metagRoot

F493702

General Info

Members	Datasets	Scaffolds	Average Seq Length
1403	781	2806	356

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2885305155\|2885305859
Length	410
Sequence	PRRYLRYSSSMARPEDRARGPEAQCAARPVAIASILGLALPAHRMPRRLTVRKYSIAAIPADGIGPEVIDAGITVLEVLAAQRGDLKLEFSLFDWGSNYYKRNGVMMPADGLERLRKFDAIYFGAVGAADVPDHVTLWGLRLQICQGFDQYANVRPTKILPGIASPLRDVRAGDLDWVIVRENSEGEYSGAGGRVHRGLPEEVGMDVSVFTRVGVERIIRYAYRLAQSRPRKLLTVVTKSNAQRHGMVMWDEIAENVSHEFPDVTWDKMLVDAMTVRMVLKPQSLDTIVATNLHADVLSDLAGALTGSLGIAPTANIDPERRFPSMFEPIHGSAFDIAGKGIANPIATFWTAVQMLSHLGEHGAADQLMRAIERAGEAGIMTPDVGGKATTRQVTEAVSNAIRGRNVLMG

Samples

	Sample ID	Description	Type	Environment
1	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
2	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
3	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
4	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
5	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
6	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
7	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
8	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
9	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
10	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
11	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
12	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
13	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
14	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
15	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
16	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
17	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
18	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
19	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
20	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
21	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
22	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
23	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
24	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
25	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
26	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
27	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
28	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
29	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
30	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
31	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
32	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
33	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
34	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
35	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
36	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
37	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
38	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
39	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
40	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
41	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
42	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
43	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
44	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
45	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
46	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
47	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
48	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
49	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
50	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
51	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
52	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
53	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
54	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
55	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
56	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
57	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
58	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
59	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
60	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
61	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
62	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
63	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
64	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
65	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
66	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
67	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
68	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
69	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
70	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
71	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
72	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
73	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
74	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
75	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
76	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
77	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
78	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
79	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
80	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
81	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
82	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
83	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
84	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
85	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
86	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
87	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
88	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
89	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
90	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
91	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
92	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
93	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
94	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
95	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
96	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
97	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
98	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
99	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
100	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
101	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
102	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
103	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
104	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
105	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
106	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
107	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
108	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
109	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
110	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
111	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
112	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
113	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
114	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
115	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
116	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
117	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
118	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
119	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
120	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
121	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
122	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
123	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
124	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
125	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
126	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
127	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
128	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
129	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
130	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
131	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
132	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
133	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
134	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
135	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
136	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
137	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
138	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
139	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
140	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
141	3300013250	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05	Metagenome	Rhizosphere
142	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
143	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
144	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
145	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
146	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
147	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
148	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
149	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
150	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
151	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
152	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
153	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
154	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
155	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
156	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
157	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
158	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
159	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
160	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
161	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
162	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
163	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
164	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
165	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
173	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
177	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
180	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
183	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
249	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
250	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
252	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
253	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
254	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
255	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
256	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
260	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
261	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
262	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
263	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
264	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
265	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
266	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
267	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
268	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
269	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
270	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
271	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
272	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
273	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
274	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
275	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
276	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
277	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
278	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
279	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
280	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
281	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
282	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
283	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
284	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
285	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
286	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
287	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
288	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
289	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
290	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
291	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
292	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
293	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
294	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
295	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
296	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
297	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
298	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
299	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
300	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
301	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
302	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
303	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
304	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
305	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
306	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
307	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
308	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
309	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
310	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
311	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
312	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
313	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
314	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
315	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
316	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
317	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
318	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
319	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
320	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
321	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
322	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
323	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
324	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
325	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
326	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
327	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
328	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
329	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
330	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
331	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
332	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
333	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
334	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
335	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
336	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
337	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
338	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
339	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
340	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
341	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
342	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
343	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
344	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
345	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
346	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
347	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
348	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
349	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
350	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
351	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
352	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
353	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
354	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
355	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
356	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
357	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
358	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
359	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
360	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
361	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
362	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
363	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
364	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
365	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
366	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
367	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
368	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
369	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
370	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
371	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
372	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
373	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
374	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
375	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
376	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
377	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
378	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
379	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
380	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
381	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
382	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
383	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
384	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
385	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
386	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
387	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
388	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
389	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
390	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
391	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
392	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
393	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
394	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
395	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
396	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
397	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
398	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
399	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
400	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
401	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
402	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
403	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
404	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
405	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
406	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
407	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
408	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
409	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
410	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
411	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
412	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
413	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
414	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
415	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
416	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
417	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
418	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
419	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
420	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
421	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
422	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
423	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
424	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
425	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
426	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
427	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
428	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
429	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
430	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
431	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
432	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
433	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
434	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
435	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
436	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
437	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
438	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
439	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
440	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
441	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
442	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
443	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
444	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
445	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
446	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
447	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
448	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
449	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
450	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
451	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
452	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
453	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
454	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
455	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
456	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
457	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
458	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
459	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
460	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
461	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
462	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
463	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
464	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
465	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
466	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
467	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
468	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
469	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
470	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
471	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
472	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
473	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
474	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
475	2885305155	Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1	Isolate	Nodule
476	2501025504	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
477	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
478	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
479	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
480	2508501050	Microvirga lupini Lut6	Isolate	Nodule
481	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
482	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
483	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
484	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
485	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
486	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
487	2510917014	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
488	2510917015	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
489	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
490	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
491	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
492	2512047030	Paraburkholderia tuberum STM678	Isolate	Nodule
493	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
494	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
495	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
496	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
497	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
498	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
499	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
500	2515154122	Paraburkholderia atlantica JPY251	Isolate	Nodule
501	2515154189	Paraburkholderia nodosa DSM 21604	Isolate	Unclassified
502	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
503	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
504	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
505	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
506	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
507	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
508	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
509	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
510	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
511	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
512	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
513	2595698237	Methylobacterium sp. UNCCL125	Isolate	Unclassified
514	2597489875	Mesorhizobium ciceri ca181	Isolate	Unclassified
515	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
516	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
517	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
518	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
519	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
520	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
521	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
522	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
523	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
524	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
525	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
526	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
527	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
528	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
529	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
530	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
531	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
532	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
533	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
534	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
535	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
536	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
537	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
538	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
539	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
540	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
541	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
542	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
543	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
544	2643221557	Ensifer sp. Root558	Isolate	Unclassified
545	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
546	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
547	2643221580	Devosia sp. Root635	Isolate	Unclassified
548	2643221610	Ensifer sp. Root74	Isolate	Unclassified
549	2643221627	Mesorhizobium sp. Root102	Isolate	Unclassified
550	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
551	2643221668	Ensifer sp. Root423	Isolate	Unclassified
552	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
553	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
554	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
555	2643221726	Ensifer sp. Root954	Isolate	Unclassified
556	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
557	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
558	2718217927	Rhizobium sp. N324	Isolate	Nodule
559	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
560	2718218423	Rhizobium sp. N941	Isolate	Nodule
561	2721755809	Rhizobium sp. N541	Isolate	Nodule
562	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
563	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
564	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
565	2744054900	Paraburkholderia ginsengiterrae DCY85-1	Isolate	Unclassified
566	2744054901	Paraburkholderia ginsengiterrae DCY85	Isolate	Unclassified
567	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
568	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
569	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
570	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
571	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
572	2791355199
573	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
574	2791355263	Rhizobium chutanense C5	Isolate	Nodule
575	2791355265	Rhizobium sp. H4	Isolate	Nodule
576	2791355266	Rhizobium sp. L43	Isolate	Nodule
577	2791355267	Rhizobium sp. L18	Isolate	Nodule
578	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
579	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
580	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
581	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
582	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
583	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
584	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
585	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
586	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
587	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
588	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
589	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
590	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
591	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
592	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
593	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
594	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
595	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
596	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
597	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
598	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
599	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
600	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
601	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
602	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
603	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
604	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
605	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
606	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
607	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
608	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
609	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
610	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
611	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
612	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
613	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
614	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
615	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
616	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
617	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
618	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
619	2842694124	Methylopila sp. R-72369	Isolate	Unclassified
620	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
621	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
622	2842775625	Roseomonas sp. R-71825	Isolate	Unclassified
623	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
624	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
625	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
626	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
627	2854681122	Luteovulum sphaeroides SCJ	Isolate	Unclassified
628	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
629	2856342000	Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1	Isolate	Nodule
630	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
631	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
632	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
633	2857591370	Brevibacillus sp. R-71934	Isolate	Unclassified
634	2858950400	Achromobacter sp. K91	Isolate	Unclassified
635	2861691609	Methylorubrum thiocyanatum DSM 11490	Isolate	Rhizosphere
636	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
637	2866612099	Amycolatopsis suaedae 8-3EHSu	Isolate	Unclassified
638	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
639	2871495908	Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1	Isolate	Nodule
640	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
641	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
642	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
643	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
644	2876377896	Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1	Isolate	Nodule
645	2876601092	Pantoea endophytica 596	Isolate	Unclassified
646	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
647	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
648	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
649	2878760144	Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1	Isolate	Nodule
650	2878767105	Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1	Isolate	Nodule
651	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
652	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
653	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
654	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
655	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
656	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
657	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
658	2881861095	Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2	Isolate	Nodule
659	2881927736	Candidimonas sp. SYP-B2681	Isolate	Rhizosphere
660	2883087390	Paraburkholderia guartelaensis CNPSo 3008	Isolate	Unclassified
661	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
662	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
663	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
664	2885326080	Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1	Isolate	Nodule
665	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
666	2887375801	Parapusillimonas sp. SGNA-6	Isolate	Rhizosphere
667	2888343758	Mesorhizobium sp. AA22	Isolate	Unclassified
668	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
669	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
670	2889306138	Methylobacterium sp. PvR107	Isolate	Rhizosphere
671	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
672	2899359706	Amycolatopsis anabasis EGI 650086	Isolate	Unclassified
673	2902682994	Paraburkholderia atlantica CNPSo 3155	Isolate	Unclassified
674	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
675	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
676	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
677	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
678	2904564687	Burkholderia sp. 571	Isolate	Unclassified
679	2904571731	Burkholderia cenocepacia 574	Isolate	Unclassified
680	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
681	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
682	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
683	2909042592	Labrys sp. LIt4	Isolate	Nodule
684	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
685	2917736166	Amycolatopsis dendrobii DR6-1	Isolate	Unclassified
686	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
687	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
688	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
689	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
690	2924754689	Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1	Isolate	Nodule
691	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
692	2925326138	Paenibacillus hemerocallicola KCTC 33185	Isolate	Unclassified
693	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
694	2928125067	Methylobacterium sp. 1973	Isolate	Unclassified
695	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
696	2928163908	Burkholderia sp. 567	Isolate	Unclassified
697	2928170801	Burkholderia sp. 572	Isolate	Unclassified
698	2928536128	Burkholderia sola 565	Isolate	Unclassified
699	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
700	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
701	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
702	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
703	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
704	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
705	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
706	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
707	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
708	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
709	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
710	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
711	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
712	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
713	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
714	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
715	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
716	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
717	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
718	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
719	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
720	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
721	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
722	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
723	2937994558	Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1	Isolate	Nodule
724	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
725	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
726	2958165035	Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1	Isolate	Nodule
727	2961163497	Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1	Isolate	Nodule
728	2965018300	Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1	Isolate	Nodule
729	2965032056	Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1	Isolate	Nodule
730	2965110997	Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1	Isolate	Nodule
731	2968171901	Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1	Isolate	Nodule
732	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
733	2970524798	Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1	Isolate	Nodule
734	2970540015	Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1	Isolate	Nodule
735	2970554993	Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1	Isolate	Nodule
736	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
737	2974320154	Acidovorax wautersii SORGH_AS 335	Isolate	Unclassified
738	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
739	2977957713	Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1	Isolate	Nodule
740	2979793036	Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1	Isolate	Nodule
741	2981990288	Burkholderia sp. PvR073	Isolate	Rhizosphere
742	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
743	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
744	2987659509	Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1	Isolate	Nodule
745	2987673487	Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1	Isolate	Nodule
746	3004188549	Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1	Isolate	Nodule
747	3004239961	Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1	Isolate	Nodule
748	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
749	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
750	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
751	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
752	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule
753	8003314358	Amycolatopsis sp. MtRt-6	Isolate	Unclassified
754	8004395343	Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1	Isolate	Nodule
755	8004695233	Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1	Isolate	Nodule
756	8005275841	Rhizobium sp. N4311	Isolate	Nodule
757	8005395548	Rhizobium sp. R339	Isolate	Nodule
758	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
759	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
760	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
761	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
762	8018176218	Rhizobium sp. N122	Isolate	Nodule
763	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
764	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
765	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
766	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
767	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
768	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
769	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
770	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
771	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
772	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
773	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
774	8039098773	Burkholderia multivorans MSMB612WGS	Isolate	Unclassified
775	8054563764	Acuticoccus kalidii M5D2P5	Isolate	Unclassified
776	8055087960	Silvania hatchlandensis H19S6	Isolate	Rhizosphere
777	8055097453	Leclercia tamurae H6W5	Isolate	Rhizosphere
778	8055617313	Mesorhizobium onobrychidis OM4	Isolate	Nodule
779	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
780	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
781	8057304971	Scandinavium manionii H17S15	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	77.89
Metatranscriptomes	0.14
Isolates	21.97

Biome Distribution

Category	Percentage (%)
Aerial Root	0.14
Bulb	0
Endosphere	7.84
Nodule	11.62
Rhizoplane	5.35
Rhizosphere	59.66
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10046273	3300001979	Bacteria	1278
2	JGI24739J22299_10006412	3300001989	Bacteria	4442
3	JGI24739J22299_10007282	3300001989	Bacteria	4157
4	JGI24735J21928_10001681	3300002067	Bacteria	7816
5	JGI24735J21928_10009232	3300002067	Bacteria	3173
6	JGI24034J26672_10007179	3300002239	Bacteria	1614
7	JGI25156J39149_1000412	3300002705	Bacteria	26731
8	JGI25151J46595_10000318	3300003187	Bacteria	52064
9	JGI25153J46596_10001487	3300003215	Bacteria	13974
10	rootH2_10071456	3300003320	Bacteria	8644
11	Ga0006562J51391_1051819	3300003578	Bacteria	16990
12	Ga0006562J51391_1051821	3300003578	Bacteria	5720
13	Ga0055539_1000025	3300003752	Bacteria	264193
14	Ga0055533_1000034	3300003756	Bacteria	264193
15	Ga0055532_1000878	3300003758	Bacteria	10031
16	Ga0055532_1003125	3300003758	Bacteria	3002
17	Ga0055525_1000044	3300003759	Bacteria	264193
18	Ga0055525_1000084	3300003759	Bacteria	155319
19	Ga0055527_1002574	3300003760	Bacteria	3002
20	Ga0055535_1005058	3300003761	Bacteria	3002
21	Ga0055542_1005184	3300003762	Bacteria	2994
22	Ga0055529_1000403	3300003763	Bacteria	45873
23	Ga0055529_1004398	3300003763	Bacteria	2149
24	Ga0055530_10000530	3300003791	Bacteria	33133
25	Ga0055540_1000131	3300003792	Bacteria	75615
26	Ga0055540_1000179	3300003792	Bacteria	62199
27	Ga0055540_1000210	3300003792	Bacteria	55346
28	Ga0055540_1000268	3300003792	Bacteria	47109
29	Ga0055540_1008451	3300003792	Bacteria	3707
30	Ga0055531_10006153	3300003794	Bacteria	6867
31	Ga0055541_1000019	3300003841	Bacteria	264193
32	Ga0055541_1004454	3300003841	Bacteria	2539
33	Ga0058692_1000056	3300003856	Bacteria	105284
34	Ga0058692_1000479	3300003856	Bacteria	17896
35	Ga0058692_1001035	3300003856	Bacteria	10908
36	Ga0058692_1001620	3300003856	Bacteria	8079
37	Ga0058692_1014604	3300003856	Bacteria	1793
38	Ga0070658_10089382	3300005327	Bacteria	2536
39	Ga0070676_10002892	3300005328	Bacteria	8864
40	Ga0070676_10070634	3300005328	Bacteria	2095
41	Ga0070676_10089912	3300005328	Bacteria	1879
42	Ga0070676_10205980	3300005328	Bacteria	1292
43	Ga0070690_100000071	3300005330	Bacteria	50633
44	Ga0070690_100041725	3300005330	Bacteria	2906
45	Ga0070670_100026292	3300005331	Bacteria	5010
46	Ga0070670_100250007	3300005331	Bacteria	1544
47	Ga0070677_10009493	3300005333	Bacteria	3300
48	Ga0068869_100003521	3300005334	Bacteria	9605
49	Ga0068869_100003727	3300005334	Bacteria	9382
50	Ga0068869_100035841	3300005334	Bacteria	3519
51	Ga0068869_100195192	3300005334	Bacteria	1594
52	Ga0070666_10115565	3300005335	Bacteria	1858
53	Ga0070680_100133922	3300005336	Bacteria	2075
54	Ga0070682_100206727	3300005337	Bacteria	1389
55	Ga0068868_100018499	3300005338	Bacteria	5211
56	Ga0068868_100030245	3300005338	Bacteria	4152
57	Ga0068868_100097176	3300005338	Bacteria	2380
58	Ga0070660_100000003	3300005339	Bacteria	176884
59	Ga0070689_100007369	3300005340	Bacteria	7684
60	Ga0070689_100095504	3300005340	Bacteria	2348
61	Ga0070661_100050660	3300005344	Bacteria	3038
62	Ga0070661_100128329	3300005344	Bacteria	1903
63	Ga0070668_100000806	3300005347	Bacteria	21607
64	Ga0070668_100003299	3300005347	Bacteria	11908
65	Ga0070668_100006317	3300005347	Bacteria	8776
66	Ga0070668_100020398	3300005347	Bacteria	5001
67	Ga0070668_100048282	3300005347	Bacteria	3273
68	Ga0070668_100063769	3300005347	Bacteria	2856
69	Ga0070668_100207383	3300005347	Bacteria	1611
70	Ga0070669_100042600	3300005353	Bacteria	3304
71	Ga0070669_100119135	3300005353	Bacteria	2011
72	Ga0070675_100003353	3300005354	Bacteria	12131
73	Ga0070675_100023424	3300005354	Bacteria	4937
74	Ga0070675_100024829	3300005354	Bacteria	4801
75	Ga0070675_100132067	3300005354	Bacteria	2128
76	Ga0070675_100331253	3300005354	Bacteria	1347
77	Ga0070671_100017097	3300005355	Bacteria	5868
78	Ga0070674_100002887	3300005356	Bacteria	9511
79	Ga0070674_100006304	3300005356	Bacteria	6911
80	Ga0070674_100047171	3300005356	Bacteria	2950
81	Ga0070674_100216859	3300005356	Bacteria	1487
82	Ga0070674_100321990	3300005356	Bacteria	1240
83	Ga0070673_100004659	3300005364	Bacteria	8706
84	Ga0070673_100232605	3300005364	Bacteria	1599
85	Ga0070688_100018223	3300005365	Bacteria	4047
86	Ga0070659_100000024	3300005366	Bacteria	148685
87	Ga0070659_100014302	3300005366	Bacteria	5927
88	Ga0070659_100030499	3300005366	Bacteria	4173
89	Ga0070659_100033782	3300005366	Bacteria	3976
90	Ga0070667_100011367	3300005367	Bacteria	7361
91	Ga0070667_100039835	3300005367	Bacteria	3939
92	Ga0070667_100141206	3300005367	Bacteria	2109
93	Ga0070709_10020309	3300005434	Bacteria	3852
94	Ga0070714_100019619	3300005435	Bacteria	5512
95	Ga0070713_100017835	3300005436	Bacteria	5383
96	Ga0070713_100048639	3300005436	Bacteria	3493
97	Ga0070710_10000593	3300005437	Bacteria	17230
98	Ga0070701_10000068	3300005438	Bacteria	28103
99	Ga0070711_100002985	3300005439	Bacteria	9772
100	Ga0070711_100114159	3300005439	Bacteria	1987
101	Ga0070700_100000434	3300005441	Bacteria	21167
102	Ga0070700_100080893	3300005441	Bacteria	2098
103	Ga0070700_100226603	3300005441	Bacteria	1328
104	Ga0070694_100001492	3300005444	Bacteria	13735
105	Ga0070708_100046016	3300005445	Bacteria	3848
106	Ga0070663_100001496	3300005455	Bacteria	12846
107	Ga0070663_100017250	3300005455	Bacteria	4707
108	Ga0070663_100028319	3300005455	Bacteria	3813
109	Ga0070663_100031398	3300005455	Bacteria	3650
110	Ga0070663_100056110	3300005455	Bacteria	2821
111	Ga0070663_100123714	3300005455	Bacteria	1957
112	Ga0070663_100146275	3300005455	Bacteria	1808
113	Ga0070678_100019847	3300005456	Bacteria	4395
114	Ga0070678_100077900	3300005456	Bacteria	2502
115	Ga0070662_100001744	3300005457	Bacteria	13378
116	Ga0070662_100004545	3300005457	Bacteria	8788
117	Ga0070662_100021387	3300005457	Bacteria	4416
118	Ga0070662_100023609	3300005457	Bacteria	4227
119	Ga0070681_10389736	3300005458	Bacteria	1304
120	Ga0068867_100003837	3300005459	Bacteria	10561
121	Ga0068867_100008458	3300005459	Bacteria	7260
122	Ga0068867_100021916	3300005459	Bacteria	4562
123	Ga0068867_100036030	3300005459	Bacteria	3590
124	Ga0070685_10029154	3300005466	Bacteria	3063
125	Ga0070706_100036139	3300005467	Bacteria	4561
126	Ga0070698_100026784	3300005471	Bacteria	5997
127	Ga0070699_100014514	3300005518	Bacteria	6775
128	Ga0070699_100031993	3300005518	Bacteria	4542
129	Ga0070684_100040760	3300005535	Bacteria	4000
130	Ga0070697_100016346	3300005536	Bacteria	5836
131	Ga0068853_100027974	3300005539	Bacteria	4741
132	Ga0070672_100041518	3300005543	Bacteria	3536
133	Ga0070672_100118677	3300005543	Bacteria	2163
134	Ga0070686_100001003	3300005544	Bacteria	16289
135	Ga0070695_100047345	3300005545	Bacteria	2746
136	Ga0070696_100056351	3300005546	Bacteria	2741
137	Ga0070693_100003038	3300005547	Bacteria	7783
138	Ga0070665_100012629	3300005548	Bacteria	8504
139	Ga0070665_100050454	3300005548	Bacteria	4175
140	Ga0070665_100056841	3300005548	Bacteria	3923
141	Ga0070665_100072112	3300005548	Bacteria	3461
142	Ga0070704_100049761	3300005549	Bacteria	2942
143	Ga0068855_100115271	3300005563	Bacteria	3080
144	Ga0070664_100004490	3300005564	Bacteria	11202
145	Ga0070664_100086492	3300005564	Bacteria	2709
146	Ga0070664_100187746	3300005564	Bacteria	1840
147	Ga0068854_100024686	3300005578	Bacteria	4118
148	Ga0068854_100108977	3300005578	Bacteria	2086
149	Ga0068854_100172764	3300005578	Bacteria	1683
150	Ga0068856_100018066	3300005614	Bacteria	6838
151	Ga0068856_100024804	3300005614	Bacteria	5840
152	Ga0070702_100000040	3300005615	Bacteria	35063
153	Ga0070702_100029438	3300005615	Bacteria	2986
154	Ga0070702_100094542	3300005615	Bacteria	1820
155	Ga0070702_100210802	3300005615	Bacteria	1293
156	Ga0068852_100002517	3300005616	Bacteria	12621
157	Ga0068852_100005074	3300005616	Bacteria	9369
158	Ga0068852_100013050	3300005616	Bacteria	6343
159	Ga0068852_100038541	3300005616	Bacteria	4017
160	Ga0068852_100076744	3300005616	Bacteria	2951
161	Ga0068859_100003009	3300005617	Bacteria	17086
162	Ga0068859_100052232	3300005617	Bacteria	4109
163	Ga0068859_100077509	3300005617	Bacteria	3364
164	Ga0068866_10000853	3300005718	Bacteria	13494
165	Ga0068866_10013094	3300005718	Bacteria	3629
166	Ga0068866_10071652	3300005718	Bacteria	1833
167	Ga0068861_100000658	3300005719	Bacteria	20535
168	Ga0068861_100020241	3300005719	Bacteria	4761
169	Ga0068861_100023361	3300005719	Bacteria	4459
170	Ga0068861_100026137	3300005719	Bacteria	4241
171	Ga0068861_100047883	3300005719	Bacteria	3229
172	Ga0068861_100103940	3300005719	Bacteria	2265
173	Ga0068861_100258960	3300005719	Bacteria	1488
174	Ga0068851_10004637	3300005834	Bacteria	6205
175	Ga0068851_10022648	3300005834	Bacteria	3063
176	Ga0068851_10180600	3300005834	Bacteria	1169
177	Ga0068870_10021546	3300005840	Bacteria	3154
178	Ga0068870_10031381	3300005840	Bacteria	2692
179	Ga0068863_100152386	3300005841	Bacteria	2212
180	Ga0068858_100002874	3300005842	Bacteria	17319
181	Ga0068858_100071870	3300005842	Bacteria	3209
182	Ga0068858_100173469	3300005842	Bacteria	2034
183	Ga0068858_100271017	3300005842	Bacteria	1615
184	Ga0068858_100391838	3300005842	Bacteria	1334
185	Ga0068860_100010860	3300005843	Bacteria	8982
186	Ga0068860_100017504	3300005843	Bacteria	6983
187	Ga0068860_100093516	3300005843	Bacteria	2865
188	Ga0068860_100111210	3300005843	Bacteria	2619
189	Ga0068860_100410589	3300005843	Bacteria	1341
190	Ga0068862_100046175	3300005844	Bacteria	3716
191	Ga0068862_100071793	3300005844	Bacteria	2989
192	Ga0068862_100083756	3300005844	Bacteria	2769
193	Ga0081455_10000955	3300005937	Bacteria	36997
194	Ga0081455_10004789	3300005937	Bacteria	15041
195	Ga0081455_10021968	3300005937	Bacteria	5974
196	Ga0081455_10094363	3300005937	Bacteria	2417
197	Ga0081455_10163397	3300005937	Bacteria	1704
198	Ga0081538_10030985	3300005981	Bacteria	3618
199	Ga0081540_1003844	3300005983	Bacteria	11739
200	Ga0081540_1029797	3300005983	Bacteria	3035
201	Ga0081539_10071479	3300005985	Bacteria	1858
202	Ga0070717_10000962	3300006028	Bacteria	19214
203	Ga0070717_10061301	3300006028	Bacteria	3117
204	Ga0070717_10079525	3300006028	Bacteria	2749
205	Ga0075365_10009979	3300006038	Bacteria	5500
206	Ga0075365_10025010	3300006038	Bacteria	3775
207	Ga0075365_10025132	3300006038	Bacteria	3768
208	Ga0075365_10122693	3300006038	Bacteria	1793
209	Ga0075368_10047647	3300006042	Bacteria	1697
210	Ga0075363_100005910	3300006048	Bacteria	5511
211	Ga0075363_100037006	3300006048	Bacteria	2561
212	Ga0075364_10048254	3300006051	Bacteria	2774
213	Ga0075432_10055416	3300006058	Bacteria	1405
214	Ga0070715_10006481	3300006163	Bacteria	3983
215	Ga0070716_100039281	3300006173	Bacteria	2626
216	Ga0070712_100012061	3300006175	Bacteria	5492
217	Ga0070712_100037513	3300006175	Bacteria	3305
218	Ga0070712_100093778	3300006175	Bacteria	2204
219	Ga0075362_10004746	3300006177	Bacteria	4908
220	Ga0075362_10013233	3300006177	Bacteria	3299
221	Ga0075367_10007404	3300006178	Bacteria	5617
222	Ga0075367_10019631	3300006178	Bacteria	3750
223	Ga0075367_10043705	3300006178	Bacteria	2624
224	Ga0075369_10023898	3300006186	Bacteria	2529
225	Ga0075369_10068597	3300006186	Bacteria	1558
226	Ga0075366_10009908	3300006195	Bacteria	5332
227	Ga0097621_100000540	3300006237	Bacteria	26618
228	Ga0097621_100003716	3300006237	Bacteria	10565
229	Ga0097621_100131694	3300006237	Bacteria	2129
230	Ga0075370_10002998	3300006353	Bacteria	7950
231	Ga0075370_10003754	3300006353	Bacteria	7268
232	Ga0075370_10042412	3300006353	Bacteria	2571
233	Ga0075370_10115702	3300006353	Bacteria	1559
234	Ga0068871_100022588	3300006358	Bacteria	4853
235	Ga0068871_100276681	3300006358	Bacteria	1467
236	Ga0075428_100161192	3300006844	Bacteria	2434
237	Ga0075428_100262605	3300006844	Bacteria	1859
238	Ga0075428_100535664	3300006844	Bacteria	1252
239	Ga0075433_10037855	3300006852	Bacteria	4163
240	Ga0075433_10122826	3300006852	Bacteria	2306
241	Ga0075434_100027653	3300006871	Bacteria	5569
242	Ga0075434_100146301	3300006871	Bacteria	2383
243	Ga0075434_100372461	3300006871	Bacteria	1449
244	Ga0068865_100000529	3300006881	Bacteria	21356
245	Ga0068865_100051454	3300006881	Bacteria	2851
246	Ga0068865_100071155	3300006881	Bacteria	2466
247	Ga0075436_100097601	3300006914	Bacteria	2044
248	Ga0097620_100003009	3300006931	Bacteria	17086
249	Ga0097620_100049566	3300006931	Bacteria	4217
250	Ga0097620_100052235	3300006931	Bacteria	4109
251	Ga0097620_100077506	3300006931	Bacteria	3364
252	Ga0099825_1040743	3300006941	Bacteria	1365
253	Ga0099824_1004100	3300006942	Bacteria	21098
254	Ga0099824_1008875	3300006942	Bacteria	12635
255	Ga0099823_1009013	3300006944	Bacteria	10131
256	Ga0079104_1002023	3300006946	Bacteria	11836
257	Ga0099826_10000004	3300006948	Bacteria	802669
258	Ga0075435_100004518	3300007076	Bacteria	9564
259	Ga0075435_100031084	3300007076	Bacteria	4204
260	Ga0075435_100032893	3300007076	Bacteria	4098
261	Ga0099795_10003924	3300007788	Bacteria	3760
262	Ga0105251_10012153	3300009011	Bacteria	4884
263	Ga0105251_10013357	3300009011	Bacteria	4598
264	Ga0105251_10115324	3300009011	Bacteria	1222
265	Ga0105244_10000668	3300009036	Bacteria	30097
266	Ga0105244_10002135	3300009036	Bacteria	15180
267	Ga0105244_10007286	3300009036	Bacteria	7036
268	Ga0105244_10009698	3300009036	Bacteria	5891
269	Ga0105244_10014827	3300009036	Bacteria	4491
270	Ga0105244_10031235	3300009036	Bacteria	2827
271	Ga0105250_10003240	3300009092	Bacteria	7757
272	Ga0105250_10003638	3300009092	Bacteria	7254
273	Ga0105250_10006897	3300009092	Bacteria	4924
274	Ga0105250_10098082	3300009092	Bacteria	1195
275	Ga0105240_10001236	3300009093	Bacteria	44352
276	Ga0105240_10002844	3300009093	Bacteria	27365
277	Ga0111539_10462380	3300009094	Bacteria	1478
278	Ga0105245_10001373	3300009098	Bacteria	22028
279	Ga0105245_10151604	3300009098	Bacteria	2193
280	Ga0105247_10108857	3300009101	Bacteria	1781
281	Ga0114129_10024966	3300009147	Bacteria	8473
282	Ga0114129_10079480	3300009147	Bacteria	4560
283	Ga0114129_10169820	3300009147	Bacteria	2974
284	Ga0114129_10477685	3300009147	Bacteria	1631
285	Ga0105243_10000265	3300009148	Bacteria	58881
286	Ga0105243_10005295	3300009148	Bacteria	10084
287	Ga0105243_10006524	3300009148	Bacteria	9014
288	Ga0105242_10000363	3300009176	Bacteria	36241
289	Ga0105242_10038254	3300009176	Bacteria	3858
290	Ga0105242_10284518	3300009176	Bacteria	1503
291	Ga0105248_10003176	3300009177	Bacteria	18210
292	Ga0105248_10003306	3300009177	Bacteria	17891
293	Ga0105248_10035287	3300009177	Bacteria	5594
294	Ga0105237_10001202	3300009545	Bacteria	34641
295	Ga0105237_10039679	3300009545	Bacteria	4752
296	Ga0105237_10130762	3300009545	Bacteria	2505
297	Ga0105237_10136247	3300009545	Bacteria	2450
298	Ga0105237_10503432	3300009545	Bacteria	1218
299	Ga0105238_10000712	3300009551	Bacteria	34771
300	Ga0105238_10006297	3300009551	Bacteria	11797
301	Ga0105238_10301698	3300009551	Bacteria	1585
302	Ga0105238_10309674	3300009551	Bacteria	1564
303	Ga0105249_10005435	3300009553	Bacteria	10999
304	Ga0105249_10028890	3300009553	Bacteria	5005
305	Ga0105239_10006022	3300010375	Bacteria	14111
306	Ga0105239_10026915	3300010375	Bacteria	6329
307	Ga0105239_10035434	3300010375	Bacteria	5480
308	Ga0105239_10274698	3300010375	Bacteria	1896
309	Ga0105246_10007546	3300011119	Bacteria	6672
310	Ga0105246_10055765	3300011119	Bacteria	2729
311	Ga0157373_10002930	3300013100	Bacteria	12931
312	Ga0157373_10004080	3300013100	Bacteria	11001
313	Ga0157373_10106069	3300013100	Bacteria	1976
314	Ga0157371_10006105	3300013102	Bacteria	10020
315	Ga0157371_10021703	3300013102	Bacteria	4711
316	Ga0157371_10188664	3300013102	Bacteria	1476
317	Ga0157370_10026494	3300013104	Bacteria	5724
318	Ga0157369_10074224	3300013105	Bacteria	3648
319	Ga0157369_10260160	3300013105	Bacteria	1810
320	Ga0171462_1053	3300013250	Bacteria	31252
321	Ga0157374_10014393	3300013296	Bacteria	6924
322	Ga0157374_10015441	3300013296	Bacteria	6698
323	Ga0157374_10041568	3300013296	Bacteria	4238
324	Ga0157374_10091761	3300013296	Bacteria	2897
325	Ga0157374_10114011	3300013296	Bacteria	2602
326	Ga0157378_10000478	3300013297	Bacteria	38074
327	Ga0157378_10069096	3300013297	Bacteria	3168
328	Ga0157378_10075599	3300013297	Bacteria	3033
329	Ga0163162_10004248	3300013306	Bacteria	13776
330	Ga0163162_10074545	3300013306	Bacteria	3452
331	Ga0163162_10096047	3300013306	Bacteria	3052
332	Ga0163162_10106003	3300013306	Bacteria	2906
333	Ga0163162_10123501	3300013306	Bacteria	2694
334	Ga0157372_10005296	3300013307	Bacteria	13697
335	Ga0157372_10031898	3300013307	Bacteria	5774
336	Ga0157372_10155549	3300013307	Bacteria	2641
337	Ga0157372_10208044	3300013307	Bacteria	2267
338	Ga0157375_10007027	3300013308	Bacteria	9832
339	Ga0157375_10040710	3300013308	Bacteria	4482
340	Ga0157375_10124364	3300013308	Bacteria	2692
341	Ga0157375_10138291	3300013308	Bacteria	2561
342	Ga0157375_10366488	3300013308	Bacteria	1607
343	Ga0157375_10373311	3300013308	Bacteria	1593
344	Ga0163163_10224728	3300014325	Bacteria	1926
345	Ga0157380_10023531	3300014326	Bacteria	4648
346	Ga0157380_10024836	3300014326	Bacteria	4539
347	Ga0157380_10044027	3300014326	Bacteria	3496
348	Ga0157380_10062580	3300014326	Bacteria	2981
349	Ga0182008_10008258	3300014497	Bacteria	5691
350	Ga0182008_10011292	3300014497	Bacteria	4758
351	Ga0157377_10013392	3300014745	Bacteria	4150
352	Ga0157379_10008975	3300014968	Bacteria	8714
353	Ga0157379_10013683	3300014968	Bacteria	7110
354	Ga0157379_10014880	3300014968	Bacteria	6825
355	Ga0157379_10062574	3300014968	Bacteria	3328
356	Ga0157376_10023321	3300014969	Bacteria	4841
357	Ga0182006_1000417	3300015261	Bacteria	34124
358	Ga0182006_1000688	3300015261	Bacteria	23576
359	Ga0183361_10004	3300016635	Bacteria	484183
360	Ga0163161_10001990	3300017792	Bacteria	14811
361	Ga0163161_10007155	3300017792	Bacteria	7715
362	Ga0163161_10022084	3300017792	Bacteria	4478
363	Ga0163161_10130806	3300017792	Bacteria	1893
364	Ga0214544_1000279	3300021320	Bacteria	85706
365	Ga0214542_1000014	3300021321	Bacteria	233825
366	Ga0214543_1000056	3300021327	Bacteria	134292
367	Ga0214543_1010227	3300021327	Bacteria	14045
368	Ga0213872_10000001	3300021361	Bacteria	662532
369	Ga0213872_10000076	3300021361	Bacteria	90633
370	Ga0213872_10030526	3300021361	Bacteria	2470
371	Ga0213876_10004612	3300021384	Bacteria	7683
372	Ga0213875_10005491	3300021388	Bacteria	6796
373	Ga0213871_10022667	3300021441	Bacteria	1576
374	Ga0209784_100002	3300025224	Bacteria	1753105
375	Ga0209566_100003	3300025225	Bacteria	1753105
376	Ga0209566_100660	3300025225	Bacteria	20710
377	Ga0209674_100004	3300025226	Bacteria	1753105
378	Ga0209672_100012	3300025228	Bacteria	795742
379	Ga0209147_100007	3300025229	Bacteria	795684
380	Ga0209147_100074	3300025229	Bacteria	208743
381	Ga0209563_100006	3300025230	Bacteria	1753105
382	Ga0209563_100025	3300025230	Bacteria	596456
383	Ga0209258_100313	3300025242	Bacteria	75617
384	Ga0209677_100003	3300025253	Bacteria	1753105
385	Ga0209148_1001172	3300025254	Bacteria	15133
386	Ga0209759_1000739	3300025256	Bacteria	28453
387	Ga0209455_1000037	3300025272	Bacteria	464097
388	Ga0209455_1002631	3300025272	Bacteria	6799
389	Ga0209676_1004266	3300025292	Bacteria	8061
390	Ga0209025_1000429	3300025294	Bacteria	83306
391	Ga0209025_1009154	3300025294	Bacteria	6959
392	Ga0209025_1029995	3300025294	Bacteria	2615
393	Ga0209564_1000401	3300025295	Bacteria	76992
394	Ga0209564_1014568	3300025295	Bacteria	3261
395	Ga0209758_1000897	3300025297	Bacteria	40451
396	Ga0209758_1002955	3300025297	Bacteria	16317
397	Ga0209758_1004390	3300025297	Bacteria	11774
398	Ga0209758_1014842	3300025297	Bacteria	4099
399	Ga0209050_1000082	3300025298	Bacteria	266864
400	Ga0209050_1004023	3300025298	Bacteria	10335
401	Ga0209050_1006857	3300025298	Bacteria	6611
402	Ga0209256_1000501	3300025299	Bacteria	57500
403	Ga0207426_1002088	3300025302	Bacteria	13802
404	Ga0209051_1000029	3300025303	Bacteria	403675
405	Ga0209051_1000032	3300025303	Bacteria	383445
406	Ga0209051_1000038	3300025303	Bacteria	320926
407	Ga0209051_1000151	3300025303	Bacteria	131835
408	Ga0209257_1000168	3300025304	Bacteria	171312
409	Ga0209257_1002212	3300025304	Bacteria	20049
410	Ga0207697_10000138	3300025315	Bacteria	35118
411	Ga0207696_1000232	3300025711	Bacteria	78423
412	Ga0207696_1004392	3300025711	Bacteria	6092
413	Ga0207696_1017735	3300025711	Bacteria	2352
414	Ga0207655_1000002	3300025728	Bacteria	1148694
415	Ga0207655_1000934	3300025728	Bacteria	30302
416	Ga0207655_1002395	3300025728	Bacteria	15292
417	Ga0207655_1011821	3300025728	Bacteria	5160
418	Ga0207655_1078123	3300025728	Bacteria	1204
419	Ga0207713_1002711	3300025735	Bacteria	12639
420	Ga0207713_1028657	3300025735	Bacteria	2507
421	Ga0207682_10001413	3300025893	Bacteria	11096
422	Ga0207682_10009354	3300025893	Bacteria	3870
423	Ga0207692_10003968	3300025898	Bacteria	5811
424	Ga0207642_10000174	3300025899	Bacteria	18462
425	Ga0207642_10006009	3300025899	Bacteria	4007
426	Ga0207642_10011252	3300025899	Bacteria	3184
427	Ga0207642_10013847	3300025899	Bacteria	2956
428	Ga0207642_10016059	3300025899	Bacteria	2810
429	Ga0207642_10081106	3300025899	Bacteria	1576
430	Ga0207710_10046481	3300025900	Bacteria	1938
431	Ga0207688_10005605	3300025901	Bacteria	6829
432	Ga0207688_10008075	3300025901	Bacteria	5725
433	Ga0207688_10012193	3300025901	Bacteria	4675
434	Ga0207680_10017472	3300025903	Bacteria	3791
435	Ga0207680_10073045	3300025903	Bacteria	2132
436	Ga0207647_10040722	3300025904	Bacteria	2924
437	Ga0207647_10060794	3300025904	Bacteria	2308
438	Ga0207699_10003942	3300025906	Bacteria	7099
439	Ga0207699_10023532	3300025906	Bacteria	3353
440	Ga0207645_10003708	3300025907	Bacteria	11507
441	Ga0207645_10014911	3300025907	Bacteria	5184
442	Ga0207645_10114826	3300025907	Bacteria	1745
443	Ga0207645_10116983	3300025907	Bacteria	1729
444	Ga0207643_10010585	3300025908	Bacteria	4967
445	Ga0207643_10025132	3300025908	Bacteria	3291
446	Ga0207705_10093244	3300025909	Bacteria	2207
447	Ga0207684_10005764	3300025910	Bacteria	11369
448	Ga0207654_10008649	3300025911	Bacteria	5158
449	Ga0207707_10197523	3300025912	Bacteria	1754
450	Ga0207695_10000301	3300025913	Bacteria	121221
451	Ga0207695_10001540	3300025913	Bacteria	37977
452	Ga0207695_10005993	3300025913	Bacteria	15896
453	Ga0207695_10046435	3300025913	Bacteria	4604
454	Ga0207695_10103560	3300025913	Bacteria	2837
455	Ga0207695_10139465	3300025913	Bacteria	2375
456	Ga0207671_10001875	3300025914	Bacteria	23385
457	Ga0207671_10007595	3300025914	Bacteria	9383
458	Ga0207671_10130801	3300025914	Bacteria	1926
459	Ga0207671_10131378	3300025914	Bacteria	1922
460	Ga0207693_10011581	3300025915	Bacteria	7134
461	Ga0207693_10012654	3300025915	Bacteria	6816
462	Ga0207693_10025259	3300025915	Bacteria	4711
463	Ga0207693_10055757	3300025915	Bacteria	3100
464	Ga0207663_10008502	3300025916	Bacteria	5371
465	Ga0207663_10040391	3300025916	Bacteria	2835
466	Ga0207660_10043075	3300025917	Bacteria	3171
467	Ga0207662_10023863	3300025918	Bacteria	3517
468	Ga0207657_10000002	3300025919	Bacteria	444378
469	Ga0207657_10127415	3300025919	Bacteria	2089
470	Ga0207649_10037204	3300025920	Bacteria	2938
471	Ga0207649_10113263	3300025920	Bacteria	1816
472	Ga0207681_10005903	3300025923	Bacteria	7508
473	Ga0207681_10047362	3300025923	Bacteria	2896
474	Ga0207694_10001517	3300025924	Bacteria	19777
475	Ga0207694_10022685	3300025924	Bacteria	4761
476	Ga0207694_10050886	3300025924	Bacteria	3210
477	Ga0207694_10317044	3300025924	Bacteria	1286
478	Ga0207650_10001906	3300025925	Bacteria	14711
479	Ga0207650_10019993	3300025925	Bacteria	4715
480	Ga0207659_10003466	3300025926	Bacteria	9459
481	Ga0207659_10009054	3300025926	Bacteria	6210
482	Ga0207659_10028913	3300025926	Bacteria	3771
483	Ga0207659_10090798	3300025926	Bacteria	2281
484	Ga0207659_10326882	3300025926	Bacteria	1267
485	Ga0207687_10001592	3300025927	Bacteria	15618
486	Ga0207687_10257801	3300025927	Bacteria	1389
487	Ga0207700_10025541	3300025928	Bacteria	4104
488	Ga0207700_10186834	3300025928	Bacteria	1739
489	Ga0207664_10066096	3300025929	Bacteria	2897
490	Ga0207664_10343055	3300025929	Bacteria	1321
491	Ga0207644_10109884	3300025931	Bacteria	2084
492	Ga0207644_10142002	3300025931	Bacteria	1850
493	Ga0207644_10194251	3300025931	Bacteria	1597
494	Ga0207690_10000014	3300025932	Bacteria	263016
495	Ga0207706_10007132	3300025933	Bacteria	10343
496	Ga0207706_10010513	3300025933	Bacteria	8458
497	Ga0207706_10026456	3300025933	Bacteria	5192
498	Ga0207686_10000731	3300025934	Bacteria	20402
499	Ga0207686_10013625	3300025934	Bacteria	4502
500	Ga0207686_10133219	3300025934	Bacteria	1707
501	Ga0207709_10007610	3300025935	Bacteria	6010
502	Ga0207670_10110484	3300025936	Bacteria	1980
503	Ga0207669_10008773	3300025937	Bacteria	4767
504	Ga0207669_10100998	3300025937	Bacteria	1907
505	Ga0207669_10318046	3300025937	Bacteria	1190
506	Ga0207704_10000296	3300025938	Bacteria	23632
507	Ga0207704_10006173	3300025938	Bacteria	5564
508	Ga0207704_10018913	3300025938	Bacteria	3607
509	Ga0207704_10178135	3300025938	Bacteria	1533
510	Ga0207665_10023006	3300025939	Bacteria	4104
511	Ga0207665_10043116	3300025939	Bacteria	3016
512	Ga0207691_10079454	3300025940	Bacteria	2952
513	Ga0207691_10160807	3300025940	Bacteria	1970
514	Ga0207711_10025421	3300025941	Bacteria	4969
515	Ga0207711_10029772	3300025941	Bacteria	4606
516	Ga0207711_10062460	3300025941	Bacteria	3213
517	Ga0207711_10146344	3300025941	Bacteria	2129
518	Ga0207689_10001104	3300025942	Bacteria	26012
519	Ga0207689_10002198	3300025942	Bacteria	18288
520	Ga0207689_10023579	3300025942	Bacteria	5161
521	Ga0207689_10088452	3300025942	Bacteria	2544
522	Ga0207661_10133636	3300025944	Bacteria	2128
523	Ga0207667_10100377	3300025949	Bacteria	2985
524	Ga0207667_10150530	3300025949	Bacteria	2395
525	Ga0207667_10311951	3300025949	Bacteria	1606
526	Ga0207651_10075496	3300025960	Bacteria	2405
527	Ga0207651_10336691	3300025960	Bacteria	1266
528	Ga0207712_10008374	3300025961	Bacteria	6534
529	Ga0207712_10010708	3300025961	Bacteria	5825
530	Ga0207712_10018842	3300025961	Bacteria	4500
531	Ga0207712_10143752	3300025961	Bacteria	1834
532	Ga0207668_10003461	3300025972	Bacteria	9261
533	Ga0207668_10030590	3300025972	Bacteria	3539
534	Ga0207668_10030673	3300025972	Bacteria	3535
535	Ga0207668_10066658	3300025972	Bacteria	2552
536	Ga0207668_10270142	3300025972	Bacteria	1390
537	Ga0207640_10030633	3300025981	Bacteria	3315
538	Ga0207640_10154216	3300025981	Bacteria	1691
539	Ga0207658_10005695	3300025986	Bacteria	8519
540	Ga0207658_10020518	3300025986	Bacteria	4575
541	Ga0207658_10094379	3300025986	Bacteria	2328
542	Ga0207677_10096999	3300026023	Bacteria	2158
543	Ga0207677_10161340	3300026023	Bacteria	1742
544	Ga0207703_10001737	3300026035	Bacteria	19563
545	Ga0207703_10021616	3300026035	Bacteria	5038
546	Ga0207703_10061909	3300026035	Bacteria	3065
547	Ga0207703_10062658	3300026035	Bacteria	3046
548	Ga0207703_10075519	3300026035	Bacteria	2793
549	Ga0207703_10078353	3300026035	Bacteria	2745
550	Ga0207639_10029470	3300026041	Bacteria	4019
551	Ga0207639_10196081	3300026041	Bacteria	1729
552	Ga0207678_10000690	3300026067	Bacteria	30909
553	Ga0207678_10007273	3300026067	Bacteria	9813
554	Ga0207678_10009247	3300026067	Bacteria	8673
555	Ga0207678_10009550	3300026067	Bacteria	8532
556	Ga0207678_10011079	3300026067	Bacteria	7922
557	Ga0207678_10012944	3300026067	Bacteria	7319
558	Ga0207678_10013068	3300026067	Bacteria	7284
559	Ga0207678_10018931	3300026067	Bacteria	6050
560	Ga0207678_10054759	3300026067	Bacteria	3436
561	Ga0207708_10000129	3300026075	Bacteria	59106
562	Ga0207708_10063210	3300026075	Bacteria	2828
563	Ga0207702_10013515	3300026078	Bacteria	6782
564	Ga0207641_10086841	3300026088	Bacteria	2728
565	Ga0207641_10275223	3300026088	Bacteria	1581
566	Ga0207648_10000252	3300026089	Bacteria	57773
567	Ga0207648_10051073	3300026089	Bacteria	3614
568	Ga0207676_10085016	3300026095	Bacteria	2580
569	Ga0207676_10120136	3300026095	Bacteria	2214
570	Ga0207674_10011921	3300026116	Bacteria	9747
571	Ga0207674_10037597	3300026116	Bacteria	5033
572	Ga0207674_10038897	3300026116	Bacteria	4934
573	Ga0207674_10073838	3300026116	Bacteria	3423
574	Ga0207675_100000829	3300026118	Bacteria	30767
575	Ga0207675_100001054	3300026118	Bacteria	27326
576	Ga0207675_100003765	3300026118	Bacteria	14780
577	Ga0207675_100006013	3300026118	Bacteria	11549
578	Ga0207675_100008982	3300026118	Bacteria	9380
579	Ga0207675_100209662	3300026118	Bacteria	1873
580	Ga0207675_100448497	3300026118	Bacteria	1278
581	Ga0207683_10001590	3300026121	Bacteria	20478
582	Ga0207683_10003302	3300026121	Bacteria	14062
583	Ga0207683_10099293	3300026121	Bacteria	2598
584	Ga0207683_10211002	3300026121	Bacteria	1767
585	Ga0207683_10240180	3300026121	Bacteria	1652
586	Ga0207698_10006398	3300026142	Bacteria	7345
587	Ga0207698_10011136	3300026142	Bacteria	5816
588	Ga0207698_10133997	3300026142	Bacteria	2122
589	Ga0209281_1000024	3300027111	Bacteria	499062
590	Ga0209389_1000004	3300027296	Bacteria	263759
591	Ga0209389_1000023	3300027296	Bacteria	150730
592	Ga0209371_1000121	3300027312	Bacteria	132565
593	Ga0209371_1000534	3300027312	Bacteria	36079
594	Ga0209371_1001024	3300027312	Bacteria	21216
595	Ga0209371_1001833	3300027312	Bacteria	13163
596	Ga0209371_1001961	3300027312	Bacteria	12447
597	Ga0209371_1002259	3300027312	Bacteria	11054
598	Ga0209371_1007367	3300027312	Bacteria	3847
599	Ga0209589_1000005	3300027357	Bacteria	530958
600	Ga0209589_1000010	3300027357	Bacteria	237657
601	Ga0209489_100005	3300027361	Bacteria	530958
602	Ga0209489_100011	3300027361	Bacteria	244710
603	Ga0209489_100295	3300027361	Bacteria	87273
604	Ga0209700_100006	3300027363	Bacteria	530958
605	Ga0209700_100013	3300027363	Bacteria	341906
606	Ga0209282_1000078	3300027666	Bacteria	76811
607	Ga0207428_10203842	3300027907	Bacteria	1488
608	Ga0207428_10206769	3300027907	Bacteria	1476
609	Ga0268266_10001354	3300028379	Bacteria	29590
610	Ga0268266_10003891	3300028379	Bacteria	14536
611	Ga0268266_10035100	3300028379	Bacteria	4265
612	Ga0268266_10430314	3300028379	Bacteria	1252
613	Ga0268265_10016272	3300028380	Bacteria	5106
614	Ga0268265_10056825	3300028380	Bacteria	2979
615	Ga0268265_10458369	3300028380	Bacteria	1192
616	Ga0268264_10014118	3300028381	Bacteria	6568
617	Ga0268264_10067678	3300028381	Bacteria	3015
618	Ga0268264_10280928	3300028381	Bacteria	1559
619	Ga0265319_1040148	3300028563	Bacteria	1583
620	Ga0307517_10000122	3300028786	Bacteria	116429
621	Ga0307515_10000873	3300028794	Bacteria	69237
622	Ga0307515_10000893	3300028794	Bacteria	68669
623	Ga0307515_10017389	3300028794	Bacteria	13101
624	Ga0307515_10030153	3300028794	Bacteria	9126
625	Ga0307515_10066632	3300028794	Bacteria	4984
626	Ga0265338_10013863	3300028800	Bacteria	9056
627	Ga0268256_1001719	3300030500	Bacteria	12447
628	Ga0268256_1001996	3300030500	Bacteria	11054
629	Ga0268256_1002539	3300030500	Bacteria	9184
630	Ga0268256_1002855	3300030500	Bacteria	8326
631	Ga0268256_1003731	3300030500	Bacteria	6697
632	Ga0268256_1005475	3300030500	Bacteria	4970
633	Ga0268256_1027289	3300030500	Bacteria	1423
634	Ga0307511_10042874	3300030521	Bacteria	3792
635	Ga0307512_10043947	3300030522	Bacteria	3679
636	Ga0307512_10056826	3300030522	Bacteria	3068
637	Ga0314311_1096979	3300030733	Bacteria	7060
638	Ga0316178_1158591	3300030735	Bacteria	2719
639	Ga0265325_10030384	3300031241	Bacteria	2897
640	Ga0265331_10029884	3300031250	Bacteria	2717
641	Ga0265316_10038284	3300031344	Bacteria	3865
642	Ga0307513_10001376	3300031456	Bacteria	35012
643	Ga0307513_10128604	3300031456	Bacteria	2483
644	Ga0307513_10228102	3300031456	Bacteria	1677
645	Ga0307513_10288285	3300031456	Bacteria	1415
646	Ga0307509_10001193	3300031507	Bacteria	44217
647	Ga0307509_10074967	3300031507	Bacteria	3515
648	Ga0307408_100002421	3300031548	Bacteria	13124
649	Ga0307408_100021592	3300031548	Bacteria	4360
650	Ga0307408_100025202	3300031548	Bacteria	4071
651	Ga0307408_100043524	3300031548	Bacteria	3195
652	Ga0307408_100167687	3300031548	Bacteria	1750
653	Ga0307508_10006278	3300031616	Bacteria	11192
654	Ga0307508_10019253	3300031616	Bacteria	6205
655	Ga0307508_10193032	3300031616	Bacteria	1637
656	Ga0307516_10001226	3300031730	Bacteria	35691
657	Ga0307516_10008598	3300031730	Bacteria	11521
658	Ga0307516_10012997	3300031730	Bacteria	8919
659	Ga0307516_10075990	3300031730	Bacteria	3212
660	Ga0307516_10218790	3300031730	Bacteria	1615
661	Ga0307516_10231532	3300031730	Bacteria	1551
662	Ga0307405_10027018	3300031731	Bacteria	3321
663	Ga0307413_10108571	3300031824	Bacteria	1852
664	Ga0307410_10061105	3300031852	Bacteria	2578
665	Ga0307406_10000764	3300031901	Bacteria	18043
666	Ga0307406_10057928	3300031901	Bacteria	2487
667	Ga0307406_10102695	3300031901	Bacteria	1951
668	Ga0307412_10007292	3300031911	Bacteria	6270
669	Ga0307412_10011408	3300031911	Bacteria	5149
670	Ga0307409_100182330	3300031995	Bacteria	1860
671	Ga0307414_10022177	3300032004	Bacteria	4000
672	Ga0307414_10291531	3300032004	Bacteria	1376
673	Ga0307411_10109194	3300032005	Bacteria	1975
674	Ga0307415_100160681	3300032126	Bacteria	1741
675	Ga0307507_10009352	3300033179	Bacteria	13110
676	Ga0307507_10064060	3300033179	Bacteria	3396
677	Ga0307507_10077314	3300033179	Bacteria	2961
678	Ga0307510_10012015	3300033180	Bacteria	10262
679	Ga0307510_10061896	3300033180	Bacteria	3830
680	Ga0373939_0000013	3300035114	Bacteria	66615
681	Ga0373960_0007028	3300035121	Bacteria	2654
682	Ga0373943_0056692	3300035170	Bacteria	1945
683	Ga0373931_0000279	3300035691	Bacteria	21420
684	Ga0373931_0018296	3300035691	Bacteria	3483
685	Ga0373931_0181143	3300035691	Bacteria	1248
686	Ga0373935_0035047	3300035692	Bacteria	3131
687	Ga0373935_0092439	3300035692	Bacteria	1982
688	Ga0373927_0050843	3300035695	Bacteria	2680
689	Ga0373947_0090673	3300035725	Bacteria	1906
690	Ga0373925_0049042	3300037068	Bacteria	3147
691	Ga0373925_0099842	3300037068	Bacteria	2230
692	Ga0395900_0043219	3300037418	Bacteria	4644
693	Ga0395898_0039741	3300037466	Bacteria	4655
694	Ga0395898_0072656	3300037466	Bacteria	3323
695	Ga0395898_0095117	3300037466	Bacteria	2862
696	Ga0395898_0325119	3300037466	Bacteria	1467
697	Ga0395905_0041589	3300037471	Bacteria	4313
698	Ga0395905_0070028	3300037471	Bacteria	3286
699	Ga0395905_0107822	3300037471	Bacteria	2615
700	Ga0436364_0075591	3300037853	Bacteria	4217
701	Ga0436364_1018828	3300037853	Bacteria	24754
702	Ga0436364_1225556	3300037853	Bacteria	3514
703	Ga0436364_1300804	3300037853	Bacteria	1453
704	Ga0395901_0025654	3300038443	Bacteria	6051
705	Ga0395901_0112750	3300038443	Bacteria	2855
706	Ga0395901_0249166	3300038443	Bacteria	1851
707	Ga0395901_0384451	3300038443	Bacteria	1444
708	Ga0400483_043589	3300039062	Bacteria	3511
709	Ga0400483_043834	3300039062	Bacteria	4344
710	Ga0400483_115135	3300039062	Bacteria	1941
711	Ga0400483_120089	3300039062	Bacteria	12571
712	Ga0400483_128059	3300039062	Bacteria	2496
713	Ga0400483_151009	3300039062	Bacteria	2229
714	Ga0400483_177444	3300039062	Bacteria	8104
715	Ga0400483_200221	3300039062	Bacteria	19937
716	Ga0400483_273270	3300039062	Bacteria	7612
717	Ga0436365_0697045	3300039437	Bacteria	35162
718	Ga0436365_0917056	3300039437	Bacteria	16389
719	Ga0436365_1814187	3300039437	Bacteria	2931
720	Ga0436360_1182866	3300039438	Bacteria	3922
721	Ga0436361_0260778	3300039447	Bacteria	35153
722	Ga0436361_0419826	3300039447	Bacteria	59464
723	Ga0436361_0554437	3300039447	Bacteria	13048
724	Ga0436363_0051374	3300039450	Bacteria	36738
725	Ga0436363_0096055	3300039450	Bacteria	3514
726	Ga0436363_1131854	3300039450	Bacteria	3032
727	Ga0439438_001374	3300041405	Bacteria	10741
728	Ga0439447_014867	3300041407	Bacteria	2172
729	Ga0439465_0000587	3300041413	Bacteria	10986
730	Ga0451833_0127402	3300041491	Bacteria	8897
731	Ga0451837_0026161	3300041494	Bacteria	2715
732	Ga0451839_0422595	3300041496	Bacteria	27935
733	Ga0451841_0803346	3300041498	Bacteria	9620
734	Ga0451847_0272648	3300041503	Bacteria	5010
735	Ga0451851_0017097	3300041507	Bacteria	10133
736	Ga0451843_0109304	3300041509	Bacteria	3818
737	Ga0451855_0665781	3300041511	Bacteria	7192
738	Ga0451853_1686677	3300041512	Bacteria	20540
739	Ga0439431_0001751	3300041997	Bacteria	4792
740	Ga0439445_0001422	3300042004	Bacteria	5197
741	Ga0439432_003560	3300042006	Bacteria	5763
742	Ga0439432_004824	3300042006	Bacteria	4894
743	Ga0439449_0001607	3300042007	Bacteria	8856
744	Ga0439452_000002	3300042010	Bacteria	1377577
745	Ga0439452_002627	3300042010	Bacteria	6549
746	Ga0450918_006827	3300042531	Bacteria	2028
747	Ga0466972_0000185	3300044658	Bacteria	48335
748	Ga0466972_0002052	3300044658	Bacteria	9871
749	Ga0466972_0002529	3300044658	Bacteria	9049
750	Ga0453684_0001553	3300044712	Bacteria	64147
751	Ga0466968_0001076	3300044735	Bacteria	9679
752	Ga0466960_0001298	3300044901	Bacteria	9056
753	Ga0495617_004023	3300046452	Bacteria	5399
754	Ga0495592_0027569	3300046454	Eukaryota	4306
755	Ga0495603_0026561	3300046455	Bacteria	3497
756	Ga0495603_0080545	3300046455	Bacteria	1908
757	Ga0495590_0000354	3300046457	Bacteria	23639
758	Ga0495590_0002571	3300046457	Bacteria	7504
759	Ga0495590_0006514	3300046457	Bacteria	4558
760	Ga0495629_0000191	3300046459	Bacteria	55189
761	Ga0495629_0001613	3300046459	Bacteria	17723
762	Ga0495629_0014530	3300046459	Bacteria	5665
763	Ga0495629_0133863	3300046459	Bacteria	1726
764	Ga0495638_0001502	3300046460	Bacteria	21008
765	Ga0495638_0022955	3300046460	Bacteria	4088
766	Ga0495653_0000154	3300046463	Bacteria	57214
767	Ga0495653_0003717	3300046463	Bacteria	12342
768	Ga0495650_0000034	3300046471	Bacteria	410132
769	Ga0495650_0011159	3300046471	Bacteria	4949
770	Ga0495650_0051745	3300046471	Bacteria	1690
771	Ga0495580_0001077	3300046472	Bacteria	23964
772	Ga0495580_0002419	3300046472	Bacteria	16311
773	Ga0495580_0009083	3300046472	Bacteria	7838
774	Ga0495580_0111547	3300046472	Bacteria	1899
775	Ga0495582_0066799	3300046473	Bacteria	1987
776	Ga0495582_0133555	3300046473	Bacteria	1403
777	Ga0495605_0001702	3300046474	Bacteria	14108
778	Ga0495605_0004586	3300046474	Bacteria	8088
779	Ga0495639_0017388	3300046475	Bacteria	3123
780	Ga0495584_0000001	3300046491	Bacteria	649329
781	Ga0495585_0006343	3300046492	Bacteria	7344
782	Ga0495596_0002026	3300046500	Bacteria	11139
783	Ga0495607_0011040	3300046501	Bacteria	6033
784	Ga0495607_0112572	3300046501	Bacteria	1440
785	Ga0495583_0000095	3300046506	Bacteria	152114
786	Ga0495606_0015158	3300046507	Bacteria	5958
787	Ga0495606_0099350	3300046507	Bacteria	1774
788	Ga0495608_0001975	3300046511	Eukaryota	14694
789	Ga0495608_0135093	3300046511	Bacteria	1576
790	Ga0495610_0033786	3300046512	Bacteria	2640
791	Ga0495618_0000888	3300046514	Eukaryota	20605
792	Ga0495628_0000951	3300046516	Eukaryota	26604
793	Ga0495630_0010544	3300046517	Bacteria	6677
794	Ga0495630_0019401	3300046517	Bacteria	4998
795	Ga0495630_0026001	3300046517	Bacteria	4331
796	Ga0495630_0071318	3300046517	Bacteria	2614
797	Ga0495632_0000057	3300046519	Bacteria	123635
798	Ga0495643_0000022	3300046522	Bacteria	289691
799	Ga0495643_0000139	3300046522	Bacteria	117261
800	Ga0495643_0000718	3300046522	Bacteria	37860
801	Ga0495644_0036131	3300046523	Bacteria	1864
802	Ga0495648_0003655	3300046524	Bacteria	13454
803	Ga0495648_0013838	3300046524	Bacteria	5943
804	Ga0495648_0017856	3300046524	Bacteria	5055
805	Ga0495648_0022171	3300046524	Bacteria	4379
806	Ga0495648_0027794	3300046524	Bacteria	3779
807	Ga0495666_0001325	3300046526	Bacteria	11994
808	Ga0495652_0001099	3300046529	Eukaryota	30589
809	Ga0495652_0001279	3300046529	Bacteria	28174
810	Ga0495652_0004329	3300046529	Eukaryota	13596
811	Ga0495654_0000132	3300046530	Bacteria	80021
812	Ga0495654_0071594	3300046530	Bacteria	1642
813	Ga0495665_0004902	3300046531	Bacteria	7211
814	Ga0495665_0035427	3300046531	Bacteria	2666
815	Ga0495586_0003113	3300046535	Bacteria	8938
816	Ga0495586_0042491	3300046535	Bacteria	2448
817	Ga0495609_0002434	3300046538	Bacteria	11452
818	Ga0495609_0010228	3300046538	Bacteria	4507
819	Ga0495597_0000443	3300046542	Bacteria	35389
820	Ga0495597_0001779	3300046542	Bacteria	14802
821	Ga0495597_0009302	3300046542	Bacteria	4864
822	Ga0495645_0013346	3300046543	Eukaryota	5807
823	Ga0495645_0013874	3300046543	Bacteria	5711
824	Ga0495645_0067847	3300046543	Bacteria	2575
825	Ga0495645_0132760	3300046543	Bacteria	1743
826	Ga0495622_0068554	3300046557	Bacteria	1638
827	Ga0495633_0000277	3300046558	Bacteria	59502
828	Ga0495633_0082181	3300046558	Bacteria	1499
829	Ga0495633_0082916	3300046558	Bacteria	1492
830	Ga0495656_0017041	3300046615	Bacteria	2766
831	Ga0495656_0028127	3300046615	Bacteria	2253
832	Ga0495668_0002194	3300046616	Bacteria	16668
833	Ga0495668_0003852	3300046616	Bacteria	10976
834	Ga0495634_0001820	3300046642	Eukaryota	18410
835	Ga0495611_0027276	3300046648	Bacteria	2496
836	Ga0495625_0009581	3300046660	Bacteria	8090
837	Ga0495625_0012055	3300046660	Bacteria	7015
838	Ga0495625_0106178	3300046660	Bacteria	1923
839	Ga0495635_0000935	3300046663	Bacteria	19257
840	Ga0495635_0196417	3300046663	Eukaryota	1369
841	Ga0495661_0057663	3300046665	Bacteria	2318
842	Ga0495588_0089797	3300046674	Bacteria	1609
843	Ga0495657_0001723	3300046675	Eukaryota	18733
844	Ga0495599_0003111	3300046678	Eukaryota	9669
845	Ga0495599_0044651	3300046678	Bacteria	2779
846	Ga0495623_0000146	3300046679	Eukaryota	43305
847	Ga0495623_0136915	3300046679	Bacteria	1460
848	Ga0495646_0000205	3300046680	Eukaryota	29082
849	Ga0495646_0000344	3300046680	Bacteria	23805
850	Ga0495646_0000595	3300046680	Bacteria	19648
851	Ga0495646_0001430	3300046680	Bacteria	14199
852	Ga0495647_0075540	3300046681	Bacteria	1357
853	Ga0495669_0002387	3300046684	Bacteria	7704
854	Ga0495669_0046498	3300046684	Bacteria	1937
855	Ga0495669_0067029	3300046684	Bacteria	1631
856	Ga0495613_0011170	3300046689	Bacteria	6668
857	Ga0495613_0017277	3300046689	Bacteria	5376
858	Ga0495624_0005121	3300046690	Eukaryota	9472
859	Ga0495624_0006904	3300046690	Bacteria	8008
860	Ga0495624_0008741	3300046690	Bacteria	7048
861	Ga0495624_0028718	3300046690	Bacteria	3632
862	Ga0495624_0049228	3300046690	Bacteria	2673
863	Ga0495624_0138525	3300046690	Bacteria	1491
864	Ga0495670_0007432	3300046691	Bacteria	5378
865	Ga0495670_0048726	3300046691	Bacteria	2119
866	Ga0495671_0018537	3300046692	Bacteria	3693
867	Ga0495671_0023545	3300046692	Bacteria	3217
868	Ga0495671_0051453	3300046692	Bacteria	2049
869	Ga0495649_0073870	3300046694	Bacteria	1826
870	Ga0495589_0003586	3300046794	Bacteria	8387
871	Ga0495660_0008053	3300046810	Bacteria	6192
872	Ga0495581_0011857	3300047315	Bacteria	5044
873	Ga0495604_0092634	3300047317	Bacteria	2238
874	Ga0495674_0002091	3300047319	Bacteria	19591
875	Ga0495674_0007360	3300047319	Bacteria	10527
876	Ga0495674_0015224	3300047319	Eukaryota	7194
877	Ga0495674_0142394	3300047319	Bacteria	2015
878	Ga0495674_0279135	3300047319	Bacteria	1369
879	Ga0495676_0000392	3300047321	Eukaryota	35442
880	Ga0495676_0007517	3300047321	Bacteria	9991
881	Ga0495680_0158021	3300047322	Bacteria	1648
882	Ga0495683_0000005	3300047323	Bacteria	287871
883	Ga0495683_0002262	3300047323	Bacteria	11749
884	Ga0495683_0026519	3300047323	Bacteria	2965
885	Ga0495687_000018	3300047443	Bacteria	342973
886	Ga0495687_006007	3300047443	Bacteria	7567
887	Ga0495687_040202	3300047443	Bacteria	2062
888	Ga0495675_0072105	3300047444	Bacteria	2179
889	Ga0495679_000117	3300047446	Bacteria	69653
890	Ga0495679_000559	3300047446	Bacteria	26086
891	Ga0495673_0026998	3300047469	Bacteria	2736
892	Ga0495673_0091480	3300047469	Bacteria	1243
893	Ga0495684_0175116	3300047471	Eukaryota	1593
894	Ga0495602_0045406	3300048088	Eukaryota	3975
895	Ga0495602_0060562	3300048088	Bacteria	3297
896	Ga0495602_0092187	3300048088	Eukaryota	2511
897	Ga0495614_0024326	3300048089	Bacteria	2615
898	Ga0495626_0017604	3300048091	Bacteria	3605
899	Ga0496100_0005203	3300048903	Bacteria	6984
900	Ga0496100_0052714	3300048903	Bacteria	2646
901	Ga0496100_0245703	3300048903	Bacteria	1322
902	Ga0496101_0000185	3300048904	Bacteria	49057
903	Ga0496101_0046465	3300048904	Bacteria	3114
904	Ga0496101_0185834	3300048904	Bacteria	1602
905	Ga0496102_0005644	3300048905	Bacteria	10619
906	Ga0496102_0068972	3300048905	Bacteria	3245
907	Ga0496102_0079193	3300048905	Bacteria	3026
908	Ga0496102_0175095	3300048905	Bacteria	2020
909	Ga0496103_0016607	3300048906	Bacteria	4393
910	Ga0496103_0068175	3300048906	Bacteria	2223
911	Ga0496104_0003041	3300048907	Bacteria	14445
912	Ga0496104_0060729	3300048907	Bacteria	3581
913	Ga0496105_0042131	3300048908	Bacteria	3763
914	Ga0496105_0093279	3300048908	Bacteria	2486
915	Ga0496105_0279253	3300048908	Bacteria	1347
916	Ga0496106_0001095	3300048909	Bacteria	20014
917	Ga0496106_0002744	3300048909	Bacteria	13030
918	Ga0496106_0029615	3300048909	Bacteria	4081
919	Ga0496106_0168844	3300048909	Bacteria	1733
920	Ga0496106_0353627	3300048909	Bacteria	1180
921	Ga0496107_0016585	3300048910	Bacteria	5174
922	Ga0496108_0001294	3300048911	Bacteria	19653
923	Ga0496108_0007433	3300048911	Bacteria	8882
924	Ga0496108_0010197	3300048911	Bacteria	7630
925	Ga0496108_0045077	3300048911	Bacteria	3682
926	Ga0496108_0051572	3300048911	Bacteria	3447
927	Ga0496109_0005297	3300048912	Bacteria	10779
928	Ga0496109_0005404	3300048912	Bacteria	10684
929	Ga0496109_0038687	3300048912	Bacteria	4313
930	Ga0496110_0000670	3300048913	Bacteria	23510
931	Ga0496110_0006716	3300048913	Bacteria	9147
932	Ga0496110_0027364	3300048913	Bacteria	4888
933	Ga0496111_0005107	3300048914	Bacteria	8355
934	Ga0496111_0016921	3300048914	Bacteria	5032
935	Ga0496111_0020836	3300048914	Bacteria	4570
936	Ga0496111_0030533	3300048914	Bacteria	3833
937	Ga0496112_0000428	3300048915	Bacteria	27788
938	Ga0496112_0010782	3300048915	Bacteria	8313
939	Ga0496112_0201768	3300048915	Bacteria	1948
940	Ga0496113_0007738	3300048916	Bacteria	6937
941	Ga0496114_0018140	3300048917	Bacteria	5686
942	Ga0496114_0170346	3300048917	Bacteria	1897
943	Ga0496115_0033420	3300048918	Bacteria	4061
944	Ga0496115_0122408	3300048918	Bacteria	2141
945	Ga0496115_0188108	3300048918	Bacteria	1706
946	Ga0496116_0017779	3300048919	Bacteria	5506
947	Ga0496116_0018738	3300048919	Bacteria	5321
948	Ga0496116_0112887	3300048919	Bacteria	1591
949	Ga0496117_0013966	3300048920	Bacteria	6959
950	Ga0496117_0035365	3300048920	Bacteria	3749
951	Ga0496117_0070720	3300048920	Bacteria	2342
952	Ga0496118_0001482	3300048921	Bacteria	35136
953	Ga0496118_0005832	3300048921	Bacteria	13804
954	Ga0496118_0066392	3300048921	Bacteria	2633
955	Ga0496119_0000005	3300048922	Bacteria	529799
956	Ga0496119_0000523	3300048922	Bacteria	52176
957	Ga0496119_0028866	3300048922	Bacteria	3775
958	Ga0496120_0000005	3300048923	Bacteria	529797
959	Ga0496120_0002461	3300048923	Bacteria	18659
960	Ga0496120_0002583	3300048923	Bacteria	18033
961	Ga0496121_0000261	3300048924	Bacteria	110085
962	Ga0496121_0004457	3300048924	Bacteria	18807
963	Ga0496121_0007689	3300048924	Bacteria	12941
964	Ga0496121_0019824	3300048924	Bacteria	6699
965	Ga0496121_0049643	3300048924	Bacteria	3555
966	Ga0496121_0053421	3300048924	Bacteria	3385
967	Ga0496121_0054300	3300048924	Bacteria	3349
968	Ga0496121_0058032	3300048924	Bacteria	3204
969	Ga0496121_0061870	3300048924	Bacteria	3069
970	Ga0496121_0240448	3300048924	Bacteria	1262
971	Ga0496122_0000701	3300048925	Bacteria	66268
972	Ga0496122_0016559	3300048925	Bacteria	6962
973	Ga0496122_0033669	3300048925	Bacteria	4208
974	Ga0496122_0078870	3300048925	Bacteria	2304
975	Ga0496122_0114125	3300048925	Bacteria	1763
976	Ga0496123_0000026	3300048926	Bacteria	318040
977	Ga0496123_0000967	3300048926	Bacteria	44394
978	Ga0496123_0004113	3300048926	Bacteria	15595
979	Ga0496123_0011352	3300048926	Bacteria	7733
980	Ga0496123_0017783	3300048926	Bacteria	5696
981	Ga0496123_0050192	3300048926	Bacteria	2789
982	Ga0496124_0000007	3300048927	Bacteria	883534
983	Ga0496124_0000396	3300048927	Bacteria	79566
984	Ga0496124_0000600	3300048927	Bacteria	60608
985	Ga0496124_0001462	3300048927	Bacteria	34873
986	Ga0496124_0002237	3300048927	Bacteria	25740
987	Ga0496124_0009748	3300048927	Bacteria	9829
988	Ga0496124_0015610	3300048927	Bacteria	7270
989	Ga0496124_0148121	3300048927	Bacteria	1845
990	Ga0496125_0000136	3300048928	Bacteria	160544
991	Ga0496125_0005728	3300048928	Bacteria	13676
992	Ga0496125_0011083	3300048928	Bacteria	9044
993	Ga0496125_0022147	3300048928	Bacteria	5907
994	Ga0496125_0045526	3300048928	Bacteria	3691
995	Ga0496125_0060816	3300048928	Bacteria	3033
996	Ga0496126_0010927	3300048929	Bacteria	9456
997	Ga0496126_0024039	3300048929	Bacteria	5889
998	Ga0496126_0054732	3300048929	Bacteria	3612
999	Ga0496126_0138271	3300048929	Bacteria	2099
1000	Ga0495678_000013	3300049459	Bacteria	316375
1001	Ga0495678_000103	3300049459	Bacteria	103891
1002	Ga0495678_003237	3300049459	Bacteria	10209
1003	Ga0501031_0060355	3300049568	Bacteria	2471
1004	Ga0501032_0004834	3300049569	Bacteria	10101
1005	Ga0501032_0032468	3300049569	Bacteria	3578
1006	Ga0501032_0093455	3300049569	Bacteria	1994
1007	Ga0501033_0003535	3300049570	Bacteria	12786
1008	Ga0501033_0011363	3300049570	Bacteria	6812
1009	Ga0501033_0127189	3300049570	Bacteria	1847
1010	Ga0501034_0018898	3300049571	Bacteria	7059
1011	Ga0501034_0019360	3300049571	Bacteria	6962
1012	Ga0501036_0013057	3300049572	Bacteria	6899
1013	Ga0501036_0037335	3300049572	Bacteria	4110
1014	Ga0501036_0100242	3300049572	Bacteria	2450
1015	Ga0501037_0000035	3300049573	Bacteria	125589
1016	Ga0501037_0001416	3300049573	Bacteria	17600
1017	Ga0501037_0031020	3300049573	Bacteria	3947
1018	Ga0501037_0149610	3300049573	Bacteria	1669
1019	Ga0501038_0022431	3300049574	Bacteria	5657
1020	Ga0501039_0033767	3300049575	Bacteria	3947
1021	Ga0501043_0000009	3300049579	Bacteria	214823
1022	Ga0501043_0000031	3300049579	Bacteria	140707
1023	Ga0501043_0006559	3300049579	Bacteria	9335
1024	Ga0501046_0000022	3300049580	Bacteria	215451
1025	Ga0501047_0000021	3300049581	Bacteria	254841
1026	Ga0501047_0021838	3300049581	Bacteria	6146
1027	Ga0501047_0037359	3300049581	Bacteria	4696
1028	Ga0501047_0060895	3300049581	Bacteria	3641
1029	Ga0501047_0117522	3300049581	Bacteria	2541
1030	Ga0501047_0188891	3300049581	Bacteria	1924
1031	Ga0501048_0000955	3300049582	Bacteria	21344
1032	Ga0501048_0154095	3300049582	Bacteria	1625
1033	Ga0501069_0000195	3300049585	Bacteria	26867
1034	Ga0501069_0151047	3300049585	Bacteria	1335
1035	Ga0501070_0000202	3300049586	Bacteria	55898
1036	Ga0501070_0137163	3300049586	Bacteria	2020
1037	Ga0501073_0087383	3300049589	Bacteria	2168
1038	Ga0501074_0000024	3300049590	Bacteria	68886
1039	Ga0501074_0058431	3300049590	Bacteria	2779
1040	Ga0501080_0000811	3300049742	Bacteria	25469
1041	Ga0501080_0082653	3300049742	Bacteria	2983
1042	Ga0501083_0003674	3300049744	Bacteria	10769
1043	Ga0501035_0000036	3300049822	Bacteria	165008
1044	Ga0501035_0013077	3300049822	Bacteria	7659
1045	Ga0501035_0021949	3300049822	Bacteria	5865
1046	Ga0501035_0022175	3300049822	Bacteria	5833
1047	Ga0501035_0119629	3300049822	Bacteria	2303
1048	Ga0501044_0000011	3300049823	Bacteria	257385
1049	Ga0501044_0011412	3300049823	Bacteria	9624
1050	Ga0501044_0029556	3300049823	Bacteria	5777
1051	Ga0501044_0088383	3300049823	Bacteria	3128
1052	Ga0501044_0125882	3300049823	Bacteria	2560
1053	nmdc:mga03683_10560_c1	3300050489	Bacteria	3315
1054	nmdc:mga0yw44_14605_c2	3300050492	Bacteria	1521
1055	nmdc:mga0yw44_2406_c1	3300050492	Bacteria	7962
1056	nmdc:mga0yw44_365507_c1	3300050492	Bacteria	973
1057	nmdc:mga0yw44_95335_c1	3300050492	Bacteria	1887
1058	nmdc:mga0k408_126863_c1	3300050493	Bacteria	1514
1059	nmdc:mga06z11_34871_c1	3300050494	Bacteria	2472
1060	nmdc:mga07m45_14060_c1	3300050496	Bacteria	4257
1061	nmdc:mga07m45_24746_c1	3300050496	Bacteria	3291
1062	nmdc:mga07m45_3142_c1	3300050496	Bacteria	7917
1063	nmdc:mga07m45_73630_c1	3300050496	Bacteria	1945
1064	nmdc:mga05p37_11307_c1	3300050507	Bacteria	10618
1065	nmdc:mga05p37_274270_c1	3300050507	Bacteria	2014
1066	nmdc:mga05p37_293551_c1	3300050507	Bacteria	1934
1067	nmdc:mga0n895_79866_c1	3300050512	Bacteria	3258
1068	nmdc:mga0rr50_15727_c1	3300050513	Bacteria	5002
1069	nmdc:mga0rr50_303318_c1	3300050513	Bacteria	1336
1070	nmdc:mga0rr50_37637_c1	3300050513	Bacteria	3494
1071	nmdc:mga08x19_61364_c1	3300050514	Bacteria	2436
1072	nmdc:mga0sz30_1100_c1	3300050516	Bacteria	8151
1073	nmdc:mga0sz30_42288_c1	3300050516	Bacteria	1580
1074	Ga0495619_0156651	3300053085	Bacteria	1572
1075	Ga0500566_0004620	3300053094	Bacteria	8193
1076	Ga0500641_0020047	3300053096	Bacteria	2534
1077	Ga0500650_0009526	3300053098	Bacteria	3904
1078	Ga0500556_0000216	3300053104	Bacteria	46888
1079	Ga0500569_048107	3300053109	Bacteria	1276
1080	Ga0500595_012004	3300053119	Bacteria	3362
1081	Ga0500614_003294	3300053123	Bacteria	3494
1082	Ga0500642_0000012	3300053130	Bacteria	206424
1083	Ga0500658_0000025	3300053134	Bacteria	113309
1084	Ga0500559_0000167	3300053136	Bacteria	51877
1085	Ga0500559_0011728	3300053136	Bacteria	3737
1086	Ga0500590_037283	3300053148	Bacteria	2512
1087	Ga0500590_058679	3300053148	Bacteria	1938
1088	Ga0500604_0003890	3300053151	Bacteria	3989
1089	Ga0500616_0000515	3300053153	Bacteria	48965
1090	Ga0500622_0022403	3300053156	Bacteria	3350
1091	Ga0500636_0000606	3300053177	Bacteria	19490
1092	Ga0500636_0050453	3300053177	Bacteria	2447
1093	Ga0500637_0089109	3300053178	Bacteria	1785
1094	Ga0500645_024417	3300053730	Bacteria	1848
1095	2885305859	2885305155	Bacteria	7348390
1096	2501407081	2501025504	Bacteria	8008976
1097	2507510971	2507262055	Bacteria	8048963
1098	2508544793	2508501009	Bacteria	7784016
1099	2508696979	2508501042	Bacteria	8719808
1100	2508726304	2508501050	Bacteria	9633614
1101	2509140440	2508501127	Bacteria	7037543
1102	2509146387	2508501128	Bacteria	8613869
1103	2509441747	2509276033	Bacteria	7180565
1104	2510248373	2510065045	Bacteria	7761063
1105	2510892198	2510461076	Bacteria	8618824
1106	2511092159	2510917013	Bacteria	9951648
1107	2511092684	2510917013	Bacteria	9951648
1108	2511097975	2510917014	Bacteria	8296963
1109	2511108161	2510917015	Bacteria	7950052
1110	2511170067	2510917026	Bacteria	7046020
1111	2511186564	2510917028	Bacteria	6185411
1112	2511437347	2511231035	Bacteria	5341610
1113	2512349692	2512047030	Bacteria	9031815
1114	2513623455	2513237092	Bacteria	8341956
1115	2513701436	2513237102	Bacteria	7703324
1116	2513870874	2513237138	Bacteria	7368160
1117	2513952443	2513237150	Bacteria	6553639
1118	2514041665	2513237165	Bacteria	6771773
1119	2515625474	2515154112	Bacteria	8294334
1120	2515644574	2515154114	Bacteria	7848616
1121	2515683150	2515154122	Bacteria	8609520
1122	2516019780	2515154189	Bacteria	9629850
1123	2517566803	2517487022	Bacteria	7227575
1124	2517889865	2517572143	Bacteria	9484767
1125	2521559271	2521172590	Bacteria	5047645
1126	2524442950	2524023205	Bacteria	8918781
1127	2524465857	2524023210	Bacteria	9029266
1128	2530648704	2529292951	Bacteria	6916614
1129	2558861370	2558860100	Bacteria	8458965
1130	2585205363	2582581294	Bacteria	6626667
1131	2585397886	2582581866	Bacteria	6859583
1132	2585526958	2585427526	Bacteria	7258840
1133	2585820571	2585427590	Bacteria	6824633
1134	2596373634	2595698237	Bacteria	6712432
1135	2597813919	2597489875	Bacteria	7010078
1136	2599410857	2599185169	Bacteria	5441380
1137	2599735635	2599185239	Bacteria	8686614
1138	2601521628	2600255254	Bacteria	5281859
1139	2601526653	2600255255	Bacteria	5282785
1140	2601613483	2600255280	Bacteria	5292309
1141	2601622386	2600255281	Bacteria	5288753
1142	2601650422	2600255288	Bacteria	5282738
1143	2601655711	2600255289	Bacteria	5281907
1144	2601656958	2600255290	Bacteria	5282218
1145	2601704755	2600255300	Bacteria	5287774
1146	2601709784	2600255301	Bacteria	5280532
1147	2601714796	2600255302	Bacteria	5288235
1148	2601725202	2600255304	Bacteria	5283973
1149	2601729744	2600255305	Bacteria	5282329
1150	2601734761	2600255306	Bacteria	5281613
1151	2601743807	2600255307	Bacteria	5439064
1152	2601754275	2600255309	Bacteria	5431045
1153	2602021726	2600255392	Bacteria	5437392
1154	2603837116	2602042103	Bacteria	5284714
1155	2603842192	2602042104	Bacteria	5281639
1156	2603847265	2602042105	Bacteria	5282303
1157	2603852336	2602042106	Bacteria	5282744
1158	2603857426	2602042107	Bacteria	6226103
1159	2603870389	2602042110	Bacteria	5283285
1160	2606047580	2603880178	Bacteria	5283018
1161	2606145917	2603880202	Bacteria	5284684
1162	2606174981	2603880211	Bacteria	5284226
1163	2616297755	2615840624	Bacteria	6557588
1164	2637225751	2636415599	Bacteria	5718434
1165	2643806834	2643221557	Bacteria	7184309
1166	2643814614	2643221558	Bacteria	5460675
1167	2643865558	2643221570	Bacteria	5103772
1168	2643910276	2643221580	Bacteria	3816678
1169	2644066627	2643221610	Bacteria	7480339
1170	2644156356	2643221627	Bacteria	6761570
1171	2644296259	2643221652	Bacteria	5140275
1172	2644379380	2643221668	Bacteria	7306521
1173	2644415161	2643221675	Bacteria	7473456
1174	2644451572	2643221680	Bacteria	7473610
1175	2644647794	2643221717	Bacteria	5676132
1176	2644693053	2643221726	Bacteria	7455827
1177	2657685841	2657244999	Bacteria	5946535
1178	2676408038	2675903046	Bacteria	5451247
1179	2719389823	2718217927	Bacteria	6972593
1180	2719643198	2718217991	Bacteria	7829542
1181	2721403466	2718218423	Bacteria	6438183
1182	2724035042	2721755809	Bacteria	6438790
1183	2728751742	2728368998	Bacteria	8720350
1184	2739243150	2738543012	Bacteria	7115078
1185	2745076895	2744054633	Bacteria	8678936
1186	2746089863	2744054900	Bacteria	8399525
1187	2746098090	2744054901	Bacteria	8397047
1188	2753460412	2751185821	Bacteria	6189929
1189	2765568561	2765235838	Bacteria	5445269
1190	2774873439	2773857925	Bacteria	6472445
1191	2776263892	2775506901	Bacteria	9631051
1192	2777023602	2775507074	Bacteria	5532402
1193	2793083749
1194	2793312917	2791355259	Bacteria	7254731
1195	2793340791	2791355263	Bacteria	6872478
1196	2793357104	2791355265	Bacteria	6539969
1197	2793361867	2791355266	Bacteria	7116587
1198	2793367420	2791355267	Bacteria	7222458
1199	2804755370	2802429268	Bacteria	6094027
1200	2806076258	2802429637	Bacteria	7067217
1201	2808970600	2808606384	Bacteria	8474373
1202	2809005293	2808606390	Bacteria	8476311
1203	2809012306	2808606391	Bacteria	8308166
1204	2809128874	2808606415	Bacteria	4576710
1205	2809148495	2808606419	Bacteria	4576925
1206	2816473724	2816332133	Bacteria	7249298
1207	2819615787	2818991449	Bacteria	5518009
1208	2824607997	2824600985	Bacteria	8488197
1209	2824616508	2824609381	Bacteria	8672835
1210	2824624684	2824617872	Bacteria	8814715
1211	2824633281	2824626560	Bacteria	8813858
1212	2824640633	2824635225	Bacteria	8785348
1213	2824649839	2824644064	Bacteria	8743947
1214	2824657836	2824653114	Bacteria	8493680
1215	2824711145	2824704595	Bacteria	9667483
1216	2824720097	2824714736	Bacteria	8717648
1217	2824728485	2824723954	Bacteria	8758240
1218	2824762876	2824753945	Bacteria	9787441
1219	2824770545	2824763712	Bacteria	9792355
1220	2838028879	2838022645	Bacteria	6494267
1221	2838663850	2838661181	Bacteria	7385261
1222	2838686168	2838680041	Bacteria	6545511
1223	2838700461	2838694306	Bacteria	6853137
1224	2838713740	2838707686	Bacteria	6619912
1225	2839096560	2839094727	Bacteria	5534556
1226	2841865787	2841864319	Bacteria	6742987
1227	2842083107	2842077413	Bacteria	6508645
1228	2842124085	2842118031	Bacteria	7033875
1229	2842204903	2842198810	Bacteria	6608673
1230	2842210827	2842205361	Bacteria	6340321
1231	2842243153	2842237096	Bacteria	6620661
1232	2842284281	2842278818	Bacteria	6340002
1233	2842297366	2842291075	Bacteria	7076806
1234	2842309086	2842304105	Bacteria	7023636
1235	2842345765	2842341865	Bacteria	7003929
1236	2842364033	2842363717	Bacteria	6844742
1237	2842376213	2842370503	Bacteria	7038661
1238	2842383760	2842377471	Bacteria	7140707
1239	2842390899	2842384541	Bacteria	7057858
1240	2842694953	2842694124	Bacteria	4063419
1241	2842737112	2842733646	Bacteria	5716726
1242	2842750362	2842747753	Bacteria	5578255
1243	2842779755	2842775625	Bacteria	5587290
1244	2844535035	2844533157	Bacteria	7517899
1245	2847938532	2847930680	Bacteria	9342022
1246	2850082835	2850079185	Bacteria	6848280
1247	2852621029	2852618963	Bacteria	4577824
1248	2854684600	2854681122	Bacteria	4548679
1249	2856336052	2856334872	Bacteria	7037011
1250	2856344137	2856342000	Bacteria	7176905
1251	2857512160	2857509624	Bacteria	7472071
1252	2857526806	2857524615	Bacteria	6615449
1253	2857541780	2857537821	Bacteria	5248181
1254	2857597091	2857591370	Bacteria	6569758
1255	2858954940	2858950400	Bacteria	6783797
1256	2861694138	2861691609	Bacteria	5628931
1257	2863423594	2863421361	Bacteria	7300805
1258	2866613558	2866612099	Bacteria	7543886
1259	2869278928	2869278585	Bacteria	7077053
1260	2871499977	2871495908	Bacteria	6935695
1261	2874123944	2874123672	Bacteria	7238285
1262	2874597711	2874590934	Bacteria	8299676
1263	2874615788	2874612657	Bacteria	8252029
1264	2874649273	2874645413	Bacteria	8214782
1265	2876378863	2876377896	Bacteria	6565995
1266	2876605374	2876601092	Bacteria	5114497
1267	2876762438	2876761206	Bacteria	10111113
1268	2876774816	2876771140	Bacteria	8287509
1269	2876822432	2876818435	Bacteria	8274608
1270	2878764120	2878760144	Bacteria	6823465
1271	2878771168	2878767105	Bacteria	6898628
1272	2878784817	2878781027	Bacteria	6834456
1273	2879077904	2879074833	Bacteria	8279565
1274	2879086224	2879083081	Bacteria	8587928
1275	2879132544	2879127579	Bacteria	8294491
1276	2879146043	2879142872	Bacteria	8267021
1277	2881370652	2881364244	Bacteria	7710352
1278	2881667407	2881665667	Bacteria	8175609
1279	2881863085	2881861095	Bacteria	7128710
1280	2881929899	2881927736	Bacteria	3993927
1281	2883092005	2883087390	Bacteria	9532701
1282	2885194914	2885192300	Bacteria	5882526
1283	2885273401	2885270888	Bacteria	9831543
1284	2885321108	2885318864	Bacteria	6729568
1285	2885329131	2885326080	Bacteria	7134805
1286	2885345852	2885342637	Bacteria	7011821
1287	2887378764	2887375801	Bacteria	5334027
1288	2888347649	2888343758	Bacteria	6611049
1289	2888421963	2888419890	Bacteria	7857137
1290	2889040437	2889033259	Bacteria	9099371
1291	2889306991	2889306138	Bacteria	6358934
1292	2893069969	2893066018	Bacteria	6158120
1293	2899361677	2899359706	Bacteria	10940472
1294	2902686579	2902682994	Bacteria	8951596
1295	2904443679	2904439833	Bacteria	5931679
1296	2904482522	2904479285	Bacteria	5073931
1297	2904513394	2904513164	Bacteria	5476410
1298	2904532577	2904530477	Bacteria	5876334
1299	2904569559	2904564687	Bacteria	7609577
1300	2904576870	2904571731	Bacteria	7608790
1301	2904605604	2904601388	Bacteria	5884906
1302	2904719182	2904711408	Bacteria	9771557
1303	2906651555	2906643746	Bacteria	8722424
1304	2909045360	2909042592	Bacteria	6499737
1305	2913296879	2913295892	Bacteria	6333755
1306	2917740218	2917736166	Bacteria	9690793
1307	2919046772	2919046199	Bacteria	5567169
1308	2919077683	2919073203	Bacteria	6531949
1309	2919081391	2919079590	Bacteria	5946433
1310	2922153939	2922151315	Bacteria	6902399
1311	2924759721	2924754689	Bacteria	6774424
1312	2924788771	2924784321	Bacteria	7416538
1313	2925333412	2925326138	Bacteria	9652120
1314	2926760115	2926754445	Bacteria	5964435
1315	2928128473	2928125067	Bacteria	5937560
1316	2928157810	2928157003	Bacteria	7522202
1317	2928165576	2928163908	Bacteria	7561269
1318	2928177775	2928170801	Bacteria	8785406
1319	2928537039	2928536128	Bacteria	7657547
1320	2929521685	2929520902	Bacteria	6765052
1321	2933575505	2933570622	Bacteria	7023390
1322	2935612790	2935608549	Bacteria	8203142
1323	2935655416	2935648319	Bacteria	8801166
1324	2935664283	2935656913	Bacteria	8965014
1325	2935824280	2935819856	Bacteria	8261050
1326	2935852574	2935847175	Bacteria	8228321
1327	2935900778	2935894831	Bacteria	6620579
1328	2935912279	2935908558	Bacteria	8568796
1329	2935924047	2935916978	Bacteria	9113783
1330	2935929308	2935926038	Bacteria	8601059
1331	2935935939	2935934488	Bacteria	8602579
1332	2935950447	2935942939	Bacteria	8599779
1333	2935957395	2935951376	Bacteria	8602333
1334	2935968426	2935967501	Bacteria	8603075
1335	2935976615	2935975950	Bacteria	8347125
1336	2935987941	2935984226	Bacteria	8302647
1337	2936018353	2936011229	Bacteria	8801034
1338	2936026884	2936019824	Bacteria	8804134
1339	2936035752	2936028420	Bacteria	8965941
1340	2936053831	2936046547	Bacteria	8903709
1341	2936058645	2936055302	Bacteria	8785755
1342	2936373824	2936367885	Bacteria	7324495
1343	2936382413	2936381700	Bacteria	7006523
1344	2937998636	2937994558	Bacteria	7036190
1345	2958058365	2958041894	Bacteria	13082850
1346	2958123580	2958122699	Bacteria	7280457
1347	2958169114	2958165035	Bacteria	6906348
1348	2961167574	2961163497	Bacteria	6901077
1349	2965022395	2965018300	Bacteria	6883036
1350	2965033484	2965032056	Bacteria	6887443
1351	2965118432	2965110997	Bacteria	6693150
1352	2968175979	2968171901	Bacteria	6894245
1353	2969082748	2969079654	Bacteria	5439582
1354	2970530274	2970524798	Bacteria	6840927
1355	2970547791	2970540015	Bacteria	6977556
1356	2970558965	2970554993	Bacteria	6814252
1357	2970593522	2970593180	Bacteria	7073582
1358	2974321933	2974320154	Bacteria	4571377
1359	2977880160	2977872689	Bacteria	7270173
1360	2977962519	2977957713	Bacteria	6877875
1361	2979793852	2979793036	Bacteria	6808957
1362	2981990827	2981990288	Bacteria	7590678
1363	2984559813	2984559226	Bacteria	5683096
1364	2984597895	2984595703	Bacteria	5682994
1365	2987663582	2987659509	Bacteria	6966464
1366	2987678873	2987673487	Bacteria	6884027
1367	3004192641	3004188549	Bacteria	6952365
1368	3004243610	3004239961	Bacteria	6892290
1369	3005485695	3005483717	Bacteria	7877331
1370	3005594517	3005587118	Bacteria	7794411
1371	639651501	639633055	Bacteria	7751309
1372	642415479	641736154	Bacteria	7689995
1373	644750938	644736347	Bacteria	6476522
1374	8003318560	8003314358	Bacteria	10575343
1375	8004403465	8004395343	Bacteria	6620908
1376	8004697376	8004695233	Bacteria	6731676
1377	8005275946	8005275841	Bacteria	6929066
1378	8005398205	8005395548	Bacteria	6806915
1379	8005695469	8005695170	Bacteria	6912330
1380	8006967259	8006964411	Bacteria	8966052
1381	8016633809	8016630954	Bacteria	9217207
1382	8016734486	8016733728	Bacteria	5274317
1383	8018180834	8018176218	Bacteria	6896178
1384	8018853168	8018845410	Bacteria	8933938
1385	8019503486	8019499862	Bacteria	5169538
1386	8019504629	8019499862	Bacteria	5169538
1387	8019625179	8019619141	Bacteria	9218857
1388	8019637001	8019629233	Bacteria	8687553
1389	8019642602	8019638758	Bacteria	9062356
1390	8019664839	8019659431	Bacteria	8577854
1391	8019674404	8019668869	Bacteria	8791617
1392	8020943302	8020938398	Bacteria	7472757
1393	8020949787	8020945358	Bacteria	8467355
1394	8020959414	8020953355	Bacteria	7439080
1395	8021121127	8021120328	Bacteria	8782274
1396	8039101859	8039098773	Bacteria	6602928
1397	8054566127	8054563764	Bacteria	5592885
1398	8055089222	8055087960	Bacteria	4784273
1399	8055099026	8055097453	Bacteria	4865496
1400	8055621715	8055617313	Bacteria	7548464
1401	8056381769	8056375014	Bacteria	7006639
1402	8056384400	8056382006	Bacteria	6408074
1403	8057306168	8057304971	Bacteria	4649742
1404	JGI24740J21852_10046273
1405	JGI24739J22299_10006412
1406	JGI24739J22299_10007282
1407	JGI24735J21928_10001681
1408	JGI24735J21928_10009232
1409	JGI24034J26672_10007179
1410	JGI25156J39149_1000412
1411	JGI25151J46595_10000318
1412	JGI25153J46596_10001487
1413	rootH2_10071456
1414	Ga0006562J51391_1051819
1415	Ga0006562J51391_1051821
1416	Ga0055539_1000025
1417	Ga0055533_1000034
1418	Ga0055532_1000878
1419	Ga0055532_1003125
1420	Ga0055525_1000044
1421	Ga0055525_1000084
1422	Ga0055527_1002574
1423	Ga0055535_1005058
1424	Ga0055542_1005184
1425	Ga0055529_1000403
1426	Ga0055529_1004398
1427	Ga0055530_10000530
1428	Ga0055540_1000131
1429	Ga0055540_1000179
1430	Ga0055540_1000210
1431	Ga0055540_1000268
1432	Ga0055540_1008451
1433	Ga0055531_10006153
1434	Ga0055541_1000019
1435	Ga0055541_1004454
1436	Ga0058692_1000056
1437	Ga0058692_1000479
1438	Ga0058692_1001035
1439	Ga0058692_1001620
1440	Ga0058692_1014604
1441	Ga0070658_10089382
1442	Ga0070676_10002892
1443	Ga0070676_10070634
1444	Ga0070676_10089912
1445	Ga0070676_10205980
1446	Ga0070690_100000071
1447	Ga0070690_100041725
1448	Ga0070670_100026292
1449	Ga0070670_100250007
1450	Ga0070677_10009493
1451	Ga0068869_100003521
1452	Ga0068869_100003727
1453	Ga0068869_100035841
1454	Ga0068869_100195192
1455	Ga0070666_10115565
1456	Ga0070680_100133922
1457	Ga0070682_100206727
1458	Ga0068868_100018499
1459	Ga0068868_100030245
1460	Ga0068868_100097176
1461	Ga0070660_100000003
1462	Ga0070689_100007369
1463	Ga0070689_100095504
1464	Ga0070661_100050660
1465	Ga0070661_100128329
1466	Ga0070668_100000806
1467	Ga0070668_100003299
1468	Ga0070668_100006317
1469	Ga0070668_100020398
1470	Ga0070668_100048282
1471	Ga0070668_100063769
1472	Ga0070668_100207383
1473	Ga0070669_100042600
1474	Ga0070669_100119135
1475	Ga0070675_100003353
1476	Ga0070675_100023424
1477	Ga0070675_100024829
1478	Ga0070675_100132067
1479	Ga0070675_100331253
1480	Ga0070671_100017097
1481	Ga0070674_100002887
1482	Ga0070674_100006304
1483	Ga0070674_100047171
1484	Ga0070674_100216859
1485	Ga0070674_100321990
1486	Ga0070673_100004659
1487	Ga0070673_100232605
1488	Ga0070688_100018223
1489	Ga0070659_100000024
1490	Ga0070659_100014302
1491	Ga0070659_100030499
1492	Ga0070659_100033782
1493	Ga0070667_100011367
1494	Ga0070667_100039835
1495	Ga0070667_100141206
1496	Ga0070709_10020309
1497	Ga0070714_100019619
1498	Ga0070713_100017835
1499	Ga0070713_100048639
1500	Ga0070710_10000593
1501	Ga0070701_10000068
1502	Ga0070711_100002985
1503	Ga0070711_100114159
1504	Ga0070700_100000434
1505	Ga0070700_100080893
1506	Ga0070700_100226603
1507	Ga0070694_100001492
1508	Ga0070708_100046016
1509	Ga0070663_100001496
1510	Ga0070663_100017250
1511	Ga0070663_100028319
1512	Ga0070663_100031398
1513	Ga0070663_100056110
1514	Ga0070663_100123714
1515	Ga0070663_100146275
1516	Ga0070678_100019847
1517	Ga0070678_100077900
1518	Ga0070662_100001744
1519	Ga0070662_100004545
1520	Ga0070662_100021387
1521	Ga0070662_100023609
1522	Ga0070681_10389736
1523	Ga0068867_100003837
1524	Ga0068867_100008458
1525	Ga0068867_100021916
1526	Ga0068867_100036030
1527	Ga0070685_10029154
1528	Ga0070706_100036139
1529	Ga0070698_100026784
1530	Ga0070699_100014514
1531	Ga0070699_100031993
1532	Ga0070684_100040760
1533	Ga0070697_100016346
1534	Ga0068853_100027974
1535	Ga0070672_100041518
1536	Ga0070672_100118677
1537	Ga0070686_100001003
1538	Ga0070695_100047345
1539	Ga0070696_100056351
1540	Ga0070693_100003038
1541	Ga0070665_100012629
1542	Ga0070665_100050454
1543	Ga0070665_100056841
1544	Ga0070665_100072112
1545	Ga0070704_100049761
1546	Ga0068855_100115271
1547	Ga0070664_100004490
1548	Ga0070664_100086492
1549	Ga0070664_100187746
1550	Ga0068854_100024686
1551	Ga0068854_100108977
1552	Ga0068854_100172764
1553	Ga0068856_100018066
1554	Ga0068856_100024804
1555	Ga0070702_100000040
1556	Ga0070702_100029438
1557	Ga0070702_100094542
1558	Ga0070702_100210802
1559	Ga0068852_100002517
1560	Ga0068852_100005074
1561	Ga0068852_100013050
1562	Ga0068852_100038541
1563	Ga0068852_100076744
1564	Ga0068859_100003009
1565	Ga0068859_100052232
1566	Ga0068859_100077509
1567	Ga0068866_10000853
1568	Ga0068866_10013094
1569	Ga0068866_10071652
1570	Ga0068861_100000658
1571	Ga0068861_100020241
1572	Ga0068861_100023361
1573	Ga0068861_100026137
1574	Ga0068861_100047883
1575	Ga0068861_100103940
1576	Ga0068861_100258960
1577	Ga0068851_10004637
1578	Ga0068851_10022648
1579	Ga0068851_10180600
1580	Ga0068870_10021546
1581	Ga0068870_10031381
1582	Ga0068863_100152386
1583	Ga0068858_100002874
1584	Ga0068858_100071870
1585	Ga0068858_100173469
1586	Ga0068858_100271017
1587	Ga0068858_100391838
1588	Ga0068860_100010860
1589	Ga0068860_100017504
1590	Ga0068860_100093516
1591	Ga0068860_100111210
1592	Ga0068860_100410589
1593	Ga0068862_100046175
1594	Ga0068862_100071793
1595	Ga0068862_100083756
1596	Ga0081455_10000955
1597	Ga0081455_10004789
1598	Ga0081455_10021968
1599	Ga0081455_10094363
1600	Ga0081455_10163397
1601	Ga0081538_10030985
1602	Ga0081540_1003844
1603	Ga0081540_1029797
1604	Ga0081539_10071479
1605	Ga0070717_10000962
1606	Ga0070717_10061301
1607	Ga0070717_10079525
1608	Ga0075365_10009979
1609	Ga0075365_10025010
1610	Ga0075365_10025132
1611	Ga0075365_10122693
1612	Ga0075368_10047647
1613	Ga0075363_100005910
1614	Ga0075363_100037006
1615	Ga0075364_10048254
1616	Ga0075432_10055416
1617	Ga0070715_10006481
1618	Ga0070716_100039281
1619	Ga0070712_100012061
1620	Ga0070712_100037513
1621	Ga0070712_100093778
1622	Ga0075362_10004746
1623	Ga0075362_10013233
1624	Ga0075367_10007404
1625	Ga0075367_10019631
1626	Ga0075367_10043705
1627	Ga0075369_10023898
1628	Ga0075369_10068597
1629	Ga0075366_10009908
1630	Ga0097621_100000540
1631	Ga0097621_100003716
1632	Ga0097621_100131694
1633	Ga0075370_10002998
1634	Ga0075370_10003754
1635	Ga0075370_10042412
1636	Ga0075370_10115702
1637	Ga0068871_100022588
1638	Ga0068871_100276681
1639	Ga0075428_100161192
1640	Ga0075428_100262605
1641	Ga0075428_100535664
1642	Ga0075433_10037855
1643	Ga0075433_10122826
1644	Ga0075434_100027653
1645	Ga0075434_100146301
1646	Ga0075434_100372461
1647	Ga0068865_100000529
1648	Ga0068865_100051454
1649	Ga0068865_100071155
1650	Ga0075436_100097601
1651	Ga0097620_100003009
1652	Ga0097620_100049566
1653	Ga0097620_100052235
1654	Ga0097620_100077506
1655	Ga0099825_1040743
1656	Ga0099824_1004100
1657	Ga0099824_1008875
1658	Ga0099823_1009013
1659	Ga0079104_1002023
1660	Ga0099826_10000004
1661	Ga0075435_100004518
1662	Ga0075435_100031084
1663	Ga0075435_100032893
1664	Ga0099795_10003924
1665	Ga0105251_10012153
1666	Ga0105251_10013357
1667	Ga0105251_10115324
1668	Ga0105244_10000668
1669	Ga0105244_10002135
1670	Ga0105244_10007286
1671	Ga0105244_10009698
1672	Ga0105244_10014827
1673	Ga0105244_10031235
1674	Ga0105250_10003240
1675	Ga0105250_10003638
1676	Ga0105250_10006897
1677	Ga0105250_10098082
1678	Ga0105240_10001236
1679	Ga0105240_10002844
1680	Ga0111539_10462380
1681	Ga0105245_10001373
1682	Ga0105245_10151604
1683	Ga0105247_10108857
1684	Ga0114129_10024966
1685	Ga0114129_10079480
1686	Ga0114129_10169820
1687	Ga0114129_10477685
1688	Ga0105243_10000265
1689	Ga0105243_10005295
1690	Ga0105243_10006524
1691	Ga0105242_10000363
1692	Ga0105242_10038254
1693	Ga0105242_10284518
1694	Ga0105248_10003176
1695	Ga0105248_10003306
1696	Ga0105248_10035287
1697	Ga0105237_10001202
1698	Ga0105237_10039679
1699	Ga0105237_10130762
1700	Ga0105237_10136247
1701	Ga0105237_10503432
1702	Ga0105238_10000712
1703	Ga0105238_10006297
1704	Ga0105238_10301698
1705	Ga0105238_10309674
1706	Ga0105249_10005435
1707	Ga0105249_10028890
1708	Ga0105239_10006022
1709	Ga0105239_10026915
1710	Ga0105239_10035434
1711	Ga0105239_10274698
1712	Ga0105246_10007546
1713	Ga0105246_10055765
1714	Ga0157373_10002930
1715	Ga0157373_10004080
1716	Ga0157373_10106069
1717	Ga0157371_10006105
1718	Ga0157371_10021703
1719	Ga0157371_10188664
1720	Ga0157370_10026494
1721	Ga0157369_10074224
1722	Ga0157369_10260160
1723	Ga0171462_1053
1724	Ga0157374_10014393
1725	Ga0157374_10015441
1726	Ga0157374_10041568
1727	Ga0157374_10091761
1728	Ga0157374_10114011
1729	Ga0157378_10000478
1730	Ga0157378_10069096
1731	Ga0157378_10075599
1732	Ga0163162_10004248
1733	Ga0163162_10074545
1734	Ga0163162_10096047
1735	Ga0163162_10106003
1736	Ga0163162_10123501
1737	Ga0157372_10005296
1738	Ga0157372_10031898
1739	Ga0157372_10155549
1740	Ga0157372_10208044
1741	Ga0157375_10007027
1742	Ga0157375_10040710
1743	Ga0157375_10124364
1744	Ga0157375_10138291
1745	Ga0157375_10366488
1746	Ga0157375_10373311
1747	Ga0163163_10224728
1748	Ga0157380_10023531
1749	Ga0157380_10024836
1750	Ga0157380_10044027
1751	Ga0157380_10062580
1752	Ga0182008_10008258
1753	Ga0182008_10011292
1754	Ga0157377_10013392
1755	Ga0157379_10008975
1756	Ga0157379_10013683
1757	Ga0157379_10014880
1758	Ga0157379_10062574
1759	Ga0157376_10023321
1760	Ga0182006_1000417
1761	Ga0182006_1000688
1762	Ga0183361_10004
1763	Ga0163161_10001990
1764	Ga0163161_10007155
1765	Ga0163161_10022084
1766	Ga0163161_10130806
1767	Ga0214544_1000279
1768	Ga0214542_1000014
1769	Ga0214543_1000056
1770	Ga0214543_1010227
1771	Ga0213872_10000001
1772	Ga0213872_10000076
1773	Ga0213872_10030526
1774	Ga0213876_10004612
1775	Ga0213875_10005491
1776	Ga0213871_10022667
1777	Ga0209784_100002
1778	Ga0209566_100003
1779	Ga0209566_100660
1780	Ga0209674_100004
1781	Ga0209672_100012
1782	Ga0209147_100007
1783	Ga0209147_100074
1784	Ga0209563_100006
1785	Ga0209563_100025
1786	Ga0209258_100313
1787	Ga0209677_100003
1788	Ga0209148_1001172
1789	Ga0209759_1000739
1790	Ga0209455_1000037
1791	Ga0209455_1002631
1792	Ga0209676_1004266
1793	Ga0209025_1000429
1794	Ga0209025_1009154
1795	Ga0209025_1029995
1796	Ga0209564_1000401
1797	Ga0209564_1014568
1798	Ga0209758_1000897
1799	Ga0209758_1002955
1800	Ga0209758_1004390
1801	Ga0209758_1014842
1802	Ga0209050_1000082
1803	Ga0209050_1004023
1804	Ga0209050_1006857
1805	Ga0209256_1000501
1806	Ga0207426_1002088
1807	Ga0209051_1000029
1808	Ga0209051_1000032
1809	Ga0209051_1000038
1810	Ga0209051_1000151
1811	Ga0209257_1000168
1812	Ga0209257_1002212
1813	Ga0207697_10000138
1814	Ga0207696_1000232
1815	Ga0207696_1004392
1816	Ga0207696_1017735
1817	Ga0207655_1000002
1818	Ga0207655_1000934
1819	Ga0207655_1002395
1820	Ga0207655_1011821
1821	Ga0207655_1078123
1822	Ga0207713_1002711
1823	Ga0207713_1028657
1824	Ga0207682_10001413
1825	Ga0207682_10009354
1826	Ga0207692_10003968
1827	Ga0207642_10000174
1828	Ga0207642_10006009
1829	Ga0207642_10011252
1830	Ga0207642_10013847
1831	Ga0207642_10016059
1832	Ga0207642_10081106
1833	Ga0207710_10046481
1834	Ga0207688_10005605
1835	Ga0207688_10008075
1836	Ga0207688_10012193
1837	Ga0207680_10017472
1838	Ga0207680_10073045
1839	Ga0207647_10040722
1840	Ga0207647_10060794
1841	Ga0207699_10003942
1842	Ga0207699_10023532
1843	Ga0207645_10003708
1844	Ga0207645_10014911
1845	Ga0207645_10114826
1846	Ga0207645_10116983
1847	Ga0207643_10010585
1848	Ga0207643_10025132
1849	Ga0207705_10093244
1850	Ga0207684_10005764
1851	Ga0207654_10008649
1852	Ga0207707_10197523
1853	Ga0207695_10000301
1854	Ga0207695_10001540
1855	Ga0207695_10005993
1856	Ga0207695_10046435
1857	Ga0207695_10103560
1858	Ga0207695_10139465
1859	Ga0207671_10001875
1860	Ga0207671_10007595
1861	Ga0207671_10130801
1862	Ga0207671_10131378
1863	Ga0207693_10011581
1864	Ga0207693_10012654
1865	Ga0207693_10025259
1866	Ga0207693_10055757
1867	Ga0207663_10008502
1868	Ga0207663_10040391
1869	Ga0207660_10043075
1870	Ga0207662_10023863
1871	Ga0207657_10000002
1872	Ga0207657_10127415
1873	Ga0207649_10037204
1874	Ga0207649_10113263
1875	Ga0207681_10005903
1876	Ga0207681_10047362
1877	Ga0207694_10001517
1878	Ga0207694_10022685
1879	Ga0207694_10050886
1880	Ga0207694_10317044
1881	Ga0207650_10001906
1882	Ga0207650_10019993
1883	Ga0207659_10003466
1884	Ga0207659_10009054
1885	Ga0207659_10028913
1886	Ga0207659_10090798
1887	Ga0207659_10326882
1888	Ga0207687_10001592
1889	Ga0207687_10257801
1890	Ga0207700_10025541
1891	Ga0207700_10186834
1892	Ga0207664_10066096
1893	Ga0207664_10343055
1894	Ga0207644_10109884
1895	Ga0207644_10142002
1896	Ga0207644_10194251
1897	Ga0207690_10000014
1898	Ga0207706_10007132
1899	Ga0207706_10010513
1900	Ga0207706_10026456
1901	Ga0207686_10000731
1902	Ga0207686_10013625
1903	Ga0207686_10133219
1904	Ga0207709_10007610
1905	Ga0207670_10110484
1906	Ga0207669_10008773
1907	Ga0207669_10100998
1908	Ga0207669_10318046
1909	Ga0207704_10000296
1910	Ga0207704_10006173
1911	Ga0207704_10018913
1912	Ga0207704_10178135
1913	Ga0207665_10023006
1914	Ga0207665_10043116
1915	Ga0207691_10079454
1916	Ga0207691_10160807
1917	Ga0207711_10025421
1918	Ga0207711_10029772
1919	Ga0207711_10062460
1920	Ga0207711_10146344
1921	Ga0207689_10001104
1922	Ga0207689_10002198
1923	Ga0207689_10023579
1924	Ga0207689_10088452
1925	Ga0207661_10133636
1926	Ga0207667_10100377
1927	Ga0207667_10150530
1928	Ga0207667_10311951
1929	Ga0207651_10075496
1930	Ga0207651_10336691
1931	Ga0207712_10008374
1932	Ga0207712_10010708
1933	Ga0207712_10018842
1934	Ga0207712_10143752
1935	Ga0207668_10003461
1936	Ga0207668_10030590
1937	Ga0207668_10030673
1938	Ga0207668_10066658
1939	Ga0207668_10270142
1940	Ga0207640_10030633
1941	Ga0207640_10154216
1942	Ga0207658_10005695
1943	Ga0207658_10020518
1944	Ga0207658_10094379
1945	Ga0207677_10096999
1946	Ga0207677_10161340
1947	Ga0207703_10001737
1948	Ga0207703_10021616
1949	Ga0207703_10061909
1950	Ga0207703_10062658
1951	Ga0207703_10075519
1952	Ga0207703_10078353
1953	Ga0207639_10029470
1954	Ga0207639_10196081
1955	Ga0207678_10000690
1956	Ga0207678_10007273
1957	Ga0207678_10009247
1958	Ga0207678_10009550
1959	Ga0207678_10011079
1960	Ga0207678_10012944
1961	Ga0207678_10013068
1962	Ga0207678_10018931
1963	Ga0207678_10054759
1964	Ga0207708_10000129
1965	Ga0207708_10063210
1966	Ga0207702_10013515
1967	Ga0207641_10086841
1968	Ga0207641_10275223
1969	Ga0207648_10000252
1970	Ga0207648_10051073
1971	Ga0207676_10085016
1972	Ga0207676_10120136
1973	Ga0207674_10011921
1974	Ga0207674_10037597
1975	Ga0207674_10038897
1976	Ga0207674_10073838
1977	Ga0207675_100000829
1978	Ga0207675_100001054
1979	Ga0207675_100003765
1980	Ga0207675_100006013
1981	Ga0207675_100008982
1982	Ga0207675_100209662
1983	Ga0207675_100448497
1984	Ga0207683_10001590
1985	Ga0207683_10003302
1986	Ga0207683_10099293
1987	Ga0207683_10211002
1988	Ga0207683_10240180
1989	Ga0207698_10006398
1990	Ga0207698_10011136
1991	Ga0207698_10133997
1992	Ga0209281_1000024
1993	Ga0209389_1000004
1994	Ga0209389_1000023
1995	Ga0209371_1000121
1996	Ga0209371_1000534
1997	Ga0209371_1001024
1998	Ga0209371_1001833
1999	Ga0209371_1001961
2000	Ga0209371_1002259
2001	Ga0209371_1007367
2002	Ga0209589_1000005
2003	Ga0209589_1000010
2004	Ga0209489_100005
2005	Ga0209489_100011
2006	Ga0209489_100295
2007	Ga0209700_100006
2008	Ga0209700_100013
2009	Ga0209282_1000078
2010	Ga0207428_10203842
2011	Ga0207428_10206769
2012	Ga0268266_10001354
2013	Ga0268266_10003891
2014	Ga0268266_10035100
2015	Ga0268266_10430314
2016	Ga0268265_10016272
2017	Ga0268265_10056825
2018	Ga0268265_10458369
2019	Ga0268264_10014118
2020	Ga0268264_10067678
2021	Ga0268264_10280928
2022	Ga0265319_1040148
2023	Ga0307517_10000122
2024	Ga0307515_10000873
2025	Ga0307515_10000893
2026	Ga0307515_10017389
2027	Ga0307515_10030153
2028	Ga0307515_10066632
2029	Ga0265338_10013863
2030	Ga0268256_1001719
2031	Ga0268256_1001996
2032	Ga0268256_1002539
2033	Ga0268256_1002855
2034	Ga0268256_1003731
2035	Ga0268256_1005475
2036	Ga0268256_1027289
2037	Ga0307511_10042874
2038	Ga0307512_10043947
2039	Ga0307512_10056826
2040	Ga0314311_1096979
2041	Ga0316178_1158591
2042	Ga0265325_10030384
2043	Ga0265331_10029884
2044	Ga0265316_10038284
2045	Ga0307513_10001376
2046	Ga0307513_10128604
2047	Ga0307513_10228102
2048	Ga0307513_10288285
2049	Ga0307509_10001193
2050	Ga0307509_10074967
2051	Ga0307408_100002421
2052	Ga0307408_100021592
2053	Ga0307408_100025202
2054	Ga0307408_100043524
2055	Ga0307408_100167687
2056	Ga0307508_10006278
2057	Ga0307508_10019253
2058	Ga0307508_10193032
2059	Ga0307516_10001226
2060	Ga0307516_10008598
2061	Ga0307516_10012997
2062	Ga0307516_10075990
2063	Ga0307516_10218790
2064	Ga0307516_10231532
2065	Ga0307405_10027018
2066	Ga0307413_10108571
2067	Ga0307410_10061105
2068	Ga0307406_10000764
2069	Ga0307406_10057928
2070	Ga0307406_10102695
2071	Ga0307412_10007292
2072	Ga0307412_10011408
2073	Ga0307409_100182330
2074	Ga0307414_10022177
2075	Ga0307414_10291531
2076	Ga0307411_10109194
2077	Ga0307415_100160681
2078	Ga0307507_10009352
2079	Ga0307507_10064060
2080	Ga0307507_10077314
2081	Ga0307510_10012015
2082	Ga0307510_10061896
2083	Ga0373939_0000013
2084	Ga0373960_0007028
2085	Ga0373943_0056692
2086	Ga0373931_0000279
2087	Ga0373931_0018296
2088	Ga0373931_0181143
2089	Ga0373935_0035047
2090	Ga0373935_0092439
2091	Ga0373927_0050843
2092	Ga0373947_0090673
2093	Ga0373925_0049042
2094	Ga0373925_0099842
2095	Ga0395900_0043219
2096	Ga0395898_0039741
2097	Ga0395898_0072656
2098	Ga0395898_0095117
2099	Ga0395898_0325119
2100	Ga0395905_0041589
2101	Ga0395905_0070028
2102	Ga0395905_0107822
2103	Ga0436364_0075591
2104	Ga0436364_1018828
2105	Ga0436364_1225556
2106	Ga0436364_1300804
2107	Ga0395901_0025654
2108	Ga0395901_0112750
2109	Ga0395901_0249166
2110	Ga0395901_0384451
2111	Ga0400483_043589
2112	Ga0400483_043834
2113	Ga0400483_115135
2114	Ga0400483_120089
2115	Ga0400483_128059
2116	Ga0400483_151009
2117	Ga0400483_177444
2118	Ga0400483_200221
2119	Ga0400483_273270
2120	Ga0436365_0697045
2121	Ga0436365_0917056
2122	Ga0436365_1814187
2123	Ga0436360_1182866
2124	Ga0436361_0260778
2125	Ga0436361_0419826
2126	Ga0436361_0554437
2127	Ga0436363_0051374
2128	Ga0436363_0096055
2129	Ga0436363_1131854
2130	Ga0439438_001374
2131	Ga0439447_014867
2132	Ga0439465_0000587
2133	Ga0451833_0127402
2134	Ga0451837_0026161
2135	Ga0451839_0422595
2136	Ga0451841_0803346
2137	Ga0451847_0272648
2138	Ga0451851_0017097
2139	Ga0451843_0109304
2140	Ga0451855_0665781
2141	Ga0451853_1686677
2142	Ga0439431_0001751
2143	Ga0439445_0001422
2144	Ga0439432_003560
2145	Ga0439432_004824
2146	Ga0439449_0001607
2147	Ga0439452_000002
2148	Ga0439452_002627
2149	Ga0450918_006827
2150	Ga0466972_0000185
2151	Ga0466972_0002052
2152	Ga0466972_0002529
2153	Ga0453684_0001553
2154	Ga0466968_0001076
2155	Ga0466960_0001298
2156	Ga0495617_004023
2157	Ga0495592_0027569
2158	Ga0495603_0026561
2159	Ga0495603_0080545
2160	Ga0495590_0000354
2161	Ga0495590_0002571
2162	Ga0495590_0006514
2163	Ga0495629_0000191
2164	Ga0495629_0001613
2165	Ga0495629_0014530
2166	Ga0495629_0133863
2167	Ga0495638_0001502
2168	Ga0495638_0022955
2169	Ga0495653_0000154
2170	Ga0495653_0003717
2171	Ga0495650_0000034
2172	Ga0495650_0011159
2173	Ga0495650_0051745
2174	Ga0495580_0001077
2175	Ga0495580_0002419
2176	Ga0495580_0009083
2177	Ga0495580_0111547
2178	Ga0495582_0066799
2179	Ga0495582_0133555
2180	Ga0495605_0001702
2181	Ga0495605_0004586
2182	Ga0495639_0017388
2183	Ga0495584_0000001
2184	Ga0495585_0006343
2185	Ga0495596_0002026
2186	Ga0495607_0011040
2187	Ga0495607_0112572
2188	Ga0495583_0000095
2189	Ga0495606_0015158
2190	Ga0495606_0099350
2191	Ga0495608_0001975
2192	Ga0495608_0135093
2193	Ga0495610_0033786
2194	Ga0495618_0000888
2195	Ga0495628_0000951
2196	Ga0495630_0010544
2197	Ga0495630_0019401
2198	Ga0495630_0026001
2199	Ga0495630_0071318
2200	Ga0495632_0000057
2201	Ga0495643_0000022
2202	Ga0495643_0000139
2203	Ga0495643_0000718
2204	Ga0495644_0036131
2205	Ga0495648_0003655
2206	Ga0495648_0013838
2207	Ga0495648_0017856
2208	Ga0495648_0022171
2209	Ga0495648_0027794
2210	Ga0495666_0001325
2211	Ga0495652_0001099
2212	Ga0495652_0001279
2213	Ga0495652_0004329
2214	Ga0495654_0000132
2215	Ga0495654_0071594
2216	Ga0495665_0004902
2217	Ga0495665_0035427
2218	Ga0495586_0003113
2219	Ga0495586_0042491
2220	Ga0495609_0002434
2221	Ga0495609_0010228
2222	Ga0495597_0000443
2223	Ga0495597_0001779
2224	Ga0495597_0009302
2225	Ga0495645_0013346
2226	Ga0495645_0013874
2227	Ga0495645_0067847
2228	Ga0495645_0132760
2229	Ga0495622_0068554
2230	Ga0495633_0000277
2231	Ga0495633_0082181
2232	Ga0495633_0082916
2233	Ga0495656_0017041
2234	Ga0495656_0028127
2235	Ga0495668_0002194
2236	Ga0495668_0003852
2237	Ga0495634_0001820
2238	Ga0495611_0027276
2239	Ga0495625_0009581
2240	Ga0495625_0012055
2241	Ga0495625_0106178
2242	Ga0495635_0000935
2243	Ga0495635_0196417
2244	Ga0495661_0057663
2245	Ga0495588_0089797
2246	Ga0495657_0001723
2247	Ga0495599_0003111
2248	Ga0495599_0044651
2249	Ga0495623_0000146
2250	Ga0495623_0136915
2251	Ga0495646_0000205
2252	Ga0495646_0000344
2253	Ga0495646_0000595
2254	Ga0495646_0001430
2255	Ga0495647_0075540
2256	Ga0495669_0002387
2257	Ga0495669_0046498
2258	Ga0495669_0067029
2259	Ga0495613_0011170
2260	Ga0495613_0017277
2261	Ga0495624_0005121
2262	Ga0495624_0006904
2263	Ga0495624_0008741
2264	Ga0495624_0028718
2265	Ga0495624_0049228
2266	Ga0495624_0138525
2267	Ga0495670_0007432
2268	Ga0495670_0048726
2269	Ga0495671_0018537
2270	Ga0495671_0023545
2271	Ga0495671_0051453
2272	Ga0495649_0073870
2273	Ga0495589_0003586
2274	Ga0495660_0008053
2275	Ga0495581_0011857
2276	Ga0495604_0092634
2277	Ga0495674_0002091
2278	Ga0495674_0007360
2279	Ga0495674_0015224
2280	Ga0495674_0142394
2281	Ga0495674_0279135
2282	Ga0495676_0000392
2283	Ga0495676_0007517
2284	Ga0495680_0158021
2285	Ga0495683_0000005
2286	Ga0495683_0002262
2287	Ga0495683_0026519
2288	Ga0495687_000018
2289	Ga0495687_006007
2290	Ga0495687_040202
2291	Ga0495675_0072105
2292	Ga0495679_000117
2293	Ga0495679_000559
2294	Ga0495673_0026998
2295	Ga0495673_0091480
2296	Ga0495684_0175116
2297	Ga0495602_0045406
2298	Ga0495602_0060562
2299	Ga0495602_0092187
2300	Ga0495614_0024326
2301	Ga0495626_0017604
2302	Ga0496100_0005203
2303	Ga0496100_0052714
2304	Ga0496100_0245703
2305	Ga0496101_0000185
2306	Ga0496101_0046465
2307	Ga0496101_0185834
2308	Ga0496102_0005644
2309	Ga0496102_0068972
2310	Ga0496102_0079193
2311	Ga0496102_0175095
2312	Ga0496103_0016607
2313	Ga0496103_0068175
2314	Ga0496104_0003041
2315	Ga0496104_0060729
2316	Ga0496105_0042131
2317	Ga0496105_0093279
2318	Ga0496105_0279253
2319	Ga0496106_0001095
2320	Ga0496106_0002744
2321	Ga0496106_0029615
2322	Ga0496106_0168844
2323	Ga0496106_0353627
2324	Ga0496107_0016585
2325	Ga0496108_0001294
2326	Ga0496108_0007433
2327	Ga0496108_0010197
2328	Ga0496108_0045077
2329	Ga0496108_0051572
2330	Ga0496109_0005297
2331	Ga0496109_0005404
2332	Ga0496109_0038687
2333	Ga0496110_0000670
2334	Ga0496110_0006716
2335	Ga0496110_0027364
2336	Ga0496111_0005107
2337	Ga0496111_0016921
2338	Ga0496111_0020836
2339	Ga0496111_0030533
2340	Ga0496112_0000428
2341	Ga0496112_0010782
2342	Ga0496112_0201768
2343	Ga0496113_0007738
2344	Ga0496114_0018140
2345	Ga0496114_0170346
2346	Ga0496115_0033420
2347	Ga0496115_0122408
2348	Ga0496115_0188108
2349	Ga0496116_0017779
2350	Ga0496116_0018738
2351	Ga0496116_0112887
2352	Ga0496117_0013966
2353	Ga0496117_0035365
2354	Ga0496117_0070720
2355	Ga0496118_0001482
2356	Ga0496118_0005832
2357	Ga0496118_0066392
2358	Ga0496119_0000005
2359	Ga0496119_0000523
2360	Ga0496119_0028866
2361	Ga0496120_0000005
2362	Ga0496120_0002461
2363	Ga0496120_0002583
2364	Ga0496121_0000261
2365	Ga0496121_0004457
2366	Ga0496121_0007689
2367	Ga0496121_0019824
2368	Ga0496121_0049643
2369	Ga0496121_0053421
2370	Ga0496121_0054300
2371	Ga0496121_0058032
2372	Ga0496121_0061870
2373	Ga0496121_0240448
2374	Ga0496122_0000701
2375	Ga0496122_0016559
2376	Ga0496122_0033669
2377	Ga0496122_0078870
2378	Ga0496122_0114125
2379	Ga0496123_0000026
2380	Ga0496123_0000967
2381	Ga0496123_0004113
2382	Ga0496123_0011352
2383	Ga0496123_0017783
2384	Ga0496123_0050192
2385	Ga0496124_0000007
2386	Ga0496124_0000396
2387	Ga0496124_0000600
2388	Ga0496124_0001462
2389	Ga0496124_0002237
2390	Ga0496124_0009748
2391	Ga0496124_0015610
2392	Ga0496124_0148121
2393	Ga0496125_0000136
2394	Ga0496125_0005728
2395	Ga0496125_0011083
2396	Ga0496125_0022147
2397	Ga0496125_0045526
2398	Ga0496125_0060816
2399	Ga0496126_0010927
2400	Ga0496126_0024039
2401	Ga0496126_0054732
2402	Ga0496126_0138271
2403	Ga0495678_000013
2404	Ga0495678_000103
2405	Ga0495678_003237
2406	Ga0501031_0060355
2407	Ga0501032_0004834
2408	Ga0501032_0032468
2409	Ga0501032_0093455
2410	Ga0501033_0003535
2411	Ga0501033_0011363
2412	Ga0501033_0127189
2413	Ga0501034_0018898
2414	Ga0501034_0019360
2415	Ga0501036_0013057
2416	Ga0501036_0037335
2417	Ga0501036_0100242
2418	Ga0501037_0000035
2419	Ga0501037_0001416
2420	Ga0501037_0031020
2421	Ga0501037_0149610
2422	Ga0501038_0022431
2423	Ga0501039_0033767
2424	Ga0501043_0000009
2425	Ga0501043_0000031
2426	Ga0501043_0006559
2427	Ga0501046_0000022
2428	Ga0501047_0000021
2429	Ga0501047_0021838
2430	Ga0501047_0037359
2431	Ga0501047_0060895
2432	Ga0501047_0117522
2433	Ga0501047_0188891
2434	Ga0501048_0000955
2435	Ga0501048_0154095
2436	Ga0501069_0000195
2437	Ga0501069_0151047
2438	Ga0501070_0000202
2439	Ga0501070_0137163
2440	Ga0501073_0087383
2441	Ga0501074_0000024
2442	Ga0501074_0058431
2443	Ga0501080_0000811
2444	Ga0501080_0082653
2445	Ga0501083_0003674
2446	Ga0501035_0000036
2447	Ga0501035_0013077
2448	Ga0501035_0021949
2449	Ga0501035_0022175
2450	Ga0501035_0119629
2451	Ga0501044_0000011
2452	Ga0501044_0011412
2453	Ga0501044_0029556
2454	Ga0501044_0088383
2455	Ga0501044_0125882
2456	nmdc:mga03683_10560_c1
2457	nmdc:mga0yw44_14605_c2
2458	nmdc:mga0yw44_2406_c1
2459	nmdc:mga0yw44_365507_c1
2460	nmdc:mga0yw44_95335_c1
2461	nmdc:mga0k408_126863_c1
2462	nmdc:mga06z11_34871_c1
2463	nmdc:mga07m45_14060_c1
2464	nmdc:mga07m45_24746_c1
2465	nmdc:mga07m45_3142_c1
2466	nmdc:mga07m45_73630_c1
2467	nmdc:mga05p37_11307_c1
2468	nmdc:mga05p37_274270_c1
2469	nmdc:mga05p37_293551_c1
2470	nmdc:mga0n895_79866_c1
2471	nmdc:mga0rr50_15727_c1
2472	nmdc:mga0rr50_303318_c1
2473	nmdc:mga0rr50_37637_c1
2474	nmdc:mga08x19_61364_c1
2475	nmdc:mga0sz30_1100_c1
2476	nmdc:mga0sz30_42288_c1
2477	Ga0495619_0156651
2478	Ga0500566_0004620
2479	Ga0500641_0020047
2480	Ga0500650_0009526
2481	Ga0500556_0000216
2482	Ga0500569_048107
2483	Ga0500595_012004
2484	Ga0500614_003294
2485	Ga0500642_0000012
2486	Ga0500658_0000025
2487	Ga0500559_0000167
2488	Ga0500559_0011728
2489	Ga0500590_037283
2490	Ga0500590_058679
2491	Ga0500604_0003890
2492	Ga0500616_0000515
2493	Ga0500622_0022403
2494	Ga0500636_0000606
2495	Ga0500636_0050453
2496	Ga0500637_0089109
2497	Ga0500645_024417
2498	2885305859
2499	2501407081
2500	2507510971
2501	2508544793
2502	2508696979
2503	2508726304
2504	2509140440
2505	2509146387
2506	2509441747
2507	2510248373
2508	2510892198
2509	2511092159
2510	2511092684
2511	2511097975
2512	2511108161
2513	2511170067
2514	2511186564
2515	2511437347
2516	2512349692
2517	2513623455
2518	2513701436
2519	2513870874
2520	2513952443
2521	2514041665
2522	2515625474
2523	2515644574
2524	2515683150
2525	2516019780
2526	2517566803
2527	2517889865
2528	2521559271
2529	2524442950
2530	2524465857
2531	2530648704
2532	2558861370
2533	2585205363
2534	2585397886
2535	2585526958
2536	2585820571
2537	2596373634
2538	2597813919
2539	2599410857
2540	2599735635
2541	2601521628
2542	2601526653
2543	2601613483
2544	2601622386
2545	2601650422
2546	2601655711
2547	2601656958
2548	2601704755
2549	2601709784
2550	2601714796
2551	2601725202
2552	2601729744
2553	2601734761
2554	2601743807
2555	2601754275
2556	2602021726
2557	2603837116
2558	2603842192
2559	2603847265
2560	2603852336
2561	2603857426
2562	2603870389
2563	2606047580
2564	2606145917
2565	2606174981
2566	2616297755
2567	2637225751
2568	2643806834
2569	2643814614
2570	2643865558
2571	2643910276
2572	2644066627
2573	2644156356
2574	2644296259
2575	2644379380
2576	2644415161
2577	2644451572
2578	2644647794
2579	2644693053
2580	2657685841
2581	2676408038
2582	2719389823
2583	2719643198
2584	2721403466
2585	2724035042
2586	2728751742
2587	2739243150
2588	2745076895
2589	2746089863
2590	2746098090
2591	2753460412
2592	2765568561
2593	2774873439
2594	2776263892
2595	2777023602
2596	2793083749
2597	2793312917
2598	2793340791
2599	2793357104
2600	2793361867
2601	2793367420
2602	2804755370
2603	2806076258
2604	2808970600
2605	2809005293
2606	2809012306
2607	2809128874
2608	2809148495
2609	2816473724
2610	2819615787
2611	2824607997
2612	2824616508
2613	2824624684
2614	2824633281
2615	2824640633
2616	2824649839
2617	2824657836
2618	2824711145
2619	2824720097
2620	2824728485
2621	2824762876
2622	2824770545
2623	2838028879
2624	2838663850
2625	2838686168
2626	2838700461
2627	2838713740
2628	2839096560
2629	2841865787
2630	2842083107
2631	2842124085
2632	2842204903
2633	2842210827
2634	2842243153
2635	2842284281
2636	2842297366
2637	2842309086
2638	2842345765
2639	2842364033
2640	2842376213
2641	2842383760
2642	2842390899
2643	2842694953
2644	2842737112
2645	2842750362
2646	2842779755
2647	2844535035
2648	2847938532
2649	2850082835
2650	2852621029
2651	2854684600
2652	2856336052
2653	2856344137
2654	2857512160
2655	2857526806
2656	2857541780
2657	2857597091
2658	2858954940
2659	2861694138
2660	2863423594
2661	2866613558
2662	2869278928
2663	2871499977
2664	2874123944
2665	2874597711
2666	2874615788
2667	2874649273
2668	2876378863
2669	2876605374
2670	2876762438
2671	2876774816
2672	2876822432
2673	2878764120
2674	2878771168
2675	2878784817
2676	2879077904
2677	2879086224
2678	2879132544
2679	2879146043
2680	2881370652
2681	2881667407
2682	2881863085
2683	2881929899
2684	2883092005
2685	2885194914
2686	2885273401
2687	2885321108
2688	2885329131
2689	2885345852
2690	2887378764
2691	2888347649
2692	2888421963
2693	2889040437
2694	2889306991
2695	2893069969
2696	2899361677
2697	2902686579
2698	2904443679
2699	2904482522
2700	2904513394
2701	2904532577
2702	2904569559
2703	2904576870
2704	2904605604
2705	2904719182
2706	2906651555
2707	2909045360
2708	2913296879
2709	2917740218
2710	2919046772
2711	2919077683
2712	2919081391
2713	2922153939
2714	2924759721
2715	2924788771
2716	2925333412
2717	2926760115
2718	2928128473
2719	2928157810
2720	2928165576
2721	2928177775
2722	2928537039
2723	2929521685
2724	2933575505
2725	2935612790
2726	2935655416
2727	2935664283
2728	2935824280
2729	2935852574
2730	2935900778
2731	2935912279
2732	2935924047
2733	2935929308
2734	2935935939
2735	2935950447
2736	2935957395
2737	2935968426
2738	2935976615
2739	2935987941
2740	2936018353
2741	2936026884
2742	2936035752
2743	2936053831
2744	2936058645
2745	2936373824
2746	2936382413
2747	2937998636
2748	2958058365
2749	2958123580
2750	2958169114
2751	2961167574
2752	2965022395
2753	2965033484
2754	2965118432
2755	2968175979
2756	2969082748
2757	2970530274
2758	2970547791
2759	2970558965
2760	2970593522
2761	2974321933
2762	2977880160
2763	2977962519
2764	2979793852
2765	2981990827
2766	2984559813
2767	2984597895
2768	2987663582
2769	2987678873
2770	3004192641
2771	3004243610
2772	3005485695
2773	3005594517
2774	639651501
2775	642415479
2776	644750938
2777	8003318560
2778	8004403465
2779	8004697376
2780	8005275946
2781	8005398205
2782	8005695469
2783	8006967259
2784	8016633809
2785	8016734486
2786	8018180834
2787	8018853168
2788	8019503486
2789	8019504629
2790	8019625179
2791	8019637001
2792	8019642602
2793	8019664839
2794	8019674404
2795	8020943302
2796	8020949787
2797	8020959414
2798	8021121127
2799	8039101859
2800	8054566127
2801	8055089222
2802	8055099026
2803	8055621715
2804	8056381769
2805	8056384400
2806	8057306168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

55

398

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3fmx-assembly1.cif.gz_X	crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh	0.8961	4	342
3fmx-assembly1.cif.gz_X	crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh	0.8739	4	342
6xxy-assembly1.cif.gz_B	crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate.	0.8682	1	339
5j33-assembly3.cif.gz_F	isopropylmalate dehydrogenase in complex with nad+	0.8498	3	340
6xxy-assembly1.cif.gz_B	crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate.	0.8468	1	339

ID	Description	Score	Start	End	Superfamily
af_P76251_1_360_3.40.718.10	Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase	0.907	1	340	3.40.718.10
af_P76251_1_360_3.40.718.10	Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase	0.887	1	340	3.40.718.10
1w0dB00	Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase	0.8398	4	339	3.40.718.10
6c0eA00	Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase	0.8332	5	339	3.40.718.10
1w0dB00	Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase	0.8327	4	339	3.40.718.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7K1QAX9-F1-model_v4	deleted	0.9859	1	114
AF-A0A2X3CQ72-F1-model_v4	Tartrate dehydrogenase (EC 1.1.1.93)	0.9851	1	114	GO:0009027
AF-A0A354JY40-F1-model_v4	deleted	0.9837	1	95
AF-A0A529IN30-F1-model_v4	deleted	0.9811	3	101
AF-A0A7K1QAX9-F1-model_v4	deleted	0.9774	1	114

F493702

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

55

398

0.95

Structural Annotation

Top 5 Hits

Map