495629_0000250
2155	Ga0495629_0007416
2156	Ga0495638_0000170
2157	Ga0495638_0001355
2158	Ga0495638_0345815
2159	Ga0495641_0006863
2160	Ga0495651_0022320
2161	Ga0495651_0079051
2162	Ga0495653_0013767
2163	Ga0495653_0154436
2164	Ga0495650_0009560
2165	Ga0495650_0063097
2166	Ga0495580_0000536
2167	Ga0495580_0033871
2168	Ga0495580_0132946
2169	Ga0495580_0562270
2170	Ga0495582_0000021
2171	Ga0495582_0078205
2172	Ga0495582_0279664
2173	Ga0495605_0173885
2174	Ga0495605_0176283
2175	Ga0495639_0000030
2176	Ga0495639_0002759
2177	Ga0495639_0029736
2178	Ga0495639_0072987
2179	Ga0495662_0001107
2180	Ga0495662_0070847
2181	Ga0495664_0005671
2182	Ga0495664_0008001
2183	Ga0495664_0012522
2184	Ga0495594_0000814
2185	Ga0495594_0191211
2186	Ga0495583_0000952
2187	Ga0495606_0003362
2188	Ga0495606_0003804
2189	Ga0495606_0032539
2190	Ga0495608_0034133
2191	Ga0495608_0085855
2192	Ga0495610_0106214
2193	Ga0495616_0036694
2194	Ga0495616_0066146
2195	Ga0495616_0090848
2196	Ga0495618_0014009
2197	Ga0495618_0032517
2198	Ga0495618_0055467
2199	Ga0495618_0136664
2200	Ga0495620_0064506
2201	Ga0495628_0029466
2202	Ga0495628_0041533
2203	Ga0495628_0124863
2204	Ga0495630_0002807
2205	Ga0495630_0037283
2206	Ga0495630_0214820
2207	Ga0495631_0089520
2208	Ga0495631_0179487
2209	Ga0495631_0197736
2210	Ga0495631_0218003
2211	Ga0495637_0159272
2212	Ga0495643_0013930
2213	Ga0495643_0046013
2214	Ga0495643_0260869
2215	Ga0495644_0039328
2216	Ga0495644_0215376
2217	Ga0495648_0000751
2218	Ga0495642_0009278
2219	Ga0495652_0010027
2220	Ga0495652_0012614
2221	Ga0495652_0098050
2222	Ga0495652_0472114
2223	Ga0495665_0000066
2224	Ga0495665_0004296
2225	Ga0495640_0002445
2226	Ga0495640_0008110
2227	Ga0495640_0028982
2228	Ga0495640_0051218
2229	Ga0495587_0004510
2230	Ga0495587_0026435
2231	Ga0495609_0018491
2232	Ga0495597_0010157
2233	Ga0495645_0033889
2234	Ga0495645_0077499
2235	Ga0495645_0114702
2236	Ga0495622_0000531
2237	Ga0495622_0010188
2238	Ga0495622_0115428
2239	Ga0495622_0125363
2240	Ga0495633_0000663
2241	Ga0495633_0116342
2242	Ga0495667_0018582
2243	Ga0495667_0018671
2244	Ga0495667_0023780
2245	Ga0495656_0022069
2246	Ga0495656_0092992
2247	Ga0495668_0102440
2248	Ga0495668_0152121
2249	Ga0495634_0000336
2250	Ga0495634_0063617
2251	Ga0495634_0124782
2252	Ga0495611_0100496
2253	Ga0495611_0211182
2254	Ga0495625_0001377
2255	Ga0495625_0204710
2256	Ga0495625_0462777
2257	Ga0495635_0000235
2258	Ga0495635_0000318
2259	Ga0495659_0010937
2260	Ga0495661_0086188
2261	Ga0495588_0001810
2262	Ga0495657_0006114
2263	Ga0495657_0007151
2264	Ga0495657_0079743
2265	Ga0495599_0001987
2266	Ga0495599_0037617
2267	Ga0495599_0215398
2268	Ga0495599_0226741
2269	Ga0495623_0032407
2270	Ga0495623_0046142
2271	Ga0495646_0034954
2272	Ga0495646_0054587
2273	Ga0495646_0083887
2274	Ga0495647_0003479
2275	Ga0495658_0004834
2276	Ga0495658_0011635
2277	Ga0495669_0002066
2278	Ga0495669_0087106
2279	Ga0495624_0003187
2280	Ga0495624_0043224
2281	Ga0495624_0085106
2282	Ga0495624_0149734
2283	Ga0495624_0326067
2284	Ga0495670_0215260
2285	Ga0495671_0035874
2286	Ga0495671_0158253
2287	Ga0495671_0203165
2288	Ga0495671_0210406
2289	Ga0495671_0224475
2290	Ga0495649_0095841
2291	Ga0495649_0122384
2292	Ga0495589_0249806
2293	Ga0495600_0006925
2294	Ga0495600_0014452
2295	Ga0495600_0025067
2296	Ga0495660_0077589
2297	Ga0495581_0000047
2298	Ga0495581_0056744
2299	Ga0495581_0127837
2300	Ga0495604_0020320
2301	Ga0495604_0065053
2302	Ga0495604_0183110
2303	Ga0495674_0000101
2304	Ga0495674_0086078
2305	Ga0495674_0213843
2306	Ga0495672_0048823
2307	Ga0495672_0133445
2308	Ga0495676_0007477
2309	Ga0495676_0048707
2310	Ga0495680_0005196
2311	Ga0495680_0077698
2312	Ga0495687_002122
2313	Ga0495687_002238
2314	Ga0495687_016690
2315	Ga0495675_0001617
2316	Ga0495675_0012041
2317	Ga0495675_0043083
2318	Ga0495675_0234742
2319	Ga0495679_032566
2320	Ga0495673_0006973
2321	Ga0495684_0020800
2322	Ga0495684_0111648
2323	Ga0495684_0214914
2324	Ga0495684_0360027
2325	Ga0495686_0098453
2326	Ga0495593_0000466
2327	Ga0495593_0003308
2328	Ga0495593_0067430
2329	Ga0495593_0096606
2330	Ga0495602_0078638
2331	Ga0495602_0147187
2332	Ga0495615_0019536
2333	Ga0496100_0089483
2334	Ga0496100_0099690
2335	Ga0496100_0164084
2336	Ga0496101_0030930
2337	Ga0496101_0078897
2338	Ga0496101_0094327
2339	Ga0496101_0394634
2340	Ga0496101_0500030
2341	Ga0496102_0009570
2342	Ga0496102_0448613
2343	Ga0496102_0464594
2344	Ga0496102_0493538
2345	Ga0496104_0009588
2346	Ga0496104_0027346
2347	Ga0496104_0114150
2348	Ga0496104_0621880
2349	Ga0496105_0001253
2350	Ga0496105_0024978
2351	Ga0496105_0109654
2352	Ga0496105_0354648
2353	Ga0496106_0001870
2354	Ga0496106_0028692
2355	Ga0496106_0125374
2356	Ga0496106_0551447
2357	Ga0496106_0560424
2358	Ga0496107_0017305
2359	Ga0496107_0121658
2360	Ga0496108_0005991
2361	Ga0496108_0044916
2362	Ga0496108_0086823
2363	Ga0496108_0264081
2364	Ga0496109_0018637
2365	Ga0496109_0083691
2366	Ga0496109_0300902
2367	Ga0496109_0320622
2368	Ga0496109_0469357
2369	Ga0496110_0027411
2370	Ga0496110_0330839
2371	Ga0496110_0930010
2372	Ga0496110_1048650
2373	Ga0496111_0118125
2374	Ga0496111_0133940
2375	Ga0496111_0483769
2376	Ga0496111_0556014
2377	Ga0496111_0621664
2378	Ga0496111_0646093
2379	Ga0496112_0000008
2380	Ga0496112_0015989
2381	Ga0496112_0052125
2382	Ga0496112_0055750
2383	Ga0496112_0109960
2384	Ga0496112_0458935
2385	Ga0496112_0681401
2386	Ga0496113_0016980
2387	Ga0496113_0134853
2388	Ga0496113_0184359
2389	Ga0496114_0031036
2390	Ga0496114_0165682
2391	Ga0496114_0168224
2392	Ga0496114_0195633
2393	Ga0496114_0338774
2394	Ga0496115_0004351
2395	Ga0496115_0022604
2396	Ga0496115_0068161
2397	Ga0496115_0122842
2398	Ga0496115_0232668
2399	Ga0496115_0587311
2400	Ga0496116_0049090
2401	Ga0496116_0342855
2402	Ga0496118_0005557
2403	Ga0496118_0010500
2404	Ga0496118_0294187
2405	Ga0496119_0013508
2406	Ga0496120_0008859
2407	Ga0496120_0062629
2408	Ga0496121_0000194
2409	Ga0496121_0000716
2410	Ga0496121_0012296
2411	Ga0496121_0038962
2412	Ga0496121_0064181
2413	Ga0496121_0092266
2414	Ga0496121_0138712
2415	Ga0496121_0574394
2416	Ga0496122_0053225
2417	Ga0496122_0124083
2418	Ga0496122_0324937
2419	Ga0496124_0001529
2420	Ga0496124_0171268
2421	Ga0496124_0204198
2422	Ga0496124_0362207
2423	Ga0496125_0084491
2424	Ga0496125_0118962
2425	Ga0496125_0124424
2426	Ga0496125_0147576
2427	Ga0496125_0235014
2428	Ga0496126_0012633
2429	Ga0496126_0016855
2430	Ga0496126_0027262
2431	Ga0496126_0035700
2432	Ga0496126_0056813
2433	Ga0496126_0113840
2434	Ga0496126_0349337
2435	Ga0495678_015852
2436	Ga0495678_037686
2437	Ga0501031_0007226
2438	Ga0501032_0000305
2439	Ga0501033_0000139
2440	Ga0501034_0004098
2441	Ga0501036_0000150
2442	Ga0501036_0554371
2443	Ga0501037_0000026
2444	Ga0501038_0000582
2445	Ga0501038_0435933
2446	Ga0501039_0000245
2447	Ga0501040_0000108
2448	Ga0501042_0001901
2449	Ga0501043_0000770
2450	Ga0501046_0000915
2451	Ga0501047_0000806
2452	Ga0501047_0256345
2453	Ga0501048_0028317
2454	Ga0501067_0028596
2455	Ga0501068_0023378
2456	Ga0501069_0015066
2457	Ga0501069_0098537
2458	Ga0501070_0000130
2459	Ga0501070_0022799
2460	Ga0501072_0031983
2461	Ga0501073_0023398
2462	Ga0501074_0005223
2463	Ga0501076_0079586
2464	Ga0501079_0089450
2465	Ga0501080_0001034
2466	Ga0501080_0115516
2467	Ga0501035_0000403
2468	Ga0501035_0289478
2469	Ga0501035_0468450
2470	Ga0501044_0000475
2471	Ga0501044_0053014
2472	Ga0501044_0348572
2473	Ga0501045_0013457
2474	nmdc:mga03683_10292_c2
2475	nmdc:mga03683_14_c1
2476	nmdc:mga03n38_17330_c1
2477	nmdc:mga03n38_181517_c1
2478	nmdc:mga00v17_187885_c1
2479	nmdc:mga00v17_67802_c1
2480	nmdc:mga00v17_7354_c1
2481	nmdc:mga0yw44_200149_c1
2482	nmdc:mga0yw44_32014_c1
2483	nmdc:mga0yw44_66862_c2
2484	nmdc:mga0yw44_82435_c1
2485	nmdc:mga0k408_25_c1
2486	nmdc:mga0k408_31706_c1
2487	nmdc:mga06z11_31203_c1
2488	nmdc:mga06z11_69145_c1
2489	nmdc:mga06z11_93702_c1
2490	nmdc:mga07m45_48866_c2
2491	nmdc:mga07m45_5124_c1
2492	nmdc:mga07m45_8_c1
2493	nmdc:mga05p37_228422_c1
2494	nmdc:mga09592_386122_c1
2495	nmdc:mga0n895_6061_c1
2496	nmdc:mga0n895_667211_c1
2497	nmdc:mga0n895_978150_c1
2498	nmdc:mga0rr50_187966_c1
2499	nmdc:mga0rr50_237762_c1
2500	nmdc:mga0rr50_76385_c1
2501	nmdc:mga0sz30_311_c1
2502	nmdc:mga0sz30_56796_c2
2503	Ga0495601_0154422
2504	Ga0495601_0336794
2505	Ga0495612_0020357
2506	Ga0495612_0024669
2507	Ga0495612_0077194
2508	Ga0500635_0051939
2509	Ga0500635_0075373
2510	Ga0495655_0004205
2511	Ga0495595_0025885
2512	Ga0495595_0247693
2513	Ga0495619_0015721
2514	Ga0495619_0028950
2515	Ga0495619_0157215
2516	Ga0495619_0379247
2517	Ga0500643_000062
2518	Ga0500647_0030103
2519	Ga0500583_0051279
2520	Ga0500566_0000065
2521	Ga0500566_0000364
2522	Ga0500566_0015975
2523	Ga0500640_038185
2524	Ga0500641_0019142
2525	Ga0500554_024471
2526	Ga0500555_000950
2527	Ga0500556_0016277
2528	Ga0500557_000073
2529	Ga0500569_009375
2530	Ga0500572_000160
2531	Ga0500572_021242
2532	Ga0500572_045491
2533	Ga0500594_0022587
2534	Ga0500594_0083925
2535	Ga0500595_003091
2536	Ga0500595_013168
2537	Ga0500607_094030
2538	Ga0500608_184624
2539	Ga0500621_126707
2540	Ga0500642_0000434
2541	Ga0500642_0191341
2542	Ga0500655_017792
2543	Ga0500655_046241
2544	Ga0500658_0032986
2545	Ga0500559_0000211
2546	Ga0500559_0002662
2547	Ga0500559_0039563
2548	Ga0500561_0054107
2549	Ga0500564_123327
2550	Ga0500568_0041062
2551	Ga0500568_0094897
2552	Ga0500577_0085237
2553	Ga0500588_0099710
2554	Ga0500588_0132354
2555	Ga0500590_006954
2556	Ga0500590_188996
2557	Ga0500603_000437
2558	Ga0500603_020943
2559	Ga0500603_025105
2560	Ga0500603_081683
2561	Ga0500604_0053325
2562	Ga0500616_0000034
2563	Ga0500620_007175
2564	Ga0500622_0027334
2565	Ga0500627_0069644
2566	Ga0500638_003863
2567	Ga0500638_165894
2568	Ga0500638_184505
2569	Ga0500638_211549
2570	Ga0500639_117770
2571	Ga0500639_202512
2572	Ga0500636_0013818
2573	Ga0500636_0044781
2574	Ga0500636_0064099
2575	Ga0500637_0000467
2576	Ga0500637_0003942
2577	Ga0500637_0261120
2578	Ga0500625_011167
2579	Ga0500625_112752
2580	Ga0500645_046712
2581	Ga0500645_084180
2582	Ga0500609_013649
2583	Ga0500596_003501
2584	Ga0500661_026284
2585	8019640084
2586	2507504869
2587	2508546224
2588	2508695156
2589	2509149823
2590	2511398372
2591	2513626734
2592	2513639580
2593	2513647934
2594	2513658187
2595	2513694963
2596	2513702231
2597	2513715738
2598	2513860210
2599	2513873885
2600	2513889812
2601	2513920321
2602	2514012856
2603	2515625838
2604	2517102358
2605	2517889256
2606	2524435773
2607	2524472059
2608	2524536476
2609	2528851616
2610	2617351731
2611	2617374087
2612	2671121465
2613	2723841989
2614	2728754754
2615	2745079070
2616	2793063089
2617	2793073227
2618	2793077461
2619	2805915968
2620	2818237308
2621	2824602603
2622	2824612617
2623	2824621079
2624	2824630086
2625	2824637898
2626	2824646351
2627	2824654432
2628	2824664757
2629	2824674229
2630	2824682067
2631	2824690858
2632	2824697623
2633	2824710776
2634	2824719115
2635	2824726365
2636	2824735331
2637	2824749122
2638	2824757085
2639	2824768421
2640	2824774913
2641	2838124143
2642	2841944490
2643	2841951630
2644	2841966044
2645	2841969267
2646	2841980333
2647	2841985587
2648	2842043854
2649	2842052156
2650	2844321850
2651	2847931442
2652	2847941781
2653	2849082703
2654	2857511597
2655	2874596863
2656	2874610400
2657	2874617732
2658	2874624448
2659	2874636736
2660	2874648668
2661	2876769017
2662	2876777327
2663	2876825409
2664	2879077658
2665	2879087522
2666	2879107253
2667	2879111718
2668	2879128632
2669	2879143972
2670	2881370975
2671	2881665723
2672	2885371372
2673	2885376137
2674	2885389529
2675	2885415309
2676	2888379935
2677	2888391015
2678	2888420744
2679	2889035112
2680	2903727600
2681	2903755097
2682	2903774188
2683	2904672213
2684	2904695166
2685	2904709116
2686	2904716212
2687	2906602910
2688	2906613269
2689	2906633503
2690	2906635442
2691	2906649044
2692	2906668573
2693	2908747856
2694	2908756818
2695	2908776563
2696	2922363371
2697	2922378320
2698	2922388646
2699	2922396603
2700	2922433766
2701	2929622579
2702	2929631203
2703	2932786374
2704	2932794660
2705	2932805529
2706	2932812551
2707	2932822913
2708	2932829612
2709	2933584342
2710	2935614931
2711	2935618130
2712	2935634808
2713	2935641472
2714	2935652959
2715	2935661542
2716	2935669470
2717	2935677932
2718	2935689619
2719	2935701831
2720	2935707295
2721	2935717138
2722	2935730028
2723	2935738553
2724	2935749199
2725	2935756972
2726	2935764416
2727	2935772744
2728	2935778119
2729	2935787347
2730	2935795865
2731	2935804326
2732	2935815410
2733	2935826029
2734	2935831203
2735	2935841812
2736	2935851648
2737	2935856371
2738	2935866297
2739	2935874603
2740	2935890353
2741	2935910330
2742	2935918384
2743	2935927759
2744	2935936369
2745	2935944078
2746	2935952515
2747	2935962307
2748	2935969355
2749	2935977880
2750	2935984817
2751	2935994064
2752	2936004925
2753	2936015729
2754	2936024363
2755	2936031750
2756	2936045065
2757	2936051572
2758	2936055988
2759	2940562886
2760	2941511862
2761	2941519564
2762	2941527744
2763	2941532381
2764	2941543885
2765	2945972721
2766	3005475494
2767	3005509518
2768	3005592724
2769	3005602199
2770	3005717953
2771	3005724988
2772	8006932695
2773	8006935804
2774	8006968274
2775	8006975722
2776	8006985989
2777	8007002117
2778	8016518596
2779	8016526567
2780	8016531646
2781	8016544849
2782	8016569915
2783	8016582499
2784	8016586784
2785	8016603195
2786	8016617998
2787	8016623574
2788	8016636057
2789	8017058074
2790	8019531474
2791	8019540056
2792	8019562985
2793	8019573064
2794	8019577661
2795	8019595759
2796	8019606003
2797	8019622584
2798	8019630524
2799	8019652851
2800	8019667352
2801	8019677123
2802	8019678858
2803	8019696675
2804	8055751030
2805	8056676220
2806	8056685139
2807	8056693897
2808	8056970944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

68

0.93 PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

6

68

0.91 PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

1

75

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2dsa-assembly2.cif.gz_C	ternary complex of bphk, a bacterial gst	0.9056	3	204
4gci-assembly1.cif.gz_B	crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione, monoclinic form	0.8986	1	204
1n2a-assembly1.cif.gz_B	crystal structure of a bacterial glutathione transferase from escherichia coli with glutathione sulfonate in the active site	0.8968	3	203
1pmt-assembly1.cif.gz_A	glutathione transferase from proteus mirabilis	0.8943	3	203
2dsa-assembly2.cif.gz_C	ternary complex of bphk, a bacterial gst	0.8936	3	204

ID	Description	Score	Start	End	Superfamily
2dsaD02	Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;	0.8927	78	193	1.20.1050.10
af_P0A9D2_2_199_3.50.50.60	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.8927	4	203	3.50.50.60
1n2aB01	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.887	3	74	3.40.30.10
2dsaD02	Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;	0.8849	78	193	1.20.1050.10
2dsaA02	Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;	0.8848	78	193	1.20.1050.10

ID	Description	Score	Start	End	GO Terms
AF-A0A4Q5RZU6-F1-model_v4	Glutathione S-transferase family protein	0.9921	1	202	GO:0016740
AF-A0A839ZXC8-F1-model_v4	Glutathione S-transferase (EC 2.5.1.18)	0.9911	1	202	GO:0016740
AF-C5SZF4-F1-model_v4	Glutathione S-transferase domain-containing protein	0.9908	19	213	GO:0016740
AF-A0A2G6T304-F1-model_v4	Glutathione S-transferase	0.9898	1	215	GO:0016740
AF-A0A519GEW7-F1-model_v4	deleted	0.9894	1	215

F493712

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

68

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

6

68

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

1

75

0.86

Structural Annotation

Top 5 Hits

Map