F493656

General Info

Members Datasets Scaffolds Average Seq Length
1399 539 1346 157

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10156105|Ga0105251_101561051
Length 181
Sequence MSQQPYGASHTKVPHFFVESFMSTVPITKYGAELLKEELQRLKTKERPAVINAIAEARAQGDLSENAEYDAAKERQAFIEGRIADLEGKLGSSLVVDPATLSSGADGRVVFAATVDLENLDSGEKVTYQIVGIDEADIKVSKVSVTSPIARALIGKSAGDVVAVEAPSGVREYEILEVRYV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
5 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
8 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
9 2643221556 Massilia sp. Root1485 Isolate Unclassified
10 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
11 2643221638 Duganella sp. Root336D2 Isolate Unclassified
12 2643221645 Massilia sp. Root351 Isolate Unclassified
13 2643221664 Massilia sp. Root418 Isolate Unclassified
14 2643221684 Massilia sp. Root133 Isolate Unclassified
15 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
16 2738541280 Massilia sp. GV090 Isolate Unclassified
17 2738541297 Duganella sp. GV083 Isolate Unclassified
18 2738541300 Massilia sp. GV016 Isolate Unclassified
19 2738541357 Duganella sp. GV053 Isolate Unclassified
20 2738543003 Duganella sp. GV066 Isolate Unclassified
21 2738543018 Massilia sp. GV045 Isolate Unclassified
22 2738543026 Duganella sp. GV089 Isolate Unclassified
23 2738543029 Duganella sp. GV039 Isolate Unclassified
24 2738543030 Massilia sp. GV097 Isolate Unclassified
25 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
26 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
27 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
28 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
29 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
30 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
31 2818991436 Collimonas arenae 515 Isolate Unclassified
32 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
33 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
34 2821131069 Duganella sp. 1224 Isolate Unclassified
35 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
36 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
37 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
38 2857553236 Duganella sp. R-74557 Isolate Unclassified
39 2857558681 Duganella sp. R-74565 Isolate Unclassified
40 2857564685 Duganella sp. R-74599 Isolate Unclassified
41 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
42 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
43 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
44 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
45 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
46 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
47 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
48 2904424332 Duganella sp. 1411 Isolate Rhizosphere
49 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
50 2919476304 Duganella sp. 3397 Isolate Unclassified
51 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
52 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
53 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
54 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
55 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
56 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
57 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
58 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
59 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
60 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
61 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
62 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
63 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
66 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
67 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
68 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
70 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
71 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
72 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
73 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
74 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
75 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
76 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
77 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
78 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
82 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
83 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
86 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
87 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
88 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
89 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
90 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
91 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
92 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
95 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
100 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
101 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
102 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
103 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
104 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
105 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
106 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
107 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
108 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
109 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
110 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
111 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
112 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
113 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
114 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
115 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
116 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
117 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
118 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
119 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
120 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
121 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
122 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
123 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
124 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
125 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
126 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
127 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
128 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
129 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
130 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
131 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
132 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
133 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
134 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
135 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
136 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
137 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
138 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
139 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
140 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
141 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
142 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
143 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
144 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
145 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
146 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
147 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
148 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
149 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
150 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
151 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
152 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
153 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
154 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
155 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
156 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
157 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
158 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
159 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
161 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
162 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
163 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
164 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
165 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
166 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
167 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
168 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
169 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
172 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
173 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
174 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
175 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
176 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
177 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
178 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
179 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
183 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
189 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
192 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
193 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
194 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
195 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
196 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
198 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
199 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
200 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
206 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
207 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
209 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
210 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
213 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
214 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
274 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
275 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
278 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
279 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
280 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
281 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
282 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
283 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
284 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
285 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
286 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
287 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
288 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
289 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
290 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
291 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
292 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
293 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
294 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
295 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
296 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
297 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
298 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
302 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
303 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
304 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
305 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
306 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
307 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
308 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
309 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
310 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
311 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
312 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
313 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
316 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
317 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
318 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
319 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
320 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
327 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
328 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
331 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
332 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
333 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
334 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
335 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
336 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
337 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
338 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
339 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
340 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
341 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
342 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
343 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
344 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
345 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
346 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
347 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
348 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
349 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
350 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
351 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
352 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
353 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
354 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
355 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
356 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
357 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
358 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
359 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
360 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
361 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
362 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
363 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
364 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
365 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
366 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
367 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
368 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
369 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
370 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
371 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
372 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
373 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
374 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
375 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
376 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
377 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
378 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
379 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
380 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
381 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
382 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
383 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
384 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
385 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
386 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
387 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
388 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
389 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
390 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
391 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
392 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
393 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
394 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
395 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
396 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
397 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
398 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
399 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
400 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
401 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
402 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
403 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
404 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
405 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
406 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
407 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
408 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
409 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
410 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
411 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
414 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
415 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
416 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
417 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
418 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
419 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
420 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
421 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
422 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
423 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
424 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
425 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
426 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
427 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
428 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
429 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
430 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
431 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
432 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
433 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
434 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
435 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
436 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
437 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
438 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
439 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
440 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
441 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
442 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
443 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
444 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
445 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
446 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
447 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
448 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
449 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
450 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
451 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
452 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
453 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
454 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
455 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
456 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
457 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
458 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
459 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
460 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
461 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
462 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
463 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
464 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
465 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
466 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
467 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
468 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
469 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
470 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
471 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
472 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
473 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
474 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
475 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
476 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
477 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
478 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
483 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
484 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
485 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
497 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
498 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
499 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
500 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
501 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
502 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
503 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
504 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
506 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
507 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
508 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
509 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
510 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
511 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
512 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
513 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
514 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
515 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
516 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
517 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
518 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
519 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
520 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
521 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
522 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
523 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
524 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
525 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.5
Metatranscriptomes 2.72
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0.36
Rhizoplane 5.65
Rhizosphere 83.7
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2009666 2162886007 Bacteria 1204
2 JGI24740J21852_10018967 3300001979 Bacteria 2430
3 JGI24739J22299_10013783 3300001989 Bacteria 2947
4 JGI25155J39150_1000275 3300002704 Bacteria 18778
5 JGI25155J39150_1001216 3300002704 Bacteria 2184
6 JGI25156J39149_1000654 3300002705 Bacteria 18946
7 JGI25162J39368_1000091 3300002737 Bacteria 101521
8 JGI25162J39368_1002877 3300002737 Bacteria 5921
9 JGI25154J39366_1001008 3300002738 Bacteria 11332
10 JGI25154J39366_1001607 3300002738 Bacteria 7679
11 JGI25157J39369_1000620 3300002741 Bacteria 20062
12 JGI25159J45721_1013111 3300002987 Bacteria 1937
13 Ga0006759J45824_1054708 3300003163 Bacteria 591
14 Ga0006759J45824_1099236 3300003163 Bacteria 583
15 JGI25165J46597_1000172 3300003214 Bacteria 101521
16 JGI25160J50197_1016729 3300003354 Bacteria 2351
17 Ga0007410J51695_1045428 3300003574 Bacteria 1430
18 Ga0007410J51695_1053832 3300003574 Bacteria 698
19 Ga0007409J51694_1018198 3300003575 Bacteria 1831
20 Ga0007409J51694_1022844 3300003575 Bacteria 1960
21 Ga0007416J51690_1014475 3300003577 Bacteria 7645
22 Ga0032354_1019193 3300003693 Bacteria 5336
23 Ga0055538_1000063 3300003751 Bacteria 101521
24 Ga0055539_1000018 3300003752 Bacteria 348596
25 Ga0055539_1000096 3300003752 Bacteria 101521
26 Ga0055533_1000022 3300003756 Bacteria 348596
27 Ga0055533_1000107 3300003756 Bacteria 101521
28 Ga0055532_1000017 3300003758 Bacteria 306880
29 Ga0055525_1000024 3300003759 Bacteria 348596
30 Ga0055525_1000047 3300003759 Bacteria 261507
31 Ga0055525_1000140 3300003759 Bacteria 101521
32 Ga0055535_1008032 3300003761 Bacteria 1945
33 Ga0055529_1000125 3300003763 Bacteria 110810
34 Ga0055526_1006167 3300003771 Bacteria 6597
35 Ga0055537_1047078 3300003773 Bacteria 502
36 Ga0055541_1000013 3300003841 Bacteria 348596
37 Ga0055541_1000064 3300003841 Bacteria 101521
38 Ga0065165_1004294 3300005262 Bacteria 8974
39 Ga0065714_10011408 3300005288 Bacteria 2171
40 Ga0065714_10014940 3300005288 Bacteria 2206
41 Ga0065704_10411895 3300005289 Bacteria 741
42 Ga0065715_10011527 3300005293 Bacteria 2683
43 Ga0065707_10947712 3300005295 Bacteria 552
44 Ga0070658_10125326 3300005327 Bacteria 2137
45 Ga0070676_10298056 3300005328 Bacteria 1092
46 Ga0070683_100196994 3300005329 Bacteria 1913
47 Ga0070690_100004194 3300005330 Bacteria 7972
48 Ga0070670_100027159 3300005331 Bacteria 4924
49 Ga0068869_100214337 3300005334 Bacteria 1524
50 Ga0068869_100240972 3300005334 Bacteria 1441
51 Ga0068869_100393022 3300005334 Bacteria 1139
52 Ga0070666_10004984 3300005335 Bacteria 8120
53 Ga0070666_10083494 3300005335 Bacteria 2185
54 Ga0070680_100373284 3300005336 Bacteria 1214
55 Ga0070682_100036629 3300005337 Bacteria 3000
56 Ga0070682_100039649 3300005337 Bacteria 2895
57 Ga0070682_100267747 3300005337 Bacteria 1240
58 Ga0068868_100015599 3300005338 Bacteria 5624
59 Ga0068868_100043085 3300005338 Bacteria 3525
60 Ga0070660_100002183 3300005339 Bacteria 13491
61 Ga0070660_100048636 3300005339 Bacteria 3257
62 Ga0070660_100648097 3300005339 Bacteria 884
63 Ga0070689_100001985 3300005340 Bacteria 13248
64 Ga0070661_100002329 3300005344 Bacteria 13040
65 Ga0070692_10046908 3300005345 Bacteria 2235
66 Ga0070668_101048454 3300005347 Bacteria 734
67 Ga0070671_100092462 3300005355 Bacteria 2534
68 Ga0070671_100234181 3300005355 Bacteria 1558
69 Ga0070674_100001678 3300005356 Bacteria 11972
70 Ga0070673_100000865 3300005364 Bacteria 17026
71 Ga0070688_100007255 3300005365 Bacteria 5971
72 Ga0070659_100001265 3300005366 Bacteria 18344
73 Ga0070659_100090041 3300005366 Bacteria 2458
74 Ga0070659_100710655 3300005366 Bacteria 869
75 Ga0070667_100003642 3300005367 Bacteria 13114
76 Ga0070667_100064885 3300005367 Bacteria 3099
77 Ga0070703_10033713 3300005406 Bacteria 1560
78 Ga0070703_10199612 3300005406 Bacteria 784
79 Ga0070709_10027578 3300005434 Bacteria 3378
80 Ga0070709_10236133 3300005434 Bacteria 1310
81 Ga0070709_10496062 3300005434 Bacteria 927
82 Ga0070714_100147756 3300005435 Bacteria 2115
83 Ga0070713_100004316 3300005436 Bacteria 9531
84 Ga0070713_100007320 3300005436 Bacteria 7732
85 Ga0070713_101176746 3300005436 Bacteria 742
86 Ga0070710_10069751 3300005437 Bacteria 2023
87 Ga0070710_10124430 3300005437 Bacteria 1565
88 Ga0070710_10166235 3300005437 Bacteria 1371
89 Ga0070711_100001521 3300005439 Bacteria 12781
90 Ga0070711_100009545 3300005439 Bacteria 5984
91 Ga0070705_100003694 3300005440 Bacteria 7493
92 Ga0070694_100599341 3300005444 Bacteria 887
93 Ga0070708_100311262 3300005445 Bacteria 1483
94 Ga0070708_100565776 3300005445 Bacteria 1072
95 Ga0070663_100161556 3300005455 Bacteria 1725
96 Ga0070663_100167050 3300005455 Bacteria 1698
97 Ga0070678_100004401 3300005456 Bacteria 7980
98 Ga0070678_100057112 3300005456 Bacteria 2858
99 Ga0070662_100003578 3300005457 Bacteria 9693
100 Ga0070662_100228550 3300005457 Bacteria 1487
101 Ga0070662_100306045 3300005457 Bacteria 1292
102 Ga0070662_100624662 3300005457 Bacteria 907
103 Ga0068867_100021691 3300005459 Bacteria 4583
104 Ga0068867_100554608 3300005459 Bacteria 996
105 Ga0070685_10016600 3300005466 Bacteria 3927
106 Ga0070706_100007439 3300005467 Bacteria 10269
107 Ga0070706_100196877 3300005467 Bacteria 1882
108 Ga0070707_100026857 3300005468 Bacteria 5470
109 Ga0070707_100809908 3300005468 Bacteria 900
110 Ga0070707_100977031 3300005468 Bacteria 812
111 Ga0070698_100107855 3300005471 Bacteria 2752
112 Ga0070699_100004740 3300005518 Bacteria 12019
113 Ga0070699_100013389 3300005518 Bacteria 7067
114 Ga0070699_100207883 3300005518 Bacteria 1742
115 Ga0070679_100065686 3300005530 Bacteria 3616
116 Ga0070679_101153528 3300005530 Bacteria 720
117 Ga0070697_100064107 3300005536 Bacteria 3001
118 Ga0070697_100083105 3300005536 Bacteria 2640
119 Ga0068853_100136981 3300005539 Bacteria 2195
120 Ga0070672_100087313 3300005543 Bacteria 2510
121 Ga0070686_100018101 3300005544 Bacteria 4129
122 Ga0070695_100291793 3300005545 Bacteria 1202
123 Ga0070695_100399192 3300005545 Bacteria 1042
124 Ga0070696_100016414 3300005546 Bacteria 4986
125 Ga0070696_100664883 3300005546 Bacteria 846
126 Ga0070693_100002246 3300005547 Bacteria 8864
127 Ga0070693_100586533 3300005547 Bacteria 803
128 Ga0070665_100003995 3300005548 Bacteria 15556
129 Ga0070704_100054101 3300005549 Bacteria 2839
130 Ga0068855_100000037 3300005563 Bacteria 158161
131 Ga0068855_100019104 3300005563 Bacteria 8235
132 Ga0068855_100020817 3300005563 Bacteria 7864
133 Ga0068855_100365741 3300005563 Bacteria 1586
134 Ga0070664_101144409 3300005564 Bacteria 733
135 Ga0068857_100387580 3300005577 Bacteria 1298
136 Ga0068857_100824397 3300005577 Bacteria 887
137 Ga0068854_100004704 3300005578 Bacteria 8605
138 Ga0068854_100004957 3300005578 Bacteria 8391
139 Ga0068854_100099655 3300005578 Bacteria 2176
140 Ga0068854_100465311 3300005578 Bacteria 1059
141 Ga0068856_100058353 3300005614 Bacteria 3811
142 Ga0068856_100234204 3300005614 Bacteria 1852
143 Ga0068856_100538641 3300005614 Bacteria 1189
144 Ga0068856_100830858 3300005614 Bacteria 943
145 Ga0070702_100004699 3300005615 Bacteria 6265
146 Ga0070702_100040445 3300005615 Bacteria 2609
147 Ga0070702_100161199 3300005615 Bacteria 1450
148 Ga0070702_100176951 3300005615 Bacteria 1393
149 Ga0068852_100057370 3300005616 Bacteria 3369
150 Ga0068859_100101205 3300005617 Bacteria 2938
151 Ga0068859_100512453 3300005617 Bacteria 1295
152 Ga0068864_100006955 3300005618 Bacteria 9278
153 Ga0068866_10001499 3300005718 Bacteria 9943
154 Ga0068866_10079945 3300005718 Bacteria 1753
155 Ga0068861_100822906 3300005719 Bacteria 873
156 Ga0068851_10511969 3300005834 Bacteria 721
157 Ga0068863_100004894 3300005841 Bacteria 13198
158 Ga0068858_100049032 3300005842 Bacteria 3911
159 Ga0068858_100080949 3300005842 Bacteria 3018
160 Ga0070717_10225840 3300006028 Bacteria 1647
161 Ga0070717_10623054 3300006028 Bacteria 979
162 Ga0070715_10010540 3300006163 Bacteria 3298
163 Ga0070715_10019155 3300006163 Bacteria 2619
164 Ga0070712_100004888 3300006175 Bacteria 8286
165 Ga0070712_100089940 3300006175 Bacteria 2247
166 Ga0070712_100214971 3300006175 Bacteria 1518
167 Ga0075366_10528077 3300006195 Bacteria 730
168 Ga0097621_100046101 3300006237 Bacteria 3525
169 Ga0097621_100273988 3300006237 Bacteria 1484
170 Ga0068871_100019735 3300006358 Bacteria 5150
171 Ga0068871_100086114 3300006358 Bacteria 2610
172 Ga0075428_100001737 3300006844 Bacteria 23250
173 Ga0075431_100276628 3300006847 Bacteria 1700
174 Ga0075434_100053373 3300006871 Bacteria 4017
175 Ga0075434_100261086 3300006871 Bacteria 1751
176 Ga0075429_100059174 3300006880 Bacteria 3337
177 Ga0068865_100017695 3300006881 Bacteria 4587
178 Ga0068865_100045549 3300006881 Bacteria 3007
179 Ga0075436_100046190 3300006914 Bacteria 3004
180 Ga0075436_100340341 3300006914 Bacteria 1080
181 Ga0097620_100101201 3300006931 Bacteria 2938
182 Ga0097620_100512459 3300006931 Bacteria 1295
183 Ga0079104_1014796 3300006946 Bacteria 2340
184 Ga0099826_10000001 3300006948 Bacteria 1155201
185 Ga0075435_100084353 3300007076 Bacteria 2614
186 Ga0075435_100332326 3300007076 Bacteria 1302
187 Ga0075435_100946792 3300007076 Bacteria 751
188 Ga0105251_10156105 3300009011 Bacteria 1029
189 Ga0105244_10031110 3300009036 Bacteria 2834
190 Ga0105244_10415334 3300009036 Bacteria 619
191 Ga0105240_10027136 3300009093 Bacteria 7502
192 Ga0105240_10058534 3300009093 Bacteria 4810
193 Ga0105240_10355771 3300009093 Bacteria 1660
194 Ga0105240_10450415 3300009093 Bacteria 1440
195 Ga0111539_10002714 3300009094 Bacteria 23478
196 Ga0111539_10043139 3300009094 Bacteria 5409
197 Ga0105245_10137680 3300009098 Bacteria 2296
198 Ga0105245_10192825 3300009098 Bacteria 1952
199 Ga0105245_10210530 3300009098 Bacteria 1871
200 Ga0105245_10319855 3300009098 Bacteria 1528
201 Ga0105245_10331865 3300009098 Bacteria 1501
202 Ga0105247_10343261 3300009101 Bacteria 1048
203 Ga0114129_10164862 3300009147 Bacteria 3025
204 Ga0105243_10461943 3300009148 Bacteria 1194
205 Ga0105243_10475361 3300009148 Bacteria 1178
206 Ga0105241_10012641 3300009174 Bacteria 6196
207 Ga0105241_10575566 3300009174 Bacteria 1014
208 Ga0105242_10022867 3300009176 Bacteria 4923
209 Ga0105242_10049831 3300009176 Bacteria 3409
210 Ga0105242_11042383 3300009176 Bacteria 828
211 Ga0105248_10001274 3300009177 Bacteria 28163
212 Ga0105248_10274738 3300009177 Bacteria 1897
213 Ga0105237_10094387 3300009545 Bacteria 2981
214 Ga0105237_10203331 3300009545 Bacteria 1981
215 Ga0105237_10231685 3300009545 Bacteria 1848
216 Ga0105237_10314393 3300009545 Bacteria 1569
217 Ga0105237_10477637 3300009545 Bacteria 1253
218 Ga0105238_10000955 3300009551 Bacteria 29651
219 Ga0105238_10073501 3300009551 Bacteria 3414
220 Ga0105238_10107469 3300009551 Bacteria 2771
221 Ga0105238_10215500 3300009551 Bacteria 1896
222 Ga0105238_10455261 3300009551 Bacteria 1277
223 Ga0105238_10594166 3300009551 Bacteria 1114
224 Ga0105239_10013663 3300010375 Bacteria 9016
225 Ga0105239_10233571 3300010375 Bacteria 2063
226 Ga0105239_10686998 3300010375 Bacteria 1170
227 Ga0105246_10223182 3300011119 Bacteria 1478
228 Ga0105246_10318267 3300011119 Bacteria 1263
229 Ga0105246_10450445 3300011119 Bacteria 1081
230 Ga0157373_10186762 3300013100 Bacteria 1460
231 Ga0157373_10343115 3300013100 Bacteria 1065
232 Ga0157371_10000013 3300013102 Bacteria 352631
233 Ga0157371_10393403 3300013102 Bacteria 1013
234 Ga0157370_10876603 3300013104 Bacteria 815
235 Ga0157369_10145101 3300013105 Bacteria 2510
236 Ga0157374_10005037 3300013296 Bacteria 11082
237 Ga0157374_11424835 3300013296 Bacteria 716
238 Ga0157378_10004389 3300013297 Bacteria 12416
239 Ga0157378_10050117 3300013297 Bacteria 3715
240 Ga0157378_10123878 3300013297 Bacteria 2386
241 Ga0157378_10360338 3300013297 Bacteria 1423
242 Ga0163162_10042566 3300013306 Bacteria 4546
243 Ga0163162_10087689 3300013306 Bacteria 3191
244 Ga0157372_10266332 3300013307 Bacteria 1990
245 Ga0157372_11056103 3300013307 Bacteria 940
246 Ga0157372_11786584 3300013307 Bacteria 707
247 Ga0157375_10086067 3300013308 Bacteria 3193
248 Ga0157375_10696817 3300013308 Bacteria 1169
249 Ga0163163_10031257 3300014325 Bacteria 5138
250 Ga0163163_10186265 3300014325 Bacteria 2123
251 Ga0182008_10016736 3300014497 Bacteria 3805
252 Ga0182008_10019024 3300014497 Bacteria 3550
253 Ga0182008_10173520 3300014497 Bacteria 1089
254 Ga0182008_10233469 3300014497 Bacteria 944
255 Ga0157377_10030450 3300014745 Bacteria 2924
256 Ga0157379_10019373 3300014968 Bacteria 6009
257 Ga0157379_10048413 3300014968 Bacteria 3794
258 Ga0157376_10027516 3300014969 Bacteria 4508
259 Ga0157376_10028649 3300014969 Bacteria 4429
260 Ga0157376_10188151 3300014969 Bacteria 1891
261 Ga0157376_10325238 3300014969 Bacteria 1463
262 Ga0182006_1000035 3300015261 Bacteria 232349
263 Ga0182006_1015816 3300015261 Bacteria 3227
264 Ga0182006_1123458 3300015261 Bacteria 897
265 Ga0182006_1127791 3300015261 Bacteria 877
266 Ga0182007_10000040 3300015262 Bacteria 120364
267 Ga0182007_10008097 3300015262 Bacteria 4339
268 Ga0182007_10025147 3300015262 Bacteria 2076
269 Ga0182007_10025272 3300015262 Bacteria 2070
270 Ga0182005_1000025 3300015265 Bacteria 235532
271 Ga0182005_1008205 3300015265 Bacteria 3088
272 Ga0163161_10025359 3300017792 Bacteria 4196
273 Ga0163161_10125767 3300017792 Bacteria 1930
274 Ga0163161_10439697 3300017792 Bacteria 1052
275 Ga0206354_11479432 3300020081 Bacteria 669
276 Ga0213872_10000442 3300021361 Bacteria 33971
277 Ga0209435_100015 3300025206 Bacteria 321177
278 Ga0209760_104093 3300025207 Bacteria 1264
279 Ga0209784_100005 3300025224 Bacteria 1040422
280 Ga0209784_100079 3300025224 Bacteria 136351
281 Ga0209566_100005 3300025225 Bacteria 1040422
282 Ga0209566_100093 3300025225 Bacteria 136351
283 Ga0209674_100009 3300025226 Bacteria 1040422
284 Ga0209674_100115 3300025226 Bacteria 136351
285 Ga0209147_100004 3300025229 Bacteria 1371850
286 Ga0209563_100003 3300025230 Bacteria 1932942
287 Ga0209563_100012 3300025230 Bacteria 1040422
288 Ga0209563_100113 3300025230 Bacteria 136351
289 Ga0207427_100262 3300025231 Bacteria 40896
290 Ga0209437_100176 3300025233 Bacteria 136351
291 Ga0209437_100329 3300025233 Bacteria 59120
292 Ga0209258_100523 3300025242 Bacteria 36787
293 Ga0209646_1000020 3300025246 Bacteria 462204
294 Ga0209646_1000040 3300025246 Bacteria 347867
295 Ga0209026_1000034 3300025250 Bacteria 306953
296 Ga0209026_1001477 3300025250 Bacteria 10363
297 Ga0209677_100006 3300025253 Bacteria 1040422
298 Ga0209677_100072 3300025253 Bacteria 136351
299 Ga0209677_104819 3300025253 Bacteria 3732
300 Ga0209148_1001634 3300025254 Bacteria 10288
301 Ga0209759_1000049 3300025256 Bacteria 221692
302 Ga0209759_1000656 3300025256 Bacteria 32085
303 Ga0209233_1000183 3300025261 Bacteria 136351
304 Ga0209565_1022947 3300025263 Bacteria 1286
305 Ga0209455_1000044 3300025272 Bacteria 410787
306 Ga0209675_1014874 3300025291 Bacteria 2343
307 Ga0209564_1000007 3300025295 Bacteria 1028582
308 Ga0209564_1018332 3300025295 Bacteria 2674
309 Ga0209256_1000005 3300025299 Bacteria 1315082
310 Ga0207656_10268669 3300025321 Bacteria 839
311 Ga0207713_1067643 3300025735 Bacteria 1331
312 Ga0207692_10065905 3300025898 Bacteria 1891
313 Ga0207692_10366682 3300025898 Bacteria 891
314 Ga0207642_10006909 3300025899 Bacteria 3802
315 Ga0207642_10038420 3300025899 Bacteria 2072
316 Ga0207680_10203891 3300025903 Bacteria 1349
317 Ga0207685_10008483 3300025905 Bacteria 2929
318 Ga0207685_10094183 3300025905 Bacteria 1268
319 Ga0207699_10030839 3300025906 Bacteria 3004
320 Ga0207699_10204252 3300025906 Bacteria 1340
321 Ga0207699_10439686 3300025906 Bacteria 934
322 Ga0207645_10095689 3300025907 Bacteria 1912
323 Ga0207705_10014245 3300025909 Bacteria 5726
324 Ga0207684_10097803 3300025910 Bacteria 2506
325 Ga0207684_10213069 3300025910 Bacteria 1666
326 Ga0207654_10055339 3300025911 Bacteria 2296
327 Ga0207654_10186779 3300025911 Bacteria 1356
328 Ga0207707_10023430 3300025912 Bacteria 5400
329 Ga0207707_10529626 3300025912 Bacteria 1003
330 Ga0207695_10001485 3300025913 Bacteria 39195
331 Ga0207695_10017853 3300025913 Bacteria 8223
332 Ga0207695_10176575 3300025913 Bacteria 2058
333 Ga0207695_10263151 3300025913 Bacteria 1622
334 Ga0207695_10267304 3300025913 Bacteria 1606
335 Ga0207671_10014534 3300025914 Bacteria 6215
336 Ga0207671_10345078 3300025914 Bacteria 1180
337 Ga0207671_10419490 3300025914 Bacteria 1065
338 Ga0207671_10449138 3300025914 Bacteria 1027
339 Ga0207671_10844774 3300025914 Bacteria 725
340 Ga0207671_11230951 3300025914 Bacteria 585
341 Ga0207693_10000325 3300025915 Bacteria 44161
342 Ga0207693_10007147 3300025915 Bacteria 9206
343 Ga0207693_10027499 3300025915 Bacteria 4496
344 Ga0207693_10311631 3300025915 Bacteria 1232
345 Ga0207663_10022607 3300025916 Bacteria 3598
346 Ga0207663_10174927 3300025916 Bacteria 1528
347 Ga0207660_10229022 3300025917 Bacteria 1461
348 Ga0207657_10000571 3300025919 Bacteria 39136
349 Ga0207657_10003818 3300025919 Bacteria 16006
350 Ga0207649_10013576 3300025920 Bacteria 4549
351 Ga0207649_10292979 3300025920 Bacteria 1187
352 Ga0207652_10362395 3300025921 Bacteria 1308
353 Ga0207652_10702479 3300025921 Bacteria 902
354 Ga0207646_10005342 3300025922 Bacteria 13532
355 Ga0207646_10100336 3300025922 Bacteria 2595
356 Ga0207694_10000783 3300025924 Bacteria 28558
357 Ga0207694_10270813 3300025924 Bacteria 1393
358 Ga0207694_10602158 3300025924 Bacteria 924
359 Ga0207650_10115157 3300025925 Bacteria 2086
360 Ga0207650_10316559 3300025925 Bacteria 1277
361 Ga0207659_10534543 3300025926 Bacteria 995
362 Ga0207687_10128423 3300025927 Bacteria 1907
363 Ga0207687_10234047 3300025927 Bacteria 1452
364 Ga0207687_10341379 3300025927 Bacteria 1218
365 Ga0207687_10451959 3300025927 Bacteria 1066
366 Ga0207700_10182988 3300025928 Bacteria 1756
367 Ga0207700_10547143 3300025928 Bacteria 1027
368 Ga0207644_10026128 3300025931 Bacteria 4021
369 Ga0207644_10177885 3300025931 Bacteria 1665
370 Ga0207690_10000971 3300025932 Bacteria 18363
371 Ga0207690_10039891 3300025932 Bacteria 3066
372 Ga0207690_10212353 3300025932 Bacteria 1476
373 Ga0207706_10011440 3300025933 Bacteria 8083
374 Ga0207706_10323662 3300025933 Bacteria 1342
375 Ga0207706_10630706 3300025933 Bacteria 919
376 Ga0207686_10000118 3300025934 Bacteria 64531
377 Ga0207686_10035088 3300025934 Bacteria 3008
378 Ga0207686_10061717 3300025934 Bacteria 2377
379 Ga0207709_10278864 3300025935 Bacteria 1234
380 Ga0207709_10587787 3300025935 Bacteria 880
381 Ga0207670_10192018 3300025936 Bacteria 1546
382 Ga0207670_10685212 3300025936 Bacteria 847
383 Ga0207669_10071567 3300025937 Bacteria 2179
384 Ga0207704_10036320 3300025938 Bacteria 2834
385 Ga0207704_10042123 3300025938 Bacteria 2685
386 Ga0207704_10395335 3300025938 Bacteria 1089
387 Ga0207665_10008043 3300025939 Bacteria 6958
388 Ga0207665_10011507 3300025939 Bacteria 5812
389 Ga0207691_10122366 3300025940 Bacteria 2304
390 Ga0207711_10140923 3300025941 Bacteria 2169
391 Ga0207711_10204359 3300025941 Bacteria 1803
392 Ga0207711_10442481 3300025941 Bacteria 1209
393 Ga0207711_10549821 3300025941 Bacteria 1077
394 Ga0207689_10271008 3300025942 Bacteria 1405
395 Ga0207679_10003703 3300025945 Bacteria 9473
396 Ga0207667_10000053 3300025949 Bacteria 226712
397 Ga0207667_10010379 3300025949 Bacteria 10885
398 Ga0207667_10041035 3300025949 Bacteria 4923
399 Ga0207667_10066275 3300025949 Bacteria 3764
400 Ga0207651_10040775 3300025960 Bacteria 3075
401 Ga0207651_10627418 3300025960 Bacteria 942
402 Ga0207640_11073868 3300025981 Bacteria 711
403 Ga0207658_10236199 3300025986 Bacteria 1545
404 Ga0207658_10321010 3300025986 Bacteria 1340
405 Ga0207677_10089453 3300026023 Bacteria 2235
406 Ga0207677_10137924 3300026023 Bacteria 1863
407 Ga0207677_10151784 3300026023 Bacteria 1788
408 Ga0207703_10032162 3300026035 Bacteria 4151
409 Ga0207639_10149553 3300026041 Bacteria 1954
410 Ga0207678_10037994 3300026067 Bacteria 4186
411 Ga0207678_10117634 3300026067 Bacteria 2268
412 Ga0207702_10097125 3300026078 Bacteria 2592
413 Ga0207702_10163950 3300026078 Bacteria 2031
414 Ga0207702_10249160 3300026078 Bacteria 1667
415 Ga0207702_10270589 3300026078 Bacteria 1602
416 Ga0207702_10399249 3300026078 Bacteria 1326
417 Ga0207641_10093135 3300026088 Bacteria 2640
418 Ga0207648_10026419 3300026089 Bacteria 5159
419 Ga0207648_10230432 3300026089 Bacteria 1648
420 Ga0207676_10299548 3300026095 Bacteria 1467
421 Ga0207674_10005654 3300026116 Bacteria 14825
422 Ga0207674_10258058 3300026116 Bacteria 1690
423 Ga0207674_10281410 3300026116 Bacteria 1611
424 Ga0207674_10302508 3300026116 Bacteria 1548
425 Ga0207683_10003257 3300026121 Bacteria 14158
426 Ga0207683_10004973 3300026121 Bacteria 11433
427 Ga0207698_10004178 3300026142 Bacteria 8785
428 Ga0207698_10012444 3300026142 Bacteria 5569
429 Ga0207698_10206330 3300026142 Bacteria 1764
430 Ga0209282_1000001 3300027666 Bacteria 2450367
431 Ga0207428_10004868 3300027907 Bacteria 12660
432 Ga0207428_10363892 3300027907 Bacteria 1063
433 Ga0268266_10233330 3300028379 Bacteria 1695
434 Ga0268264_10222767 3300028381 Bacteria 1737
435 Ga0268264_11548598 3300028381 Bacteria 673
436 Ga0316177_1056911 3300030731 Bacteria 1559
437 Ga0316178_1070957 3300030735 Bacteria 1692
438 Ga0316180_1080061 3300030736 Bacteria 3757
439 Ga0316182_1091364 3300030745 Bacteria 681
440 Ga0316182_1138354 3300030745 Bacteria 643
441 Ga0265325_10000262 3300031241 Bacteria 37299
442 Ga0265327_10027789 3300031251 Bacteria 3249
443 Ga0265327_10028337 3300031251 Bacteria 3206
444 Ga0307408_100000294 3300031548 Bacteria 48528
445 Ga0307408_100070573 3300031548 Bacteria 2579
446 Ga0307408_100189269 3300031548 Bacteria 1657
447 Ga0316576_10014395 3300031727 Bacteria 5286
448 Ga0316576_10119002 3300031727 Bacteria 1983
449 Ga0316578_10005843 3300031728 Bacteria 6017
450 Ga0316578_10698694 3300031728 Bacteria 591
451 Ga0307516_10248129 3300031730 Bacteria 1476
452 Ga0307413_10152110 3300031824 Bacteria 1614
453 Ga0307413_10352374 3300031824 Bacteria 1136
454 Ga0307413_10592313 3300031824 Bacteria 906
455 Ga0307518_10028537 3300031838 Bacteria 4028
456 Ga0307410_10091192 3300031852 Bacteria 2163
457 Ga0307410_10168964 3300031852 Bacteria 1646
458 Ga0307412_10026102 3300031911 Bacteria 3628
459 Ga0307412_10661874 3300031911 Bacteria 892
460 Ga0307409_100013944 3300031995 Bacteria 5202
461 Ga0307416_100012770 3300032002 Bacteria 5677
462 Ga0307414_10133833 3300032004 Bacteria 1929
463 Ga0307414_10240273 3300032004 Bacteria 1499
464 Ga0307414_10271035 3300032004 Bacteria 1421
465 Ga0307414_11195266 3300032004 Bacteria 704
466 Ga0307411_10089098 3300032005 Bacteria 2148
467 Ga0307411_10116293 3300032005 Bacteria 1925
468 Ga0307411_10180747 3300032005 Bacteria 1601
469 Ga0307411_10276268 3300032005 Bacteria 1335
470 Ga0316583_10000450 3300032133 Bacteria 12121
471 Ga0316583_10007762 3300032133 Bacteria 3869
472 Ga0316580_10154243 3300032139 Bacteria 705
473 Ga0307507_10059523 3300033179 Bacteria 3575
474 Ga0316592_1003877 3300033524 Bacteria 2743
475 Ga0316592_1005553 3300033524 Bacteria 2400
476 Ga0316587_1028496 3300033529 Bacteria 980
477 Ga0316596_1000002 3300033541 Bacteria 24681
478 Ga0316596_1000007 3300033541 Bacteria 19350
479 Ga0373926_0104149 3300035083 Bacteria 1063
480 Ga0373923_0073468 3300035111 Bacteria 1472
481 Ga0373936_0020708 3300035113 Bacteria 2556
482 Ga0373936_0131451 3300035113 Bacteria 1076
483 Ga0373939_0036290 3300035114 Bacteria 1457
484 Ga0373945_0017368 3300035116 Bacteria 2436
485 Ga0373953_0011867 3300035117 Bacteria 3070
486 Ga0373954_0094093 3300035118 Bacteria 1441
487 Ga0373956_0008504 3300035119 Bacteria 4154
488 Ga0373956_0033825 3300035119 Bacteria 2249
489 Ga0373956_0075954 3300035119 Bacteria 1537
490 Ga0373943_0083321 3300035170 Bacteria 1643
491 Ga0373943_0377635 3300035170 Bacteria 815
492 Ga0373946_0036344 3300035171 Bacteria 1997
493 Ga0373955_0044618 3300035172 Bacteria 2389
494 Ga0373955_0068759 3300035172 Bacteria 1974
495 Ga0316574_0148984 3300035398 Bacteria 1508
496 Ga0373924_0050158 3300035410 Bacteria 1728
497 Ga0373935_0059744 3300035692 Bacteria 2438
498 Ga0373935_0073331 3300035692 Bacteria 2211
499 Ga0373927_0012113 3300035695 Bacteria 5738
500 Ga0373927_0013469 3300035695 Bacteria 5434
501 Ga0373927_0041604 3300035695 Bacteria 2980
502 Ga0373927_0759692 3300035695 Bacteria 640
503 Ga0373927_0904829 3300035695 Bacteria 582
504 Ga0373933_0060334 3300035724 Bacteria 2286
505 Ga0373933_0077401 3300035724 Bacteria 2033
506 Ga0373933_0232091 3300035724 Bacteria 1185
507 Ga0373947_0082116 3300035725 Bacteria 1997
508 Ga0373947_0110948 3300035725 Bacteria 1733
509 Ga0373947_0127072 3300035725 Bacteria 1624
510 Ga0373947_0444702 3300035725 Bacteria 877
511 Ga0373937_0004053 3300036401 Bacteria 12409
512 Ga0373937_0076494 3300036401 Bacteria 3091
513 Ga0373937_0177721 3300036401 Bacteria 1998
514 Ga0373937_0416795 3300036401 Bacteria 1274
515 Ga0316582_0004588 3300036647 Bacteria 7000
516 Ga0316584_0169500 3300036712 Bacteria 1620
517 Ga0316584_0237324 3300036712 Bacteria 1335
518 Ga0373925_0024531 3300037068 Bacteria 4402
519 Ga0373925_0026948 3300037068 Bacteria 4207
520 Ga0373925_0055374 3300037068 Bacteria 2969
521 Ga0395899_0000183 3300037312 Bacteria 91818
522 Ga0395899_0005514 3300037312 Bacteria 9803
523 Ga0395899_0011802 3300037312 Bacteria 6686
524 Ga0395899_0015482 3300037312 Bacteria 5814
525 Ga0395899_0019639 3300037312 Bacteria 5129
526 Ga0395899_0047299 3300037312 Bacteria 3203
527 Ga0395899_0049915 3300037312 Bacteria 3108
528 Ga0395899_0070098 3300037312 Bacteria 2566
529 Ga0395899_0219765 3300037312 Bacteria 1316
530 Ga0395900_0000331 3300037418 Bacteria 69780
531 Ga0395900_0005509 3300037418 Bacteria 13249
532 Ga0395900_0013338 3300037418 Bacteria 8401
533 Ga0395900_0039845 3300037418 Bacteria 4841
534 Ga0395900_0061672 3300037418 Bacteria 3855
535 Ga0395900_0103143 3300037418 Bacteria 2930
536 Ga0395900_0116900 3300037418 Bacteria 2736
537 Ga0395900_0328331 3300037418 Bacteria 1508
538 Ga0395898_0002939 3300037466 Bacteria 19377
539 Ga0395898_0026637 3300037466 Bacteria 5814
540 Ga0395898_0048112 3300037466 Bacteria 4183
541 Ga0395898_0118397 3300037466 Bacteria 2537
542 Ga0395898_0187514 3300037466 Bacteria 1976
543 Ga0395905_0004758 3300037471 Bacteria 14030
544 Ga0395905_0021934 3300037471 Bacteria 6040
545 Ga0395905_0050257 3300037471 Bacteria 3907
546 Ga0395905_0087348 3300037471 Bacteria 2923
547 Ga0395905_0234734 3300037471 Bacteria 1714
548 Ga0395905_0237236 3300037471 Bacteria 1704
549 Ga0395905_0245926 3300037471 Bacteria 1671
550 Ga0395905_0778575 3300037471 Bacteria 859
551 Ga0395901_0000097 3300038443 Bacteria 118528
552 Ga0395901_0009352 3300038443 Bacteria 9938
553 Ga0395901_0030543 3300038443 Bacteria 5551
554 Ga0395901_0201311 3300038443 Bacteria 2087
555 Ga0395901_0236417 3300038443 Bacteria 1906
556 Ga0395901_0314025 3300038443 Bacteria 1622
557 Ga0395901_0427788 3300038443 Bacteria 1357
558 Ga0395901_0553519 3300038443 Bacteria 1165
559 Ga0395901_0553742 3300038443 Bacteria 1165
560 Ga0395901_1443153 3300038443 Bacteria 645
561 Ga0400483_066879 3300039062 Bacteria 63337
562 Ga0400483_146612 3300039062 Bacteria 1776
563 Ga0436360_0890123 3300039438 Bacteria 653
564 Ga0436361_0061503 3300039447 Bacteria 127805
565 Ga0436361_0204853 3300039447 Bacteria 15869
566 Ga0436361_0383429 3300039447 Bacteria 1349
567 Ga0439439_0003713 3300041406 Bacteria 3387
568 Ga0439448_0037833 3300042005 Bacteria 1551
569 Ga0439449_0001658 3300042007 Bacteria 8745
570 Ga0439449_0014317 3300042007 Bacteria 2981
571 Ga0439454_025630 3300042011 Bacteria 898
572 Ga0439455_0040097 3300042012 Bacteria 1196
573 Ga0450904_008348 3300042139 Bacteria 1022
574 Ga0439458_0004250 3300042157 Bacteria 3305
575 Ga0439458_0020540 3300042157 Bacteria 1525
576 Ga0451577_0128327 3300042876 Bacteria 2274
577 Ga0451577_1084677 3300042876 Bacteria 717
578 Ga0451577_1727726 3300042876 Bacteria 550
579 Ga0466969_0439929 3300044656 Bacteria 593
580 Ga0466972_0000275 3300044658 Bacteria 32437
581 Ga0466972_0018121 3300044658 Bacteria 3522
582 Ga0466972_0022289 3300044658 Bacteria 3154
583 Ga0453683_0909240 3300044673 Bacteria 582
584 Ga0466965_0031058 3300044683 Bacteria 2603
585 Ga0466965_0034658 3300044683 Bacteria 2469
586 Ga0466965_0052576 3300044683 Bacteria 2023
587 Ga0466965_0083479 3300044683 Bacteria 1617
588 Ga0466965_0115875 3300044683 Bacteria 1380
589 Ga0466966_0019370 3300044684 Bacteria 4477
590 Ga0466966_0106606 3300044684 Bacteria 1729
591 Ga0466966_0108832 3300044684 Bacteria 1709
592 Ga0466966_0184175 3300044684 Bacteria 1266
593 Ga0466961_0164364 3300044693 Bacteria 1382
594 Ga0466964_0005584 3300044706 Bacteria 4670
595 Ga0466964_0028701 3300044706 Bacteria 2193
596 Ga0466964_0052875 3300044706 Bacteria 1670
597 Ga0466964_0214098 3300044706 Bacteria 932
598 Ga0453684_0005853 3300044712 Bacteria 23905
599 Ga0466971_0022364 3300044719 Bacteria 2817
600 Ga0466971_0137791 3300044719 Bacteria 1135
601 Ga0466971_0680257 3300044719 Bacteria 516
602 Ga0466968_0005700 3300044735 Bacteria 4667
603 Ga0466970_0038578 3300044765 Bacteria 2534
604 Ga0466957_0038618 3300044842 Bacteria 2877
605 Ga0466960_0341790 3300044901 Bacteria 852
606 Ga0466959_0157211 3300045049 Bacteria 1599
607 Ga0466959_0242477 3300045049 Bacteria 1244
608 Ga0466959_0297089 3300045049 Bacteria 1106
609 Ga0466959_0995015 3300045049 Bacteria 558
610 Ga0451576_0002470 3300045051 Bacteria 27511
611 Ga0451576_0168707 3300045051 Bacteria 2284
612 Ga0466958_0337462 3300045836 Bacteria 969
613 Ga0466958_0950990 3300045836 Bacteria 560
614 Ga0466967_0078869 3300045976 Bacteria 2967
615 Ga0466967_0336607 3300045976 Bacteria 1458
616 Ga0495617_000009 3300046452 Bacteria 312936
617 Ga0495617_026010 3300046452 Bacteria 1971
618 Ga0495627_006670 3300046453 Bacteria 4497
619 Ga0495627_058943 3300046453 Bacteria 1139
620 Ga0495592_0047319 3300046454 Bacteria 3203
621 Ga0495603_0037909 3300046455 Bacteria 2892
622 Ga0495603_0042128 3300046455 Bacteria 2730
623 Ga0495603_0178895 3300046455 Bacteria 1227
624 Ga0495590_0000054 3300046457 Bacteria 100477
625 Ga0495590_0043066 3300046457 Bacteria 1574
626 Ga0495590_0050954 3300046457 Bacteria 1445
627 Ga0495590_0402027 3300046457 Bacteria 525
628 Ga0495591_023034 3300046458 Bacteria 2003
629 Ga0495591_026013 3300046458 Bacteria 1826
630 Ga0495629_0122521 3300046459 Bacteria 1811
631 Ga0495629_0291919 3300046459 Bacteria 1117
632 Ga0495629_0442648 3300046459 Bacteria 880
633 Ga0495638_0022607 3300046460 Bacteria 4126
634 Ga0495638_0057841 3300046460 Bacteria 2404
635 Ga0495651_0053029 3300046462 Bacteria 3123
636 Ga0495651_0108525 3300046462 Bacteria 2055
637 Ga0495651_0155360 3300046462 Bacteria 1645
638 Ga0495653_0014598 3300046463 Bacteria 6411
639 Ga0495653_0033179 3300046463 Bacteria 4091
640 Ga0495653_0043178 3300046463 Bacteria 3506
641 Ga0495653_0253295 3300046463 Bacteria 1167
642 Ga0495650_0000593 3300046471 Bacteria 50088
643 Ga0495650_0028439 3300046471 Bacteria 2566
644 Ga0495580_0034101 3300046472 Bacteria 3665
645 Ga0495580_0054857 3300046472 Bacteria 2810
646 Ga0495580_0082784 3300046472 Bacteria 2236
647 Ga0495580_0114350 3300046472 Bacteria 1874
648 Ga0495580_0151150 3300046472 Bacteria 1608
649 Ga0495580_0179227 3300046472 Bacteria 1463
650 Ga0495582_0018805 3300046473 Bacteria 3777
651 Ga0495582_0018828 3300046473 Bacteria 3775
652 Ga0495605_0000024 3300046474 Bacteria 236016
653 Ga0495605_0000150 3300046474 Bacteria 90165
654 Ga0495605_0015140 3300046474 Bacteria 4203
655 Ga0495605_0017715 3300046474 Bacteria 3830
656 Ga0495605_0020086 3300046474 Bacteria 3553
657 Ga0495605_0036410 3300046474 Bacteria 2481
658 Ga0495605_0096022 3300046474 Bacteria 1368
659 Ga0495605_0109442 3300046474 Bacteria 1262
660 Ga0495605_0263300 3300046474 Bacteria 735
661 Ga0495639_0121048 3300046475 Bacteria 1248
662 Ga0495639_0275999 3300046475 Bacteria 835
663 Ga0495662_0024992 3300046476 Bacteria 2884
664 Ga0495664_0103722 3300046477 Bacteria 1714
665 Ga0495664_0291919 3300046477 Bacteria 985
666 Ga0495584_0004700 3300046491 Bacteria 7312
667 Ga0495584_0010175 3300046491 Bacteria 4829
668 Ga0495584_0018909 3300046491 Bacteria 3500
669 Ga0495584_0026934 3300046491 Bacteria 2913
670 Ga0495584_0113124 3300046491 Bacteria 1373
671 Ga0495584_0168914 3300046491 Bacteria 1112
672 Ga0495584_0527994 3300046491 Bacteria 601
673 Ga0495585_0000130 3300046492 Bacteria 81689
674 Ga0495585_0017853 3300046492 Bacteria 4095
675 Ga0495585_0017899 3300046492 Bacteria 4089
676 Ga0495585_0021109 3300046492 Bacteria 3740
677 Ga0495585_0023091 3300046492 Bacteria 3570
678 Ga0495585_0031069 3300046492 Bacteria 3035
679 Ga0495585_0032805 3300046492 Bacteria 2940
680 Ga0495585_0036668 3300046492 Bacteria 2763
681 Ga0495585_0081286 3300046492 Bacteria 1755
682 Ga0495585_0099296 3300046492 Bacteria 1558
683 Ga0495585_0111604 3300046492 Bacteria 1453
684 Ga0495585_0124731 3300046492 Bacteria 1359
685 Ga0495585_0144845 3300046492 Bacteria 1242
686 Ga0495585_0223744 3300046492 Bacteria 948
687 Ga0495585_0302855 3300046492 Bacteria 785
688 Ga0495585_0331404 3300046492 Bacteria 742
689 Ga0495594_0011814 3300046499 Bacteria 4541
690 Ga0495594_0026282 3300046499 Bacteria 3131
691 Ga0495594_0042316 3300046499 Bacteria 2494
692 Ga0495594_0104279 3300046499 Bacteria 1596
693 Ga0495594_0130258 3300046499 Bacteria 1424
694 Ga0495594_0148063 3300046499 Bacteria 1332
695 Ga0495594_0173761 3300046499 Bacteria 1226
696 Ga0495594_0541274 3300046499 Bacteria 661
697 Ga0495596_0008779 3300046500 Bacteria 4474
698 Ga0495596_0011263 3300046500 Bacteria 3863
699 Ga0495596_0011276 3300046500 Bacteria 3861
700 Ga0495596_0036439 3300046500 Bacteria 1948
701 Ga0495596_0038300 3300046500 Bacteria 1895
702 Ga0495596_0056912 3300046500 Bacteria 1526
703 Ga0495596_0094647 3300046500 Bacteria 1159
704 Ga0495607_0006535 3300046501 Bacteria 8196
705 Ga0495607_0011899 3300046501 Bacteria 5763
706 Ga0495607_0022423 3300046501 Bacteria 3965
707 Ga0495607_0027341 3300046501 Bacteria 3528
708 Ga0495607_0036400 3300046501 Bacteria 2965
709 Ga0495607_0036883 3300046501 Bacteria 2941
710 Ga0495607_0099529 3300046501 Bacteria 1559
711 Ga0495607_0129827 3300046501 Bacteria 1312
712 Ga0495607_0167811 3300046501 Bacteria 1111
713 Ga0495583_0000217 3300046506 Bacteria 96747
714 Ga0495583_0003595 3300046506 Bacteria 11632
715 Ga0495583_0014453 3300046506 Bacteria 4355
716 Ga0495583_0016161 3300046506 Bacteria 4023
717 Ga0495583_0017569 3300046506 Bacteria 3793
718 Ga0495583_0019334 3300046506 Bacteria 3558
719 Ga0495583_0021560 3300046506 Bacteria 3311
720 Ga0495583_0024000 3300046506 Bacteria 3073
721 Ga0495583_0088318 3300046506 Bacteria 1338
722 Ga0495583_0127006 3300046506 Bacteria 1069
723 Ga0495583_0236223 3300046506 Bacteria 735
724 Ga0495606_0000111 3300046507 Bacteria 138144
725 Ga0495606_0012314 3300046507 Bacteria 6876
726 Ga0495606_0031459 3300046507 Bacteria 3689
727 Ga0495606_0031807 3300046507 Bacteria 3663
728 Ga0495606_0043133 3300046507 Bacteria 3011
729 Ga0495606_0088578 3300046507 Bacteria 1908
730 Ga0495606_0098299 3300046507 Bacteria 1786
731 Ga0495606_0145603 3300046507 Bacteria 1395
732 Ga0495606_0153040 3300046507 Bacteria 1352
733 Ga0495606_0161695 3300046507 Bacteria 1306
734 Ga0495606_0296781 3300046507 Bacteria 877
735 Ga0495608_0173893 3300046511 Bacteria 1365
736 Ga0495608_0303761 3300046511 Bacteria 987
737 Ga0495610_0001639 3300046512 Bacteria 19681
738 Ga0495616_0005459 3300046513 Bacteria 7820
739 Ga0495616_0016582 3300046513 Bacteria 4074
740 Ga0495616_0019296 3300046513 Bacteria 3722
741 Ga0495616_0021514 3300046513 Bacteria 3492
742 Ga0495616_0027344 3300046513 Bacteria 3027
743 Ga0495616_0030519 3300046513 Bacteria 2832
744 Ga0495616_0063878 3300046513 Bacteria 1798
745 Ga0495616_0123861 3300046513 Bacteria 1190
746 Ga0495616_0154812 3300046513 Bacteria 1034
747 Ga0495620_0033837 3300046515 Bacteria 2315
748 Ga0495628_0004010 3300046516 Bacteria 13117
749 Ga0495628_0025764 3300046516 Bacteria 4802
750 Ga0495628_0030236 3300046516 Bacteria 4387
751 Ga0495628_0229240 3300046516 Bacteria 1393
752 Ga0495630_0033105 3300046517 Bacteria 3854
753 Ga0495630_0162029 3300046517 Bacteria 1703
754 Ga0495631_0006593 3300046518 Bacteria 5974
755 Ga0495631_0014519 3300046518 Bacteria 3799
756 Ga0495631_0017281 3300046518 Bacteria 3416
757 Ga0495631_0039169 3300046518 Bacteria 2104
758 Ga0495631_0041961 3300046518 Bacteria 2023
759 Ga0495631_0060501 3300046518 Bacteria 1643
760 Ga0495631_0080611 3300046518 Bacteria 1404
761 Ga0495631_0150013 3300046518 Bacteria 1000
762 Ga0495631_0167828 3300046518 Bacteria 941
763 Ga0495632_0005838 3300046519 Bacteria 8057
764 Ga0495632_0015712 3300046519 Bacteria 4232
765 Ga0495632_0017969 3300046519 Bacteria 3889
766 Ga0495632_0018711 3300046519 Bacteria 3793
767 Ga0495632_0022036 3300046519 Bacteria 3422
768 Ga0495632_0024467 3300046519 Bacteria 3206
769 Ga0495632_0033167 3300046519 Bacteria 2653
770 Ga0495632_0293983 3300046519 Bacteria 721
771 Ga0495637_0000317 3300046520 Bacteria 37449
772 Ga0495637_0067719 3300046520 Bacteria 1448
773 Ga0495637_0076779 3300046520 Bacteria 1338
774 Ga0495637_0271947 3300046520 Bacteria 606
775 Ga0495643_0001166 3300046522 Bacteria 25657
776 Ga0495643_0012630 3300046522 Bacteria 5087
777 Ga0495643_0019193 3300046522 Bacteria 3959
778 Ga0495643_0030060 3300046522 Bacteria 3036
779 Ga0495643_0043149 3300046522 Bacteria 2455
780 Ga0495643_0052223 3300046522 Bacteria 2195
781 Ga0495643_0068217 3300046522 Bacteria 1872
782 Ga0495643_0072390 3300046522 Bacteria 1807
783 Ga0495643_0097693 3300046522 Bacteria 1508
784 Ga0495643_0142034 3300046522 Bacteria 1196
785 Ga0495644_0005136 3300046523 Bacteria 5125
786 Ga0495644_0009052 3300046523 Bacteria 3832
787 Ga0495644_0015329 3300046523 Bacteria 2934
788 Ga0495644_0084782 3300046523 Bacteria 1194
789 Ga0495644_0280832 3300046523 Bacteria 649
790 Ga0495648_0013732 3300046524 Bacteria 5970
791 Ga0495648_0022393 3300046524 Bacteria 4350
792 Ga0495648_0030178 3300046524 Bacteria 3588
793 Ga0495648_0031398 3300046524 Bacteria 3498
794 Ga0495648_0060544 3300046524 Bacteria 2252
795 Ga0495648_0257725 3300046524 Bacteria 838
796 Ga0495663_0017407 3300046525 Bacteria 2040
797 Ga0495663_0022183 3300046525 Bacteria 1833
798 Ga0495663_0068445 3300046525 Bacteria 1127
799 Ga0495663_0082955 3300046525 Bacteria 1035
800 Ga0495666_0004837 3300046526 Bacteria 6806
801 Ga0495666_0019043 3300046526 Bacteria 3409
802 Ga0495666_0019490 3300046526 Bacteria 3366
803 Ga0495666_0021664 3300046526 Bacteria 3181
804 Ga0495666_0059007 3300046526 Bacteria 1835
805 Ga0495642_0003195 3300046528 Bacteria 6490
806 Ga0495642_0009672 3300046528 Bacteria 3688
807 Ga0495642_0011766 3300046528 Bacteria 3370
808 Ga0495642_0013208 3300046528 Bacteria 3190
809 Ga0495642_0015642 3300046528 Bacteria 2952
810 Ga0495642_0016149 3300046528 Bacteria 2908
811 Ga0495642_0018647 3300046528 Bacteria 2716
812 Ga0495642_0038628 3300046528 Bacteria 1934
813 Ga0495642_0054932 3300046528 Bacteria 1642
814 Ga0495642_0149590 3300046528 Bacteria 1009
815 Ga0495642_0551544 3300046528 Bacteria 511
816 Ga0495652_0049885 3300046529 Bacteria 3581
817 Ga0495652_0073263 3300046529 Bacteria 2852
818 Ga0495652_0114911 3300046529 Bacteria 2158
819 Ga0495652_0326069 3300046529 Bacteria 1107
820 Ga0495654_0032996 3300046530 Bacteria 2623
821 Ga0495654_0034077 3300046530 Bacteria 2572
822 Ga0495654_0074326 3300046530 Bacteria 1605
823 Ga0495654_0236393 3300046530 Bacteria 766
824 Ga0495665_0028022 3300046531 Bacteria 3022
825 Ga0495665_0034768 3300046531 Bacteria 2695
826 Ga0495665_0071333 3300046531 Bacteria 1829
827 Ga0495665_0160698 3300046531 Bacteria 1171
828 Ga0495665_0200130 3300046531 Bacteria 1035
829 Ga0495665_0399741 3300046531 Bacteria 697
830 Ga0495640_0194312 3300046533 Bacteria 1289
831 Ga0495586_0028869 3300046535 Bacteria 2968
832 Ga0495586_0034409 3300046535 Bacteria 2721
833 Ga0495586_0061876 3300046535 Bacteria 2037
834 Ga0495586_0062533 3300046535 Bacteria 2027
835 Ga0495586_0294140 3300046535 Bacteria 930
836 Ga0495587_0021577 3300046536 Bacteria 3972
837 Ga0495587_0035530 3300046536 Bacteria 3001
838 Ga0495598_0011881 3300046537 Bacteria 2122
839 Ga0495598_0056914 3300046537 Bacteria 1195
840 Ga0495609_0000030 3300046538 Bacteria 215885
841 Ga0495609_0010610 3300046538 Bacteria 4413
842 Ga0495609_0018320 3300046538 Bacteria 3244
843 Ga0495609_0035248 3300046538 Bacteria 2265
844 Ga0495609_0040781 3300046538 Bacteria 2088
845 Ga0495609_0041128 3300046538 Bacteria 2079
846 Ga0495609_0046675 3300046538 Bacteria 1939
847 Ga0495609_0054568 3300046538 Bacteria 1774
848 Ga0495609_0065072 3300046538 Bacteria 1607
849 Ga0495609_0072288 3300046538 Bacteria 1514
850 Ga0495609_0117049 3300046538 Bacteria 1147
851 Ga0495609_0155196 3300046538 Bacteria 972
852 Ga0495609_0282615 3300046538 Bacteria 678
853 Ga0495621_0016295 3300046539 Bacteria 2383
854 Ga0495621_0025100 3300046539 Bacteria 1999
855 Ga0495621_0112505 3300046539 Bacteria 1045
856 Ga0495597_0006249 3300046542 Bacteria 6175
857 Ga0495597_0013175 3300046542 Bacteria 3968
858 Ga0495597_0014538 3300046542 Bacteria 3745
859 Ga0495597_0021593 3300046542 Bacteria 2991
860 Ga0495597_0026824 3300046542 Bacteria 2645
861 Ga0495597_0056360 3300046542 Bacteria 1721
862 Ga0495597_0058946 3300046542 Bacteria 1677
863 Ga0495597_0085971 3300046542 Bacteria 1339
864 Ga0495597_0145296 3300046542 Bacteria 976
865 Ga0495645_0074182 3300046543 Bacteria 2450
866 Ga0495645_0128066 3300046543 Bacteria 1782
867 Ga0495645_0243285 3300046543 Bacteria 1199
868 Ga0495645_0250011 3300046543 Bacteria 1179
869 Ga0495622_0037877 3300046557 Bacteria 2245
870 Ga0495622_0050467 3300046557 Bacteria 1930
871 Ga0495622_0093388 3300046557 Bacteria 1381
872 Ga0495622_0132103 3300046557 Bacteria 1136
873 Ga0495622_0138112 3300046557 Bacteria 1107
874 Ga0495622_0264232 3300046557 Bacteria 755
875 Ga0495633_0000271 3300046558 Bacteria 60538
876 Ga0495633_0018039 3300046558 Bacteria 3590
877 Ga0495633_0019858 3300046558 Bacteria 3390
878 Ga0495633_0033219 3300046558 Bacteria 2488
879 Ga0495633_0061485 3300046558 Bacteria 1758
880 Ga0495633_0087407 3300046558 Bacteria 1449
881 Ga0495633_0097623 3300046558 Bacteria 1364
882 Ga0495633_0155708 3300046558 Bacteria 1055
883 Ga0495633_0383003 3300046558 Bacteria 636
884 Ga0495633_0434349 3300046558 Bacteria 593
885 Ga0495667_0276671 3300046559 Bacteria 1066
886 Ga0495656_0046119 3300046615 Bacteria 1843
887 Ga0495656_0106956 3300046615 Bacteria 1302
888 Ga0495656_0119286 3300046615 Bacteria 1243
889 Ga0495656_0123765 3300046615 Bacteria 1223
890 Ga0495668_0002794 3300046616 Bacteria 13898
891 Ga0495668_0019080 3300046616 Bacteria 3957
892 Ga0495668_0020751 3300046616 Bacteria 3775
893 Ga0495668_0026520 3300046616 Bacteria 3287
894 Ga0495668_0052616 3300046616 Bacteria 2252
895 Ga0495668_0057592 3300046616 Bacteria 2144
896 Ga0495668_0083035 3300046616 Bacteria 1757
897 Ga0495668_0090100 3300046616 Bacteria 1680
898 Ga0495668_0114739 3300046616 Bacteria 1473
899 Ga0495668_0126074 3300046616 Bacteria 1401
900 Ga0495668_0130157 3300046616 Bacteria 1377
901 Ga0495668_0177276 3300046616 Bacteria 1168
902 Ga0495634_0030867 3300046642 Bacteria 3695
903 Ga0495634_0273699 3300046642 Bacteria 1027
904 Ga0495611_0000944 3300046648 Bacteria 15586
905 Ga0495611_0017645 3300046648 Bacteria 3055
906 Ga0495611_0021885 3300046648 Bacteria 2763
907 Ga0495611_0032757 3300046648 Bacteria 2291
908 Ga0495611_0054713 3300046648 Bacteria 1804
909 Ga0495611_0067049 3300046648 Bacteria 1637
910 Ga0495611_0073910 3300046648 Bacteria 1560
911 Ga0495625_0072104 3300046660 Bacteria 2422
912 Ga0495625_0076921 3300046660 Bacteria 2332
913 Ga0495625_0129086 3300046660 Bacteria 1713
914 Ga0495625_0169698 3300046660 Bacteria 1457
915 Ga0495625_0186107 3300046660 Bacteria 1378
916 Ga0495625_0219210 3300046660 Bacteria 1247
917 Ga0495625_0231242 3300046660 Bacteria 1207
918 Ga0495635_0001055 3300046663 Bacteria 18247
919 Ga0495635_0370760 3300046663 Bacteria 953
920 Ga0495659_0044871 3300046664 Bacteria 1591
921 Ga0495659_0291515 3300046664 Bacteria 688
922 Ga0495661_0003016 3300046665 Bacteria 12690
923 Ga0495661_0022811 3300046665 Bacteria 4069
924 Ga0495661_0023036 3300046665 Bacteria 4047
925 Ga0495661_0026310 3300046665 Bacteria 3748
926 Ga0495661_0038432 3300046665 Bacteria 2981
927 Ga0495661_0054848 3300046665 Bacteria 2391
928 Ga0495661_0060721 3300046665 Bacteria 2245
929 Ga0495661_0097043 3300046665 Bacteria 1665
930 Ga0495661_0108389 3300046665 Bacteria 1551
931 Ga0495661_0114471 3300046665 Bacteria 1498
932 Ga0495661_0175220 3300046665 Bacteria 1140
933 Ga0495661_0183882 3300046665 Bacteria 1105
934 Ga0495661_0218491 3300046665 Bacteria 988
935 Ga0495661_0238678 3300046665 Bacteria 933
936 Ga0495661_0395773 3300046665 Bacteria 672
937 Ga0495661_0400422 3300046665 Bacteria 667
938 Ga0495588_0000078 3300046674 Bacteria 214254
939 Ga0495588_0007873 3300046674 Bacteria 4867
940 Ga0495588_0013498 3300046674 Bacteria 3894
941 Ga0495588_0021100 3300046674 Bacteria 3206
942 Ga0495588_0031883 3300046674 Bacteria 2654
943 Ga0495588_0045184 3300046674 Bacteria 2257
944 Ga0495588_0053202 3300046674 Bacteria 2087
945 Ga0495588_0053879 3300046674 Bacteria 2074
946 Ga0495588_0078835 3300046674 Bacteria 1718
947 Ga0495588_0079305 3300046674 Bacteria 1713
948 Ga0495588_0163724 3300046674 Bacteria 1176
949 Ga0495588_0345264 3300046674 Bacteria 782
950 Ga0495588_0360871 3300046674 Bacteria 763
951 Ga0495657_0450986 3300046675 Bacteria 753
952 Ga0495599_0014744 3300046678 Bacteria 4839
953 Ga0495599_0407877 3300046678 Bacteria 809
954 Ga0495623_0033704 3300046679 Bacteria 3286
955 Ga0495623_0131306 3300046679 Bacteria 1499
956 Ga0495623_0144758 3300046679 Bacteria 1410
957 Ga0495623_0204858 3300046679 Bacteria 1132
958 Ga0495623_0246794 3300046679 Bacteria 1006
959 Ga0495623_0551682 3300046679 Bacteria 603
960 Ga0495623_0615013 3300046679 Bacteria 563
961 Ga0495646_0011747 3300046680 Bacteria 5568
962 Ga0495646_0038428 3300046680 Bacteria 2956
963 Ga0495646_0072612 3300046680 Bacteria 2023
964 Ga0495658_0055078 3300046683 Bacteria 2264
965 Ga0495658_0364847 3300046683 Bacteria 919
966 Ga0495669_0000057 3300046684 Bacteria 76704
967 Ga0495669_0010183 3300046684 Bacteria 3971
968 Ga0495669_0023293 3300046684 Bacteria 2694
969 Ga0495669_0025438 3300046684 Bacteria 2581
970 Ga0495669_0064491 3300046684 Bacteria 1662
971 Ga0495613_0141044 3300046689 Bacteria 1722
972 Ga0495613_0149515 3300046689 Bacteria 1666
973 Ga0495624_0019960 3300046690 Bacteria 4465
974 Ga0495624_0021494 3300046690 Bacteria 4278
975 Ga0495624_0817440 3300046690 Bacteria 550
976 Ga0495670_0033139 3300046691 Bacteria 2570
977 Ga0495670_0041936 3300046691 Bacteria 2283
978 Ga0495670_0050890 3300046691 Bacteria 2073
979 Ga0495670_0082759 3300046691 Bacteria 1636
980 Ga0495670_0093245 3300046691 Bacteria 1543
981 Ga0495670_0191456 3300046691 Bacteria 1081
982 Ga0495670_0304018 3300046691 Bacteria 855
983 Ga0495670_0414410 3300046691 Bacteria 728
984 Ga0495670_0422068 3300046691 Bacteria 721
985 Ga0495670_0503078 3300046691 Bacteria 658
986 Ga0495671_0014453 3300046692 Bacteria 4248
987 Ga0495671_0063655 3300046692 Bacteria 1816
988 Ga0495671_0066395 3300046692 Bacteria 1775
989 Ga0495671_0123409 3300046692 Bacteria 1263
990 Ga0495649_0007358 3300046694 Bacteria 6727
991 Ga0495649_0016251 3300046694 Bacteria 4220
992 Ga0495649_0063095 3300046694 Bacteria 1991
993 Ga0495649_0079616 3300046694 Bacteria 1752
994 Ga0495649_0103008 3300046694 Bacteria 1516
995 Ga0495649_0163013 3300046694 Bacteria 1168
996 Ga0495649_0250581 3300046694 Bacteria 910
997 Ga0495649_0351971 3300046694 Bacteria 744
998 Ga0495589_0000021 3300046794 Bacteria 197941
999 Ga0495589_0000193 3300046794 Bacteria 53197
1000 Ga0495589_0015027 3300046794 Bacteria 3984
1001 Ga0495589_0018583 3300046794 Bacteria 3563
1002 Ga0495589_0019463 3300046794 Bacteria 3479
1003 Ga0495589_0024338 3300046794 Bacteria 3078
1004 Ga0495589_0026665 3300046794 Bacteria 2926
1005 Ga0495589_0029213 3300046794 Bacteria 2779
1006 Ga0495589_0029794 3300046794 Bacteria 2751
1007 Ga0495589_0033697 3300046794 Bacteria 2571
1008 Ga0495589_0096889 3300046794 Bacteria 1429
1009 Ga0495589_0156361 3300046794 Bacteria 1087
1010 Ga0495600_0012680 3300046809 Bacteria 5276
1011 Ga0495600_0043503 3300046809 Bacteria 2929
1012 Ga0495600_0064915 3300046809 Bacteria 2386
1013 Ga0495660_0006653 3300046810 Bacteria 6830
1014 Ga0495660_0018126 3300046810 Bacteria 4048
1015 Ga0495660_0033020 3300046810 Bacteria 2904
1016 Ga0495660_0045751 3300046810 Bacteria 2401
1017 Ga0495660_0064519 3300046810 Bacteria 1957
1018 Ga0495660_0095304 3300046810 Bacteria 1539
1019 Ga0495660_0102597 3300046810 Bacteria 1470
1020 Ga0495660_0103292 3300046810 Bacteria 1464
1021 Ga0495660_0170138 3300046810 Bacteria 1062
1022 Ga0495660_0297654 3300046810 Bacteria 732
1023 Ga0495581_0024181 3300047315 Bacteria 3520
1024 Ga0495581_0048836 3300047315 Bacteria 2443
1025 Ga0495581_0049215 3300047315 Bacteria 2433
1026 Ga0495581_0059618 3300047315 Bacteria 2205
1027 Ga0495581_0067339 3300047315 Bacteria 2070
1028 Ga0495581_0305727 3300047315 Bacteria 929
1029 Ga0495604_0029049 3300047317 Bacteria 4400
1030 Ga0495604_0035632 3300047317 Bacteria 3928
1031 Ga0495604_0091755 3300047317 Bacteria 2252
1032 Ga0495604_0254824 3300047317 Bacteria 1195
1033 Ga0495604_0267923 3300047317 Bacteria 1158
1034 Ga0495604_0430012 3300047317 Bacteria 865
1035 Ga0495604_0612328 3300047317 Bacteria 697
1036 Ga0495636_0005023 3300047318 Bacteria 5193
1037 Ga0495636_0051454 3300047318 Bacteria 1726
1038 Ga0495636_0084804 3300047318 Bacteria 1368
1039 Ga0495636_0326516 3300047318 Bacteria 721
1040 Ga0495674_0104908 3300047319 Bacteria 2403
1041 Ga0495674_0106139 3300047319 Bacteria 2386
1042 Ga0495674_1043329 3300047319 Bacteria 625
1043 Ga0495672_0000031 3300047320 Bacteria 298258
1044 Ga0495672_0000178 3300047320 Bacteria 91834
1045 Ga0495672_0008348 3300047320 Bacteria 7660
1046 Ga0495672_0019596 3300047320 Bacteria 4459
1047 Ga0495672_0024609 3300047320 Bacteria 3874
1048 Ga0495672_0115555 3300047320 Bacteria 1434
1049 Ga0495672_0321717 3300047320 Bacteria 726
1050 Ga0495676_0037581 3300047321 Bacteria 4028
1051 Ga0495676_0071155 3300047321 Bacteria 2675
1052 Ga0495676_0102200 3300047321 Bacteria 2118
1053 Ga0495676_0117394 3300047321 Bacteria 1941
1054 Ga0495676_0373360 3300047321 Bacteria 950
1055 Ga0495676_0810652 3300047321 Bacteria 602
1056 Ga0495680_0045790 3300047322 Bacteria 3452
1057 Ga0495680_0240671 3300047322 Bacteria 1285
1058 Ga0495683_0001145 3300047323 Bacteria 18245
1059 Ga0495683_0012100 3300047323 Bacteria 4536
1060 Ga0495683_0072006 3300047323 Bacteria 1695
1061 Ga0495683_0100586 3300047323 Bacteria 1390
1062 Ga0495683_0103684 3300047323 Bacteria 1365
1063 Ga0495683_0118858 3300047323 Bacteria 1256
1064 Ga0495683_0147789 3300047323 Bacteria 1096
1065 Ga0495687_000012 3300047443 Bacteria 391586
1066 Ga0495687_000407 3300047443 Bacteria 53252
1067 Ga0495687_010545 3300047443 Bacteria 5060
1068 Ga0495687_010619 3300047443 Bacteria 5037
1069 Ga0495687_017002 3300047443 Bacteria 3642
1070 Ga0495687_022051 3300047443 Bacteria 3065
1071 Ga0495687_025311 3300047443 Bacteria 2808
1072 Ga0495687_087608 3300047443 Bacteria 1201
1073 Ga0495675_0023477 3300047444 Bacteria 3929
1074 Ga0495675_0053941 3300047444 Bacteria 2551
1075 Ga0495675_0146055 3300047444 Bacteria 1463
1076 Ga0495675_0175213 3300047444 Bacteria 1315
1077 Ga0495675_0406157 3300047444 Bacteria 793
1078 Ga0495675_0515171 3300047444 Bacteria 685
1079 Ga0495677_0000029 3300047445 Bacteria 91481
1080 Ga0495677_0009885 3300047445 Bacteria 3513
1081 Ga0495677_0013909 3300047445 Bacteria 2929
1082 Ga0495677_0031852 3300047445 Bacteria 1919
1083 Ga0495677_0033060 3300047445 Bacteria 1884
1084 Ga0495677_0039358 3300047445 Bacteria 1728
1085 Ga0495677_0073660 3300047445 Bacteria 1274
1086 Ga0495677_0175767 3300047445 Bacteria 829
1087 Ga0495677_0204131 3300047445 Bacteria 768
1088 Ga0495677_0273381 3300047445 Bacteria 662
1089 Ga0495677_0328872 3300047445 Bacteria 602
1090 Ga0495679_006393 3300047446 Bacteria 5080
1091 Ga0495679_013445 3300047446 Bacteria 3073
1092 Ga0495679_038255 3300047446 Bacteria 1503
1093 Ga0495679_090912 3300047446 Bacteria 856
1094 Ga0495685_017538 3300047447 Bacteria 2452
1095 Ga0495685_026444 3300047447 Bacteria 1997
1096 Ga0495685_045059 3300047447 Bacteria 1503
1097 Ga0495685_087144 3300047447 Bacteria 1036
1098 Ga0495685_093592 3300047447 Bacteria 995
1099 Ga0495673_0000028 3300047469 Bacteria 473418
1100 Ga0495673_0068348 3300047469 Bacteria 1501
1101 Ga0495681_0016324 3300047470 Bacteria 4166
1102 Ga0495681_0017670 3300047470 Bacteria 3951
1103 Ga0495681_0020448 3300047470 Bacteria 3592
1104 Ga0495681_0030366 3300047470 Bacteria 2752
1105 Ga0495681_0036098 3300047470 Bacteria 2448
1106 Ga0495681_0053925 3300047470 Bacteria 1880
1107 Ga0495681_0055838 3300047470 Bacteria 1840
1108 Ga0495681_0063129 3300047470 Bacteria 1700
1109 Ga0495681_0134559 3300047470 Bacteria 1049
1110 Ga0495681_0203622 3300047470 Bacteria 801
1111 Ga0495684_0048834 3300047471 Bacteria 3235
1112 Ga0495686_0000738 3300047472 Bacteria 43615
1113 Ga0495686_0008189 3300047472 Bacteria 7713
1114 Ga0495686_0045612 3300047472 Bacteria 2772
1115 Ga0495686_0050961 3300047472 Bacteria 2599
1116 Ga0495686_0095474 3300047472 Bacteria 1800
1117 Ga0495593_0015115 3300047673 Bacteria 4383
1118 Ga0495593_0120015 3300047673 Bacteria 1338
1119 Ga0495593_0129475 3300047673 Bacteria 1281
1120 Ga0495593_0245510 3300047673 Bacteria 896
1121 Ga0495602_0059295 3300048088 Bacteria 3342
1122 Ga0495602_0165470 3300048088 Bacteria 1722
1123 Ga0495602_0194167 3300048088 Bacteria 1554
1124 Ga0495602_0211613 3300048088 Bacteria 1471
1125 Ga0495602_0295523 3300048088 Bacteria 1187
1126 Ga0495614_0003050 3300048089 Bacteria 7465
1127 Ga0495614_0052023 3300048089 Bacteria 1755
1128 Ga0495614_0080005 3300048089 Bacteria 1415
1129 Ga0495614_0186307 3300048089 Bacteria 935
1130 Ga0495615_0041128 3300048090 Bacteria 1154
1131 Ga0495626_0000017 3300048091 Bacteria 231648
1132 Ga0495626_0000028 3300048091 Bacteria 204580
1133 Ga0495626_0005379 3300048091 Bacteria 7516
1134 Ga0495626_0009200 3300048091 Bacteria 5347
1135 Ga0495626_0016880 3300048091 Bacteria 3698
1136 Ga0495626_0020411 3300048091 Bacteria 3302
1137 Ga0495626_0032667 3300048091 Bacteria 2497
1138 Ga0495626_0037023 3300048091 Bacteria 2321
1139 Ga0495626_0038291 3300048091 Bacteria 2274
1140 Ga0495626_0042808 3300048091 Bacteria 2126
1141 Ga0495626_0045212 3300048091 Bacteria 2056
1142 Ga0495626_0053144 3300048091 Bacteria 1865
1143 Ga0495626_0056957 3300048091 Bacteria 1788
1144 Ga0495626_0072865 3300048091 Bacteria 1539
1145 Ga0495626_0074583 3300048091 Bacteria 1517
1146 Ga0495626_0113461 3300048091 Bacteria 1171
1147 Ga0495626_0115701 3300048091 Bacteria 1157
1148 Ga0495626_0160139 3300048091 Bacteria 944
1149 Ga0495626_0218578 3300048091 Bacteria 775
1150 Ga0496100_0030264 3300048903 Bacteria 3357
1151 Ga0496100_0058178 3300048903 Bacteria 2535
1152 Ga0496100_0150897 3300048903 Bacteria 1657
1153 Ga0496100_0245245 3300048903 Bacteria 1323
1154 Ga0496100_0604127 3300048903 Bacteria 852
1155 Ga0496100_0927713 3300048903 Bacteria 684
1156 Ga0496100_1011616 3300048903 Bacteria 654
1157 Ga0496101_0044130 3300048904 Bacteria 3189
1158 Ga0496101_0114312 3300048904 Bacteria 2035
1159 Ga0496101_0164657 3300048904 Bacteria 1702
1160 Ga0496102_0000166 3300048905 Bacteria 88956
1161 Ga0496102_0000198 3300048905 Bacteria 81732
1162 Ga0496102_0043495 3300048905 Bacteria 4073
1163 Ga0496102_0165660 3300048905 Bacteria 2080
1164 Ga0496102_0213392 3300048905 Bacteria 1819
1165 Ga0496102_0246002 3300048905 Bacteria 1686
1166 Ga0496102_0282195 3300048905 Bacteria 1565
1167 Ga0496102_0463421 3300048905 Bacteria 1188
1168 Ga0496103_0014421 3300048906 Bacteria 4691
1169 Ga0496103_0035137 3300048906 Bacteria 3068
1170 Ga0496103_0210807 3300048906 Bacteria 1249
1171 Ga0496103_0293764 3300048906 Bacteria 1045
1172 Ga0496104_0011806 3300048907 Bacteria 7839
1173 Ga0496104_0348537 3300048907 Bacteria 1393
1174 Ga0496104_0407011 3300048907 Bacteria 1273
1175 Ga0496105_0107014 3300048908 Bacteria 2308
1176 Ga0496105_0137128 3300048908 Bacteria 2015
1177 Ga0496105_0181153 3300048908 Bacteria 1725
1178 Ga0496105_0207257 3300048908 Bacteria 1599
1179 Ga0496106_0037440 3300048909 Bacteria 3629
1180 Ga0496106_0325155 3300048909 Bacteria 1234
1181 Ga0496106_0518710 3300048909 Bacteria 957
1182 Ga0496106_0748867 3300048909 Bacteria 777
1183 Ga0496106_1019680 3300048909 Bacteria 650
1184 Ga0496107_0008333 3300048910 Bacteria 7172
1185 Ga0496107_0057289 3300048910 Bacteria 2817
1186 Ga0496107_0110601 3300048910 Bacteria 2019
1187 Ga0496107_0385055 3300048910 Bacteria 1043
1188 Ga0496108_0049209 3300048911 Bacteria 3525
1189 Ga0496108_0213912 3300048911 Bacteria 1674
1190 Ga0496108_0373266 3300048911 Bacteria 1245
1191 Ga0496108_0620238 3300048911 Bacteria 942
1192 Ga0496108_0665374 3300048911 Bacteria 904
1193 Ga0496109_0005807 3300048912 Bacteria 10336
1194 Ga0496109_0069130 3300048912 Bacteria 3238
1195 Ga0496109_0102125 3300048912 Bacteria 2661
1196 Ga0496109_0108227 3300048912 Bacteria 2583
1197 Ga0496109_0559998 3300048912 Bacteria 1078
1198 Ga0496109_0702029 3300048912 Bacteria 949
1199 Ga0496110_0017718 3300048913 Bacteria 5958
1200 Ga0496110_0060817 3300048913 Bacteria 3332
1201 Ga0496110_1042823 3300048913 Bacteria 725
1202 Ga0496110_1253604 3300048913 Bacteria 650
1203 Ga0496111_0009592 3300048914 Bacteria 6467
1204 Ga0496111_0027877 3300048914 Bacteria 4000
1205 Ga0496111_0055656 3300048914 Bacteria 2861
1206 Ga0496112_0033696 3300048915 Bacteria 4980
1207 Ga0496112_0952363 3300048915 Bacteria 779
1208 Ga0496113_0033447 3300048916 Bacteria 3743
1209 Ga0496113_0091492 3300048916 Bacteria 2345
1210 Ga0496113_0147673 3300048916 Bacteria 1853
1211 Ga0496113_1324230 3300048916 Bacteria 559
1212 Ga0496113_1420521 3300048916 Bacteria 537
1213 Ga0496114_0011526 3300048917 Bacteria 7065
1214 Ga0496114_0041652 3300048917 Bacteria 3806
1215 Ga0496114_0065479 3300048917 Bacteria 3045
1216 Ga0496114_0095236 3300048917 Bacteria 2533
1217 Ga0496114_0212790 3300048917 Bacteria 1696
1218 Ga0496115_0078080 3300048918 Bacteria 2693
1219 Ga0496115_0093660 3300048918 Bacteria 2457
1220 Ga0496115_0098112 3300048918 Bacteria 2399
1221 Ga0496115_0140263 3300048918 Bacteria 1994
1222 Ga0496115_0217993 3300048918 Bacteria 1575
1223 Ga0496115_0267873 3300048918 Bacteria 1404
1224 Ga0496115_0270790 3300048918 Bacteria 1395
1225 Ga0496115_0282430 3300048918 Bacteria 1363
1226 Ga0496115_0454362 3300048918 Bacteria 1034
1227 Ga0496115_0462476 3300048918 Bacteria 1023
1228 Ga0496116_0017608 3300048919 Bacteria 5537
1229 Ga0496116_0044500 3300048919 Bacteria 3014
1230 Ga0496117_0000045 3300048920 Bacteria 301047
1231 Ga0496117_0380648 3300048920 Bacteria 719
1232 Ga0496118_0000041 3300048921 Bacteria 301047
1233 Ga0496118_0059002 3300048921 Bacteria 2862
1234 Ga0496121_0051062 3300048924 Bacteria 3486
1235 Ga0496121_0134001 3300048924 Bacteria 1849
1236 Ga0496121_0193253 3300048924 Bacteria 1457
1237 Ga0496121_0198348 3300048924 Bacteria 1433
1238 Ga0496121_0596685 3300048924 Bacteria 682
1239 Ga0496122_0032256 3300048925 Bacteria 4336
1240 Ga0496122_0036552 3300048925 Bacteria 3968
1241 Ga0496122_0038511 3300048925 Bacteria 3829
1242 Ga0496122_0057424 3300048925 Bacteria 2890
1243 Ga0496122_0414699 3300048925 Bacteria 679
1244 Ga0496123_0018844 3300048926 Bacteria 5467
1245 Ga0496123_0028191 3300048926 Bacteria 4163
1246 Ga0496123_0034600 3300048926 Bacteria 3615
1247 Ga0496123_0047040 3300048926 Bacteria 2919
1248 Ga0496123_0279648 3300048926 Bacteria 807
1249 Ga0496124_0016097 3300048927 Bacteria 7134
1250 Ga0496124_0064567 3300048927 Bacteria 3055
1251 Ga0496124_0206378 3300048927 Bacteria 1490
1252 Ga0496124_0297982 3300048927 Bacteria 1166
1253 Ga0496124_0319355 3300048927 Bacteria 1112
1254 Ga0496125_0040174 3300048928 Bacteria 4015
1255 Ga0496125_0041078 3300048928 Bacteria 3959
1256 Ga0496125_0045082 3300048928 Bacteria 3717
1257 Ga0496125_0218463 3300048928 Bacteria 1230
1258 Ga0496125_0243330 3300048928 Bacteria 1140
1259 Ga0496125_0429383 3300048928 Bacteria 763
1260 Ga0496126_0246866 3300048929 Bacteria 1489
1261 Ga0496126_0518587 3300048929 Bacteria 950
1262 Ga0496126_0567801 3300048929 Bacteria 898
1263 Ga0501308_006152 3300049128 Bacteria 1221
1264 Ga0501310_009961 3300049130 Bacteria 1054
1265 Ga0501304_003915 3300049160 Bacteria 1111
1266 Ga0501305_022539 3300049161 Bacteria 937
1267 Ga0495678_000769 3300049459 Bacteria 28986
1268 Ga0495678_001549 3300049459 Bacteria 17735
1269 Ga0495678_002684 3300049459 Bacteria 11749
1270 Ga0495678_017365 3300049459 Bacteria 3263
1271 Ga0495678_017933 3300049459 Bacteria 3195
1272 Ga0495678_019925 3300049459 Bacteria 2980
1273 Ga0495678_021048 3300049459 Bacteria 2877
1274 Ga0495682_0010066 3300049460 Bacteria 3672
1275 Ga0495682_0010283 3300049460 Bacteria 3628
1276 Ga0495682_0010389 3300049460 Bacteria 3607
1277 Ga0495682_0012989 3300049460 Bacteria 3178
1278 Ga0495682_0036125 3300049460 Bacteria 1819
1279 Ga0495682_0075768 3300049460 Bacteria 1210
1280 Ga0501290_013158 3300049513 Bacteria 1077
1281 Ga0501312_065007 3300049528 Bacteria 638
1282 Ga0501313_042918 3300049529 Bacteria 612
1283 Ga0501316_076069 3300049532 Bacteria 514
1284 Ga0501321_045258 3300049537 Bacteria 630
1285 Ga0501323_013047 3300049539 Bacteria 1023
1286 Ga0501032_0003171 3300049569 Bacteria 12656
1287 Ga0501034_0009859 3300049571 Bacteria 9988
1288 Ga0501034_0114782 3300049571 Bacteria 2682
1289 Ga0501034_0242332 3300049571 Bacteria 1749
1290 Ga0501036_0279472 3300049572 Bacteria 1397
1291 Ga0501038_0007948 3300049574 Bacteria 9773
1292 Ga0501043_0098860 3300049579 Bacteria 2294
1293 Ga0501048_0884975 3300049582 Bacteria 642
1294 Ga0501067_0302894 3300049583 Bacteria 890
1295 Ga0501068_0757150 3300049584 Bacteria 636
1296 Ga0501069_0380873 3300049585 Bacteria 833
1297 Ga0501076_0387328 3300049592 Bacteria 1149
1298 Ga0501222_007677 3300049662 Bacteria 1439
1299 Ga0501238_004953 3300049671 Bacteria 1677
1300 Ga0501240_058404 3300049673 Bacteria 676
1301 Ga0501269_005909 3300049766 Bacteria 1473
1302 Ga0501035_0036589 3300049822 Bacteria 4448
1303 Ga0501035_0073224 3300049822 Bacteria 3031
1304 Ga0501035_0443727 3300049822 Bacteria 1074
1305 Ga0501044_0812920 3300049823 Bacteria 813
1306 nmdc:mga0yw44_30617_c1 3300050492 Bacteria 3121
1307 nmdc:mga0k408_63061_c1 3300050493 Bacteria 2155
1308 nmdc:mga05p37_1065231_c1 3300050507 Bacteria 851
1309 nmdc:mga05p37_243942_c1 3300050507 Bacteria 2158
1310 nmdc:mga09592_65296_c1 3300050508 Bacteria 3083
1311 nmdc:mga08y16_8362_c1 3300050511 Bacteria 10827
1312 nmdc:mga08y16_98284_c1 3300050511 Bacteria 3048
1313 nmdc:mga0n895_1247043_c1 3300050512 Bacteria 716
1314 nmdc:mga0n895_382601_c1 3300050512 Bacteria 1424
1315 nmdc:mga0rr50_128334_c1 3300050513 Bacteria 2027
1316 nmdc:mga0rr50_76770_c1 3300050513 Bacteria 2565
1317 nmdc:mga0rr50_962289_c1 3300050513 Bacteria 728
1318 nmdc:mga08x19_160257_c1 3300050514 Bacteria 1528
1319 nmdc:mga0a205_1306724_c1 3300050515 Bacteria 573
1320 nmdc:mga0a205_194502_c1 3300050515 Bacteria 1919
1321 Ga0495601_0017775 3300053077 Bacteria 4320
1322 Ga0495612_0318104 3300053078 Bacteria 700
1323 Ga0495595_0097296 3300053084 Bacteria 1418
1324 Ga0495595_0168686 3300053084 Bacteria 1083
1325 Ga0495619_0235247 3300053085 Bacteria 1269
1326 Ga0500608_155571 3300053122 Bacteria 997
1327 Ga0500618_006829 3300053125 Bacteria 3311
1328 Ga0500574_012739 3300053141 Bacteria 1935
1329 Ga0500600_0006158 3300053149 Bacteria 7132
1330 Ga0500619_007351 3300053154 Bacteria 2603
1331 Ga0500622_0000002 3300053156 Bacteria 646442
1332 Ga0587070_026373 3300059491 Bacteria 1021
1333 Ga0587082_062226 3300059504 Bacteria 738
1334 Ga0587083_0103339 3300059505 Bacteria 713
1335 Ga0587088_030882 3300059508 Bacteria 957
1336 Ga0587090_004715 3300059510 Bacteria 1671
1337 Ga0587125_023600 3300059607 Bacteria 743
1338 Ga0587062_043488 3300059639 Bacteria 737
1339 Ga0587067_017566 3300059640 Bacteria 1189
1340 Ga0587068_000071 3300059641 Bacteria 6070
1341 Ga0587079_022009 3300059647 Bacteria 1153
1342 Ga0587079_058217 3300059647 Bacteria 830
1343 Ga0587102_027498 3300059649 Bacteria 678
1344 Ga0587107_014070 3300059652 Bacteria 1024
1345 Ga0587071_110099 3300060344 Bacteria 647
1346 Ga0587111_0003898 3300060346 Bacteria 2171

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021361 Ga0213872_10000442 Ga0213872_1000044214 126
2 3300039447 Ga0436361_0061503 Ga0436361_0061503_45162_45695 126
3 3300002737 JGI25162J39368_1000091 JGI25162J39368_100009112 133
4 3300003214 JGI25165J46597_1000172 JGI25165J46597_100017212 133
5 3300003751 Ga0055538_1000063 Ga0055538_100006380 133
6 3300003752 Ga0055539_1000096 Ga0055539_100009680 133
7 3300003756 Ga0055533_1000107 Ga0055533_100010780 133
8 3300003759 Ga0055525_1000140 Ga0055525_100014080 133
9 3300003841 Ga0055541_1000064 Ga0055541_100006480 133
10 3300015262 Ga0182007_10008097 Ga0182007_100080973 133
11 3300015262 Ga0182007_10025147 Ga0182007_100251472 133
12 3300015265 Ga0182005_1008205 Ga0182005_10082052 133
13 3300025207 Ga0209760_104093 Ga0209760_1040931 133
14 3300025224 Ga0209784_100079 Ga0209784_100079132 133
15 3300025225 Ga0209566_100093 Ga0209566_100093132 133
16 3300025226 Ga0209674_100115 Ga0209674_100115132 133
17 3300025230 Ga0209563_100113 Ga0209563_100113132 133
18 3300025231 Ga0207427_100262 Ga0207427_10026226 133
19 3300025233 Ga0209437_100176 Ga0209437_100176132 133
20 3300025253 Ga0209677_100072 Ga0209677_100072132 133
21 3300025261 Ga0209233_1000183 Ga0209233_1000183132 133
22 3300046454 Ga0495592_0047319 Ga0495592_0047319_1219_1695 133
23 3300046462 Ga0495651_0053029 Ga0495651_0053029_2499_2975 133
24 3300046462 Ga0495651_0108525 Ga0495651_0108525_352_828 133
25 3300046463 Ga0495653_0014598 Ga0495653_0014598_4392_4868 133
26 3300046511 Ga0495608_0303761 Ga0495608_0303761_157_633 133
27 3300046516 Ga0495628_0004010 Ga0495628_0004010_10018_10494 133
28 3300046516 Ga0495628_0025764 Ga0495628_0025764_1679_2155 133
29 3300046516 Ga0495628_0229240 Ga0495628_0229240_835_1311 133
30 3300046529 Ga0495652_0073263 Ga0495652_0073263_800_1276 133
31 3300046529 Ga0495652_0114911 Ga0495652_0114911_1216_1692 133
32 3300046529 Ga0495652_0326069 Ga0495652_0326069_56_532 133
33 3300046543 Ga0495645_0074182 Ga0495645_0074182_851_1327 133
34 3300046557 Ga0495622_0264232 Ga0495622_0264232_124_600 133
35 3300046678 Ga0495599_0014744 Ga0495599_0014744_2613_3089 133
36 3300046679 Ga0495623_0204858 Ga0495623_0204858_92_568 133
37 3300046680 Ga0495646_0011747 Ga0495646_0011747_2711_3187 133
38 3300046680 Ga0495646_0072612 Ga0495646_0072612_395_871 133
39 3300046690 Ga0495624_0021494 Ga0495624_0021494_1148_1624 133
40 3300046690 Ga0495624_0817440 Ga0495624_0817440_44_520 133
41 3300046809 Ga0495600_0064915 Ga0495600_0064915_514_990 133
42 3300047317 Ga0495604_0029049 Ga0495604_0029049_2500_2976 133
43 3300048088 Ga0495602_0211613 Ga0495602_0211613_115_591 133
44 3300053077 Ga0495601_0017775 Ga0495601_0017775_2321_2797 133
45 3300053122 Ga0500608_155571 Ga0500608_155571_29_505 133
46 3300053141 Ga0500574_012739 Ga0500574_012739_1404_1880 133
47 3300053154 Ga0500619_007351 Ga0500619_007351_672_1148 133
48 3300025916 Ga0207663_10174927 Ga0207663_101749272 135
49 3300050492 nmdc:mga0yw44_30617_c1 nmdc:mga0yw44_30617_c1_899_1360 137
50 iso_pu_bacteria 2857558681 2857563320 140
51 3300046507 Ga0495606_0012314 Ga0495606_0012314_2659_3186 142
52 3300048907 Ga0496104_0407011 Ga0496104_0407011_283_717 142
53 3300044684 Ga0466966_0019370 Ga0466966_0019370_713_1189 144
54 3300044719 Ga0466971_0137791 Ga0466971_0137791_113_589 144
55 3300005337 Ga0070682_100036629 Ga0070682_1000366294 145
56 3300031548 Ga0307408_100070573 Ga0307408_1000705733 145
57 3300037312 Ga0395899_0019639 Ga0395899_0019639_1511_1987 146
58 3300037418 Ga0395900_0039845 Ga0395900_0039845_517_993 146
59 3300037466 Ga0395898_0026637 Ga0395898_0026637_4775_5251 146
60 3300038443 Ga0395901_0314025 Ga0395901_0314025_258_734 146
61 3300049579 Ga0501043_0098860 Ga0501043_0098860_1829_2284 150
62 3300031251 Ga0265327_10028337 Ga0265327_100283373 151
63 3300005444 Ga0070694_100599341 Ga0070694_1005993412 152
64 3300005445 Ga0070708_100311262 Ga0070708_1003112622 152
65 3300005467 Ga0070706_100196877 Ga0070706_1001968772 152
66 3300005468 Ga0070707_100026857 Ga0070707_1000268577 152
67 3300005471 Ga0070698_100107855 Ga0070698_1001078552 152
68 3300005518 Ga0070699_100013389 Ga0070699_1000133891 152
69 3300005530 Ga0070679_101153528 Ga0070679_1011535281 152
70 3300005536 Ga0070697_100083105 Ga0070697_1000831052 152
71 3300005545 Ga0070695_100399192 Ga0070695_1003991922 152
72 3300005546 Ga0070696_100664883 Ga0070696_1006648831 152
73 3300006871 Ga0075434_100053373 Ga0075434_1000533732 152
74 3300006914 Ga0075436_100046190 Ga0075436_1000461902 152
75 3300007076 Ga0075435_100946792 Ga0075435_1009467921 152
76 3300013105 Ga0157369_10145101 Ga0157369_101451012 152
77 3300025910 Ga0207684_10097803 Ga0207684_100978032 152
78 3300025910 Ga0207684_10213069 Ga0207684_102130692 152
79 3300025922 Ga0207646_10005342 Ga0207646_100053428 152
80 3300025922 Ga0207646_10100336 Ga0207646_101003362 152
81 3300031548 Ga0307408_100189269 Ga0307408_1001892692 152
82 3300031824 Ga0307413_10152110 Ga0307413_101521103 152
83 3300031824 Ga0307413_10352374 Ga0307413_103523741 152
84 3300031824 Ga0307413_10592313 Ga0307413_105923131 152
85 3300031852 Ga0307410_10091192 Ga0307410_100911922 152
86 3300031852 Ga0307410_10168964 Ga0307410_101689643 152
87 3300031911 Ga0307412_10026102 Ga0307412_100261021 152
88 3300031995 Ga0307409_100013944 Ga0307409_1000139442 152
89 3300032002 Ga0307416_100012770 Ga0307416_1000127702 152
90 3300032004 Ga0307414_10240273 Ga0307414_102402732 152
91 3300032005 Ga0307411_10116293 Ga0307411_101162931 152
92 3300032005 Ga0307411_10276268 Ga0307411_102762682 152
93 3300035083 Ga0373926_0104149 Ga0373926_0104149_65_526 152
94 3300035695 Ga0373927_0012113 Ga0373927_0012113_4296_4757 152
95 3300035725 Ga0373947_0082116 Ga0373947_0082116_1263_1724 152
96 3300044656 Ga0466969_0439929 Ga0466969_0439929_12_473 152
97 3300046472 Ga0495580_0034101 Ga0495580_0034101_1828_2289 152
98 3300046530 Ga0495654_0032996 Ga0495654_0032996_1444_1905 152
99 3300046615 Ga0495656_0119286 Ga0495656_0119286_128_589 152
100 3300048913 Ga0496110_1042823 Ga0496110_1042823_10_471 152
101 3300048928 Ga0496125_0218463 Ga0496125_0218463_300_761 152
102 3300049532 Ga0501316_076069 Ga0501316_076069_42_503 152
103 3300049584 Ga0501068_0757150 Ga0501068_0757150_113_574 152
104 3300049585 Ga0501069_0380873 Ga0501069_0380873_86_547 152
105 3300050493 nmdc:mga0k408_63061_c1 nmdc:mga0k408_63061_c1_1184_1645 152
106 3300050507 nmdc:mga05p37_1065231_c1 nmdc:mga05p37_1065231_c1_48_509 152
107 3300050507 nmdc:mga05p37_243942_c1 nmdc:mga05p37_243942_c1_687_1148 152
108 3300050508 nmdc:mga09592_65296_c1 nmdc:mga09592_65296_c1_840_1301 152
109 3300050511 nmdc:mga08y16_8362_c1 nmdc:mga08y16_8362_c1_1965_2426 152
110 3300050512 nmdc:mga0n895_1247043_c1 nmdc:mga0n895_1247043_c1_119_580 152
111 3300050513 nmdc:mga0rr50_962289_c1 nmdc:mga0rr50_962289_c1_188_649 152
112 3300050514 nmdc:mga08x19_160257_c1 nmdc:mga08x19_160257_c1_1025_1486 152
113 3300050515 nmdc:mga0a205_1306724_c1 nmdc:mga0a205_1306724_c1_11_472 152
114 iso_pu_bacteria 2643221556 2643802798 152
115 iso_pu_bacteria 2643221684 2644472303 152
116 iso_pu_bacteria 2808606418 2809142734 152
117 iso_pu_bacteria 8047673197 8047678602 152
118 iso_pu_bacteria 2511231003 2511249997 153
119 iso_pu_bacteria 2511231026 2511387750 153
120 iso_pu_bacteria 2521172590 2521557298 153
121 iso_pu_bacteria 2548876994 2550695279 153
122 iso_pu_bacteria 2551306416 2553005350 153
123 iso_pu_bacteria 2600255292 2601669878 153
124 iso_pu_bacteria 2643221554 2643790989 153
125 iso_pu_bacteria 2643221603 2644027801 153
126 iso_pu_bacteria 2643221638 2644211841 153
127 iso_pu_bacteria 2643221645 2644251911 153
128 iso_pu_bacteria 2643221664 2644360561 153
129 iso_pu_bacteria 2734482258 2735817934 153
130 iso_pu_bacteria 2738541280 2738740384 153
131 iso_pu_bacteria 2738541297 2738828846 153
132 iso_pu_bacteria 2738541300 2738843365 153
133 iso_pu_bacteria 2738541357 2739152642 153
134 iso_pu_bacteria 2738543003 2739194562 153
135 iso_pu_bacteria 2738543018 2739275562 153
136 iso_pu_bacteria 2738543026 2739321038 153
137 iso_pu_bacteria 2738543029 2739339279 153
138 iso_pu_bacteria 2738543030 2739344606 153
139 iso_pu_bacteria 2739367655 2739610758 153
140 iso_pu_bacteria 2765235838 2765568426 153
141 iso_pu_bacteria 2808606386 2808981181 153
142 iso_pu_bacteria 2808606415 2809131766 153
143 iso_pu_bacteria 2808606419 2809151422 153
144 iso_pu_bacteria 2818991436 2819541233 153
145 iso_pu_bacteria 2818991445 2819591981 153
146 iso_pu_bacteria 2818991449 2819617706 153
147 iso_pu_bacteria 2821131069 2821133080 153
148 iso_pu_bacteria 2852618963 2852620903 153
149 iso_pu_bacteria 2857542790 2857544826 153
150 iso_pu_bacteria 2857547612 2857551055 153
151 iso_pu_bacteria 2857553236 2857558350 153
152 iso_pu_bacteria 2857564685 2857567277 153
153 iso_pu_bacteria 2857576091 2857578454 153
154 iso_pu_bacteria 2884811622 2884814183 153
155 iso_pu_bacteria 2884836552 2884840606 153
156 iso_pu_bacteria 2884852848 2884855863 153
157 iso_pu_bacteria 2885080285 2885085803 153
158 iso_pu_bacteria 2887375801 2887379900 153
159 iso_pu_bacteria 2896154374 2896157212 153
160 iso_pu_bacteria 2904424332 2904427282 153
161 iso_pu_bacteria 2904589729 2904592699 153
162 iso_pu_bacteria 2919476304 2919479852 153
163 iso_pu_bacteria 2932410948 2932413367 153
164 iso_pu_bacteria 2932416698 2932417427 153
165 iso_pu_bacteria 2939631187 2939634758 153
166 3300046810 Ga0495660_0297654 Ga0495660_0297654_54_524 155
167 3300003163 Ga0006759J45824_1054708 Ga0006759J45824_10547081 156
168 3300003574 Ga0007410J51695_1053832 Ga0007410J51695_10538321 156
169 3300003575 Ga0007409J51694_1018198 Ga0007409J51694_10181982 156
170 3300003693 Ga0032354_1019193 Ga0032354_10191933 156
171 3300003759 Ga0055525_1000047 Ga0055525_100004712 156
172 3300005262 Ga0065165_1004294 Ga0065165_10042946 156
173 3300005288 Ga0065714_10011408 Ga0065714_100114082 156
174 3300005289 Ga0065704_10411895 Ga0065704_104118951 156
175 3300005327 Ga0070658_10125326 Ga0070658_101253264 156
176 3300005329 Ga0070683_100196994 Ga0070683_1001969943 156
177 3300005334 Ga0068869_100240972 Ga0068869_1002409721 156
178 3300005336 Ga0070680_100373284 Ga0070680_1003732842 156
179 3300005339 Ga0070660_100648097 Ga0070660_1006480972 156
180 3300005347 Ga0070668_101048454 Ga0070668_1010484541 156
181 3300005366 Ga0070659_100710655 Ga0070659_1007106552 156
182 3300005455 Ga0070663_100161556 Ga0070663_1001615562 156
183 3300005457 Ga0070662_100306045 Ga0070662_1003060452 156
184 3300005457 Ga0070662_100624662 Ga0070662_1006246622 156
185 3300005563 Ga0068855_100020817 Ga0068855_1000208178 156
186 3300005564 Ga0070664_101144409 Ga0070664_1011444092 156
187 3300005577 Ga0068857_100387580 Ga0068857_1003875802 156
188 3300005578 Ga0068854_100465311 Ga0068854_1004653112 156
189 3300006028 Ga0070717_10225840 Ga0070717_102258402 156
190 3300009036 Ga0105244_10031110 Ga0105244_100311103 156
191 3300009093 Ga0105240_10450415 Ga0105240_104504152 156
192 3300009098 Ga0105245_10319855 Ga0105245_103198552 156
193 3300009148 Ga0105243_10461943 Ga0105243_104619432 156
194 3300009174 Ga0105241_10575566 Ga0105241_105755662 156
195 3300009176 Ga0105242_10049831 Ga0105242_100498312 156
196 3300009545 Ga0105237_10314393 Ga0105237_103143931 156
197 3300009551 Ga0105238_10455261 Ga0105238_104552612 156
198 3300011119 Ga0105246_10223182 Ga0105246_102231822 156
199 3300013100 Ga0157373_10186762 Ga0157373_101867622 156
200 3300013102 Ga0157371_10000013 Ga0157371_1000001332 156
201 3300013104 Ga0157370_10876603 Ga0157370_108766032 156
202 3300013296 Ga0157374_11424835 Ga0157374_114248351 156
203 3300013297 Ga0157378_10050117 Ga0157378_100501175 156
204 3300013307 Ga0157372_11786584 Ga0157372_117865842 156
205 3300014497 Ga0182008_10016736 Ga0182008_100167362 156
206 3300014497 Ga0182008_10019024 Ga0182008_100190242 156
207 3300015261 Ga0182006_1000035 Ga0182006_1000035150 156
208 3300015261 Ga0182006_1123458 Ga0182006_11234581 156
209 3300015261 Ga0182006_1127791 Ga0182006_11277911 156
210 3300015262 Ga0182007_10000040 Ga0182007_1000004050 156
211 3300015262 Ga0182007_10025272 Ga0182007_100252722 156
212 3300015265 Ga0182005_1000025 Ga0182005_1000025150 156
213 3300017792 Ga0163161_10125767 Ga0163161_101257674 156
214 3300017792 Ga0163161_10439697 Ga0163161_104396972 156
215 3300020081 Ga0206354_11479432 Ga0206354_114794321 156
216 3300025230 Ga0209563_100003 Ga0209563_100003542 156
217 3300025253 Ga0209677_104819 Ga0209677_1048195 156
218 3300025254 Ga0209148_1001634 Ga0209148_10016342 156
219 3300025909 Ga0207705_10014245 Ga0207705_100142455 156
220 3300025911 Ga0207654_10186779 Ga0207654_101867792 156
221 3300025912 Ga0207707_10529626 Ga0207707_105296262 156
222 3300025913 Ga0207695_10176575 Ga0207695_101765752 156
223 3300025914 Ga0207671_11230951 Ga0207671_112309511 156
224 3300025917 Ga0207660_10229022 Ga0207660_102290222 156
225 3300025921 Ga0207652_10362395 Ga0207652_103623952 156
226 3300025924 Ga0207694_10602158 Ga0207694_106021582 156
227 3300025926 Ga0207659_10534543 Ga0207659_105345432 156
228 3300025927 Ga0207687_10341379 Ga0207687_103413792 156
229 3300025932 Ga0207690_10039891 Ga0207690_100398912 156
230 3300025933 Ga0207706_10323662 Ga0207706_103236622 156
231 3300025933 Ga0207706_10630706 Ga0207706_106307061 156
232 3300025934 Ga0207686_10035088 Ga0207686_100350882 156
233 3300025935 Ga0207709_10587787 Ga0207709_105877872 156
234 3300025938 Ga0207704_10042123 Ga0207704_100421232 156
235 3300025949 Ga0207667_10066275 Ga0207667_100662753 156
236 3300025981 Ga0207640_11073868 Ga0207640_110738681 156
237 3300026041 Ga0207639_10149553 Ga0207639_101495534 156
238 3300026067 Ga0207678_10117634 Ga0207678_101176342 156
239 3300026078 Ga0207702_10163950 Ga0207702_101639502 156
240 3300026116 Ga0207674_10281410 Ga0207674_102814102 156
241 3300032004 Ga0307414_10271035 Ga0307414_102710352 156
242 3300032004 Ga0307414_11195266 Ga0307414_111952662 156
243 3300037312 Ga0395899_0000183 Ga0395899_0000183_83528_84001 156
244 3300037312 Ga0395899_0047299 Ga0395899_0047299_1990_2463 156
245 3300037312 Ga0395899_0049915 Ga0395899_0049915_1136_1609 156
246 3300037312 Ga0395899_0219765 Ga0395899_0219765_57_530 156
247 3300037418 Ga0395900_0000331 Ga0395900_0000331_91_564 156
248 3300037418 Ga0395900_0005509 Ga0395900_0005509_12456_12929 156
249 3300037418 Ga0395900_0116900 Ga0395900_0116900_425_898 156
250 3300037418 Ga0395900_0328331 Ga0395900_0328331_485_958 156
251 3300037466 Ga0395898_0118397 Ga0395898_0118397_1061_1534 156
252 3300037466 Ga0395898_0187514 Ga0395898_0187514_1152_1625 156
253 3300037471 Ga0395905_0237236 Ga0395905_0237236_281_760 156
254 3300037471 Ga0395905_0245926 Ga0395905_0245926_106_579 156
255 3300037471 Ga0395905_0778575 Ga0395905_0778575_146_619 156
256 3300038443 Ga0395901_0000097 Ga0395901_0000097_33719_34192 156
257 3300038443 Ga0395901_0030543 Ga0395901_0030543_1685_2158 156
258 3300038443 Ga0395901_0236417 Ga0395901_0236417_1256_1729 156
259 3300038443 Ga0395901_0553519 Ga0395901_0553519_301_774 156
260 3300038443 Ga0395901_1443153 Ga0395901_1443153_132_605 156
261 3300042005 Ga0439448_0037833 Ga0439448_0037833_240_713 156
262 3300042007 Ga0439449_0014317 Ga0439449_0014317_445_918 156
263 3300042011 Ga0439454_025630 Ga0439454_025630_381_854 156
264 3300042012 Ga0439455_0040097 Ga0439455_0040097_546_1019 156
265 3300042157 Ga0439458_0004250 Ga0439458_0004250_2379_2852 156
266 3300044658 Ga0466972_0022289 Ga0466972_0022289_623_1096 156
267 3300044683 Ga0466965_0034658 Ga0466965_0034658_1018_1491 156
268 3300044683 Ga0466965_0052576 Ga0466965_0052576_562_1035 156
269 3300044683 Ga0466965_0115875 Ga0466965_0115875_220_693 156
270 3300044684 Ga0466966_0106606 Ga0466966_0106606_724_1197 156
271 3300044684 Ga0466966_0108832 Ga0466966_0108832_891_1364 156
272 3300044684 Ga0466966_0184175 Ga0466966_0184175_573_1046 156
273 3300044693 Ga0466961_0164364 Ga0466961_0164364_862_1335 156
274 3300044706 Ga0466964_0005584 Ga0466964_0005584_2565_3038 156
275 3300044706 Ga0466964_0028701 Ga0466964_0028701_737_1210 156
276 3300044719 Ga0466971_0022364 Ga0466971_0022364_1951_2424 156
277 3300044719 Ga0466971_0680257 Ga0466971_0680257_29_502 156
278 3300044735 Ga0466968_0005700 Ga0466968_0005700_504_977 156
279 3300044842 Ga0466957_0038618 Ga0466957_0038618_1558_2031 156
280 3300045049 Ga0466959_0157211 Ga0466959_0157211_75_548 156
281 3300045049 Ga0466959_0242477 Ga0466959_0242477_475_948 156
282 3300045049 Ga0466959_0297089 Ga0466959_0297089_91_564 156
283 3300045049 Ga0466959_0995015 Ga0466959_0995015_75_548 156
284 3300045836 Ga0466958_0337462 Ga0466958_0337462_443_916 156
285 3300045836 Ga0466958_0950990 Ga0466958_0950990_54_527 156
286 3300045976 Ga0466967_0078869 Ga0466967_0078869_2174_2647 156
287 3300045976 Ga0466967_0336607 Ga0466967_0336607_551_1024 156
288 3300046452 Ga0495617_000009 Ga0495617_000009_149566_150039 156
289 3300046452 Ga0495617_026010 Ga0495617_026010_427_900 156
290 3300046453 Ga0495627_006670 Ga0495627_006670_1316_1789 156
291 3300046453 Ga0495627_058943 Ga0495627_058943_634_1107 156
292 3300046455 Ga0495603_0037909 Ga0495603_0037909_726_1199 156
293 3300046457 Ga0495590_0000054 Ga0495590_0000054_85294_85767 156
294 3300046457 Ga0495590_0043066 Ga0495590_0043066_1084_1557 156
295 3300046457 Ga0495590_0050954 Ga0495590_0050954_624_1097 156
296 3300046457 Ga0495590_0402027 Ga0495590_0402027_35_508 156
297 3300046458 Ga0495591_023034 Ga0495591_023034_92_565 156
298 3300046458 Ga0495591_026013 Ga0495591_026013_740_1213 156
299 3300046459 Ga0495629_0291919 Ga0495629_0291919_376_849 156
300 3300046460 Ga0495638_0022607 Ga0495638_0022607_2720_3193 156
301 3300046460 Ga0495638_0057841 Ga0495638_0057841_266_739 156
302 3300046463 Ga0495653_0033179 Ga0495653_0033179_77_550 156
303 3300046463 Ga0495653_0043178 Ga0495653_0043178_2102_2575 156
304 3300046471 Ga0495650_0000593 Ga0495650_0000593_933_1406 156
305 3300046471 Ga0495650_0028439 Ga0495650_0028439_42_515 156
306 3300046472 Ga0495580_0114350 Ga0495580_0114350_332_805 156
307 3300046473 Ga0495582_0018828 Ga0495582_0018828_2560_3033 156
308 3300046474 Ga0495605_0000024 Ga0495605_0000024_72416_72889 156
309 3300046474 Ga0495605_0000150 Ga0495605_0000150_86752_87225 156
310 3300046474 Ga0495605_0015140 Ga0495605_0015140_2414_2887 156
311 3300046474 Ga0495605_0017715 Ga0495605_0017715_319_792 156
312 3300046474 Ga0495605_0020086 Ga0495605_0020086_718_1191 156
313 3300046474 Ga0495605_0036410 Ga0495605_0036410_627_1100 156
314 3300046474 Ga0495605_0096022 Ga0495605_0096022_726_1199 156
315 3300046474 Ga0495605_0109442 Ga0495605_0109442_535_1008 156
316 3300046474 Ga0495605_0263300 Ga0495605_0263300_236_709 156
317 3300046477 Ga0495664_0291919 Ga0495664_0291919_337_810 156
318 3300046491 Ga0495584_0004700 Ga0495584_0004700_2379_2852 156
319 3300046491 Ga0495584_0010175 Ga0495584_0010175_2036_2509 156
320 3300046491 Ga0495584_0018909 Ga0495584_0018909_2456_2929 156
321 3300046491 Ga0495584_0026934 Ga0495584_0026934_2338_2811 156
322 3300046491 Ga0495584_0113124 Ga0495584_0113124_131_604 156
323 3300046491 Ga0495584_0527994 Ga0495584_0527994_30_503 156
324 3300046492 Ga0495585_0000130 Ga0495585_0000130_1197_1670 156
325 3300046492 Ga0495585_0017853 Ga0495585_0017853_827_1300 156
326 3300046492 Ga0495585_0017899 Ga0495585_0017899_2376_2849 156
327 3300046492 Ga0495585_0021109 Ga0495585_0021109_673_1146 156
328 3300046492 Ga0495585_0023091 Ga0495585_0023091_2325_2798 156
329 3300046492 Ga0495585_0031069 Ga0495585_0031069_120_593 156
330 3300046492 Ga0495585_0032805 Ga0495585_0032805_61_534 156
331 3300046492 Ga0495585_0036668 Ga0495585_0036668_1983_2456 156
332 3300046492 Ga0495585_0081286 Ga0495585_0081286_616_1089 156
333 3300046492 Ga0495585_0099296 Ga0495585_0099296_1039_1512 156
334 3300046492 Ga0495585_0111604 Ga0495585_0111604_242_715 156
335 3300046492 Ga0495585_0124731 Ga0495585_0124731_564_1037 156
336 3300046492 Ga0495585_0223744 Ga0495585_0223744_12_485 156
337 3300046492 Ga0495585_0302855 Ga0495585_0302855_122_595 156
338 3300046499 Ga0495594_0011814 Ga0495594_0011814_3693_4166 156
339 3300046499 Ga0495594_0042316 Ga0495594_0042316_1245_1718 156
340 3300046499 Ga0495594_0104279 Ga0495594_0104279_967_1440 156
341 3300046499 Ga0495594_0130258 Ga0495594_0130258_376_849 156
342 3300046499 Ga0495594_0148063 Ga0495594_0148063_382_855 156
343 3300046500 Ga0495596_0008779 Ga0495596_0008779_576_1049 156
344 3300046500 Ga0495596_0011263 Ga0495596_0011263_2674_3147 156
345 3300046500 Ga0495596_0011276 Ga0495596_0011276_2849_3322 156
346 3300046500 Ga0495596_0036439 Ga0495596_0036439_190_663 156
347 3300046500 Ga0495596_0038300 Ga0495596_0038300_859_1332 156
348 3300046500 Ga0495596_0056912 Ga0495596_0056912_733_1206 156
349 3300046500 Ga0495596_0094647 Ga0495596_0094647_307_780 156
350 3300046501 Ga0495607_0006535 Ga0495607_0006535_5412_5885 156
351 3300046501 Ga0495607_0011899 Ga0495607_0011899_891_1364 156
352 3300046501 Ga0495607_0022423 Ga0495607_0022423_3057_3530 156
353 3300046501 Ga0495607_0027341 Ga0495607_0027341_1565_2038 156
354 3300046501 Ga0495607_0036400 Ga0495607_0036400_1887_2360 156
355 3300046501 Ga0495607_0036883 Ga0495607_0036883_1423_1896 156
356 3300046501 Ga0495607_0099529 Ga0495607_0099529_408_881 156
357 3300046501 Ga0495607_0129827 Ga0495607_0129827_111_584 156
358 3300046501 Ga0495607_0167811 Ga0495607_0167811_192_665 156
359 3300046506 Ga0495583_0003595 Ga0495583_0003595_2374_2847 156
360 3300046506 Ga0495583_0016161 Ga0495583_0016161_2763_3236 156
361 3300046506 Ga0495583_0019334 Ga0495583_0019334_2433_2906 156
362 3300046506 Ga0495583_0021560 Ga0495583_0021560_802_1275 156
363 3300046506 Ga0495583_0024000 Ga0495583_0024000_2412_2885 156
364 3300046506 Ga0495583_0127006 Ga0495583_0127006_150_623 156
365 3300046506 Ga0495583_0236223 Ga0495583_0236223_236_709 156
366 3300046507 Ga0495606_0000111 Ga0495606_0000111_105006_105482 156
367 3300046507 Ga0495606_0031807 Ga0495606_0031807_2367_2840 156
368 3300046507 Ga0495606_0043133 Ga0495606_0043133_1766_2239 156
369 3300046507 Ga0495606_0088578 Ga0495606_0088578_1142_1615 156
370 3300046507 Ga0495606_0098299 Ga0495606_0098299_803_1276 156
371 3300046507 Ga0495606_0145603 Ga0495606_0145603_817_1290 156
372 3300046507 Ga0495606_0161695 Ga0495606_0161695_202_675 156
373 3300046507 Ga0495606_0296781 Ga0495606_0296781_58_531 156
374 3300046512 Ga0495610_0001639 Ga0495610_0001639_12373_12846 156
375 3300046513 Ga0495616_0005459 Ga0495616_0005459_4298_4771 156
376 3300046513 Ga0495616_0016582 Ga0495616_0016582_2621_3094 156
377 3300046513 Ga0495616_0019296 Ga0495616_0019296_650_1123 156
378 3300046513 Ga0495616_0021514 Ga0495616_0021514_1256_1729 156
379 3300046513 Ga0495616_0027344 Ga0495616_0027344_641_1114 156
380 3300046513 Ga0495616_0030519 Ga0495616_0030519_1672_2145 156
381 3300046513 Ga0495616_0063878 Ga0495616_0063878_1134_1607 156
382 3300046513 Ga0495616_0123861 Ga0495616_0123861_256_729 156
383 3300046513 Ga0495616_0154812 Ga0495616_0154812_546_1019 156
384 3300046515 Ga0495620_0033837 Ga0495620_0033837_601_1074 156
385 3300046517 Ga0495630_0033105 Ga0495630_0033105_2599_3072 156
386 3300046518 Ga0495631_0006593 Ga0495631_0006593_2700_3173 156
387 3300046518 Ga0495631_0014519 Ga0495631_0014519_2451_2924 156
388 3300046518 Ga0495631_0017281 Ga0495631_0017281_679_1152 156
389 3300046518 Ga0495631_0039169 Ga0495631_0039169_789_1262 156
390 3300046518 Ga0495631_0060501 Ga0495631_0060501_423_896 156
391 3300046518 Ga0495631_0150013 Ga0495631_0150013_436_909 156
392 3300046518 Ga0495631_0167828 Ga0495631_0167828_288_761 156
393 3300046519 Ga0495632_0005838 Ga0495632_0005838_5130_5603 156
394 3300046519 Ga0495632_0015712 Ga0495632_0015712_1684_2157 156
395 3300046519 Ga0495632_0017969 Ga0495632_0017969_876_1349 156
396 3300046519 Ga0495632_0018711 Ga0495632_0018711_882_1355 156
397 3300046519 Ga0495632_0022036 Ga0495632_0022036_1044_1517 156
398 3300046519 Ga0495632_0024467 Ga0495632_0024467_730_1203 156
399 3300046519 Ga0495632_0033167 Ga0495632_0033167_2131_2604 156
400 3300046519 Ga0495632_0293983 Ga0495632_0293983_129_602 156
401 3300046520 Ga0495637_0000317 Ga0495637_0000317_3733_4206 156
402 3300046520 Ga0495637_0067719 Ga0495637_0067719_618_1091 156
403 3300046520 Ga0495637_0076779 Ga0495637_0076779_246_719 156
404 3300046522 Ga0495643_0012630 Ga0495643_0012630_2614_3087 156
405 3300046522 Ga0495643_0030060 Ga0495643_0030060_52_525 156
406 3300046522 Ga0495643_0043149 Ga0495643_0043149_316_789 156
407 3300046522 Ga0495643_0052223 Ga0495643_0052223_703_1176 156
408 3300046522 Ga0495643_0072390 Ga0495643_0072390_523_996 156
409 3300046522 Ga0495643_0097693 Ga0495643_0097693_954_1427 156
410 3300046523 Ga0495644_0005136 Ga0495644_0005136_2263_2736 156
411 3300046523 Ga0495644_0009052 Ga0495644_0009052_585_1058 156
412 3300046523 Ga0495644_0015329 Ga0495644_0015329_1214_1687 156
413 3300046523 Ga0495644_0084782 Ga0495644_0084782_41_514 156
414 3300046523 Ga0495644_0280832 Ga0495644_0280832_80_553 156
415 3300046524 Ga0495648_0013732 Ga0495648_0013732_2688_3161 156
416 3300046524 Ga0495648_0022393 Ga0495648_0022393_2941_3414 156
417 3300046524 Ga0495648_0030178 Ga0495648_0030178_1680_2153 156
418 3300046524 Ga0495648_0031398 Ga0495648_0031398_444_917 156
419 3300046524 Ga0495648_0060544 Ga0495648_0060544_76_549 156
420 3300046524 Ga0495648_0257725 Ga0495648_0257725_156_629 156
421 3300046525 Ga0495663_0017407 Ga0495663_0017407_129_602 156
422 3300046526 Ga0495666_0004837 Ga0495666_0004837_5463_5936 156
423 3300046526 Ga0495666_0019043 Ga0495666_0019043_2336_2809 156
424 3300046528 Ga0495642_0003195 Ga0495642_0003195_5401_5874 156
425 3300046528 Ga0495642_0009672 Ga0495642_0009672_2248_2721 156
426 3300046528 Ga0495642_0011766 Ga0495642_0011766_2180_2653 156
427 3300046528 Ga0495642_0013208 Ga0495642_0013208_2617_3090 156
428 3300046528 Ga0495642_0015642 Ga0495642_0015642_1818_2291 156
429 3300046528 Ga0495642_0016149 Ga0495642_0016149_1534_2007 156
430 3300046528 Ga0495642_0018647 Ga0495642_0018647_944_1417 156
431 3300046528 Ga0495642_0038628 Ga0495642_0038628_280_753 156
432 3300046528 Ga0495642_0054932 Ga0495642_0054932_500_973 156
433 3300046528 Ga0495642_0551544 Ga0495642_0551544_11_484 156
434 3300046529 Ga0495652_0049885 Ga0495652_0049885_3076_3549 156
435 3300046530 Ga0495654_0034077 Ga0495654_0034077_1136_1609 156
436 3300046530 Ga0495654_0074326 Ga0495654_0074326_318_791 156
437 3300046530 Ga0495654_0236393 Ga0495654_0236393_261_734 156
438 3300046531 Ga0495665_0071333 Ga0495665_0071333_767_1240 156
439 3300046531 Ga0495665_0160698 Ga0495665_0160698_166_639 156
440 3300046531 Ga0495665_0200130 Ga0495665_0200130_436_909 156
441 3300046533 Ga0495640_0194312 Ga0495640_0194312_433_906 156
442 3300046535 Ga0495586_0028869 Ga0495586_0028869_648_1121 156
443 3300046535 Ga0495586_0061876 Ga0495586_0061876_188_661 156
444 3300046536 Ga0495587_0021577 Ga0495587_0021577_963_1436 156
445 3300046536 Ga0495587_0035530 Ga0495587_0035530_858_1331 156
446 3300046538 Ga0495609_0000030 Ga0495609_0000030_87719_88192 156
447 3300046538 Ga0495609_0010610 Ga0495609_0010610_3001_3474 156
448 3300046538 Ga0495609_0018320 Ga0495609_0018320_211_684 156
449 3300046538 Ga0495609_0035248 Ga0495609_0035248_376_849 156
450 3300046538 Ga0495609_0040781 Ga0495609_0040781_970_1443 156
451 3300046538 Ga0495609_0046675 Ga0495609_0046675_1098_1571 156
452 3300046538 Ga0495609_0054568 Ga0495609_0054568_953_1426 156
453 3300046538 Ga0495609_0065072 Ga0495609_0065072_321_794 156
454 3300046538 Ga0495609_0072288 Ga0495609_0072288_518_991 156
455 3300046538 Ga0495609_0117049 Ga0495609_0117049_379_852 156
456 3300046538 Ga0495609_0282615 Ga0495609_0282615_26_499 156
457 3300046542 Ga0495597_0013175 Ga0495597_0013175_2406_2879 156
458 3300046542 Ga0495597_0014538 Ga0495597_0014538_1294_1767 156
459 3300046542 Ga0495597_0021593 Ga0495597_0021593_1579_2052 156
460 3300046542 Ga0495597_0026824 Ga0495597_0026824_455_928 156
461 3300046542 Ga0495597_0056360 Ga0495597_0056360_784_1257 156
462 3300046542 Ga0495597_0058946 Ga0495597_0058946_48_521 156
463 3300046543 Ga0495645_0128066 Ga0495645_0128066_797_1270 156
464 3300046543 Ga0495645_0250011 Ga0495645_0250011_17_490 156
465 3300046557 Ga0495622_0050467 Ga0495622_0050467_1082_1555 156
466 3300046557 Ga0495622_0132103 Ga0495622_0132103_11_484 156
467 3300046557 Ga0495622_0138112 Ga0495622_0138112_31_504 156
468 3300046558 Ga0495633_0000271 Ga0495633_0000271_854_1330 156
469 3300046558 Ga0495633_0018039 Ga0495633_0018039_690_1163 156
470 3300046558 Ga0495633_0019858 Ga0495633_0019858_2040_2513 156
471 3300046558 Ga0495633_0033219 Ga0495633_0033219_16_489 156
472 3300046558 Ga0495633_0061485 Ga0495633_0061485_512_985 156
473 3300046558 Ga0495633_0087407 Ga0495633_0087407_394_867 156
474 3300046558 Ga0495633_0383003 Ga0495633_0383003_92_565 156
475 3300046558 Ga0495633_0434349 Ga0495633_0434349_26_499 156
476 3300046615 Ga0495656_0046119 Ga0495656_0046119_168_641 156
477 3300046615 Ga0495656_0106956 Ga0495656_0106956_521_994 156
478 3300046615 Ga0495656_0123765 Ga0495656_0123765_45_518 156
479 3300046616 Ga0495668_0002794 Ga0495668_0002794_2935_3408 156
480 3300046616 Ga0495668_0019080 Ga0495668_0019080_964_1437 156
481 3300046616 Ga0495668_0020751 Ga0495668_0020751_699_1172 156
482 3300046616 Ga0495668_0026520 Ga0495668_0026520_2255_2728 156
483 3300046616 Ga0495668_0052616 Ga0495668_0052616_1055_1528 156
484 3300046616 Ga0495668_0057592 Ga0495668_0057592_670_1143 156
485 3300046616 Ga0495668_0083035 Ga0495668_0083035_274_747 156
486 3300046616 Ga0495668_0090100 Ga0495668_0090100_491_964 156
487 3300046616 Ga0495668_0126074 Ga0495668_0126074_578_1051 156
488 3300046616 Ga0495668_0130157 Ga0495668_0130157_878_1351 156
489 3300046616 Ga0495668_0177276 Ga0495668_0177276_187_660 156
490 3300046642 Ga0495634_0030867 Ga0495634_0030867_647_1120 156
491 3300046648 Ga0495611_0000944 Ga0495611_0000944_409_882 156
492 3300046648 Ga0495611_0017645 Ga0495611_0017645_1162_1635 156
493 3300046648 Ga0495611_0021885 Ga0495611_0021885_308_781 156
494 3300046648 Ga0495611_0054713 Ga0495611_0054713_1042_1563 156
495 3300046648 Ga0495611_0067049 Ga0495611_0067049_875_1348 156
496 3300046648 Ga0495611_0073910 Ga0495611_0073910_125_598 156
497 3300046660 Ga0495625_0072104 Ga0495625_0072104_1900_2373 156
498 3300046660 Ga0495625_0169698 Ga0495625_0169698_723_1196 156
499 3300046660 Ga0495625_0186107 Ga0495625_0186107_138_611 156
500 3300046660 Ga0495625_0219210 Ga0495625_0219210_560_1033 156
501 3300046660 Ga0495625_0231242 Ga0495625_0231242_713_1186 156
502 3300046663 Ga0495635_0001055 Ga0495635_0001055_16921_17394 156
503 3300046665 Ga0495661_0003016 Ga0495661_0003016_6465_6938 156
504 3300046665 Ga0495661_0023036 Ga0495661_0023036_1253_1726 156
505 3300046665 Ga0495661_0026310 Ga0495661_0026310_573_1046 156
506 3300046665 Ga0495661_0038432 Ga0495661_0038432_271_744 156
507 3300046665 Ga0495661_0054848 Ga0495661_0054848_605_1078 156
508 3300046665 Ga0495661_0097043 Ga0495661_0097043_723_1196 156
509 3300046665 Ga0495661_0108389 Ga0495661_0108389_645_1118 156
510 3300046665 Ga0495661_0114471 Ga0495661_0114471_728_1201 156
511 3300046665 Ga0495661_0183882 Ga0495661_0183882_421_894 156
512 3300046665 Ga0495661_0218491 Ga0495661_0218491_102_575 156
513 3300046665 Ga0495661_0238678 Ga0495661_0238678_125_598 156
514 3300046665 Ga0495661_0395773 Ga0495661_0395773_24_497 156
515 3300046665 Ga0495661_0400422 Ga0495661_0400422_93_566 156
516 3300046674 Ga0495588_0000078 Ga0495588_0000078_27235_27708 156
517 3300046674 Ga0495588_0007873 Ga0495588_0007873_312_785 156
518 3300046674 Ga0495588_0021100 Ga0495588_0021100_746_1219 156
519 3300046674 Ga0495588_0031883 Ga0495588_0031883_493_966 156
520 3300046674 Ga0495588_0053202 Ga0495588_0053202_1216_1689 156
521 3300046674 Ga0495588_0053879 Ga0495588_0053879_1105_1578 156
522 3300046674 Ga0495588_0078835 Ga0495588_0078835_259_732 156
523 3300046674 Ga0495588_0345264 Ga0495588_0345264_114_587 156
524 3300046678 Ga0495599_0407877 Ga0495599_0407877_305_778 156
525 3300046679 Ga0495623_0033704 Ga0495623_0033704_730_1203 156
526 3300046679 Ga0495623_0144758 Ga0495623_0144758_787_1260 156
527 3300046679 Ga0495623_0551682 Ga0495623_0551682_61_534 156
528 3300046680 Ga0495646_0038428 Ga0495646_0038428_2352_2825 156
529 3300046684 Ga0495669_0000057 Ga0495669_0000057_74301_74774 156
530 3300046684 Ga0495669_0010183 Ga0495669_0010183_674_1147 156
531 3300046684 Ga0495669_0023293 Ga0495669_0023293_247_720 156
532 3300046684 Ga0495669_0025438 Ga0495669_0025438_1004_1477 156
533 3300046684 Ga0495669_0064491 Ga0495669_0064491_998_1471 156
534 3300046689 Ga0495613_0149515 Ga0495613_0149515_475_948 156
535 3300046691 Ga0495670_0041936 Ga0495670_0041936_1141_1614 156
536 3300046691 Ga0495670_0050890 Ga0495670_0050890_653_1126 156
537 3300046691 Ga0495670_0082759 Ga0495670_0082759_499_972 156
538 3300046691 Ga0495670_0191456 Ga0495670_0191456_594_1067 156
539 3300046691 Ga0495670_0422068 Ga0495670_0422068_49_522 156
540 3300046691 Ga0495670_0503078 Ga0495670_0503078_145_618 156
541 3300046692 Ga0495671_0014453 Ga0495671_0014453_1062_1535 156
542 3300046692 Ga0495671_0123409 Ga0495671_0123409_403_876 156
543 3300046694 Ga0495649_0007358 Ga0495649_0007358_3053_3526 156
544 3300046694 Ga0495649_0016251 Ga0495649_0016251_598_1071 156
545 3300046694 Ga0495649_0063095 Ga0495649_0063095_353_826 156
546 3300046694 Ga0495649_0079616 Ga0495649_0079616_534_1007 156
547 3300046694 Ga0495649_0163013 Ga0495649_0163013_439_912 156
548 3300046694 Ga0495649_0250581 Ga0495649_0250581_352_825 156
549 3300046794 Ga0495589_0000021 Ga0495589_0000021_88019_88492 156
550 3300046794 Ga0495589_0000193 Ga0495589_0000193_31031_31504 156
551 3300046794 Ga0495589_0015027 Ga0495589_0015027_714_1187 156
552 3300046794 Ga0495589_0018583 Ga0495589_0018583_2127_2600 156
553 3300046794 Ga0495589_0019463 Ga0495589_0019463_1605_2078 156
554 3300046794 Ga0495589_0024338 Ga0495589_0024338_2289_2762 156
555 3300046794 Ga0495589_0026665 Ga0495589_0026665_1919_2392 156
556 3300046794 Ga0495589_0029213 Ga0495589_0029213_857_1330 156
557 3300046794 Ga0495589_0029794 Ga0495589_0029794_874_1347 156
558 3300046794 Ga0495589_0033697 Ga0495589_0033697_212_685 156
559 3300046794 Ga0495589_0096889 Ga0495589_0096889_563_1036 156
560 3300046794 Ga0495589_0156361 Ga0495589_0156361_456_929 156
561 3300046809 Ga0495600_0043503 Ga0495600_0043503_1858_2331 156
562 3300046810 Ga0495660_0006653 Ga0495660_0006653_1943_2416 156
563 3300046810 Ga0495660_0018126 Ga0495660_0018126_2603_3076 156
564 3300046810 Ga0495660_0033020 Ga0495660_0033020_262_735 156
565 3300046810 Ga0495660_0045751 Ga0495660_0045751_134_607 156
566 3300046810 Ga0495660_0064519 Ga0495660_0064519_1169_1642 156
567 3300046810 Ga0495660_0095304 Ga0495660_0095304_731_1204 156
568 3300046810 Ga0495660_0102597 Ga0495660_0102597_940_1413 156
569 3300046810 Ga0495660_0103292 Ga0495660_0103292_26_499 156
570 3300046810 Ga0495660_0170138 Ga0495660_0170138_419_892 156
571 3300047315 Ga0495581_0024181 Ga0495581_0024181_2645_3118 156
572 3300047317 Ga0495604_0035632 Ga0495604_0035632_716_1189 156
573 3300047317 Ga0495604_0091755 Ga0495604_0091755_1443_1916 156
574 3300047317 Ga0495604_0612328 Ga0495604_0612328_88_561 156
575 3300047319 Ga0495674_1043329 Ga0495674_1043329_75_548 156
576 3300047320 Ga0495672_0000178 Ga0495672_0000178_75528_76001 156
577 3300047320 Ga0495672_0008348 Ga0495672_0008348_6206_6679 156
578 3300047320 Ga0495672_0019596 Ga0495672_0019596_985_1458 156
579 3300047320 Ga0495672_0024609 Ga0495672_0024609_1371_1844 156
580 3300047320 Ga0495672_0115555 Ga0495672_0115555_813_1286 156
581 3300047321 Ga0495676_0037581 Ga0495676_0037581_945_1418 156
582 3300047321 Ga0495676_0117394 Ga0495676_0117394_845_1318 156
583 3300047322 Ga0495680_0045790 Ga0495680_0045790_2452_2925 156
584 3300047322 Ga0495680_0240671 Ga0495680_0240671_109_582 156
585 3300047323 Ga0495683_0001145 Ga0495683_0001145_14598_15071 156
586 3300047323 Ga0495683_0012100 Ga0495683_0012100_2186_2659 156
587 3300047323 Ga0495683_0072006 Ga0495683_0072006_484_957 156
588 3300047323 Ga0495683_0100586 Ga0495683_0100586_428_901 156
589 3300047323 Ga0495683_0103684 Ga0495683_0103684_328_801 156
590 3300047323 Ga0495683_0147789 Ga0495683_0147789_285_758 156
591 3300047443 Ga0495687_000012 Ga0495687_000012_326668_327141 156
592 3300047443 Ga0495687_000407 Ga0495687_000407_2991_3464 156
593 3300047443 Ga0495687_010545 Ga0495687_010545_1724_2197 156
594 3300047443 Ga0495687_010619 Ga0495687_010619_1928_2401 156
595 3300047443 Ga0495687_017002 Ga0495687_017002_1089_1562 156
596 3300047443 Ga0495687_025311 Ga0495687_025311_1925_2398 156
597 3300047443 Ga0495687_087608 Ga0495687_087608_44_517 156
598 3300047444 Ga0495675_0023477 Ga0495675_0023477_2274_2747 156
599 3300047444 Ga0495675_0053941 Ga0495675_0053941_1712_2185 156
600 3300047444 Ga0495675_0146055 Ga0495675_0146055_332_805 156
601 3300047444 Ga0495675_0515171 Ga0495675_0515171_71_544 156
602 3300047445 Ga0495677_0000029 Ga0495677_0000029_2990_3463 156
603 3300047445 Ga0495677_0009885 Ga0495677_0009885_602_1075 156
604 3300047445 Ga0495677_0013909 Ga0495677_0013909_2381_2854 156
605 3300047445 Ga0495677_0031852 Ga0495677_0031852_294_767 156
606 3300047445 Ga0495677_0033060 Ga0495677_0033060_727_1200 156
607 3300047445 Ga0495677_0039358 Ga0495677_0039358_961_1434 156
608 3300047445 Ga0495677_0073660 Ga0495677_0073660_104_577 156
609 3300047445 Ga0495677_0175767 Ga0495677_0175767_154_627 156
610 3300047445 Ga0495677_0204131 Ga0495677_0204131_66_539 156
611 3300047445 Ga0495677_0273381 Ga0495677_0273381_118_591 156
612 3300047446 Ga0495679_006393 Ga0495679_006393_3391_3864 156
613 3300047446 Ga0495679_013445 Ga0495679_013445_1901_2374 156
614 3300047446 Ga0495679_038255 Ga0495679_038255_872_1345 156
615 3300047446 Ga0495679_090912 Ga0495679_090912_170_643 156
616 3300047447 Ga0495685_017538 Ga0495685_017538_35_508 156
617 3300047447 Ga0495685_045059 Ga0495685_045059_848_1321 156
618 3300047447 Ga0495685_087144 Ga0495685_087144_393_866 156
619 3300047469 Ga0495673_0068348 Ga0495673_0068348_905_1378 156
620 3300047470 Ga0495681_0016324 Ga0495681_0016324_834_1307 156
621 3300047470 Ga0495681_0017670 Ga0495681_0017670_2459_2932 156
622 3300047470 Ga0495681_0020448 Ga0495681_0020448_954_1427 156
623 3300047470 Ga0495681_0030366 Ga0495681_0030366_385_858 156
624 3300047470 Ga0495681_0053925 Ga0495681_0053925_1115_1588 156
625 3300047470 Ga0495681_0063129 Ga0495681_0063129_960_1433 156
626 3300047470 Ga0495681_0134559 Ga0495681_0134559_283_756 156
627 3300047470 Ga0495681_0203622 Ga0495681_0203622_194_667 156
628 3300047472 Ga0495686_0000738 Ga0495686_0000738_39865_40338 156
629 3300047472 Ga0495686_0008189 Ga0495686_0008189_2831_3304 156
630 3300047472 Ga0495686_0050961 Ga0495686_0050961_1446_1922 156
631 3300047472 Ga0495686_0095474 Ga0495686_0095474_481_954 156
632 3300047673 Ga0495593_0015115 Ga0495593_0015115_1082_1555 156
633 3300047673 Ga0495593_0120015 Ga0495593_0120015_147_620 156
634 3300048088 Ga0495602_0059295 Ga0495602_0059295_2331_2804 156
635 3300048088 Ga0495602_0165470 Ga0495602_0165470_647_1120 156
636 3300048089 Ga0495614_0003050 Ga0495614_0003050_2614_3087 156
637 3300048089 Ga0495614_0052023 Ga0495614_0052023_558_1031 156
638 3300048091 Ga0495626_0000017 Ga0495626_0000017_230283_230756 156
639 3300048091 Ga0495626_0000028 Ga0495626_0000028_200945_201418 156
640 3300048091 Ga0495626_0009200 Ga0495626_0009200_2490_2963 156
641 3300048091 Ga0495626_0016880 Ga0495626_0016880_2438_2911 156
642 3300048091 Ga0495626_0020411 Ga0495626_0020411_1664_2137 156
643 3300048091 Ga0495626_0032667 Ga0495626_0032667_673_1146 156
644 3300048091 Ga0495626_0037023 Ga0495626_0037023_816_1289 156
645 3300048091 Ga0495626_0038291 Ga0495626_0038291_348_821 156
646 3300048091 Ga0495626_0042808 Ga0495626_0042808_1259_1732 156
647 3300048091 Ga0495626_0045212 Ga0495626_0045212_1093_1566 156
648 3300048091 Ga0495626_0053144 Ga0495626_0053144_1120_1593 156
649 3300048091 Ga0495626_0056957 Ga0495626_0056957_825_1298 156
650 3300048091 Ga0495626_0072865 Ga0495626_0072865_614_1087 156
651 3300048091 Ga0495626_0074583 Ga0495626_0074583_111_584 156
652 3300048091 Ga0495626_0113461 Ga0495626_0113461_630_1103 156
653 3300048091 Ga0495626_0115701 Ga0495626_0115701_35_508 156
654 3300048091 Ga0495626_0160139 Ga0495626_0160139_139_612 156
655 3300048091 Ga0495626_0218578 Ga0495626_0218578_209_682 156
656 3300048903 Ga0496100_0150897 Ga0496100_0150897_998_1471 156
657 3300048903 Ga0496100_0604127 Ga0496100_0604127_202_675 156
658 3300048903 Ga0496100_1011616 Ga0496100_1011616_135_608 156
659 3300048905 Ga0496102_0000198 Ga0496102_0000198_75678_76151 156
660 3300048905 Ga0496102_0213392 Ga0496102_0213392_552_1025 156
661 3300048905 Ga0496102_0246002 Ga0496102_0246002_312_785 156
662 3300048905 Ga0496102_0282195 Ga0496102_0282195_751_1224 156
663 3300048906 Ga0496103_0210807 Ga0496103_0210807_488_961 156
664 3300048906 Ga0496103_0293764 Ga0496103_0293764_189_662 156
665 3300048908 Ga0496105_0107014 Ga0496105_0107014_1825_2298 156
666 3300048908 Ga0496105_0181153 Ga0496105_0181153_1225_1698 156
667 3300048908 Ga0496105_0207257 Ga0496105_0207257_729_1202 156
668 3300048909 Ga0496106_0325155 Ga0496106_0325155_566_1039 156
669 3300048910 Ga0496107_0057289 Ga0496107_0057289_219_692 156
670 3300048911 Ga0496108_0213912 Ga0496108_0213912_512_985 156
671 3300048911 Ga0496108_0620238 Ga0496108_0620238_20_493 156
672 3300048912 Ga0496109_0069130 Ga0496109_0069130_388_861 156
673 3300048912 Ga0496109_0702029 Ga0496109_0702029_459_932 156
674 3300048913 Ga0496110_0017718 Ga0496110_0017718_3264_3737 156
675 3300048913 Ga0496110_1253604 Ga0496110_1253604_17_490 156
676 3300048914 Ga0496111_0027877 Ga0496111_0027877_1017_1493 156
677 3300048916 Ga0496113_0033447 Ga0496113_0033447_1641_2114 156
678 3300048916 Ga0496113_0147673 Ga0496113_0147673_1042_1515 156
679 3300048917 Ga0496114_0065479 Ga0496114_0065479_1230_1703 156
680 3300048918 Ga0496115_0140263 Ga0496115_0140263_1377_1850 156
681 3300048919 Ga0496116_0017608 Ga0496116_0017608_3943_4419 156
682 3300048920 Ga0496117_0000045 Ga0496117_0000045_70812_71288 156
683 3300048920 Ga0496117_0380648 Ga0496117_0380648_94_567 156
684 3300048921 Ga0496118_0000041 Ga0496118_0000041_70812_71288 156
685 3300048924 Ga0496121_0134001 Ga0496121_0134001_288_761 156
686 3300048924 Ga0496121_0198348 Ga0496121_0198348_226_699 156
687 3300048925 Ga0496122_0032256 Ga0496122_0032256_1192_1665 156
688 3300048925 Ga0496122_0036552 Ga0496122_0036552_2700_3176 156
689 3300048925 Ga0496122_0057424 Ga0496122_0057424_2369_2842 156
690 3300048925 Ga0496122_0414699 Ga0496122_0414699_174_647 156
691 3300048926 Ga0496123_0028191 Ga0496123_0028191_2637_3113 156
692 3300048926 Ga0496123_0034600 Ga0496123_0034600_2756_3229 156
693 3300048926 Ga0496123_0047040 Ga0496123_0047040_1569_2042 156
694 3300048926 Ga0496123_0279648 Ga0496123_0279648_266_739 156
695 3300048927 Ga0496124_0016097 Ga0496124_0016097_933_1406 156
696 3300048927 Ga0496124_0064567 Ga0496124_0064567_1038_1514 156
697 3300048927 Ga0496124_0297982 Ga0496124_0297982_404_877 156
698 3300048927 Ga0496124_0319355 Ga0496124_0319355_172_645 156
699 3300048928 Ga0496125_0040174 Ga0496125_0040174_901_1374 156
700 3300048928 Ga0496125_0045082 Ga0496125_0045082_2528_3001 156
701 3300048928 Ga0496125_0429383 Ga0496125_0429383_88_561 156
702 3300048929 Ga0496126_0246866 Ga0496126_0246866_627_1100 156
703 3300048929 Ga0496126_0518587 Ga0496126_0518587_347_820 156
704 3300048929 Ga0496126_0567801 Ga0496126_0567801_364_840 156
705 3300049128 Ga0501308_006152 Ga0501308_006152_587_1060 156
706 3300049160 Ga0501304_003915 Ga0501304_003915_583_1056 156
707 3300049459 Ga0495678_000769 Ga0495678_000769_25322_25795 156
708 3300049459 Ga0495678_001549 Ga0495678_001549_2236_2709 156
709 3300049459 Ga0495678_017365 Ga0495678_017365_356_829 156
710 3300049459 Ga0495678_019925 Ga0495678_019925_636_1109 156
711 3300049459 Ga0495678_021048 Ga0495678_021048_2286_2759 156
712 3300049460 Ga0495682_0010066 Ga0495682_0010066_853_1326 156
713 3300049460 Ga0495682_0010283 Ga0495682_0010283_1925_2398 156
714 3300049460 Ga0495682_0010389 Ga0495682_0010389_872_1345 156
715 3300049460 Ga0495682_0012989 Ga0495682_0012989_791_1267 156
716 3300049460 Ga0495682_0036125 Ga0495682_0036125_509_982 156
717 3300049460 Ga0495682_0075768 Ga0495682_0075768_157_630 156
718 3300049537 Ga0501321_045258 Ga0501321_045258_102_575 156
719 3300049571 Ga0501034_0242332 Ga0501034_0242332_973_1446 156
720 3300049572 Ga0501036_0279472 Ga0501036_0279472_246_719 156
721 3300049662 Ga0501222_007677 Ga0501222_007677_243_716 156
722 3300049822 Ga0501035_0073224 Ga0501035_0073224_1287_1760 156
723 3300059491 Ga0587070_026373 Ga0587070_026373_474_947 156
724 3300059504 Ga0587082_062226 Ga0587082_062226_101_574 156
725 3300059505 Ga0587083_0103339 Ga0587083_0103339_220_693 156
726 3300059508 Ga0587088_030882 Ga0587088_030882_392_865 156
727 3300059607 Ga0587125_023600 Ga0587125_023600_13_486 156
728 3300059640 Ga0587067_017566 Ga0587067_017566_594_1067 156
729 3300059641 Ga0587068_000071 Ga0587068_000071_285_758 156
730 3300059647 Ga0587079_022009 Ga0587079_022009_670_1143 156
731 3300059647 Ga0587079_058217 Ga0587079_058217_340_813 156
732 3300059649 Ga0587102_027498 Ga0587102_027498_123_596 156
733 3300059652 Ga0587107_014070 Ga0587107_014070_525_998 156
734 3300060344 Ga0587071_110099 Ga0587071_110099_133_606 156
735 2162886007 SwRhRL2b_contig_2009666 SwRhRL2b_0170.00002110 157
736 3300001979 JGI24740J21852_10018967 JGI24740J21852_100189674 157
737 3300001989 JGI24739J22299_10013783 JGI24739J22299_100137832 157
738 3300002704 JGI25155J39150_1000275 JGI25155J39150_100027514 157
739 3300002704 JGI25155J39150_1001216 JGI25155J39150_10012162 157
740 3300002705 JGI25156J39149_1000654 JGI25156J39149_10006542 157
741 3300002737 JGI25162J39368_1002877 JGI25162J39368_10028775 157
742 3300002738 JGI25154J39366_1001008 JGI25154J39366_10010082 157
743 3300002738 JGI25154J39366_1001607 JGI25154J39366_10016072 157
744 3300002741 JGI25157J39369_1000620 JGI25157J39369_10006202 157
745 3300002987 JGI25159J45721_1013111 JGI25159J45721_10131112 157
746 3300003163 Ga0006759J45824_1099236 Ga0006759J45824_10992361 157
747 3300003354 JGI25160J50197_1016729 JGI25160J50197_10167292 157
748 3300003574 Ga0007410J51695_1045428 Ga0007410J51695_10454281 157
749 3300003575 Ga0007409J51694_1022844 Ga0007409J51694_10228442 157
750 3300003577 Ga0007416J51690_1014475 Ga0007416J51690_10144752 157
751 3300003752 Ga0055539_1000018 Ga0055539_1000018118 157
752 3300003756 Ga0055533_1000022 Ga0055533_1000022118 157
753 3300003758 Ga0055532_1000017 Ga0055532_100001776 157
754 3300003759 Ga0055525_1000024 Ga0055525_1000024118 157
755 3300003761 Ga0055535_1008032 Ga0055535_10080322 157
756 3300003763 Ga0055529_1000125 Ga0055529_100012537 157
757 3300003771 Ga0055526_1006167 Ga0055526_10061675 157
758 3300003773 Ga0055537_1047078 Ga0055537_10470781 157
759 3300003841 Ga0055541_1000013 Ga0055541_1000013118 157
760 3300005288 Ga0065714_10014940 Ga0065714_100149402 157
761 3300005293 Ga0065715_10011527 Ga0065715_100115274 157
762 3300005295 Ga0065707_10947712 Ga0065707_109477121 157
763 3300005328 Ga0070676_10298056 Ga0070676_102980562 157
764 3300005330 Ga0070690_100004194 Ga0070690_10000419413 157
765 3300005331 Ga0070670_100027159 Ga0070670_1000271598 157
766 3300005334 Ga0068869_100214337 Ga0068869_1002143372 157
767 3300005334 Ga0068869_100393022 Ga0068869_1003930222 157
768 3300005335 Ga0070666_10004984 Ga0070666_100049847 157
769 3300005335 Ga0070666_10083494 Ga0070666_100834942 157
770 3300005337 Ga0070682_100039649 Ga0070682_1000396492 157
771 3300005337 Ga0070682_100267747 Ga0070682_1002677472 157
772 3300005338 Ga0068868_100015599 Ga0068868_1000155992 157
773 3300005338 Ga0068868_100043085 Ga0068868_1000430856 157
774 3300005339 Ga0070660_100002183 Ga0070660_1000021833 157
775 3300005339 Ga0070660_100048636 Ga0070660_1000486362 157
776 3300005340 Ga0070689_100001985 Ga0070689_10000198519 157
777 3300005344 Ga0070661_100002329 Ga0070661_1000023293 157
778 3300005345 Ga0070692_10046908 Ga0070692_100469082 157
779 3300005355 Ga0070671_100092462 Ga0070671_1000924621 157
780 3300005355 Ga0070671_100234181 Ga0070671_1002341812 157
781 3300005356 Ga0070674_100001678 Ga0070674_10000167815 157
782 3300005364 Ga0070673_100000865 Ga0070673_10000086517 157
783 3300005365 Ga0070688_100007255 Ga0070688_1000072552 157
784 3300005366 Ga0070659_100001265 Ga0070659_10000126522 157
785 3300005366 Ga0070659_100090041 Ga0070659_1000900412 157
786 3300005367 Ga0070667_100003642 Ga0070667_1000036427 157
787 3300005367 Ga0070667_100064885 Ga0070667_1000648852 157
788 3300005406 Ga0070703_10033713 Ga0070703_100337132 157
789 3300005406 Ga0070703_10199612 Ga0070703_101996122 157
790 3300005434 Ga0070709_10027578 Ga0070709_100275782 157
791 3300005434 Ga0070709_10236133 Ga0070709_102361331 157
792 3300005434 Ga0070709_10496062 Ga0070709_104960622 157
793 3300005435 Ga0070714_100147756 Ga0070714_1001477564 157
794 3300005436 Ga0070713_100004316 Ga0070713_1000043167 157
795 3300005436 Ga0070713_100007320 Ga0070713_10000732013 157
796 3300005436 Ga0070713_101176746 Ga0070713_1011767461 157
797 3300005437 Ga0070710_10069751 Ga0070710_100697512 157
798 3300005437 Ga0070710_10124430 Ga0070710_101244301 157
799 3300005437 Ga0070710_10166235 Ga0070710_101662352 157
800 3300005439 Ga0070711_100001521 Ga0070711_10000152116 157
801 3300005439 Ga0070711_100009545 Ga0070711_1000095454 157
802 3300005440 Ga0070705_100003694 Ga0070705_1000036942 157
803 3300005445 Ga0070708_100565776 Ga0070708_1005657762 157
804 3300005455 Ga0070663_100167050 Ga0070663_1001670502 157
805 3300005456 Ga0070678_100004401 Ga0070678_1000044012 157
806 3300005456 Ga0070678_100057112 Ga0070678_1000571122 157
807 3300005457 Ga0070662_100003578 Ga0070662_1000035782 157
808 3300005457 Ga0070662_100228550 Ga0070662_1002285502 157
809 3300005459 Ga0068867_100021691 Ga0068867_1000216919 157
810 3300005459 Ga0068867_100554608 Ga0068867_1005546081 157
811 3300005466 Ga0070685_10016600 Ga0070685_100166002 157
812 3300005467 Ga0070706_100007439 Ga0070706_1000074392 157
813 3300005468 Ga0070707_100809908 Ga0070707_1008099082 157
814 3300005468 Ga0070707_100977031 Ga0070707_1009770311 157
815 3300005518 Ga0070699_100004740 Ga0070699_1000047402 157
816 3300005518 Ga0070699_100207883 Ga0070699_1002078832 157
817 3300005530 Ga0070679_100065686 Ga0070679_1000656862 157
818 3300005536 Ga0070697_100064107 Ga0070697_1000641072 157
819 3300005539 Ga0068853_100136981 Ga0068853_1001369811 157
820 3300005543 Ga0070672_100087313 Ga0070672_1000873135 157
821 3300005544 Ga0070686_100018101 Ga0070686_1000181012 157
822 3300005545 Ga0070695_100291793 Ga0070695_1002917931 157
823 3300005546 Ga0070696_100016414 Ga0070696_10001641410 157
824 3300005547 Ga0070693_100002246 Ga0070693_1000022463 157
825 3300005547 Ga0070693_100586533 Ga0070693_1005865332 157
826 3300005548 Ga0070665_100003995 Ga0070665_10000399522 157
827 3300005549 Ga0070704_100054101 Ga0070704_1000541012 157
828 3300005563 Ga0068855_100000037 Ga0068855_10000003726 157
829 3300005563 Ga0068855_100019104 Ga0068855_1000191044 157
830 3300005563 Ga0068855_100365741 Ga0068855_1003657412 157
831 3300005577 Ga0068857_100824397 Ga0068857_1008243973 157
832 3300005578 Ga0068854_100004704 Ga0068854_1000047046 157
833 3300005578 Ga0068854_100004957 Ga0068854_1000049572 157
834 3300005578 Ga0068854_100099655 Ga0068854_1000996553 157
835 3300005614 Ga0068856_100058353 Ga0068856_1000583532 157
836 3300005614 Ga0068856_100234204 Ga0068856_1002342042 157
837 3300005614 Ga0068856_100538641 Ga0068856_1005386411 157
838 3300005614 Ga0068856_100830858 Ga0068856_1008308583 157
839 3300005615 Ga0070702_100004699 Ga0070702_10000469910 157
840 3300005615 Ga0070702_100040445 Ga0070702_1000404452 157
841 3300005615 Ga0070702_100161199 Ga0070702_1001611992 157
842 3300005615 Ga0070702_100176951 Ga0070702_1001769511 157
843 3300005616 Ga0068852_100057370 Ga0068852_1000573702 157
844 3300005617 Ga0068859_100101205 Ga0068859_1001012052 157
845 3300005617 Ga0068859_100512453 Ga0068859_1005124532 157
846 3300005618 Ga0068864_100006955 Ga0068864_1000069556 157
847 3300005718 Ga0068866_10001499 Ga0068866_1000149912 157
848 3300005718 Ga0068866_10079945 Ga0068866_100799452 157
849 3300005719 Ga0068861_100822906 Ga0068861_1008229062 157
850 3300005834 Ga0068851_10511969 Ga0068851_105119691 157
851 3300005841 Ga0068863_100004894 Ga0068863_1000048949 157
852 3300005842 Ga0068858_100049032 Ga0068858_1000490322 157
853 3300005842 Ga0068858_100080949 Ga0068858_1000809493 157
854 3300006028 Ga0070717_10623054 Ga0070717_106230541 157
855 3300006163 Ga0070715_10010540 Ga0070715_100105402 157
856 3300006163 Ga0070715_10019155 Ga0070715_100191555 157
857 3300006175 Ga0070712_100004888 Ga0070712_10000488812 157
858 3300006175 Ga0070712_100089940 Ga0070712_1000899403 157
859 3300006175 Ga0070712_100214971 Ga0070712_1002149712 157
860 3300006195 Ga0075366_10528077 Ga0075366_105280772 157
861 3300006237 Ga0097621_100046101 Ga0097621_1000461012 157
862 3300006237 Ga0097621_100273988 Ga0097621_1002739883 157
863 3300006358 Ga0068871_100019735 Ga0068871_1000197352 157
864 3300006358 Ga0068871_100086114 Ga0068871_1000861143 157
865 3300006844 Ga0075428_100001737 Ga0075428_10000173712 157
866 3300006847 Ga0075431_100276628 Ga0075431_1002766281 157
867 3300006871 Ga0075434_100261086 Ga0075434_1002610863 157
868 3300006880 Ga0075429_100059174 Ga0075429_1000591744 157
869 3300006881 Ga0068865_100017695 Ga0068865_1000176956 157
870 3300006881 Ga0068865_100045549 Ga0068865_1000455492 157
871 3300006914 Ga0075436_100340341 Ga0075436_1003403412 157
872 3300006931 Ga0097620_100101201 Ga0097620_1001012012 157
873 3300006931 Ga0097620_100512459 Ga0097620_1005124592 157
874 3300006946 Ga0079104_1014796 Ga0079104_10147962 157
875 3300006948 Ga0099826_10000001 Ga0099826_10000001642 157
876 3300007076 Ga0075435_100084353 Ga0075435_1000843533 157
877 3300007076 Ga0075435_100332326 Ga0075435_1003323262 157
878 3300009011 Ga0105251_10156105 Ga0105251_101561051 157
879 3300009036 Ga0105244_10415334 Ga0105244_104153341 157
880 3300009093 Ga0105240_10027136 Ga0105240_100271363 157
881 3300009093 Ga0105240_10058534 Ga0105240_100585344 157
882 3300009093 Ga0105240_10355771 Ga0105240_103557713 157
883 3300009094 Ga0111539_10002714 Ga0111539_100027144 157
884 3300009094 Ga0111539_10043139 Ga0111539_100431392 157
885 3300009098 Ga0105245_10137680 Ga0105245_101376802 157
886 3300009098 Ga0105245_10192825 Ga0105245_101928252 157
887 3300009098 Ga0105245_10210530 Ga0105245_102105302 157
888 3300009098 Ga0105245_10331865 Ga0105245_103318652 157
889 3300009101 Ga0105247_10343261 Ga0105247_103432612 157
890 3300009147 Ga0114129_10164862 Ga0114129_101648622 157
891 3300009148 Ga0105243_10475361 Ga0105243_104753611 157
892 3300009174 Ga0105241_10012641 Ga0105241_1001264111 157
893 3300009176 Ga0105242_10022867 Ga0105242_100228672 157
894 3300009176 Ga0105242_11042383 Ga0105242_110423831 157
895 3300009177 Ga0105248_10001274 Ga0105248_1000127412 157
896 3300009177 Ga0105248_10274738 Ga0105248_102747382 157
897 3300009545 Ga0105237_10094387 Ga0105237_100943872 157
898 3300009545 Ga0105237_10203331 Ga0105237_102033313 157
899 3300009545 Ga0105237_10231685 Ga0105237_102316852 157
900 3300009545 Ga0105237_10477637 Ga0105237_104776372 157
901 3300009551 Ga0105238_10000955 Ga0105238_100009554 157
902 3300009551 Ga0105238_10073501 Ga0105238_100735012 157
903 3300009551 Ga0105238_10107469 Ga0105238_101074692 157
904 3300009551 Ga0105238_10215500 Ga0105238_102155003 157
905 3300009551 Ga0105238_10594166 Ga0105238_105941662 157
906 3300010375 Ga0105239_10013663 Ga0105239_100136632 157
907 3300010375 Ga0105239_10233571 Ga0105239_102335712 157
908 3300010375 Ga0105239_10686998 Ga0105239_106869982 157
909 3300011119 Ga0105246_10318267 Ga0105246_103182672 157
910 3300011119 Ga0105246_10450445 Ga0105246_104504452 157
911 3300013100 Ga0157373_10343115 Ga0157373_103431152 157
912 3300013102 Ga0157371_10393403 Ga0157371_103934032 157
913 3300013296 Ga0157374_10005037 Ga0157374_100050372 157
914 3300013297 Ga0157378_10004389 Ga0157378_100043899 157
915 3300013297 Ga0157378_10123878 Ga0157378_101238783 157
916 3300013297 Ga0157378_10360338 Ga0157378_103603382 157
917 3300013306 Ga0163162_10042566 Ga0163162_100425662 157
918 3300013306 Ga0163162_10087689 Ga0163162_100876892 157
919 3300013307 Ga0157372_10266332 Ga0157372_102663322 157
920 3300013307 Ga0157372_11056103 Ga0157372_110561032 157
921 3300013308 Ga0157375_10086067 Ga0157375_100860672 157
922 3300013308 Ga0157375_10696817 Ga0157375_106968172 157
923 3300014325 Ga0163163_10031257 Ga0163163_100312572 157
924 3300014325 Ga0163163_10186265 Ga0163163_101862652 157
925 3300014497 Ga0182008_10173520 Ga0182008_101735202 157
926 3300014497 Ga0182008_10233469 Ga0182008_102334691 157
927 3300014745 Ga0157377_10030450 Ga0157377_100304502 157
928 3300014968 Ga0157379_10019373 Ga0157379_100193735 157
929 3300014968 Ga0157379_10048413 Ga0157379_100484132 157
930 3300014969 Ga0157376_10027516 Ga0157376_100275162 157
931 3300014969 Ga0157376_10028649 Ga0157376_100286492 157
932 3300014969 Ga0157376_10188151 Ga0157376_101881512 157
933 3300014969 Ga0157376_10325238 Ga0157376_103252382 157
934 3300015261 Ga0182006_1015816 Ga0182006_10158163 157
935 3300017792 Ga0163161_10025359 Ga0163161_100253592 157
936 3300025206 Ga0209435_100015 Ga0209435_10001589 157
937 3300025224 Ga0209784_100005 Ga0209784_100005605 157
938 3300025225 Ga0209566_100005 Ga0209566_100005605 157
939 3300025226 Ga0209674_100009 Ga0209674_100009605 157
940 3300025229 Ga0209147_100004 Ga0209147_1000041137 157
941 3300025230 Ga0209563_100012 Ga0209563_100012605 157
942 3300025233 Ga0209437_100329 Ga0209437_10032922 157
943 3300025242 Ga0209258_100523 Ga0209258_1005232 157
944 3300025246 Ga0209646_1000020 Ga0209646_100002071 157
945 3300025246 Ga0209646_1000040 Ga0209646_1000040119 157
946 3300025250 Ga0209026_1000034 Ga0209026_1000034200 157
947 3300025250 Ga0209026_1001477 Ga0209026_10014779 157
948 3300025253 Ga0209677_100006 Ga0209677_100006605 157
949 3300025256 Ga0209759_1000049 Ga0209759_10000493 157
950 3300025256 Ga0209759_1000656 Ga0209759_10006562 157
951 3300025263 Ga0209565_1022947 Ga0209565_10229473 157
952 3300025272 Ga0209455_1000044 Ga0209455_1000044276 157
953 3300025291 Ga0209675_1014874 Ga0209675_10148743 157
954 3300025295 Ga0209564_1000007 Ga0209564_1000007632 157
955 3300025295 Ga0209564_1018332 Ga0209564_10183325 157
956 3300025299 Ga0209256_1000005 Ga0209256_1000005949 157
957 3300025321 Ga0207656_10268669 Ga0207656_102686692 157
958 3300025735 Ga0207713_1067643 Ga0207713_10676431 157
959 3300025898 Ga0207692_10065905 Ga0207692_100659052 157
960 3300025898 Ga0207692_10366682 Ga0207692_103666821 157
961 3300025899 Ga0207642_10006909 Ga0207642_100069092 157
962 3300025899 Ga0207642_10038420 Ga0207642_100384203 157
963 3300025903 Ga0207680_10203891 Ga0207680_102038911 157
964 3300025905 Ga0207685_10008483 Ga0207685_100084832 157
965 3300025905 Ga0207685_10094183 Ga0207685_100941832 157
966 3300025906 Ga0207699_10030839 Ga0207699_100308396 157
967 3300025906 Ga0207699_10204252 Ga0207699_102042522 157
968 3300025906 Ga0207699_10439686 Ga0207699_104396861 157
969 3300025907 Ga0207645_10095689 Ga0207645_100956892 157
970 3300025911 Ga0207654_10055339 Ga0207654_100553392 157
971 3300025912 Ga0207707_10023430 Ga0207707_100234304 157
972 3300025913 Ga0207695_10001485 Ga0207695_1000148511 157
973 3300025913 Ga0207695_10017853 Ga0207695_100178534 157
974 3300025913 Ga0207695_10263151 Ga0207695_102631513 157
975 3300025913 Ga0207695_10267304 Ga0207695_102673043 157
976 3300025914 Ga0207671_10014534 Ga0207671_100145342 157
977 3300025914 Ga0207671_10345078 Ga0207671_103450781 157
978 3300025914 Ga0207671_10419490 Ga0207671_104194902 157
979 3300025914 Ga0207671_10449138 Ga0207671_104491382 157
980 3300025914 Ga0207671_10844774 Ga0207671_108447742 157
981 3300025915 Ga0207693_10000325 Ga0207693_1000032565 157
982 3300025915 Ga0207693_10007147 Ga0207693_1000714711 157
983 3300025915 Ga0207693_10027499 Ga0207693_100274993 157
984 3300025915 Ga0207693_10311631 Ga0207693_103116312 157
985 3300025916 Ga0207663_10022607 Ga0207663_100226076 157
986 3300025919 Ga0207657_10000571 Ga0207657_1000057133 157
987 3300025919 Ga0207657_10003818 Ga0207657_1000381815 157
988 3300025920 Ga0207649_10013576 Ga0207649_100135762 157
989 3300025920 Ga0207649_10292979 Ga0207649_102929792 157
990 3300025921 Ga0207652_10702479 Ga0207652_107024792 157
991 3300025924 Ga0207694_10000783 Ga0207694_100007833 157
992 3300025924 Ga0207694_10270813 Ga0207694_102708133 157
993 3300025925 Ga0207650_10115157 Ga0207650_101151573 157
994 3300025925 Ga0207650_10316559 Ga0207650_103165592 157
995 3300025927 Ga0207687_10128423 Ga0207687_101284232 157
996 3300025927 Ga0207687_10234047 Ga0207687_102340472 157
997 3300025927 Ga0207687_10451959 Ga0207687_104519592 157
998 3300025928 Ga0207700_10182988 Ga0207700_101829882 157
999 3300025928 Ga0207700_10547143 Ga0207700_105471431 157
1000 3300025931 Ga0207644_10026128 Ga0207644_100261283 157
1001 3300025931 Ga0207644_10177885 Ga0207644_101778853 157
1002 3300025932 Ga0207690_10000971 Ga0207690_100009712 157
1003 3300025932 Ga0207690_10212353 Ga0207690_102123532 157
1004 3300025933 Ga0207706_10011440 Ga0207706_100114402 157
1005 3300025934 Ga0207686_10000118 Ga0207686_1000011865 157
1006 3300025934 Ga0207686_10061717 Ga0207686_100617172 157
1007 3300025935 Ga0207709_10278864 Ga0207709_102788643 157
1008 3300025936 Ga0207670_10192018 Ga0207670_101920182 157
1009 3300025936 Ga0207670_10685212 Ga0207670_106852122 157
1010 3300025937 Ga0207669_10071567 Ga0207669_100715672 157
1011 3300025938 Ga0207704_10036320 Ga0207704_100363202 157
1012 3300025938 Ga0207704_10395335 Ga0207704_103953351 157
1013 3300025939 Ga0207665_10008043 Ga0207665_100080432 157
1014 3300025939 Ga0207665_10011507 Ga0207665_100115072 157
1015 3300025940 Ga0207691_10122366 Ga0207691_101223662 157
1016 3300025941 Ga0207711_10140923 Ga0207711_101409232 157
1017 3300025941 Ga0207711_10204359 Ga0207711_102043592 157
1018 3300025941 Ga0207711_10442481 Ga0207711_104424812 157
1019 3300025941 Ga0207711_10549821 Ga0207711_105498211 157
1020 3300025942 Ga0207689_10271008 Ga0207689_102710083 157
1021 3300025945 Ga0207679_10003703 Ga0207679_100037033 157
1022 3300025949 Ga0207667_10000053 Ga0207667_10000053159 157
1023 3300025949 Ga0207667_10010379 Ga0207667_1001037910 157
1024 3300025949 Ga0207667_10041035 Ga0207667_100410353 157
1025 3300025960 Ga0207651_10040775 Ga0207651_100407752 157
1026 3300025960 Ga0207651_10627418 Ga0207651_106274182 157
1027 3300025986 Ga0207658_10236199 Ga0207658_102361992 157
1028 3300025986 Ga0207658_10321010 Ga0207658_103210102 157
1029 3300026023 Ga0207677_10089453 Ga0207677_100894533 157
1030 3300026023 Ga0207677_10137924 Ga0207677_101379242 157
1031 3300026023 Ga0207677_10151784 Ga0207677_101517842 157
1032 3300026035 Ga0207703_10032162 Ga0207703_100321622 157
1033 3300026067 Ga0207678_10037994 Ga0207678_100379942 157
1034 3300026078 Ga0207702_10097125 Ga0207702_100971254 157
1035 3300026078 Ga0207702_10249160 Ga0207702_102491602 157
1036 3300026078 Ga0207702_10270589 Ga0207702_102705891 157
1037 3300026078 Ga0207702_10399249 Ga0207702_103992492 157
1038 3300026088 Ga0207641_10093135 Ga0207641_100931352 157
1039 3300026089 Ga0207648_10026419 Ga0207648_100264192 157
1040 3300026089 Ga0207648_10230432 Ga0207648_102304322 157
1041 3300026095 Ga0207676_10299548 Ga0207676_102995482 157
1042 3300026116 Ga0207674_10005654 Ga0207674_100056544 157
1043 3300026116 Ga0207674_10258058 Ga0207674_102580581 157
1044 3300026116 Ga0207674_10302508 Ga0207674_103025083 157
1045 3300026121 Ga0207683_10003257 Ga0207683_1000325712 157
1046 3300026121 Ga0207683_10004973 Ga0207683_100049732 157
1047 3300026142 Ga0207698_10004178 Ga0207698_100041787 157
1048 3300026142 Ga0207698_10012444 Ga0207698_100124444 157
1049 3300026142 Ga0207698_10206330 Ga0207698_102063302 157
1050 3300027666 Ga0209282_1000001 Ga0209282_10000011780 157
1051 3300027907 Ga0207428_10004868 Ga0207428_100048685 157
1052 3300027907 Ga0207428_10363892 Ga0207428_103638922 157
1053 3300028379 Ga0268266_10233330 Ga0268266_102333301 157
1054 3300028381 Ga0268264_10222767 Ga0268264_102227672 157
1055 3300028381 Ga0268264_11548598 Ga0268264_115485981 157
1056 3300030731 Ga0316177_1056911 Ga0316177_10569112 157
1057 3300030735 Ga0316178_1070957 Ga0316178_10709573 157
1058 3300030736 Ga0316180_1080061 Ga0316180_10800614 157
1059 3300030745 Ga0316182_1091364 Ga0316182_10913642 157
1060 3300030745 Ga0316182_1138354 Ga0316182_11383541 157
1061 3300031241 Ga0265325_10000262 Ga0265325_1000026215 157
1062 3300031251 Ga0265327_10027789 Ga0265327_100277892 157
1063 3300031548 Ga0307408_100000294 Ga0307408_1000002944 157
1064 3300031727 Ga0316576_10014395 Ga0316576_100143955 157
1065 3300031727 Ga0316576_10119002 Ga0316576_101190022 157
1066 3300031728 Ga0316578_10005843 Ga0316578_100058432 157
1067 3300031728 Ga0316578_10698694 Ga0316578_106986941 157
1068 3300031730 Ga0307516_10248129 Ga0307516_102481292 157
1069 3300031838 Ga0307518_10028537 Ga0307518_100285372 157
1070 3300031911 Ga0307412_10661874 Ga0307412_106618742 157
1071 3300032004 Ga0307414_10133833 Ga0307414_101338332 157
1072 3300032005 Ga0307411_10089098 Ga0307411_100890984 157
1073 3300032005 Ga0307411_10180747 Ga0307411_101807472 157
1074 3300032133 Ga0316583_10000450 Ga0316583_100004502 157
1075 3300032133 Ga0316583_10007762 Ga0316583_100077622 157
1076 3300032139 Ga0316580_10154243 Ga0316580_101542431 157
1077 3300033179 Ga0307507_10059523 Ga0307507_100595235 157
1078 3300033524 Ga0316592_1003877 Ga0316592_10038772 157
1079 3300033524 Ga0316592_1005553 Ga0316592_10055532 157
1080 3300033529 Ga0316587_1028496 Ga0316587_10284962 157
1081 3300033541 Ga0316596_1000002 Ga0316596_10000024 157
1082 3300033541 Ga0316596_1000007 Ga0316596_10000073 157
1083 3300035111 Ga0373923_0073468 Ga0373923_0073468_314_790 157
1084 3300035113 Ga0373936_0020708 Ga0373936_0020708_1409_1885 157
1085 3300035113 Ga0373936_0131451 Ga0373936_0131451_556_1032 157
1086 3300035114 Ga0373939_0036290 Ga0373939_0036290_630_1106 157
1087 3300035116 Ga0373945_0017368 Ga0373945_0017368_830_1306 157
1088 3300035117 Ga0373953_0011867 Ga0373953_0011867_2253_2729 157
1089 3300035118 Ga0373954_0094093 Ga0373954_0094093_281_757 157
1090 3300035119 Ga0373956_0008504 Ga0373956_0008504_1925_2401 157
1091 3300035119 Ga0373956_0033825 Ga0373956_0033825_1706_2182 157
1092 3300035119 Ga0373956_0075954 Ga0373956_0075954_460_936 157
1093 3300035170 Ga0373943_0083321 Ga0373943_0083321_368_844 157
1094 3300035170 Ga0373943_0377635 Ga0373943_0377635_39_515 157
1095 3300035171 Ga0373946_0036344 Ga0373946_0036344_954_1430 157
1096 3300035172 Ga0373955_0044618 Ga0373955_0044618_813_1289 157
1097 3300035172 Ga0373955_0068759 Ga0373955_0068759_317_793 157
1098 3300035398 Ga0316574_0148984 Ga0316574_0148984_582_1061 157
1099 3300035410 Ga0373924_0050158 Ga0373924_0050158_409_885 157
1100 3300035692 Ga0373935_0059744 Ga0373935_0059744_1697_2173 157
1101 3300035692 Ga0373935_0073331 Ga0373935_0073331_846_1322 157
1102 3300035695 Ga0373927_0013469 Ga0373927_0013469_2931_3407 157
1103 3300035695 Ga0373927_0041604 Ga0373927_0041604_1591_2067 157
1104 3300035695 Ga0373927_0759692 Ga0373927_0759692_136_612 157
1105 3300035695 Ga0373927_0904829 Ga0373927_0904829_57_533 157
1106 3300035724 Ga0373933_0060334 Ga0373933_0060334_168_644 157
1107 3300035724 Ga0373933_0077401 Ga0373933_0077401_1406_1882 157
1108 3300035724 Ga0373933_0232091 Ga0373933_0232091_186_662 157
1109 3300035725 Ga0373947_0110948 Ga0373947_0110948_544_1020 157
1110 3300035725 Ga0373947_0127072 Ga0373947_0127072_492_968 157
1111 3300035725 Ga0373947_0444702 Ga0373947_0444702_368_844 157
1112 3300036401 Ga0373937_0004053 Ga0373937_0004053_238_714 157
1113 3300036401 Ga0373937_0076494 Ga0373937_0076494_1938_2414 157
1114 3300036401 Ga0373937_0177721 Ga0373937_0177721_612_1088 157
1115 3300036401 Ga0373937_0416795 Ga0373937_0416795_786_1262 157
1116 3300036647 Ga0316582_0004588 Ga0316582_0004588_2328_2807 157
1117 3300036712 Ga0316584_0169500 Ga0316584_0169500_423_899 157
1118 3300036712 Ga0316584_0237324 Ga0316584_0237324_750_1226 157
1119 3300037068 Ga0373925_0024531 Ga0373925_0024531_3114_3590 157
1120 3300037068 Ga0373925_0026948 Ga0373925_0026948_721_1197 157
1121 3300037068 Ga0373925_0055374 Ga0373925_0055374_650_1126 157
1122 3300037312 Ga0395899_0005514 Ga0395899_0005514_1959_2435 157
1123 3300037312 Ga0395899_0011802 Ga0395899_0011802_6029_6505 157
1124 3300037312 Ga0395899_0015482 Ga0395899_0015482_2486_2962 157
1125 3300037312 Ga0395899_0070098 Ga0395899_0070098_669_1145 157
1126 3300037418 Ga0395900_0013338 Ga0395900_0013338_7866_8342 157
1127 3300037418 Ga0395900_0061672 Ga0395900_0061672_537_1013 157
1128 3300037418 Ga0395900_0103143 Ga0395900_0103143_1399_1875 157
1129 3300037466 Ga0395898_0002939 Ga0395898_0002939_8751_9227 157
1130 3300037466 Ga0395898_0048112 Ga0395898_0048112_2274_2750 157
1131 3300037471 Ga0395905_0004758 Ga0395905_0004758_4338_4814 157
1132 3300037471 Ga0395905_0021934 Ga0395905_0021934_2463_2939 157
1133 3300037471 Ga0395905_0050257 Ga0395905_0050257_3233_3709 157
1134 3300037471 Ga0395905_0087348 Ga0395905_0087348_695_1171 157
1135 3300037471 Ga0395905_0234734 Ga0395905_0234734_983_1459 157
1136 3300038443 Ga0395901_0009352 Ga0395901_0009352_6738_7214 157
1137 3300038443 Ga0395901_0201311 Ga0395901_0201311_459_935 157
1138 3300038443 Ga0395901_0427788 Ga0395901_0427788_15_491 157
1139 3300038443 Ga0395901_0553742 Ga0395901_0553742_673_1149 157
1140 3300039062 Ga0400483_066879 Ga0400483_066879_18567_19043 157
1141 3300039062 Ga0400483_146612 Ga0400483_146612_900_1376 157
1142 3300039438 Ga0436360_0890123 Ga0436360_0890123_134_610 157
1143 3300039447 Ga0436361_0204853 Ga0436361_0204853_7987_8463 157
1144 3300039447 Ga0436361_0383429 Ga0436361_0383429_636_1112 157
1145 3300041406 Ga0439439_0003713 Ga0439439_0003713_800_1276 157
1146 3300042007 Ga0439449_0001658 Ga0439449_0001658_4157_4633 157
1147 3300042139 Ga0450904_008348 Ga0450904_008348_521_1000 157
1148 3300042157 Ga0439458_0020540 Ga0439458_0020540_334_810 157
1149 3300042876 Ga0451577_0128327 Ga0451577_0128327_756_1238 157
1150 3300042876 Ga0451577_1084677 Ga0451577_1084677_37_513 157
1151 3300042876 Ga0451577_1727726 Ga0451577_1727726_44_520 157
1152 3300044658 Ga0466972_0000275 Ga0466972_0000275_31292_31771 157
1153 3300044658 Ga0466972_0018121 Ga0466972_0018121_674_1156 157
1154 3300044673 Ga0453683_0909240 Ga0453683_0909240_66_542 157
1155 3300044683 Ga0466965_0031058 Ga0466965_0031058_713_1195 157
1156 3300044683 Ga0466965_0083479 Ga0466965_0083479_81_557 157
1157 3300044706 Ga0466964_0052875 Ga0466964_0052875_349_831 157
1158 3300044706 Ga0466964_0214098 Ga0466964_0214098_153_632 157
1159 3300044712 Ga0453684_0005853 Ga0453684_0005853_12741_13223 157
1160 3300044765 Ga0466970_0038578 Ga0466970_0038578_1409_1885 157
1161 3300044901 Ga0466960_0341790 Ga0466960_0341790_214_693 157
1162 3300045051 Ga0451576_0002470 Ga0451576_0002470_10790_11266 157
1163 3300045051 Ga0451576_0168707 Ga0451576_0168707_1259_1735 157
1164 3300046455 Ga0495603_0042128 Ga0495603_0042128_291_767 157
1165 3300046455 Ga0495603_0178895 Ga0495603_0178895_465_944 157
1166 3300046459 Ga0495629_0122521 Ga0495629_0122521_725_1201 157
1167 3300046459 Ga0495629_0442648 Ga0495629_0442648_206_685 157
1168 3300046462 Ga0495651_0155360 Ga0495651_0155360_904_1380 157
1169 3300046463 Ga0495653_0253295 Ga0495653_0253295_135_614 157
1170 3300046472 Ga0495580_0054857 Ga0495580_0054857_1536_2012 157
1171 3300046472 Ga0495580_0082784 Ga0495580_0082784_800_1276 157
1172 3300046472 Ga0495580_0151150 Ga0495580_0151150_253_729 157
1173 3300046472 Ga0495580_0179227 Ga0495580_0179227_369_848 157
1174 3300046473 Ga0495582_0018805 Ga0495582_0018805_497_973 157
1175 3300046475 Ga0495639_0121048 Ga0495639_0121048_467_943 157
1176 3300046475 Ga0495639_0275999 Ga0495639_0275999_341_820 157
1177 3300046476 Ga0495662_0024992 Ga0495662_0024992_109_585 157
1178 3300046477 Ga0495664_0103722 Ga0495664_0103722_270_746 157
1179 3300046491 Ga0495584_0168914 Ga0495584_0168914_517_996 157
1180 3300046492 Ga0495585_0144845 Ga0495585_0144845_126_605 157
1181 3300046492 Ga0495585_0331404 Ga0495585_0331404_91_570 157
1182 3300046499 Ga0495594_0026282 Ga0495594_0026282_2052_2531 157
1183 3300046499 Ga0495594_0173761 Ga0495594_0173761_88_564 157
1184 3300046499 Ga0495594_0541274 Ga0495594_0541274_137_613 157
1185 3300046506 Ga0495583_0000217 Ga0495583_0000217_5235_5765 157
1186 3300046506 Ga0495583_0014453 Ga0495583_0014453_2940_3419 157
1187 3300046506 Ga0495583_0017569 Ga0495583_0017569_606_1085 157
1188 3300046506 Ga0495583_0088318 Ga0495583_0088318_163_642 157
1189 3300046507 Ga0495606_0031459 Ga0495606_0031459_1002_1481 157
1190 3300046507 Ga0495606_0153040 Ga0495606_0153040_313_792 157
1191 3300046511 Ga0495608_0173893 Ga0495608_0173893_623_1099 157
1192 3300046516 Ga0495628_0030236 Ga0495628_0030236_2183_2659 157
1193 3300046517 Ga0495630_0162029 Ga0495630_0162029_964_1443 157
1194 3300046518 Ga0495631_0041961 Ga0495631_0041961_572_1051 157
1195 3300046518 Ga0495631_0080611 Ga0495631_0080611_117_596 157
1196 3300046520 Ga0495637_0271947 Ga0495637_0271947_71_550 157
1197 3300046522 Ga0495643_0001166 Ga0495643_0001166_991_1470 157
1198 3300046522 Ga0495643_0019193 Ga0495643_0019193_2041_2517 157
1199 3300046522 Ga0495643_0068217 Ga0495643_0068217_1019_1495 157
1200 3300046522 Ga0495643_0142034 Ga0495643_0142034_71_550 157
1201 3300046525 Ga0495663_0022183 Ga0495663_0022183_788_1267 157
1202 3300046525 Ga0495663_0068445 Ga0495663_0068445_323_802 157
1203 3300046525 Ga0495663_0082955 Ga0495663_0082955_116_595 157
1204 3300046526 Ga0495666_0019490 Ga0495666_0019490_2463_2942 157
1205 3300046526 Ga0495666_0021664 Ga0495666_0021664_911_1390 157
1206 3300046526 Ga0495666_0059007 Ga0495666_0059007_719_1198 157
1207 3300046528 Ga0495642_0149590 Ga0495642_0149590_116_595 157
1208 3300046531 Ga0495665_0028022 Ga0495665_0028022_344_823 157
1209 3300046531 Ga0495665_0034768 Ga0495665_0034768_1052_1531 157
1210 3300046531 Ga0495665_0399741 Ga0495665_0399741_173_649 157
1211 3300046535 Ga0495586_0034409 Ga0495586_0034409_1425_1904 157
1212 3300046535 Ga0495586_0062533 Ga0495586_0062533_419_895 157
1213 3300046535 Ga0495586_0294140 Ga0495586_0294140_429_905 157
1214 3300046537 Ga0495598_0011881 Ga0495598_0011881_1123_1599 157
1215 3300046537 Ga0495598_0056914 Ga0495598_0056914_118_594 157
1216 3300046538 Ga0495609_0041128 Ga0495609_0041128_21_497 157
1217 3300046538 Ga0495609_0155196 Ga0495609_0155196_444_923 157
1218 3300046539 Ga0495621_0016295 Ga0495621_0016295_227_703 157
1219 3300046539 Ga0495621_0025100 Ga0495621_0025100_68_544 157
1220 3300046539 Ga0495621_0112505 Ga0495621_0112505_240_719 157
1221 3300046542 Ga0495597_0006249 Ga0495597_0006249_2957_3436 157
1222 3300046542 Ga0495597_0085971 Ga0495597_0085971_426_905 157
1223 3300046542 Ga0495597_0145296 Ga0495597_0145296_484_963 157
1224 3300046543 Ga0495645_0243285 Ga0495645_0243285_285_761 157
1225 3300046557 Ga0495622_0037877 Ga0495622_0037877_813_1292 157
1226 3300046557 Ga0495622_0093388 Ga0495622_0093388_552_1031 157
1227 3300046558 Ga0495633_0097623 Ga0495633_0097623_720_1199 157
1228 3300046558 Ga0495633_0155708 Ga0495633_0155708_485_967 157
1229 3300046559 Ga0495667_0276671 Ga0495667_0276671_433_912 157
1230 3300046616 Ga0495668_0114739 Ga0495668_0114739_33_512 157
1231 3300046642 Ga0495634_0273699 Ga0495634_0273699_408_887 157
1232 3300046648 Ga0495611_0032757 Ga0495611_0032757_487_966 157
1233 3300046660 Ga0495625_0076921 Ga0495625_0076921_1086_1568 157
1234 3300046660 Ga0495625_0129086 Ga0495625_0129086_688_1167 157
1235 3300046663 Ga0495635_0370760 Ga0495635_0370760_273_749 157
1236 3300046664 Ga0495659_0044871 Ga0495659_0044871_855_1334 157
1237 3300046664 Ga0495659_0291515 Ga0495659_0291515_24_503 157
1238 3300046665 Ga0495661_0022811 Ga0495661_0022811_144_620 157
1239 3300046665 Ga0495661_0060721 Ga0495661_0060721_877_1356 157
1240 3300046665 Ga0495661_0175220 Ga0495661_0175220_498_977 157
1241 3300046674 Ga0495588_0013498 Ga0495588_0013498_2266_2745 157
1242 3300046674 Ga0495588_0045184 Ga0495588_0045184_1527_2006 157
1243 3300046674 Ga0495588_0079305 Ga0495588_0079305_851_1330 157
1244 3300046674 Ga0495588_0163724 Ga0495588_0163724_67_546 157
1245 3300046674 Ga0495588_0360871 Ga0495588_0360871_185_664 157
1246 3300046675 Ga0495657_0450986 Ga0495657_0450986_220_696 157
1247 3300046679 Ga0495623_0131306 Ga0495623_0131306_156_635 157
1248 3300046679 Ga0495623_0246794 Ga0495623_0246794_328_804 157
1249 3300046679 Ga0495623_0615013 Ga0495623_0615013_50_526 157
1250 3300046683 Ga0495658_0055078 Ga0495658_0055078_1604_2080 157
1251 3300046683 Ga0495658_0364847 Ga0495658_0364847_150_626 157
1252 3300046689 Ga0495613_0141044 Ga0495613_0141044_515_994 157
1253 3300046690 Ga0495624_0019960 Ga0495624_0019960_487_966 157
1254 3300046691 Ga0495670_0033139 Ga0495670_0033139_434_913 157
1255 3300046691 Ga0495670_0093245 Ga0495670_0093245_623_1102 157
1256 3300046691 Ga0495670_0304018 Ga0495670_0304018_322_801 157
1257 3300046691 Ga0495670_0414410 Ga0495670_0414410_85_564 157
1258 3300046692 Ga0495671_0063655 Ga0495671_0063655_67_546 157
1259 3300046692 Ga0495671_0066395 Ga0495671_0066395_457_936 157
1260 3300046694 Ga0495649_0103008 Ga0495649_0103008_167_643 157
1261 3300046694 Ga0495649_0351971 Ga0495649_0351971_74_553 157
1262 3300046809 Ga0495600_0012680 Ga0495600_0012680_2590_3069 157
1263 3300047315 Ga0495581_0048836 Ga0495581_0048836_417_896 157
1264 3300047315 Ga0495581_0049215 Ga0495581_0049215_691_1170 157
1265 3300047315 Ga0495581_0059618 Ga0495581_0059618_1335_1814 157
1266 3300047315 Ga0495581_0067339 Ga0495581_0067339_1578_2054 157
1267 3300047315 Ga0495581_0305727 Ga0495581_0305727_376_855 157
1268 3300047317 Ga0495604_0254824 Ga0495604_0254824_27_506 157
1269 3300047317 Ga0495604_0267923 Ga0495604_0267923_159_635 157
1270 3300047317 Ga0495604_0430012 Ga0495604_0430012_351_830 157
1271 3300047318 Ga0495636_0005023 Ga0495636_0005023_3827_4306 157
1272 3300047318 Ga0495636_0051454 Ga0495636_0051454_677_1156 157
1273 3300047318 Ga0495636_0084804 Ga0495636_0084804_834_1313 157
1274 3300047318 Ga0495636_0326516 Ga0495636_0326516_157_636 157
1275 3300047319 Ga0495674_0104908 Ga0495674_0104908_552_1028 157
1276 3300047319 Ga0495674_0106139 Ga0495674_0106139_1287_1766 157
1277 3300047320 Ga0495672_0000031 Ga0495672_0000031_110727_111302 157
1278 3300047320 Ga0495672_0321717 Ga0495672_0321717_130_612 157
1279 3300047321 Ga0495676_0071155 Ga0495676_0071155_2038_2517 157
1280 3300047321 Ga0495676_0102200 Ga0495676_0102200_598_1077 157
1281 3300047321 Ga0495676_0373360 Ga0495676_0373360_229_708 157
1282 3300047321 Ga0495676_0810652 Ga0495676_0810652_100_579 157
1283 3300047323 Ga0495683_0118858 Ga0495683_0118858_514_993 157
1284 3300047443 Ga0495687_022051 Ga0495687_022051_189_665 157
1285 3300047444 Ga0495675_0175213 Ga0495675_0175213_709_1188 157
1286 3300047444 Ga0495675_0406157 Ga0495675_0406157_172_648 157
1287 3300047445 Ga0495677_0328872 Ga0495677_0328872_49_528 157
1288 3300047447 Ga0495685_026444 Ga0495685_026444_414_893 157
1289 3300047447 Ga0495685_093592 Ga0495685_093592_263_742 157
1290 3300047469 Ga0495673_0000028 Ga0495673_0000028_63584_64060 157
1291 3300047470 Ga0495681_0036098 Ga0495681_0036098_928_1407 157
1292 3300047470 Ga0495681_0055838 Ga0495681_0055838_650_1129 157
1293 3300047471 Ga0495684_0048834 Ga0495684_0048834_982_1458 157
1294 3300047472 Ga0495686_0045612 Ga0495686_0045612_1221_1700 157
1295 3300047673 Ga0495593_0129475 Ga0495593_0129475_459_938 157
1296 3300047673 Ga0495593_0245510 Ga0495593_0245510_28_507 157
1297 3300048088 Ga0495602_0194167 Ga0495602_0194167_794_1270 157
1298 3300048088 Ga0495602_0295523 Ga0495602_0295523_681_1160 157
1299 3300048089 Ga0495614_0080005 Ga0495614_0080005_783_1259 157
1300 3300048089 Ga0495614_0186307 Ga0495614_0186307_391_870 157
1301 3300048090 Ga0495615_0041128 Ga0495615_0041128_332_811 157
1302 3300048091 Ga0495626_0005379 Ga0495626_0005379_3069_3548 157
1303 3300048903 Ga0496100_0030264 Ga0496100_0030264_174_650 157
1304 3300048903 Ga0496100_0058178 Ga0496100_0058178_148_624 157
1305 3300048903 Ga0496100_0245245 Ga0496100_0245245_281_757 157
1306 3300048903 Ga0496100_0927713 Ga0496100_0927713_73_549 157
1307 3300048904 Ga0496101_0044130 Ga0496101_0044130_540_1016 157
1308 3300048904 Ga0496101_0114312 Ga0496101_0114312_868_1344 157
1309 3300048904 Ga0496101_0164657 Ga0496101_0164657_93_569 157
1310 3300048905 Ga0496102_0000166 Ga0496102_0000166_3168_3647 157
1311 3300048905 Ga0496102_0043495 Ga0496102_0043495_2954_3433 157
1312 3300048905 Ga0496102_0165660 Ga0496102_0165660_354_833 157
1313 3300048905 Ga0496102_0463421 Ga0496102_0463421_543_1022 157
1314 3300048906 Ga0496103_0014421 Ga0496103_0014421_1655_2134 157
1315 3300048906 Ga0496103_0035137 Ga0496103_0035137_297_773 157
1316 3300048907 Ga0496104_0011806 Ga0496104_0011806_882_1358 157
1317 3300048907 Ga0496104_0348537 Ga0496104_0348537_378_854 157
1318 3300048908 Ga0496105_0137128 Ga0496105_0137128_1140_1616 157
1319 3300048909 Ga0496106_0037440 Ga0496106_0037440_2526_3002 157
1320 3300048909 Ga0496106_0518710 Ga0496106_0518710_32_511 157
1321 3300048909 Ga0496106_0748867 Ga0496106_0748867_226_702 157
1322 3300048909 Ga0496106_1019680 Ga0496106_1019680_104_580 157
1323 3300048910 Ga0496107_0008333 Ga0496107_0008333_5739_6215 157
1324 3300048910 Ga0496107_0110601 Ga0496107_0110601_1176_1652 157
1325 3300048910 Ga0496107_0385055 Ga0496107_0385055_495_971 157
1326 3300048911 Ga0496108_0049209 Ga0496108_0049209_628_1104 157
1327 3300048911 Ga0496108_0373266 Ga0496108_0373266_73_549 157
1328 3300048911 Ga0496108_0665374 Ga0496108_0665374_315_791 157
1329 3300048912 Ga0496109_0005807 Ga0496109_0005807_3058_3534 157
1330 3300048912 Ga0496109_0102125 Ga0496109_0102125_1575_2051 157
1331 3300048912 Ga0496109_0108227 Ga0496109_0108227_826_1302 157
1332 3300048912 Ga0496109_0559998 Ga0496109_0559998_155_631 157
1333 3300048913 Ga0496110_0060817 Ga0496110_0060817_940_1416 157
1334 3300048914 Ga0496111_0009592 Ga0496111_0009592_5415_5891 157
1335 3300048914 Ga0496111_0055656 Ga0496111_0055656_608_1084 157
1336 3300048915 Ga0496112_0033696 Ga0496112_0033696_721_1197 157
1337 3300048915 Ga0496112_0952363 Ga0496112_0952363_289_765 157
1338 3300048916 Ga0496113_0091492 Ga0496113_0091492_1353_1829 157
1339 3300048916 Ga0496113_1324230 Ga0496113_1324230_56_532 157
1340 3300048916 Ga0496113_1420521 Ga0496113_1420521_30_506 157
1341 3300048917 Ga0496114_0011526 Ga0496114_0011526_6084_6560 157
1342 3300048917 Ga0496114_0041652 Ga0496114_0041652_2441_2917 157
1343 3300048917 Ga0496114_0095236 Ga0496114_0095236_1453_1929 157
1344 3300048917 Ga0496114_0212790 Ga0496114_0212790_1077_1553 157
1345 3300048918 Ga0496115_0078080 Ga0496115_0078080_1850_2329 157
1346 3300048918 Ga0496115_0093660 Ga0496115_0093660_587_1066 157
1347 3300048918 Ga0496115_0098112 Ga0496115_0098112_1571_2050 157
1348 3300048918 Ga0496115_0217993 Ga0496115_0217993_56_532 157
1349 3300048918 Ga0496115_0267873 Ga0496115_0267873_820_1299 157
1350 3300048918 Ga0496115_0270790 Ga0496115_0270790_166_642 157
1351 3300048918 Ga0496115_0282430 Ga0496115_0282430_275_751 157
1352 3300048918 Ga0496115_0454362 Ga0496115_0454362_389_868 157
1353 3300048918 Ga0496115_0462476 Ga0496115_0462476_315_794 157
1354 3300048919 Ga0496116_0044500 Ga0496116_0044500_1567_2049 157
1355 3300048921 Ga0496118_0059002 Ga0496118_0059002_156_638 157
1356 3300048924 Ga0496121_0051062 Ga0496121_0051062_2006_2488 157
1357 3300048924 Ga0496121_0193253 Ga0496121_0193253_678_1160 157
1358 3300048924 Ga0496121_0596685 Ga0496121_0596685_145_627 157
1359 3300048925 Ga0496122_0038511 Ga0496122_0038511_2366_2848 157
1360 3300048926 Ga0496123_0018844 Ga0496123_0018844_2358_2840 157
1361 3300048927 Ga0496124_0206378 Ga0496124_0206378_367_843 157
1362 3300048928 Ga0496125_0041078 Ga0496125_0041078_889_1371 157
1363 3300048928 Ga0496125_0243330 Ga0496125_0243330_561_1043 157
1364 3300049130 Ga0501310_009961 Ga0501310_009961_149_631 157
1365 3300049161 Ga0501305_022539 Ga0501305_022539_11_493 157
1366 3300049459 Ga0495678_002684 Ga0495678_002684_2257_2736 157
1367 3300049459 Ga0495678_017933 Ga0495678_017933_2332_2811 157
1368 3300049513 Ga0501290_013158 Ga0501290_013158_158_634 157
1369 3300049528 Ga0501312_065007 Ga0501312_065007_73_552 157
1370 3300049529 Ga0501313_042918 Ga0501313_042918_11_487 157
1371 3300049539 Ga0501323_013047 Ga0501323_013047_507_986 157
1372 3300049569 Ga0501032_0003171 Ga0501032_0003171_5807_6283 157
1373 3300049571 Ga0501034_0009859 Ga0501034_0009859_5647_6123 157
1374 3300049571 Ga0501034_0114782 Ga0501034_0114782_499_975 157
1375 3300049574 Ga0501038_0007948 Ga0501038_0007948_8941_9417 157
1376 3300049582 Ga0501048_0884975 Ga0501048_0884975_123_599 157
1377 3300049583 Ga0501067_0302894 Ga0501067_0302894_329_805 157
1378 3300049592 Ga0501076_0387328 Ga0501076_0387328_429_905 157
1379 3300049671 Ga0501238_004953 Ga0501238_004953_288_764 157
1380 3300049673 Ga0501240_058404 Ga0501240_058404_95_574 157
1381 3300049766 Ga0501269_005909 Ga0501269_005909_704_1186 157
1382 3300049822 Ga0501035_0036589 Ga0501035_0036589_748_1224 157
1383 3300049822 Ga0501035_0443727 Ga0501035_0443727_84_560 157
1384 3300049823 Ga0501044_0812920 Ga0501044_0812920_38_514 157
1385 3300050511 nmdc:mga08y16_98284_c1 nmdc:mga08y16_98284_c1_316_792 157
1386 3300050512 nmdc:mga0n895_382601_c1 nmdc:mga0n895_382601_c1_282_758 157
1387 3300050513 nmdc:mga0rr50_128334_c1 nmdc:mga0rr50_128334_c1_1205_1681 157
1388 3300050513 nmdc:mga0rr50_76770_c1 nmdc:mga0rr50_76770_c1_941_1417 157
1389 3300050515 nmdc:mga0a205_194502_c1 nmdc:mga0a205_194502_c1_256_786 157
1390 3300053078 Ga0495612_0318104 Ga0495612_0318104_190_666 157
1391 3300053084 Ga0495595_0097296 Ga0495595_0097296_880_1356 157
1392 3300053084 Ga0495595_0168686 Ga0495595_0168686_290_766 157
1393 3300053085 Ga0495619_0235247 Ga0495619_0235247_676_1152 157
1394 3300053125 Ga0500618_006829 Ga0500618_006829_2057_2533 157
1395 3300053149 Ga0500600_0006158 Ga0500600_0006158_433_954 157
1396 3300053156 Ga0500622_0000002 Ga0500622_0000002_546933_547409 157
1397 3300059510 Ga0587090_004715 Ga0587090_004715_966_1442 157
1398 3300059639 Ga0587062_043488 Ga0587062_043488_58_534 157
1399 3300060346 Ga0587111_0003898 Ga0587111_0003898_1410_1886 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

104

180

0.98

PF03449

GreA_GreB_N

Transcription elongation factor, N-terminal

25

95

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1grj-assembly1.cif.gz_A grea transcript cleavage factor from escherichia coli 0.9625 3 157
1grj-assembly1.cif.gz_A grea transcript cleavage factor from escherichia coli 0.9501 3 157
3ta8-assembly1.cif.gz_A crystal structure hp-nap from strain ys39 iron loaded (cocrystallization 5mm) 0.9306 11 68
1ji4-assembly1.cif.gz_A nap protein from helicobacter pylori 0.9238 14 68
4pju-assembly1.cif.gz_A crystal structure of human stromal antigen 2 (sa2) in complex with sister chromatid cohesion protein 1 (scc1) 0.922 13 70
ID Description Score Start End Superfamily
af_P0A6W5_1_75_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9999 1 74 1.10.287.180
1grjA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9854 3 74 1.10.287.180
1grjA02 Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain 0.9817 75 157 3.10.50.30
af_P0A6W5_1_75_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9736 1 74 1.10.287.180
1grjA02 Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain 0.9693 75 157 3.10.50.30
ID Description Score Start End GO Terms
AF-A0A3C1WF27-F1-model_v4 Transcription elongation factor GreA 0.9946 86 157 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A2A7U692-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9904 1 157 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A233RI48-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9894 1 157 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A090V2Y6-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9858 1 157 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A2T3K4A0-F1-model_v4 deleted 0.9854 1 157

Feature Viewer

pLDDT pTM Quality
93.05 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map