F493656
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1399 | 539 | 1346 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10156105|Ga0105251_101561051 |
| Length | 181 |
| Sequence | MSQQPYGASHTKVPHFFVESFMSTVPITKYGAELLKEELQRLKTKERPAVINAIAEARAQGDLSENAEYDAAKERQAFIEGRIADLEGKLGSSLVVDPATLSSGADGRVVFAATVDLENLDSGEKVTYQIVGIDEADIKVSKVSVTSPIARALIGKSAGDVVAVEAPSGVREYEILEVRYV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 4 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 5 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 6 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 7 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 8 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 9 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 10 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 11 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 12 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 13 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 14 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 15 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 16 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 17 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 18 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 19 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 20 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 21 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 22 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 23 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 24 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 25 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 26 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 27 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 28 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 29 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 30 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 31 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 32 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 33 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 34 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 35 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 36 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 37 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 38 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 39 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 40 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 41 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 42 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 43 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 44 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 45 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 46 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 47 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 48 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 49 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 50 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 51 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 52 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 53 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 54 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 55 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 56 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 57 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 58 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 59 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 60 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 61 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 62 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 63 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 64 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 65 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 66 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 67 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 68 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 73 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 75 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 80 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 82 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 83 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 90 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 94 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 103 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 118 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 119 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 124 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 126 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 134 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 136 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 137 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 138 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 140 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 141 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 142 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 143 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 144 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 145 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 146 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 147 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 150 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 151 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 153 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 154 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 155 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 156 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 157 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 158 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 159 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 161 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 162 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 163 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 189 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 193 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 194 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 195 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 197 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 198 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 199 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 209 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 210 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 213 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 218 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 219 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 274 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 275 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 278 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 279 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 280 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 281 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 282 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 283 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 284 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 285 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 286 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 287 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 288 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 289 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 290 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 292 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 293 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 294 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 295 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 296 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 297 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 298 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 302 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 304 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 305 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 307 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 308 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 310 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 311 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 312 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 313 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 315 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 316 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 317 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 318 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 319 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 320 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 323 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 324 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 325 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 326 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 327 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 328 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 329 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 330 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 331 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 332 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 333 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 334 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 335 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 336 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 337 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 338 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 339 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 340 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 341 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 342 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 343 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 344 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 345 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 346 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 347 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 348 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 349 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 350 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 351 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 352 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 353 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 354 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 355 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 454 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 455 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 456 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 457 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 458 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 459 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 460 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 461 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 462 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 463 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 464 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 465 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 466 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 467 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 468 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 469 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 470 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 471 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 472 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 473 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 474 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 475 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 476 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 477 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 478 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 485 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 501 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 502 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 503 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 504 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 507 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 508 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 515 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 520 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 521 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 522 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 523 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 524 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 525 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.5 |
| Metatranscriptomes | 2.72 |
| Isolates | 3.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4 |
| Nodule | 0.36 |
| Rhizoplane | 5.65 |
| Rhizosphere | 83.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2009666 | 2162886007 | Bacteria | 1204 |
| 2 | JGI24740J21852_10018967 | 3300001979 | Bacteria | 2430 |
| 3 | JGI24739J22299_10013783 | 3300001989 | Bacteria | 2947 |
| 4 | JGI25155J39150_1000275 | 3300002704 | Bacteria | 18778 |
| 5 | JGI25155J39150_1001216 | 3300002704 | Bacteria | 2184 |
| 6 | JGI25156J39149_1000654 | 3300002705 | Bacteria | 18946 |
| 7 | JGI25162J39368_1000091 | 3300002737 | Bacteria | 101521 |
| 8 | JGI25162J39368_1002877 | 3300002737 | Bacteria | 5921 |
| 9 | JGI25154J39366_1001008 | 3300002738 | Bacteria | 11332 |
| 10 | JGI25154J39366_1001607 | 3300002738 | Bacteria | 7679 |
| 11 | JGI25157J39369_1000620 | 3300002741 | Bacteria | 20062 |
| 12 | JGI25159J45721_1013111 | 3300002987 | Bacteria | 1937 |
| 13 | Ga0006759J45824_1054708 | 3300003163 | Bacteria | 591 |
| 14 | Ga0006759J45824_1099236 | 3300003163 | Bacteria | 583 |
| 15 | JGI25165J46597_1000172 | 3300003214 | Bacteria | 101521 |
| 16 | JGI25160J50197_1016729 | 3300003354 | Bacteria | 2351 |
| 17 | Ga0007410J51695_1045428 | 3300003574 | Bacteria | 1430 |
| 18 | Ga0007410J51695_1053832 | 3300003574 | Bacteria | 698 |
| 19 | Ga0007409J51694_1018198 | 3300003575 | Bacteria | 1831 |
| 20 | Ga0007409J51694_1022844 | 3300003575 | Bacteria | 1960 |
| 21 | Ga0007416J51690_1014475 | 3300003577 | Bacteria | 7645 |
| 22 | Ga0032354_1019193 | 3300003693 | Bacteria | 5336 |
| 23 | Ga0055538_1000063 | 3300003751 | Bacteria | 101521 |
| 24 | Ga0055539_1000018 | 3300003752 | Bacteria | 348596 |
| 25 | Ga0055539_1000096 | 3300003752 | Bacteria | 101521 |
| 26 | Ga0055533_1000022 | 3300003756 | Bacteria | 348596 |
| 27 | Ga0055533_1000107 | 3300003756 | Bacteria | 101521 |
| 28 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 29 | Ga0055525_1000024 | 3300003759 | Bacteria | 348596 |
| 30 | Ga0055525_1000047 | 3300003759 | Bacteria | 261507 |
| 31 | Ga0055525_1000140 | 3300003759 | Bacteria | 101521 |
| 32 | Ga0055535_1008032 | 3300003761 | Bacteria | 1945 |
| 33 | Ga0055529_1000125 | 3300003763 | Bacteria | 110810 |
| 34 | Ga0055526_1006167 | 3300003771 | Bacteria | 6597 |
| 35 | Ga0055537_1047078 | 3300003773 | Bacteria | 502 |
| 36 | Ga0055541_1000013 | 3300003841 | Bacteria | 348596 |
| 37 | Ga0055541_1000064 | 3300003841 | Bacteria | 101521 |
| 38 | Ga0065165_1004294 | 3300005262 | Bacteria | 8974 |
| 39 | Ga0065714_10011408 | 3300005288 | Bacteria | 2171 |
| 40 | Ga0065714_10014940 | 3300005288 | Bacteria | 2206 |
| 41 | Ga0065704_10411895 | 3300005289 | Bacteria | 741 |
| 42 | Ga0065715_10011527 | 3300005293 | Bacteria | 2683 |
| 43 | Ga0065707_10947712 | 3300005295 | Bacteria | 552 |
| 44 | Ga0070658_10125326 | 3300005327 | Bacteria | 2137 |
| 45 | Ga0070676_10298056 | 3300005328 | Bacteria | 1092 |
| 46 | Ga0070683_100196994 | 3300005329 | Bacteria | 1913 |
| 47 | Ga0070690_100004194 | 3300005330 | Bacteria | 7972 |
| 48 | Ga0070670_100027159 | 3300005331 | Bacteria | 4924 |
| 49 | Ga0068869_100214337 | 3300005334 | Bacteria | 1524 |
| 50 | Ga0068869_100240972 | 3300005334 | Bacteria | 1441 |
| 51 | Ga0068869_100393022 | 3300005334 | Bacteria | 1139 |
| 52 | Ga0070666_10004984 | 3300005335 | Bacteria | 8120 |
| 53 | Ga0070666_10083494 | 3300005335 | Bacteria | 2185 |
| 54 | Ga0070680_100373284 | 3300005336 | Bacteria | 1214 |
| 55 | Ga0070682_100036629 | 3300005337 | Bacteria | 3000 |
| 56 | Ga0070682_100039649 | 3300005337 | Bacteria | 2895 |
| 57 | Ga0070682_100267747 | 3300005337 | Bacteria | 1240 |
| 58 | Ga0068868_100015599 | 3300005338 | Bacteria | 5624 |
| 59 | Ga0068868_100043085 | 3300005338 | Bacteria | 3525 |
| 60 | Ga0070660_100002183 | 3300005339 | Bacteria | 13491 |
| 61 | Ga0070660_100048636 | 3300005339 | Bacteria | 3257 |
| 62 | Ga0070660_100648097 | 3300005339 | Bacteria | 884 |
| 63 | Ga0070689_100001985 | 3300005340 | Bacteria | 13248 |
| 64 | Ga0070661_100002329 | 3300005344 | Bacteria | 13040 |
| 65 | Ga0070692_10046908 | 3300005345 | Bacteria | 2235 |
| 66 | Ga0070668_101048454 | 3300005347 | Bacteria | 734 |
| 67 | Ga0070671_100092462 | 3300005355 | Bacteria | 2534 |
| 68 | Ga0070671_100234181 | 3300005355 | Bacteria | 1558 |
| 69 | Ga0070674_100001678 | 3300005356 | Bacteria | 11972 |
| 70 | Ga0070673_100000865 | 3300005364 | Bacteria | 17026 |
| 71 | Ga0070688_100007255 | 3300005365 | Bacteria | 5971 |
| 72 | Ga0070659_100001265 | 3300005366 | Bacteria | 18344 |
| 73 | Ga0070659_100090041 | 3300005366 | Bacteria | 2458 |
| 74 | Ga0070659_100710655 | 3300005366 | Bacteria | 869 |
| 75 | Ga0070667_100003642 | 3300005367 | Bacteria | 13114 |
| 76 | Ga0070667_100064885 | 3300005367 | Bacteria | 3099 |
| 77 | Ga0070703_10033713 | 3300005406 | Bacteria | 1560 |
| 78 | Ga0070703_10199612 | 3300005406 | Bacteria | 784 |
| 79 | Ga0070709_10027578 | 3300005434 | Bacteria | 3378 |
| 80 | Ga0070709_10236133 | 3300005434 | Bacteria | 1310 |
| 81 | Ga0070709_10496062 | 3300005434 | Bacteria | 927 |
| 82 | Ga0070714_100147756 | 3300005435 | Bacteria | 2115 |
| 83 | Ga0070713_100004316 | 3300005436 | Bacteria | 9531 |
| 84 | Ga0070713_100007320 | 3300005436 | Bacteria | 7732 |
| 85 | Ga0070713_101176746 | 3300005436 | Bacteria | 742 |
| 86 | Ga0070710_10069751 | 3300005437 | Bacteria | 2023 |
| 87 | Ga0070710_10124430 | 3300005437 | Bacteria | 1565 |
| 88 | Ga0070710_10166235 | 3300005437 | Bacteria | 1371 |
| 89 | Ga0070711_100001521 | 3300005439 | Bacteria | 12781 |
| 90 | Ga0070711_100009545 | 3300005439 | Bacteria | 5984 |
| 91 | Ga0070705_100003694 | 3300005440 | Bacteria | 7493 |
| 92 | Ga0070694_100599341 | 3300005444 | Bacteria | 887 |
| 93 | Ga0070708_100311262 | 3300005445 | Bacteria | 1483 |
| 94 | Ga0070708_100565776 | 3300005445 | Bacteria | 1072 |
| 95 | Ga0070663_100161556 | 3300005455 | Bacteria | 1725 |
| 96 | Ga0070663_100167050 | 3300005455 | Bacteria | 1698 |
| 97 | Ga0070678_100004401 | 3300005456 | Bacteria | 7980 |
| 98 | Ga0070678_100057112 | 3300005456 | Bacteria | 2858 |
| 99 | Ga0070662_100003578 | 3300005457 | Bacteria | 9693 |
| 100 | Ga0070662_100228550 | 3300005457 | Bacteria | 1487 |
| 101 | Ga0070662_100306045 | 3300005457 | Bacteria | 1292 |
| 102 | Ga0070662_100624662 | 3300005457 | Bacteria | 907 |
| 103 | Ga0068867_100021691 | 3300005459 | Bacteria | 4583 |
| 104 | Ga0068867_100554608 | 3300005459 | Bacteria | 996 |
| 105 | Ga0070685_10016600 | 3300005466 | Bacteria | 3927 |
| 106 | Ga0070706_100007439 | 3300005467 | Bacteria | 10269 |
| 107 | Ga0070706_100196877 | 3300005467 | Bacteria | 1882 |
| 108 | Ga0070707_100026857 | 3300005468 | Bacteria | 5470 |
| 109 | Ga0070707_100809908 | 3300005468 | Bacteria | 900 |
| 110 | Ga0070707_100977031 | 3300005468 | Bacteria | 812 |
| 111 | Ga0070698_100107855 | 3300005471 | Bacteria | 2752 |
| 112 | Ga0070699_100004740 | 3300005518 | Bacteria | 12019 |
| 113 | Ga0070699_100013389 | 3300005518 | Bacteria | 7067 |
| 114 | Ga0070699_100207883 | 3300005518 | Bacteria | 1742 |
| 115 | Ga0070679_100065686 | 3300005530 | Bacteria | 3616 |
| 116 | Ga0070679_101153528 | 3300005530 | Bacteria | 720 |
| 117 | Ga0070697_100064107 | 3300005536 | Bacteria | 3001 |
| 118 | Ga0070697_100083105 | 3300005536 | Bacteria | 2640 |
| 119 | Ga0068853_100136981 | 3300005539 | Bacteria | 2195 |
| 120 | Ga0070672_100087313 | 3300005543 | Bacteria | 2510 |
| 121 | Ga0070686_100018101 | 3300005544 | Bacteria | 4129 |
| 122 | Ga0070695_100291793 | 3300005545 | Bacteria | 1202 |
| 123 | Ga0070695_100399192 | 3300005545 | Bacteria | 1042 |
| 124 | Ga0070696_100016414 | 3300005546 | Bacteria | 4986 |
| 125 | Ga0070696_100664883 | 3300005546 | Bacteria | 846 |
| 126 | Ga0070693_100002246 | 3300005547 | Bacteria | 8864 |
| 127 | Ga0070693_100586533 | 3300005547 | Bacteria | 803 |
| 128 | Ga0070665_100003995 | 3300005548 | Bacteria | 15556 |
| 129 | Ga0070704_100054101 | 3300005549 | Bacteria | 2839 |
| 130 | Ga0068855_100000037 | 3300005563 | Bacteria | 158161 |
| 131 | Ga0068855_100019104 | 3300005563 | Bacteria | 8235 |
| 132 | Ga0068855_100020817 | 3300005563 | Bacteria | 7864 |
| 133 | Ga0068855_100365741 | 3300005563 | Bacteria | 1586 |
| 134 | Ga0070664_101144409 | 3300005564 | Bacteria | 733 |
| 135 | Ga0068857_100387580 | 3300005577 | Bacteria | 1298 |
| 136 | Ga0068857_100824397 | 3300005577 | Bacteria | 887 |
| 137 | Ga0068854_100004704 | 3300005578 | Bacteria | 8605 |
| 138 | Ga0068854_100004957 | 3300005578 | Bacteria | 8391 |
| 139 | Ga0068854_100099655 | 3300005578 | Bacteria | 2176 |
| 140 | Ga0068854_100465311 | 3300005578 | Bacteria | 1059 |
| 141 | Ga0068856_100058353 | 3300005614 | Bacteria | 3811 |
| 142 | Ga0068856_100234204 | 3300005614 | Bacteria | 1852 |
| 143 | Ga0068856_100538641 | 3300005614 | Bacteria | 1189 |
| 144 | Ga0068856_100830858 | 3300005614 | Bacteria | 943 |
| 145 | Ga0070702_100004699 | 3300005615 | Bacteria | 6265 |
| 146 | Ga0070702_100040445 | 3300005615 | Bacteria | 2609 |
| 147 | Ga0070702_100161199 | 3300005615 | Bacteria | 1450 |
| 148 | Ga0070702_100176951 | 3300005615 | Bacteria | 1393 |
| 149 | Ga0068852_100057370 | 3300005616 | Bacteria | 3369 |
| 150 | Ga0068859_100101205 | 3300005617 | Bacteria | 2938 |
| 151 | Ga0068859_100512453 | 3300005617 | Bacteria | 1295 |
| 152 | Ga0068864_100006955 | 3300005618 | Bacteria | 9278 |
| 153 | Ga0068866_10001499 | 3300005718 | Bacteria | 9943 |
| 154 | Ga0068866_10079945 | 3300005718 | Bacteria | 1753 |
| 155 | Ga0068861_100822906 | 3300005719 | Bacteria | 873 |
| 156 | Ga0068851_10511969 | 3300005834 | Bacteria | 721 |
| 157 | Ga0068863_100004894 | 3300005841 | Bacteria | 13198 |
| 158 | Ga0068858_100049032 | 3300005842 | Bacteria | 3911 |
| 159 | Ga0068858_100080949 | 3300005842 | Bacteria | 3018 |
| 160 | Ga0070717_10225840 | 3300006028 | Bacteria | 1647 |
| 161 | Ga0070717_10623054 | 3300006028 | Bacteria | 979 |
| 162 | Ga0070715_10010540 | 3300006163 | Bacteria | 3298 |
| 163 | Ga0070715_10019155 | 3300006163 | Bacteria | 2619 |
| 164 | Ga0070712_100004888 | 3300006175 | Bacteria | 8286 |
| 165 | Ga0070712_100089940 | 3300006175 | Bacteria | 2247 |
| 166 | Ga0070712_100214971 | 3300006175 | Bacteria | 1518 |
| 167 | Ga0075366_10528077 | 3300006195 | Bacteria | 730 |
| 168 | Ga0097621_100046101 | 3300006237 | Bacteria | 3525 |
| 169 | Ga0097621_100273988 | 3300006237 | Bacteria | 1484 |
| 170 | Ga0068871_100019735 | 3300006358 | Bacteria | 5150 |
| 171 | Ga0068871_100086114 | 3300006358 | Bacteria | 2610 |
| 172 | Ga0075428_100001737 | 3300006844 | Bacteria | 23250 |
| 173 | Ga0075431_100276628 | 3300006847 | Bacteria | 1700 |
| 174 | Ga0075434_100053373 | 3300006871 | Bacteria | 4017 |
| 175 | Ga0075434_100261086 | 3300006871 | Bacteria | 1751 |
| 176 | Ga0075429_100059174 | 3300006880 | Bacteria | 3337 |
| 177 | Ga0068865_100017695 | 3300006881 | Bacteria | 4587 |
| 178 | Ga0068865_100045549 | 3300006881 | Bacteria | 3007 |
| 179 | Ga0075436_100046190 | 3300006914 | Bacteria | 3004 |
| 180 | Ga0075436_100340341 | 3300006914 | Bacteria | 1080 |
| 181 | Ga0097620_100101201 | 3300006931 | Bacteria | 2938 |
| 182 | Ga0097620_100512459 | 3300006931 | Bacteria | 1295 |
| 183 | Ga0079104_1014796 | 3300006946 | Bacteria | 2340 |
| 184 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 185 | Ga0075435_100084353 | 3300007076 | Bacteria | 2614 |
| 186 | Ga0075435_100332326 | 3300007076 | Bacteria | 1302 |
| 187 | Ga0075435_100946792 | 3300007076 | Bacteria | 751 |
| 188 | Ga0105251_10156105 | 3300009011 | Bacteria | 1029 |
| 189 | Ga0105244_10031110 | 3300009036 | Bacteria | 2834 |
| 190 | Ga0105244_10415334 | 3300009036 | Bacteria | 619 |
| 191 | Ga0105240_10027136 | 3300009093 | Bacteria | 7502 |
| 192 | Ga0105240_10058534 | 3300009093 | Bacteria | 4810 |
| 193 | Ga0105240_10355771 | 3300009093 | Bacteria | 1660 |
| 194 | Ga0105240_10450415 | 3300009093 | Bacteria | 1440 |
| 195 | Ga0111539_10002714 | 3300009094 | Bacteria | 23478 |
| 196 | Ga0111539_10043139 | 3300009094 | Bacteria | 5409 |
| 197 | Ga0105245_10137680 | 3300009098 | Bacteria | 2296 |
| 198 | Ga0105245_10192825 | 3300009098 | Bacteria | 1952 |
| 199 | Ga0105245_10210530 | 3300009098 | Bacteria | 1871 |
| 200 | Ga0105245_10319855 | 3300009098 | Bacteria | 1528 |
| 201 | Ga0105245_10331865 | 3300009098 | Bacteria | 1501 |
| 202 | Ga0105247_10343261 | 3300009101 | Bacteria | 1048 |
| 203 | Ga0114129_10164862 | 3300009147 | Bacteria | 3025 |
| 204 | Ga0105243_10461943 | 3300009148 | Bacteria | 1194 |
| 205 | Ga0105243_10475361 | 3300009148 | Bacteria | 1178 |
| 206 | Ga0105241_10012641 | 3300009174 | Bacteria | 6196 |
| 207 | Ga0105241_10575566 | 3300009174 | Bacteria | 1014 |
| 208 | Ga0105242_10022867 | 3300009176 | Bacteria | 4923 |
| 209 | Ga0105242_10049831 | 3300009176 | Bacteria | 3409 |
| 210 | Ga0105242_11042383 | 3300009176 | Bacteria | 828 |
| 211 | Ga0105248_10001274 | 3300009177 | Bacteria | 28163 |
| 212 | Ga0105248_10274738 | 3300009177 | Bacteria | 1897 |
| 213 | Ga0105237_10094387 | 3300009545 | Bacteria | 2981 |
| 214 | Ga0105237_10203331 | 3300009545 | Bacteria | 1981 |
| 215 | Ga0105237_10231685 | 3300009545 | Bacteria | 1848 |
| 216 | Ga0105237_10314393 | 3300009545 | Bacteria | 1569 |
| 217 | Ga0105237_10477637 | 3300009545 | Bacteria | 1253 |
| 218 | Ga0105238_10000955 | 3300009551 | Bacteria | 29651 |
| 219 | Ga0105238_10073501 | 3300009551 | Bacteria | 3414 |
| 220 | Ga0105238_10107469 | 3300009551 | Bacteria | 2771 |
| 221 | Ga0105238_10215500 | 3300009551 | Bacteria | 1896 |
| 222 | Ga0105238_10455261 | 3300009551 | Bacteria | 1277 |
| 223 | Ga0105238_10594166 | 3300009551 | Bacteria | 1114 |
| 224 | Ga0105239_10013663 | 3300010375 | Bacteria | 9016 |
| 225 | Ga0105239_10233571 | 3300010375 | Bacteria | 2063 |
| 226 | Ga0105239_10686998 | 3300010375 | Bacteria | 1170 |
| 227 | Ga0105246_10223182 | 3300011119 | Bacteria | 1478 |
| 228 | Ga0105246_10318267 | 3300011119 | Bacteria | 1263 |
| 229 | Ga0105246_10450445 | 3300011119 | Bacteria | 1081 |
| 230 | Ga0157373_10186762 | 3300013100 | Bacteria | 1460 |
| 231 | Ga0157373_10343115 | 3300013100 | Bacteria | 1065 |
| 232 | Ga0157371_10000013 | 3300013102 | Bacteria | 352631 |
| 233 | Ga0157371_10393403 | 3300013102 | Bacteria | 1013 |
| 234 | Ga0157370_10876603 | 3300013104 | Bacteria | 815 |
| 235 | Ga0157369_10145101 | 3300013105 | Bacteria | 2510 |
| 236 | Ga0157374_10005037 | 3300013296 | Bacteria | 11082 |
| 237 | Ga0157374_11424835 | 3300013296 | Bacteria | 716 |
| 238 | Ga0157378_10004389 | 3300013297 | Bacteria | 12416 |
| 239 | Ga0157378_10050117 | 3300013297 | Bacteria | 3715 |
| 240 | Ga0157378_10123878 | 3300013297 | Bacteria | 2386 |
| 241 | Ga0157378_10360338 | 3300013297 | Bacteria | 1423 |
| 242 | Ga0163162_10042566 | 3300013306 | Bacteria | 4546 |
| 243 | Ga0163162_10087689 | 3300013306 | Bacteria | 3191 |
| 244 | Ga0157372_10266332 | 3300013307 | Bacteria | 1990 |
| 245 | Ga0157372_11056103 | 3300013307 | Bacteria | 940 |
| 246 | Ga0157372_11786584 | 3300013307 | Bacteria | 707 |
| 247 | Ga0157375_10086067 | 3300013308 | Bacteria | 3193 |
| 248 | Ga0157375_10696817 | 3300013308 | Bacteria | 1169 |
| 249 | Ga0163163_10031257 | 3300014325 | Bacteria | 5138 |
| 250 | Ga0163163_10186265 | 3300014325 | Bacteria | 2123 |
| 251 | Ga0182008_10016736 | 3300014497 | Bacteria | 3805 |
| 252 | Ga0182008_10019024 | 3300014497 | Bacteria | 3550 |
| 253 | Ga0182008_10173520 | 3300014497 | Bacteria | 1089 |
| 254 | Ga0182008_10233469 | 3300014497 | Bacteria | 944 |
| 255 | Ga0157377_10030450 | 3300014745 | Bacteria | 2924 |
| 256 | Ga0157379_10019373 | 3300014968 | Bacteria | 6009 |
| 257 | Ga0157379_10048413 | 3300014968 | Bacteria | 3794 |
| 258 | Ga0157376_10027516 | 3300014969 | Bacteria | 4508 |
| 259 | Ga0157376_10028649 | 3300014969 | Bacteria | 4429 |
| 260 | Ga0157376_10188151 | 3300014969 | Bacteria | 1891 |
| 261 | Ga0157376_10325238 | 3300014969 | Bacteria | 1463 |
| 262 | Ga0182006_1000035 | 3300015261 | Bacteria | 232349 |
| 263 | Ga0182006_1015816 | 3300015261 | Bacteria | 3227 |
| 264 | Ga0182006_1123458 | 3300015261 | Bacteria | 897 |
| 265 | Ga0182006_1127791 | 3300015261 | Bacteria | 877 |
| 266 | Ga0182007_10000040 | 3300015262 | Bacteria | 120364 |
| 267 | Ga0182007_10008097 | 3300015262 | Bacteria | 4339 |
| 268 | Ga0182007_10025147 | 3300015262 | Bacteria | 2076 |
| 269 | Ga0182007_10025272 | 3300015262 | Bacteria | 2070 |
| 270 | Ga0182005_1000025 | 3300015265 | Bacteria | 235532 |
| 271 | Ga0182005_1008205 | 3300015265 | Bacteria | 3088 |
| 272 | Ga0163161_10025359 | 3300017792 | Bacteria | 4196 |
| 273 | Ga0163161_10125767 | 3300017792 | Bacteria | 1930 |
| 274 | Ga0163161_10439697 | 3300017792 | Bacteria | 1052 |
| 275 | Ga0206354_11479432 | 3300020081 | Bacteria | 669 |
| 276 | Ga0213872_10000442 | 3300021361 | Bacteria | 33971 |
| 277 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 278 | Ga0209760_104093 | 3300025207 | Bacteria | 1264 |
| 279 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 280 | Ga0209784_100079 | 3300025224 | Bacteria | 136351 |
| 281 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 282 | Ga0209566_100093 | 3300025225 | Bacteria | 136351 |
| 283 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 284 | Ga0209674_100115 | 3300025226 | Bacteria | 136351 |
| 285 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 286 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 287 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 288 | Ga0209563_100113 | 3300025230 | Bacteria | 136351 |
| 289 | Ga0207427_100262 | 3300025231 | Bacteria | 40896 |
| 290 | Ga0209437_100176 | 3300025233 | Bacteria | 136351 |
| 291 | Ga0209437_100329 | 3300025233 | Bacteria | 59120 |
| 292 | Ga0209258_100523 | 3300025242 | Bacteria | 36787 |
| 293 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 294 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 295 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 296 | Ga0209026_1001477 | 3300025250 | Bacteria | 10363 |
| 297 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 298 | Ga0209677_100072 | 3300025253 | Bacteria | 136351 |
| 299 | Ga0209677_104819 | 3300025253 | Bacteria | 3732 |
| 300 | Ga0209148_1001634 | 3300025254 | Bacteria | 10288 |
| 301 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 302 | Ga0209759_1000656 | 3300025256 | Bacteria | 32085 |
| 303 | Ga0209233_1000183 | 3300025261 | Bacteria | 136351 |
| 304 | Ga0209565_1022947 | 3300025263 | Bacteria | 1286 |
| 305 | Ga0209455_1000044 | 3300025272 | Bacteria | 410787 |
| 306 | Ga0209675_1014874 | 3300025291 | Bacteria | 2343 |
| 307 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 308 | Ga0209564_1018332 | 3300025295 | Bacteria | 2674 |
| 309 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 310 | Ga0207656_10268669 | 3300025321 | Bacteria | 839 |
| 311 | Ga0207713_1067643 | 3300025735 | Bacteria | 1331 |
| 312 | Ga0207692_10065905 | 3300025898 | Bacteria | 1891 |
| 313 | Ga0207692_10366682 | 3300025898 | Bacteria | 891 |
| 314 | Ga0207642_10006909 | 3300025899 | Bacteria | 3802 |
| 315 | Ga0207642_10038420 | 3300025899 | Bacteria | 2072 |
| 316 | Ga0207680_10203891 | 3300025903 | Bacteria | 1349 |
| 317 | Ga0207685_10008483 | 3300025905 | Bacteria | 2929 |
| 318 | Ga0207685_10094183 | 3300025905 | Bacteria | 1268 |
| 319 | Ga0207699_10030839 | 3300025906 | Bacteria | 3004 |
| 320 | Ga0207699_10204252 | 3300025906 | Bacteria | 1340 |
| 321 | Ga0207699_10439686 | 3300025906 | Bacteria | 934 |
| 322 | Ga0207645_10095689 | 3300025907 | Bacteria | 1912 |
| 323 | Ga0207705_10014245 | 3300025909 | Bacteria | 5726 |
| 324 | Ga0207684_10097803 | 3300025910 | Bacteria | 2506 |
| 325 | Ga0207684_10213069 | 3300025910 | Bacteria | 1666 |
| 326 | Ga0207654_10055339 | 3300025911 | Bacteria | 2296 |
| 327 | Ga0207654_10186779 | 3300025911 | Bacteria | 1356 |
| 328 | Ga0207707_10023430 | 3300025912 | Bacteria | 5400 |
| 329 | Ga0207707_10529626 | 3300025912 | Bacteria | 1003 |
| 330 | Ga0207695_10001485 | 3300025913 | Bacteria | 39195 |
| 331 | Ga0207695_10017853 | 3300025913 | Bacteria | 8223 |
| 332 | Ga0207695_10176575 | 3300025913 | Bacteria | 2058 |
| 333 | Ga0207695_10263151 | 3300025913 | Bacteria | 1622 |
| 334 | Ga0207695_10267304 | 3300025913 | Bacteria | 1606 |
| 335 | Ga0207671_10014534 | 3300025914 | Bacteria | 6215 |
| 336 | Ga0207671_10345078 | 3300025914 | Bacteria | 1180 |
| 337 | Ga0207671_10419490 | 3300025914 | Bacteria | 1065 |
| 338 | Ga0207671_10449138 | 3300025914 | Bacteria | 1027 |
| 339 | Ga0207671_10844774 | 3300025914 | Bacteria | 725 |
| 340 | Ga0207671_11230951 | 3300025914 | Bacteria | 585 |
| 341 | Ga0207693_10000325 | 3300025915 | Bacteria | 44161 |
| 342 | Ga0207693_10007147 | 3300025915 | Bacteria | 9206 |
| 343 | Ga0207693_10027499 | 3300025915 | Bacteria | 4496 |
| 344 | Ga0207693_10311631 | 3300025915 | Bacteria | 1232 |
| 345 | Ga0207663_10022607 | 3300025916 | Bacteria | 3598 |
| 346 | Ga0207663_10174927 | 3300025916 | Bacteria | 1528 |
| 347 | Ga0207660_10229022 | 3300025917 | Bacteria | 1461 |
| 348 | Ga0207657_10000571 | 3300025919 | Bacteria | 39136 |
| 349 | Ga0207657_10003818 | 3300025919 | Bacteria | 16006 |
| 350 | Ga0207649_10013576 | 3300025920 | Bacteria | 4549 |
| 351 | Ga0207649_10292979 | 3300025920 | Bacteria | 1187 |
| 352 | Ga0207652_10362395 | 3300025921 | Bacteria | 1308 |
| 353 | Ga0207652_10702479 | 3300025921 | Bacteria | 902 |
| 354 | Ga0207646_10005342 | 3300025922 | Bacteria | 13532 |
| 355 | Ga0207646_10100336 | 3300025922 | Bacteria | 2595 |
| 356 | Ga0207694_10000783 | 3300025924 | Bacteria | 28558 |
| 357 | Ga0207694_10270813 | 3300025924 | Bacteria | 1393 |
| 358 | Ga0207694_10602158 | 3300025924 | Bacteria | 924 |
| 359 | Ga0207650_10115157 | 3300025925 | Bacteria | 2086 |
| 360 | Ga0207650_10316559 | 3300025925 | Bacteria | 1277 |
| 361 | Ga0207659_10534543 | 3300025926 | Bacteria | 995 |
| 362 | Ga0207687_10128423 | 3300025927 | Bacteria | 1907 |
| 363 | Ga0207687_10234047 | 3300025927 | Bacteria | 1452 |
| 364 | Ga0207687_10341379 | 3300025927 | Bacteria | 1218 |
| 365 | Ga0207687_10451959 | 3300025927 | Bacteria | 1066 |
| 366 | Ga0207700_10182988 | 3300025928 | Bacteria | 1756 |
| 367 | Ga0207700_10547143 | 3300025928 | Bacteria | 1027 |
| 368 | Ga0207644_10026128 | 3300025931 | Bacteria | 4021 |
| 369 | Ga0207644_10177885 | 3300025931 | Bacteria | 1665 |
| 370 | Ga0207690_10000971 | 3300025932 | Bacteria | 18363 |
| 371 | Ga0207690_10039891 | 3300025932 | Bacteria | 3066 |
| 372 | Ga0207690_10212353 | 3300025932 | Bacteria | 1476 |
| 373 | Ga0207706_10011440 | 3300025933 | Bacteria | 8083 |
| 374 | Ga0207706_10323662 | 3300025933 | Bacteria | 1342 |
| 375 | Ga0207706_10630706 | 3300025933 | Bacteria | 919 |
| 376 | Ga0207686_10000118 | 3300025934 | Bacteria | 64531 |
| 377 | Ga0207686_10035088 | 3300025934 | Bacteria | 3008 |
| 378 | Ga0207686_10061717 | 3300025934 | Bacteria | 2377 |
| 379 | Ga0207709_10278864 | 3300025935 | Bacteria | 1234 |
| 380 | Ga0207709_10587787 | 3300025935 | Bacteria | 880 |
| 381 | Ga0207670_10192018 | 3300025936 | Bacteria | 1546 |
| 382 | Ga0207670_10685212 | 3300025936 | Bacteria | 847 |
| 383 | Ga0207669_10071567 | 3300025937 | Bacteria | 2179 |
| 384 | Ga0207704_10036320 | 3300025938 | Bacteria | 2834 |
| 385 | Ga0207704_10042123 | 3300025938 | Bacteria | 2685 |
| 386 | Ga0207704_10395335 | 3300025938 | Bacteria | 1089 |
| 387 | Ga0207665_10008043 | 3300025939 | Bacteria | 6958 |
| 388 | Ga0207665_10011507 | 3300025939 | Bacteria | 5812 |
| 389 | Ga0207691_10122366 | 3300025940 | Bacteria | 2304 |
| 390 | Ga0207711_10140923 | 3300025941 | Bacteria | 2169 |
| 391 | Ga0207711_10204359 | 3300025941 | Bacteria | 1803 |
| 392 | Ga0207711_10442481 | 3300025941 | Bacteria | 1209 |
| 393 | Ga0207711_10549821 | 3300025941 | Bacteria | 1077 |
| 394 | Ga0207689_10271008 | 3300025942 | Bacteria | 1405 |
| 395 | Ga0207679_10003703 | 3300025945 | Bacteria | 9473 |
| 396 | Ga0207667_10000053 | 3300025949 | Bacteria | 226712 |
| 397 | Ga0207667_10010379 | 3300025949 | Bacteria | 10885 |
| 398 | Ga0207667_10041035 | 3300025949 | Bacteria | 4923 |
| 399 | Ga0207667_10066275 | 3300025949 | Bacteria | 3764 |
| 400 | Ga0207651_10040775 | 3300025960 | Bacteria | 3075 |
| 401 | Ga0207651_10627418 | 3300025960 | Bacteria | 942 |
| 402 | Ga0207640_11073868 | 3300025981 | Bacteria | 711 |
| 403 | Ga0207658_10236199 | 3300025986 | Bacteria | 1545 |
| 404 | Ga0207658_10321010 | 3300025986 | Bacteria | 1340 |
| 405 | Ga0207677_10089453 | 3300026023 | Bacteria | 2235 |
| 406 | Ga0207677_10137924 | 3300026023 | Bacteria | 1863 |
| 407 | Ga0207677_10151784 | 3300026023 | Bacteria | 1788 |
| 408 | Ga0207703_10032162 | 3300026035 | Bacteria | 4151 |
| 409 | Ga0207639_10149553 | 3300026041 | Bacteria | 1954 |
| 410 | Ga0207678_10037994 | 3300026067 | Bacteria | 4186 |
| 411 | Ga0207678_10117634 | 3300026067 | Bacteria | 2268 |
| 412 | Ga0207702_10097125 | 3300026078 | Bacteria | 2592 |
| 413 | Ga0207702_10163950 | 3300026078 | Bacteria | 2031 |
| 414 | Ga0207702_10249160 | 3300026078 | Bacteria | 1667 |
| 415 | Ga0207702_10270589 | 3300026078 | Bacteria | 1602 |
| 416 | Ga0207702_10399249 | 3300026078 | Bacteria | 1326 |
| 417 | Ga0207641_10093135 | 3300026088 | Bacteria | 2640 |
| 418 | Ga0207648_10026419 | 3300026089 | Bacteria | 5159 |
| 419 | Ga0207648_10230432 | 3300026089 | Bacteria | 1648 |
| 420 | Ga0207676_10299548 | 3300026095 | Bacteria | 1467 |
| 421 | Ga0207674_10005654 | 3300026116 | Bacteria | 14825 |
| 422 | Ga0207674_10258058 | 3300026116 | Bacteria | 1690 |
| 423 | Ga0207674_10281410 | 3300026116 | Bacteria | 1611 |
| 424 | Ga0207674_10302508 | 3300026116 | Bacteria | 1548 |
| 425 | Ga0207683_10003257 | 3300026121 | Bacteria | 14158 |
| 426 | Ga0207683_10004973 | 3300026121 | Bacteria | 11433 |
| 427 | Ga0207698_10004178 | 3300026142 | Bacteria | 8785 |
| 428 | Ga0207698_10012444 | 3300026142 | Bacteria | 5569 |
| 429 | Ga0207698_10206330 | 3300026142 | Bacteria | 1764 |
| 430 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 431 | Ga0207428_10004868 | 3300027907 | Bacteria | 12660 |
| 432 | Ga0207428_10363892 | 3300027907 | Bacteria | 1063 |
| 433 | Ga0268266_10233330 | 3300028379 | Bacteria | 1695 |
| 434 | Ga0268264_10222767 | 3300028381 | Bacteria | 1737 |
| 435 | Ga0268264_11548598 | 3300028381 | Bacteria | 673 |
| 436 | Ga0316177_1056911 | 3300030731 | Bacteria | 1559 |
| 437 | Ga0316178_1070957 | 3300030735 | Bacteria | 1692 |
| 438 | Ga0316180_1080061 | 3300030736 | Bacteria | 3757 |
| 439 | Ga0316182_1091364 | 3300030745 | Bacteria | 681 |
| 440 | Ga0316182_1138354 | 3300030745 | Bacteria | 643 |
| 441 | Ga0265325_10000262 | 3300031241 | Bacteria | 37299 |
| 442 | Ga0265327_10027789 | 3300031251 | Bacteria | 3249 |
| 443 | Ga0265327_10028337 | 3300031251 | Bacteria | 3206 |
| 444 | Ga0307408_100000294 | 3300031548 | Bacteria | 48528 |
| 445 | Ga0307408_100070573 | 3300031548 | Bacteria | 2579 |
| 446 | Ga0307408_100189269 | 3300031548 | Bacteria | 1657 |
| 447 | Ga0316576_10014395 | 3300031727 | Bacteria | 5286 |
| 448 | Ga0316576_10119002 | 3300031727 | Bacteria | 1983 |
| 449 | Ga0316578_10005843 | 3300031728 | Bacteria | 6017 |
| 450 | Ga0316578_10698694 | 3300031728 | Bacteria | 591 |
| 451 | Ga0307516_10248129 | 3300031730 | Bacteria | 1476 |
| 452 | Ga0307413_10152110 | 3300031824 | Bacteria | 1614 |
| 453 | Ga0307413_10352374 | 3300031824 | Bacteria | 1136 |
| 454 | Ga0307413_10592313 | 3300031824 | Bacteria | 906 |
| 455 | Ga0307518_10028537 | 3300031838 | Bacteria | 4028 |
| 456 | Ga0307410_10091192 | 3300031852 | Bacteria | 2163 |
| 457 | Ga0307410_10168964 | 3300031852 | Bacteria | 1646 |
| 458 | Ga0307412_10026102 | 3300031911 | Bacteria | 3628 |
| 459 | Ga0307412_10661874 | 3300031911 | Bacteria | 892 |
| 460 | Ga0307409_100013944 | 3300031995 | Bacteria | 5202 |
| 461 | Ga0307416_100012770 | 3300032002 | Bacteria | 5677 |
| 462 | Ga0307414_10133833 | 3300032004 | Bacteria | 1929 |
| 463 | Ga0307414_10240273 | 3300032004 | Bacteria | 1499 |
| 464 | Ga0307414_10271035 | 3300032004 | Bacteria | 1421 |
| 465 | Ga0307414_11195266 | 3300032004 | Bacteria | 704 |
| 466 | Ga0307411_10089098 | 3300032005 | Bacteria | 2148 |
| 467 | Ga0307411_10116293 | 3300032005 | Bacteria | 1925 |
| 468 | Ga0307411_10180747 | 3300032005 | Bacteria | 1601 |
| 469 | Ga0307411_10276268 | 3300032005 | Bacteria | 1335 |
| 470 | Ga0316583_10000450 | 3300032133 | Bacteria | 12121 |
| 471 | Ga0316583_10007762 | 3300032133 | Bacteria | 3869 |
| 472 | Ga0316580_10154243 | 3300032139 | Bacteria | 705 |
| 473 | Ga0307507_10059523 | 3300033179 | Bacteria | 3575 |
| 474 | Ga0316592_1003877 | 3300033524 | Bacteria | 2743 |
| 475 | Ga0316592_1005553 | 3300033524 | Bacteria | 2400 |
| 476 | Ga0316587_1028496 | 3300033529 | Bacteria | 980 |
| 477 | Ga0316596_1000002 | 3300033541 | Bacteria | 24681 |
| 478 | Ga0316596_1000007 | 3300033541 | Bacteria | 19350 |
| 479 | Ga0373926_0104149 | 3300035083 | Bacteria | 1063 |
| 480 | Ga0373923_0073468 | 3300035111 | Bacteria | 1472 |
| 481 | Ga0373936_0020708 | 3300035113 | Bacteria | 2556 |
| 482 | Ga0373936_0131451 | 3300035113 | Bacteria | 1076 |
| 483 | Ga0373939_0036290 | 3300035114 | Bacteria | 1457 |
| 484 | Ga0373945_0017368 | 3300035116 | Bacteria | 2436 |
| 485 | Ga0373953_0011867 | 3300035117 | Bacteria | 3070 |
| 486 | Ga0373954_0094093 | 3300035118 | Bacteria | 1441 |
| 487 | Ga0373956_0008504 | 3300035119 | Bacteria | 4154 |
| 488 | Ga0373956_0033825 | 3300035119 | Bacteria | 2249 |
| 489 | Ga0373956_0075954 | 3300035119 | Bacteria | 1537 |
| 490 | Ga0373943_0083321 | 3300035170 | Bacteria | 1643 |
| 491 | Ga0373943_0377635 | 3300035170 | Bacteria | 815 |
| 492 | Ga0373946_0036344 | 3300035171 | Bacteria | 1997 |
| 493 | Ga0373955_0044618 | 3300035172 | Bacteria | 2389 |
| 494 | Ga0373955_0068759 | 3300035172 | Bacteria | 1974 |
| 495 | Ga0316574_0148984 | 3300035398 | Bacteria | 1508 |
| 496 | Ga0373924_0050158 | 3300035410 | Bacteria | 1728 |
| 497 | Ga0373935_0059744 | 3300035692 | Bacteria | 2438 |
| 498 | Ga0373935_0073331 | 3300035692 | Bacteria | 2211 |
| 499 | Ga0373927_0012113 | 3300035695 | Bacteria | 5738 |
| 500 | Ga0373927_0013469 | 3300035695 | Bacteria | 5434 |
| 501 | Ga0373927_0041604 | 3300035695 | Bacteria | 2980 |
| 502 | Ga0373927_0759692 | 3300035695 | Bacteria | 640 |
| 503 | Ga0373927_0904829 | 3300035695 | Bacteria | 582 |
| 504 | Ga0373933_0060334 | 3300035724 | Bacteria | 2286 |
| 505 | Ga0373933_0077401 | 3300035724 | Bacteria | 2033 |
| 506 | Ga0373933_0232091 | 3300035724 | Bacteria | 1185 |
| 507 | Ga0373947_0082116 | 3300035725 | Bacteria | 1997 |
| 508 | Ga0373947_0110948 | 3300035725 | Bacteria | 1733 |
| 509 | Ga0373947_0127072 | 3300035725 | Bacteria | 1624 |
| 510 | Ga0373947_0444702 | 3300035725 | Bacteria | 877 |
| 511 | Ga0373937_0004053 | 3300036401 | Bacteria | 12409 |
| 512 | Ga0373937_0076494 | 3300036401 | Bacteria | 3091 |
| 513 | Ga0373937_0177721 | 3300036401 | Bacteria | 1998 |
| 514 | Ga0373937_0416795 | 3300036401 | Bacteria | 1274 |
| 515 | Ga0316582_0004588 | 3300036647 | Bacteria | 7000 |
| 516 | Ga0316584_0169500 | 3300036712 | Bacteria | 1620 |
| 517 | Ga0316584_0237324 | 3300036712 | Bacteria | 1335 |
| 518 | Ga0373925_0024531 | 3300037068 | Bacteria | 4402 |
| 519 | Ga0373925_0026948 | 3300037068 | Bacteria | 4207 |
| 520 | Ga0373925_0055374 | 3300037068 | Bacteria | 2969 |
| 521 | Ga0395899_0000183 | 3300037312 | Bacteria | 91818 |
| 522 | Ga0395899_0005514 | 3300037312 | Bacteria | 9803 |
| 523 | Ga0395899_0011802 | 3300037312 | Bacteria | 6686 |
| 524 | Ga0395899_0015482 | 3300037312 | Bacteria | 5814 |
| 525 | Ga0395899_0019639 | 3300037312 | Bacteria | 5129 |
| 526 | Ga0395899_0047299 | 3300037312 | Bacteria | 3203 |
| 527 | Ga0395899_0049915 | 3300037312 | Bacteria | 3108 |
| 528 | Ga0395899_0070098 | 3300037312 | Bacteria | 2566 |
| 529 | Ga0395899_0219765 | 3300037312 | Bacteria | 1316 |
| 530 | Ga0395900_0000331 | 3300037418 | Bacteria | 69780 |
| 531 | Ga0395900_0005509 | 3300037418 | Bacteria | 13249 |
| 532 | Ga0395900_0013338 | 3300037418 | Bacteria | 8401 |
| 533 | Ga0395900_0039845 | 3300037418 | Bacteria | 4841 |
| 534 | Ga0395900_0061672 | 3300037418 | Bacteria | 3855 |
| 535 | Ga0395900_0103143 | 3300037418 | Bacteria | 2930 |
| 536 | Ga0395900_0116900 | 3300037418 | Bacteria | 2736 |
| 537 | Ga0395900_0328331 | 3300037418 | Bacteria | 1508 |
| 538 | Ga0395898_0002939 | 3300037466 | Bacteria | 19377 |
| 539 | Ga0395898_0026637 | 3300037466 | Bacteria | 5814 |
| 540 | Ga0395898_0048112 | 3300037466 | Bacteria | 4183 |
| 541 | Ga0395898_0118397 | 3300037466 | Bacteria | 2537 |
| 542 | Ga0395898_0187514 | 3300037466 | Bacteria | 1976 |
| 543 | Ga0395905_0004758 | 3300037471 | Bacteria | 14030 |
| 544 | Ga0395905_0021934 | 3300037471 | Bacteria | 6040 |
| 545 | Ga0395905_0050257 | 3300037471 | Bacteria | 3907 |
| 546 | Ga0395905_0087348 | 3300037471 | Bacteria | 2923 |
| 547 | Ga0395905_0234734 | 3300037471 | Bacteria | 1714 |
| 548 | Ga0395905_0237236 | 3300037471 | Bacteria | 1704 |
| 549 | Ga0395905_0245926 | 3300037471 | Bacteria | 1671 |
| 550 | Ga0395905_0778575 | 3300037471 | Bacteria | 859 |
| 551 | Ga0395901_0000097 | 3300038443 | Bacteria | 118528 |
| 552 | Ga0395901_0009352 | 3300038443 | Bacteria | 9938 |
| 553 | Ga0395901_0030543 | 3300038443 | Bacteria | 5551 |
| 554 | Ga0395901_0201311 | 3300038443 | Bacteria | 2087 |
| 555 | Ga0395901_0236417 | 3300038443 | Bacteria | 1906 |
| 556 | Ga0395901_0314025 | 3300038443 | Bacteria | 1622 |
| 557 | Ga0395901_0427788 | 3300038443 | Bacteria | 1357 |
| 558 | Ga0395901_0553519 | 3300038443 | Bacteria | 1165 |
| 559 | Ga0395901_0553742 | 3300038443 | Bacteria | 1165 |
| 560 | Ga0395901_1443153 | 3300038443 | Bacteria | 645 |
| 561 | Ga0400483_066879 | 3300039062 | Bacteria | 63337 |
| 562 | Ga0400483_146612 | 3300039062 | Bacteria | 1776 |
| 563 | Ga0436360_0890123 | 3300039438 | Bacteria | 653 |
| 564 | Ga0436361_0061503 | 3300039447 | Bacteria | 127805 |
| 565 | Ga0436361_0204853 | 3300039447 | Bacteria | 15869 |
| 566 | Ga0436361_0383429 | 3300039447 | Bacteria | 1349 |
| 567 | Ga0439439_0003713 | 3300041406 | Bacteria | 3387 |
| 568 | Ga0439448_0037833 | 3300042005 | Bacteria | 1551 |
| 569 | Ga0439449_0001658 | 3300042007 | Bacteria | 8745 |
| 570 | Ga0439449_0014317 | 3300042007 | Bacteria | 2981 |
| 571 | Ga0439454_025630 | 3300042011 | Bacteria | 898 |
| 572 | Ga0439455_0040097 | 3300042012 | Bacteria | 1196 |
| 573 | Ga0450904_008348 | 3300042139 | Bacteria | 1022 |
| 574 | Ga0439458_0004250 | 3300042157 | Bacteria | 3305 |
| 575 | Ga0439458_0020540 | 3300042157 | Bacteria | 1525 |
| 576 | Ga0451577_0128327 | 3300042876 | Bacteria | 2274 |
| 577 | Ga0451577_1084677 | 3300042876 | Bacteria | 717 |
| 578 | Ga0451577_1727726 | 3300042876 | Bacteria | 550 |
| 579 | Ga0466969_0439929 | 3300044656 | Bacteria | 593 |
| 580 | Ga0466972_0000275 | 3300044658 | Bacteria | 32437 |
| 581 | Ga0466972_0018121 | 3300044658 | Bacteria | 3522 |
| 582 | Ga0466972_0022289 | 3300044658 | Bacteria | 3154 |
| 583 | Ga0453683_0909240 | 3300044673 | Bacteria | 582 |
| 584 | Ga0466965_0031058 | 3300044683 | Bacteria | 2603 |
| 585 | Ga0466965_0034658 | 3300044683 | Bacteria | 2469 |
| 586 | Ga0466965_0052576 | 3300044683 | Bacteria | 2023 |
| 587 | Ga0466965_0083479 | 3300044683 | Bacteria | 1617 |
| 588 | Ga0466965_0115875 | 3300044683 | Bacteria | 1380 |
| 589 | Ga0466966_0019370 | 3300044684 | Bacteria | 4477 |
| 590 | Ga0466966_0106606 | 3300044684 | Bacteria | 1729 |
| 591 | Ga0466966_0108832 | 3300044684 | Bacteria | 1709 |
| 592 | Ga0466966_0184175 | 3300044684 | Bacteria | 1266 |
| 593 | Ga0466961_0164364 | 3300044693 | Bacteria | 1382 |
| 594 | Ga0466964_0005584 | 3300044706 | Bacteria | 4670 |
| 595 | Ga0466964_0028701 | 3300044706 | Bacteria | 2193 |
| 596 | Ga0466964_0052875 | 3300044706 | Bacteria | 1670 |
| 597 | Ga0466964_0214098 | 3300044706 | Bacteria | 932 |
| 598 | Ga0453684_0005853 | 3300044712 | Bacteria | 23905 |
| 599 | Ga0466971_0022364 | 3300044719 | Bacteria | 2817 |
| 600 | Ga0466971_0137791 | 3300044719 | Bacteria | 1135 |
| 601 | Ga0466971_0680257 | 3300044719 | Bacteria | 516 |
| 602 | Ga0466968_0005700 | 3300044735 | Bacteria | 4667 |
| 603 | Ga0466970_0038578 | 3300044765 | Bacteria | 2534 |
| 604 | Ga0466957_0038618 | 3300044842 | Bacteria | 2877 |
| 605 | Ga0466960_0341790 | 3300044901 | Bacteria | 852 |
| 606 | Ga0466959_0157211 | 3300045049 | Bacteria | 1599 |
| 607 | Ga0466959_0242477 | 3300045049 | Bacteria | 1244 |
| 608 | Ga0466959_0297089 | 3300045049 | Bacteria | 1106 |
| 609 | Ga0466959_0995015 | 3300045049 | Bacteria | 558 |
| 610 | Ga0451576_0002470 | 3300045051 | Bacteria | 27511 |
| 611 | Ga0451576_0168707 | 3300045051 | Bacteria | 2284 |
| 612 | Ga0466958_0337462 | 3300045836 | Bacteria | 969 |
| 613 | Ga0466958_0950990 | 3300045836 | Bacteria | 560 |
| 614 | Ga0466967_0078869 | 3300045976 | Bacteria | 2967 |
| 615 | Ga0466967_0336607 | 3300045976 | Bacteria | 1458 |
| 616 | Ga0495617_000009 | 3300046452 | Bacteria | 312936 |
| 617 | Ga0495617_026010 | 3300046452 | Bacteria | 1971 |
| 618 | Ga0495627_006670 | 3300046453 | Bacteria | 4497 |
| 619 | Ga0495627_058943 | 3300046453 | Bacteria | 1139 |
| 620 | Ga0495592_0047319 | 3300046454 | Bacteria | 3203 |
| 621 | Ga0495603_0037909 | 3300046455 | Bacteria | 2892 |
| 622 | Ga0495603_0042128 | 3300046455 | Bacteria | 2730 |
| 623 | Ga0495603_0178895 | 3300046455 | Bacteria | 1227 |
| 624 | Ga0495590_0000054 | 3300046457 | Bacteria | 100477 |
| 625 | Ga0495590_0043066 | 3300046457 | Bacteria | 1574 |
| 626 | Ga0495590_0050954 | 3300046457 | Bacteria | 1445 |
| 627 | Ga0495590_0402027 | 3300046457 | Bacteria | 525 |
| 628 | Ga0495591_023034 | 3300046458 | Bacteria | 2003 |
| 629 | Ga0495591_026013 | 3300046458 | Bacteria | 1826 |
| 630 | Ga0495629_0122521 | 3300046459 | Bacteria | 1811 |
| 631 | Ga0495629_0291919 | 3300046459 | Bacteria | 1117 |
| 632 | Ga0495629_0442648 | 3300046459 | Bacteria | 880 |
| 633 | Ga0495638_0022607 | 3300046460 | Bacteria | 4126 |
| 634 | Ga0495638_0057841 | 3300046460 | Bacteria | 2404 |
| 635 | Ga0495651_0053029 | 3300046462 | Bacteria | 3123 |
| 636 | Ga0495651_0108525 | 3300046462 | Bacteria | 2055 |
| 637 | Ga0495651_0155360 | 3300046462 | Bacteria | 1645 |
| 638 | Ga0495653_0014598 | 3300046463 | Bacteria | 6411 |
| 639 | Ga0495653_0033179 | 3300046463 | Bacteria | 4091 |
| 640 | Ga0495653_0043178 | 3300046463 | Bacteria | 3506 |
| 641 | Ga0495653_0253295 | 3300046463 | Bacteria | 1167 |
| 642 | Ga0495650_0000593 | 3300046471 | Bacteria | 50088 |
| 643 | Ga0495650_0028439 | 3300046471 | Bacteria | 2566 |
| 644 | Ga0495580_0034101 | 3300046472 | Bacteria | 3665 |
| 645 | Ga0495580_0054857 | 3300046472 | Bacteria | 2810 |
| 646 | Ga0495580_0082784 | 3300046472 | Bacteria | 2236 |
| 647 | Ga0495580_0114350 | 3300046472 | Bacteria | 1874 |
| 648 | Ga0495580_0151150 | 3300046472 | Bacteria | 1608 |
| 649 | Ga0495580_0179227 | 3300046472 | Bacteria | 1463 |
| 650 | Ga0495582_0018805 | 3300046473 | Bacteria | 3777 |
| 651 | Ga0495582_0018828 | 3300046473 | Bacteria | 3775 |
| 652 | Ga0495605_0000024 | 3300046474 | Bacteria | 236016 |
| 653 | Ga0495605_0000150 | 3300046474 | Bacteria | 90165 |
| 654 | Ga0495605_0015140 | 3300046474 | Bacteria | 4203 |
| 655 | Ga0495605_0017715 | 3300046474 | Bacteria | 3830 |
| 656 | Ga0495605_0020086 | 3300046474 | Bacteria | 3553 |
| 657 | Ga0495605_0036410 | 3300046474 | Bacteria | 2481 |
| 658 | Ga0495605_0096022 | 3300046474 | Bacteria | 1368 |
| 659 | Ga0495605_0109442 | 3300046474 | Bacteria | 1262 |
| 660 | Ga0495605_0263300 | 3300046474 | Bacteria | 735 |
| 661 | Ga0495639_0121048 | 3300046475 | Bacteria | 1248 |
| 662 | Ga0495639_0275999 | 3300046475 | Bacteria | 835 |
| 663 | Ga0495662_0024992 | 3300046476 | Bacteria | 2884 |
| 664 | Ga0495664_0103722 | 3300046477 | Bacteria | 1714 |
| 665 | Ga0495664_0291919 | 3300046477 | Bacteria | 985 |
| 666 | Ga0495584_0004700 | 3300046491 | Bacteria | 7312 |
| 667 | Ga0495584_0010175 | 3300046491 | Bacteria | 4829 |
| 668 | Ga0495584_0018909 | 3300046491 | Bacteria | 3500 |
| 669 | Ga0495584_0026934 | 3300046491 | Bacteria | 2913 |
| 670 | Ga0495584_0113124 | 3300046491 | Bacteria | 1373 |
| 671 | Ga0495584_0168914 | 3300046491 | Bacteria | 1112 |
| 672 | Ga0495584_0527994 | 3300046491 | Bacteria | 601 |
| 673 | Ga0495585_0000130 | 3300046492 | Bacteria | 81689 |
| 674 | Ga0495585_0017853 | 3300046492 | Bacteria | 4095 |
| 675 | Ga0495585_0017899 | 3300046492 | Bacteria | 4089 |
| 676 | Ga0495585_0021109 | 3300046492 | Bacteria | 3740 |
| 677 | Ga0495585_0023091 | 3300046492 | Bacteria | 3570 |
| 678 | Ga0495585_0031069 | 3300046492 | Bacteria | 3035 |
| 679 | Ga0495585_0032805 | 3300046492 | Bacteria | 2940 |
| 680 | Ga0495585_0036668 | 3300046492 | Bacteria | 2763 |
| 681 | Ga0495585_0081286 | 3300046492 | Bacteria | 1755 |
| 682 | Ga0495585_0099296 | 3300046492 | Bacteria | 1558 |
| 683 | Ga0495585_0111604 | 3300046492 | Bacteria | 1453 |
| 684 | Ga0495585_0124731 | 3300046492 | Bacteria | 1359 |
| 685 | Ga0495585_0144845 | 3300046492 | Bacteria | 1242 |
| 686 | Ga0495585_0223744 | 3300046492 | Bacteria | 948 |
| 687 | Ga0495585_0302855 | 3300046492 | Bacteria | 785 |
| 688 | Ga0495585_0331404 | 3300046492 | Bacteria | 742 |
| 689 | Ga0495594_0011814 | 3300046499 | Bacteria | 4541 |
| 690 | Ga0495594_0026282 | 3300046499 | Bacteria | 3131 |
| 691 | Ga0495594_0042316 | 3300046499 | Bacteria | 2494 |
| 692 | Ga0495594_0104279 | 3300046499 | Bacteria | 1596 |
| 693 | Ga0495594_0130258 | 3300046499 | Bacteria | 1424 |
| 694 | Ga0495594_0148063 | 3300046499 | Bacteria | 1332 |
| 695 | Ga0495594_0173761 | 3300046499 | Bacteria | 1226 |
| 696 | Ga0495594_0541274 | 3300046499 | Bacteria | 661 |
| 697 | Ga0495596_0008779 | 3300046500 | Bacteria | 4474 |
| 698 | Ga0495596_0011263 | 3300046500 | Bacteria | 3863 |
| 699 | Ga0495596_0011276 | 3300046500 | Bacteria | 3861 |
| 700 | Ga0495596_0036439 | 3300046500 | Bacteria | 1948 |
| 701 | Ga0495596_0038300 | 3300046500 | Bacteria | 1895 |
| 702 | Ga0495596_0056912 | 3300046500 | Bacteria | 1526 |
| 703 | Ga0495596_0094647 | 3300046500 | Bacteria | 1159 |
| 704 | Ga0495607_0006535 | 3300046501 | Bacteria | 8196 |
| 705 | Ga0495607_0011899 | 3300046501 | Bacteria | 5763 |
| 706 | Ga0495607_0022423 | 3300046501 | Bacteria | 3965 |
| 707 | Ga0495607_0027341 | 3300046501 | Bacteria | 3528 |
| 708 | Ga0495607_0036400 | 3300046501 | Bacteria | 2965 |
| 709 | Ga0495607_0036883 | 3300046501 | Bacteria | 2941 |
| 710 | Ga0495607_0099529 | 3300046501 | Bacteria | 1559 |
| 711 | Ga0495607_0129827 | 3300046501 | Bacteria | 1312 |
| 712 | Ga0495607_0167811 | 3300046501 | Bacteria | 1111 |
| 713 | Ga0495583_0000217 | 3300046506 | Bacteria | 96747 |
| 714 | Ga0495583_0003595 | 3300046506 | Bacteria | 11632 |
| 715 | Ga0495583_0014453 | 3300046506 | Bacteria | 4355 |
| 716 | Ga0495583_0016161 | 3300046506 | Bacteria | 4023 |
| 717 | Ga0495583_0017569 | 3300046506 | Bacteria | 3793 |
| 718 | Ga0495583_0019334 | 3300046506 | Bacteria | 3558 |
| 719 | Ga0495583_0021560 | 3300046506 | Bacteria | 3311 |
| 720 | Ga0495583_0024000 | 3300046506 | Bacteria | 3073 |
| 721 | Ga0495583_0088318 | 3300046506 | Bacteria | 1338 |
| 722 | Ga0495583_0127006 | 3300046506 | Bacteria | 1069 |
| 723 | Ga0495583_0236223 | 3300046506 | Bacteria | 735 |
| 724 | Ga0495606_0000111 | 3300046507 | Bacteria | 138144 |
| 725 | Ga0495606_0012314 | 3300046507 | Bacteria | 6876 |
| 726 | Ga0495606_0031459 | 3300046507 | Bacteria | 3689 |
| 727 | Ga0495606_0031807 | 3300046507 | Bacteria | 3663 |
| 728 | Ga0495606_0043133 | 3300046507 | Bacteria | 3011 |
| 729 | Ga0495606_0088578 | 3300046507 | Bacteria | 1908 |
| 730 | Ga0495606_0098299 | 3300046507 | Bacteria | 1786 |
| 731 | Ga0495606_0145603 | 3300046507 | Bacteria | 1395 |
| 732 | Ga0495606_0153040 | 3300046507 | Bacteria | 1352 |
| 733 | Ga0495606_0161695 | 3300046507 | Bacteria | 1306 |
| 734 | Ga0495606_0296781 | 3300046507 | Bacteria | 877 |
| 735 | Ga0495608_0173893 | 3300046511 | Bacteria | 1365 |
| 736 | Ga0495608_0303761 | 3300046511 | Bacteria | 987 |
| 737 | Ga0495610_0001639 | 3300046512 | Bacteria | 19681 |
| 738 | Ga0495616_0005459 | 3300046513 | Bacteria | 7820 |
| 739 | Ga0495616_0016582 | 3300046513 | Bacteria | 4074 |
| 740 | Ga0495616_0019296 | 3300046513 | Bacteria | 3722 |
| 741 | Ga0495616_0021514 | 3300046513 | Bacteria | 3492 |
| 742 | Ga0495616_0027344 | 3300046513 | Bacteria | 3027 |
| 743 | Ga0495616_0030519 | 3300046513 | Bacteria | 2832 |
| 744 | Ga0495616_0063878 | 3300046513 | Bacteria | 1798 |
| 745 | Ga0495616_0123861 | 3300046513 | Bacteria | 1190 |
| 746 | Ga0495616_0154812 | 3300046513 | Bacteria | 1034 |
| 747 | Ga0495620_0033837 | 3300046515 | Bacteria | 2315 |
| 748 | Ga0495628_0004010 | 3300046516 | Bacteria | 13117 |
| 749 | Ga0495628_0025764 | 3300046516 | Bacteria | 4802 |
| 750 | Ga0495628_0030236 | 3300046516 | Bacteria | 4387 |
| 751 | Ga0495628_0229240 | 3300046516 | Bacteria | 1393 |
| 752 | Ga0495630_0033105 | 3300046517 | Bacteria | 3854 |
| 753 | Ga0495630_0162029 | 3300046517 | Bacteria | 1703 |
| 754 | Ga0495631_0006593 | 3300046518 | Bacteria | 5974 |
| 755 | Ga0495631_0014519 | 3300046518 | Bacteria | 3799 |
| 756 | Ga0495631_0017281 | 3300046518 | Bacteria | 3416 |
| 757 | Ga0495631_0039169 | 3300046518 | Bacteria | 2104 |
| 758 | Ga0495631_0041961 | 3300046518 | Bacteria | 2023 |
| 759 | Ga0495631_0060501 | 3300046518 | Bacteria | 1643 |
| 760 | Ga0495631_0080611 | 3300046518 | Bacteria | 1404 |
| 761 | Ga0495631_0150013 | 3300046518 | Bacteria | 1000 |
| 762 | Ga0495631_0167828 | 3300046518 | Bacteria | 941 |
| 763 | Ga0495632_0005838 | 3300046519 | Bacteria | 8057 |
| 764 | Ga0495632_0015712 | 3300046519 | Bacteria | 4232 |
| 765 | Ga0495632_0017969 | 3300046519 | Bacteria | 3889 |
| 766 | Ga0495632_0018711 | 3300046519 | Bacteria | 3793 |
| 767 | Ga0495632_0022036 | 3300046519 | Bacteria | 3422 |
| 768 | Ga0495632_0024467 | 3300046519 | Bacteria | 3206 |
| 769 | Ga0495632_0033167 | 3300046519 | Bacteria | 2653 |
| 770 | Ga0495632_0293983 | 3300046519 | Bacteria | 721 |
| 771 | Ga0495637_0000317 | 3300046520 | Bacteria | 37449 |
| 772 | Ga0495637_0067719 | 3300046520 | Bacteria | 1448 |
| 773 | Ga0495637_0076779 | 3300046520 | Bacteria | 1338 |
| 774 | Ga0495637_0271947 | 3300046520 | Bacteria | 606 |
| 775 | Ga0495643_0001166 | 3300046522 | Bacteria | 25657 |
| 776 | Ga0495643_0012630 | 3300046522 | Bacteria | 5087 |
| 777 | Ga0495643_0019193 | 3300046522 | Bacteria | 3959 |
| 778 | Ga0495643_0030060 | 3300046522 | Bacteria | 3036 |
| 779 | Ga0495643_0043149 | 3300046522 | Bacteria | 2455 |
| 780 | Ga0495643_0052223 | 3300046522 | Bacteria | 2195 |
| 781 | Ga0495643_0068217 | 3300046522 | Bacteria | 1872 |
| 782 | Ga0495643_0072390 | 3300046522 | Bacteria | 1807 |
| 783 | Ga0495643_0097693 | 3300046522 | Bacteria | 1508 |
| 784 | Ga0495643_0142034 | 3300046522 | Bacteria | 1196 |
| 785 | Ga0495644_0005136 | 3300046523 | Bacteria | 5125 |
| 786 | Ga0495644_0009052 | 3300046523 | Bacteria | 3832 |
| 787 | Ga0495644_0015329 | 3300046523 | Bacteria | 2934 |
| 788 | Ga0495644_0084782 | 3300046523 | Bacteria | 1194 |
| 789 | Ga0495644_0280832 | 3300046523 | Bacteria | 649 |
| 790 | Ga0495648_0013732 | 3300046524 | Bacteria | 5970 |
| 791 | Ga0495648_0022393 | 3300046524 | Bacteria | 4350 |
| 792 | Ga0495648_0030178 | 3300046524 | Bacteria | 3588 |
| 793 | Ga0495648_0031398 | 3300046524 | Bacteria | 3498 |
| 794 | Ga0495648_0060544 | 3300046524 | Bacteria | 2252 |
| 795 | Ga0495648_0257725 | 3300046524 | Bacteria | 838 |
| 796 | Ga0495663_0017407 | 3300046525 | Bacteria | 2040 |
| 797 | Ga0495663_0022183 | 3300046525 | Bacteria | 1833 |
| 798 | Ga0495663_0068445 | 3300046525 | Bacteria | 1127 |
| 799 | Ga0495663_0082955 | 3300046525 | Bacteria | 1035 |
| 800 | Ga0495666_0004837 | 3300046526 | Bacteria | 6806 |
| 801 | Ga0495666_0019043 | 3300046526 | Bacteria | 3409 |
| 802 | Ga0495666_0019490 | 3300046526 | Bacteria | 3366 |
| 803 | Ga0495666_0021664 | 3300046526 | Bacteria | 3181 |
| 804 | Ga0495666_0059007 | 3300046526 | Bacteria | 1835 |
| 805 | Ga0495642_0003195 | 3300046528 | Bacteria | 6490 |
| 806 | Ga0495642_0009672 | 3300046528 | Bacteria | 3688 |
| 807 | Ga0495642_0011766 | 3300046528 | Bacteria | 3370 |
| 808 | Ga0495642_0013208 | 3300046528 | Bacteria | 3190 |
| 809 | Ga0495642_0015642 | 3300046528 | Bacteria | 2952 |
| 810 | Ga0495642_0016149 | 3300046528 | Bacteria | 2908 |
| 811 | Ga0495642_0018647 | 3300046528 | Bacteria | 2716 |
| 812 | Ga0495642_0038628 | 3300046528 | Bacteria | 1934 |
| 813 | Ga0495642_0054932 | 3300046528 | Bacteria | 1642 |
| 814 | Ga0495642_0149590 | 3300046528 | Bacteria | 1009 |
| 815 | Ga0495642_0551544 | 3300046528 | Bacteria | 511 |
| 816 | Ga0495652_0049885 | 3300046529 | Bacteria | 3581 |
| 817 | Ga0495652_0073263 | 3300046529 | Bacteria | 2852 |
| 818 | Ga0495652_0114911 | 3300046529 | Bacteria | 2158 |
| 819 | Ga0495652_0326069 | 3300046529 | Bacteria | 1107 |
| 820 | Ga0495654_0032996 | 3300046530 | Bacteria | 2623 |
| 821 | Ga0495654_0034077 | 3300046530 | Bacteria | 2572 |
| 822 | Ga0495654_0074326 | 3300046530 | Bacteria | 1605 |
| 823 | Ga0495654_0236393 | 3300046530 | Bacteria | 766 |
| 824 | Ga0495665_0028022 | 3300046531 | Bacteria | 3022 |
| 825 | Ga0495665_0034768 | 3300046531 | Bacteria | 2695 |
| 826 | Ga0495665_0071333 | 3300046531 | Bacteria | 1829 |
| 827 | Ga0495665_0160698 | 3300046531 | Bacteria | 1171 |
| 828 | Ga0495665_0200130 | 3300046531 | Bacteria | 1035 |
| 829 | Ga0495665_0399741 | 3300046531 | Bacteria | 697 |
| 830 | Ga0495640_0194312 | 3300046533 | Bacteria | 1289 |
| 831 | Ga0495586_0028869 | 3300046535 | Bacteria | 2968 |
| 832 | Ga0495586_0034409 | 3300046535 | Bacteria | 2721 |
| 833 | Ga0495586_0061876 | 3300046535 | Bacteria | 2037 |
| 834 | Ga0495586_0062533 | 3300046535 | Bacteria | 2027 |
| 835 | Ga0495586_0294140 | 3300046535 | Bacteria | 930 |
| 836 | Ga0495587_0021577 | 3300046536 | Bacteria | 3972 |
| 837 | Ga0495587_0035530 | 3300046536 | Bacteria | 3001 |
| 838 | Ga0495598_0011881 | 3300046537 | Bacteria | 2122 |
| 839 | Ga0495598_0056914 | 3300046537 | Bacteria | 1195 |
| 840 | Ga0495609_0000030 | 3300046538 | Bacteria | 215885 |
| 841 | Ga0495609_0010610 | 3300046538 | Bacteria | 4413 |
| 842 | Ga0495609_0018320 | 3300046538 | Bacteria | 3244 |
| 843 | Ga0495609_0035248 | 3300046538 | Bacteria | 2265 |
| 844 | Ga0495609_0040781 | 3300046538 | Bacteria | 2088 |
| 845 | Ga0495609_0041128 | 3300046538 | Bacteria | 2079 |
| 846 | Ga0495609_0046675 | 3300046538 | Bacteria | 1939 |
| 847 | Ga0495609_0054568 | 3300046538 | Bacteria | 1774 |
| 848 | Ga0495609_0065072 | 3300046538 | Bacteria | 1607 |
| 849 | Ga0495609_0072288 | 3300046538 | Bacteria | 1514 |
| 850 | Ga0495609_0117049 | 3300046538 | Bacteria | 1147 |
| 851 | Ga0495609_0155196 | 3300046538 | Bacteria | 972 |
| 852 | Ga0495609_0282615 | 3300046538 | Bacteria | 678 |
| 853 | Ga0495621_0016295 | 3300046539 | Bacteria | 2383 |
| 854 | Ga0495621_0025100 | 3300046539 | Bacteria | 1999 |
| 855 | Ga0495621_0112505 | 3300046539 | Bacteria | 1045 |
| 856 | Ga0495597_0006249 | 3300046542 | Bacteria | 6175 |
| 857 | Ga0495597_0013175 | 3300046542 | Bacteria | 3968 |
| 858 | Ga0495597_0014538 | 3300046542 | Bacteria | 3745 |
| 859 | Ga0495597_0021593 | 3300046542 | Bacteria | 2991 |
| 860 | Ga0495597_0026824 | 3300046542 | Bacteria | 2645 |
| 861 | Ga0495597_0056360 | 3300046542 | Bacteria | 1721 |
| 862 | Ga0495597_0058946 | 3300046542 | Bacteria | 1677 |
| 863 | Ga0495597_0085971 | 3300046542 | Bacteria | 1339 |
| 864 | Ga0495597_0145296 | 3300046542 | Bacteria | 976 |
| 865 | Ga0495645_0074182 | 3300046543 | Bacteria | 2450 |
| 866 | Ga0495645_0128066 | 3300046543 | Bacteria | 1782 |
| 867 | Ga0495645_0243285 | 3300046543 | Bacteria | 1199 |
| 868 | Ga0495645_0250011 | 3300046543 | Bacteria | 1179 |
| 869 | Ga0495622_0037877 | 3300046557 | Bacteria | 2245 |
| 870 | Ga0495622_0050467 | 3300046557 | Bacteria | 1930 |
| 871 | Ga0495622_0093388 | 3300046557 | Bacteria | 1381 |
| 872 | Ga0495622_0132103 | 3300046557 | Bacteria | 1136 |
| 873 | Ga0495622_0138112 | 3300046557 | Bacteria | 1107 |
| 874 | Ga0495622_0264232 | 3300046557 | Bacteria | 755 |
| 875 | Ga0495633_0000271 | 3300046558 | Bacteria | 60538 |
| 876 | Ga0495633_0018039 | 3300046558 | Bacteria | 3590 |
| 877 | Ga0495633_0019858 | 3300046558 | Bacteria | 3390 |
| 878 | Ga0495633_0033219 | 3300046558 | Bacteria | 2488 |
| 879 | Ga0495633_0061485 | 3300046558 | Bacteria | 1758 |
| 880 | Ga0495633_0087407 | 3300046558 | Bacteria | 1449 |
| 881 | Ga0495633_0097623 | 3300046558 | Bacteria | 1364 |
| 882 | Ga0495633_0155708 | 3300046558 | Bacteria | 1055 |
| 883 | Ga0495633_0383003 | 3300046558 | Bacteria | 636 |
| 884 | Ga0495633_0434349 | 3300046558 | Bacteria | 593 |
| 885 | Ga0495667_0276671 | 3300046559 | Bacteria | 1066 |
| 886 | Ga0495656_0046119 | 3300046615 | Bacteria | 1843 |
| 887 | Ga0495656_0106956 | 3300046615 | Bacteria | 1302 |
| 888 | Ga0495656_0119286 | 3300046615 | Bacteria | 1243 |
| 889 | Ga0495656_0123765 | 3300046615 | Bacteria | 1223 |
| 890 | Ga0495668_0002794 | 3300046616 | Bacteria | 13898 |
| 891 | Ga0495668_0019080 | 3300046616 | Bacteria | 3957 |
| 892 | Ga0495668_0020751 | 3300046616 | Bacteria | 3775 |
| 893 | Ga0495668_0026520 | 3300046616 | Bacteria | 3287 |
| 894 | Ga0495668_0052616 | 3300046616 | Bacteria | 2252 |
| 895 | Ga0495668_0057592 | 3300046616 | Bacteria | 2144 |
| 896 | Ga0495668_0083035 | 3300046616 | Bacteria | 1757 |
| 897 | Ga0495668_0090100 | 3300046616 | Bacteria | 1680 |
| 898 | Ga0495668_0114739 | 3300046616 | Bacteria | 1473 |
| 899 | Ga0495668_0126074 | 3300046616 | Bacteria | 1401 |
| 900 | Ga0495668_0130157 | 3300046616 | Bacteria | 1377 |
| 901 | Ga0495668_0177276 | 3300046616 | Bacteria | 1168 |
| 902 | Ga0495634_0030867 | 3300046642 | Bacteria | 3695 |
| 903 | Ga0495634_0273699 | 3300046642 | Bacteria | 1027 |
| 904 | Ga0495611_0000944 | 3300046648 | Bacteria | 15586 |
| 905 | Ga0495611_0017645 | 3300046648 | Bacteria | 3055 |
| 906 | Ga0495611_0021885 | 3300046648 | Bacteria | 2763 |
| 907 | Ga0495611_0032757 | 3300046648 | Bacteria | 2291 |
| 908 | Ga0495611_0054713 | 3300046648 | Bacteria | 1804 |
| 909 | Ga0495611_0067049 | 3300046648 | Bacteria | 1637 |
| 910 | Ga0495611_0073910 | 3300046648 | Bacteria | 1560 |
| 911 | Ga0495625_0072104 | 3300046660 | Bacteria | 2422 |
| 912 | Ga0495625_0076921 | 3300046660 | Bacteria | 2332 |
| 913 | Ga0495625_0129086 | 3300046660 | Bacteria | 1713 |
| 914 | Ga0495625_0169698 | 3300046660 | Bacteria | 1457 |
| 915 | Ga0495625_0186107 | 3300046660 | Bacteria | 1378 |
| 916 | Ga0495625_0219210 | 3300046660 | Bacteria | 1247 |
| 917 | Ga0495625_0231242 | 3300046660 | Bacteria | 1207 |
| 918 | Ga0495635_0001055 | 3300046663 | Bacteria | 18247 |
| 919 | Ga0495635_0370760 | 3300046663 | Bacteria | 953 |
| 920 | Ga0495659_0044871 | 3300046664 | Bacteria | 1591 |
| 921 | Ga0495659_0291515 | 3300046664 | Bacteria | 688 |
| 922 | Ga0495661_0003016 | 3300046665 | Bacteria | 12690 |
| 923 | Ga0495661_0022811 | 3300046665 | Bacteria | 4069 |
| 924 | Ga0495661_0023036 | 3300046665 | Bacteria | 4047 |
| 925 | Ga0495661_0026310 | 3300046665 | Bacteria | 3748 |
| 926 | Ga0495661_0038432 | 3300046665 | Bacteria | 2981 |
| 927 | Ga0495661_0054848 | 3300046665 | Bacteria | 2391 |
| 928 | Ga0495661_0060721 | 3300046665 | Bacteria | 2245 |
| 929 | Ga0495661_0097043 | 3300046665 | Bacteria | 1665 |
| 930 | Ga0495661_0108389 | 3300046665 | Bacteria | 1551 |
| 931 | Ga0495661_0114471 | 3300046665 | Bacteria | 1498 |
| 932 | Ga0495661_0175220 | 3300046665 | Bacteria | 1140 |
| 933 | Ga0495661_0183882 | 3300046665 | Bacteria | 1105 |
| 934 | Ga0495661_0218491 | 3300046665 | Bacteria | 988 |
| 935 | Ga0495661_0238678 | 3300046665 | Bacteria | 933 |
| 936 | Ga0495661_0395773 | 3300046665 | Bacteria | 672 |
| 937 | Ga0495661_0400422 | 3300046665 | Bacteria | 667 |
| 938 | Ga0495588_0000078 | 3300046674 | Bacteria | 214254 |
| 939 | Ga0495588_0007873 | 3300046674 | Bacteria | 4867 |
| 940 | Ga0495588_0013498 | 3300046674 | Bacteria | 3894 |
| 941 | Ga0495588_0021100 | 3300046674 | Bacteria | 3206 |
| 942 | Ga0495588_0031883 | 3300046674 | Bacteria | 2654 |
| 943 | Ga0495588_0045184 | 3300046674 | Bacteria | 2257 |
| 944 | Ga0495588_0053202 | 3300046674 | Bacteria | 2087 |
| 945 | Ga0495588_0053879 | 3300046674 | Bacteria | 2074 |
| 946 | Ga0495588_0078835 | 3300046674 | Bacteria | 1718 |
| 947 | Ga0495588_0079305 | 3300046674 | Bacteria | 1713 |
| 948 | Ga0495588_0163724 | 3300046674 | Bacteria | 1176 |
| 949 | Ga0495588_0345264 | 3300046674 | Bacteria | 782 |
| 950 | Ga0495588_0360871 | 3300046674 | Bacteria | 763 |
| 951 | Ga0495657_0450986 | 3300046675 | Bacteria | 753 |
| 952 | Ga0495599_0014744 | 3300046678 | Bacteria | 4839 |
| 953 | Ga0495599_0407877 | 3300046678 | Bacteria | 809 |
| 954 | Ga0495623_0033704 | 3300046679 | Bacteria | 3286 |
| 955 | Ga0495623_0131306 | 3300046679 | Bacteria | 1499 |
| 956 | Ga0495623_0144758 | 3300046679 | Bacteria | 1410 |
| 957 | Ga0495623_0204858 | 3300046679 | Bacteria | 1132 |
| 958 | Ga0495623_0246794 | 3300046679 | Bacteria | 1006 |
| 959 | Ga0495623_0551682 | 3300046679 | Bacteria | 603 |
| 960 | Ga0495623_0615013 | 3300046679 | Bacteria | 563 |
| 961 | Ga0495646_0011747 | 3300046680 | Bacteria | 5568 |
| 962 | Ga0495646_0038428 | 3300046680 | Bacteria | 2956 |
| 963 | Ga0495646_0072612 | 3300046680 | Bacteria | 2023 |
| 964 | Ga0495658_0055078 | 3300046683 | Bacteria | 2264 |
| 965 | Ga0495658_0364847 | 3300046683 | Bacteria | 919 |
| 966 | Ga0495669_0000057 | 3300046684 | Bacteria | 76704 |
| 967 | Ga0495669_0010183 | 3300046684 | Bacteria | 3971 |
| 968 | Ga0495669_0023293 | 3300046684 | Bacteria | 2694 |
| 969 | Ga0495669_0025438 | 3300046684 | Bacteria | 2581 |
| 970 | Ga0495669_0064491 | 3300046684 | Bacteria | 1662 |
| 971 | Ga0495613_0141044 | 3300046689 | Bacteria | 1722 |
| 972 | Ga0495613_0149515 | 3300046689 | Bacteria | 1666 |
| 973 | Ga0495624_0019960 | 3300046690 | Bacteria | 4465 |
| 974 | Ga0495624_0021494 | 3300046690 | Bacteria | 4278 |
| 975 | Ga0495624_0817440 | 3300046690 | Bacteria | 550 |
| 976 | Ga0495670_0033139 | 3300046691 | Bacteria | 2570 |
| 977 | Ga0495670_0041936 | 3300046691 | Bacteria | 2283 |
| 978 | Ga0495670_0050890 | 3300046691 | Bacteria | 2073 |
| 979 | Ga0495670_0082759 | 3300046691 | Bacteria | 1636 |
| 980 | Ga0495670_0093245 | 3300046691 | Bacteria | 1543 |
| 981 | Ga0495670_0191456 | 3300046691 | Bacteria | 1081 |
| 982 | Ga0495670_0304018 | 3300046691 | Bacteria | 855 |
| 983 | Ga0495670_0414410 | 3300046691 | Bacteria | 728 |
| 984 | Ga0495670_0422068 | 3300046691 | Bacteria | 721 |
| 985 | Ga0495670_0503078 | 3300046691 | Bacteria | 658 |
| 986 | Ga0495671_0014453 | 3300046692 | Bacteria | 4248 |
| 987 | Ga0495671_0063655 | 3300046692 | Bacteria | 1816 |
| 988 | Ga0495671_0066395 | 3300046692 | Bacteria | 1775 |
| 989 | Ga0495671_0123409 | 3300046692 | Bacteria | 1263 |
| 990 | Ga0495649_0007358 | 3300046694 | Bacteria | 6727 |
| 991 | Ga0495649_0016251 | 3300046694 | Bacteria | 4220 |
| 992 | Ga0495649_0063095 | 3300046694 | Bacteria | 1991 |
| 993 | Ga0495649_0079616 | 3300046694 | Bacteria | 1752 |
| 994 | Ga0495649_0103008 | 3300046694 | Bacteria | 1516 |
| 995 | Ga0495649_0163013 | 3300046694 | Bacteria | 1168 |
| 996 | Ga0495649_0250581 | 3300046694 | Bacteria | 910 |
| 997 | Ga0495649_0351971 | 3300046694 | Bacteria | 744 |
| 998 | Ga0495589_0000021 | 3300046794 | Bacteria | 197941 |
| 999 | Ga0495589_0000193 | 3300046794 | Bacteria | 53197 |
| 1000 | Ga0495589_0015027 | 3300046794 | Bacteria | 3984 |
| 1001 | Ga0495589_0018583 | 3300046794 | Bacteria | 3563 |
| 1002 | Ga0495589_0019463 | 3300046794 | Bacteria | 3479 |
| 1003 | Ga0495589_0024338 | 3300046794 | Bacteria | 3078 |
| 1004 | Ga0495589_0026665 | 3300046794 | Bacteria | 2926 |
| 1005 | Ga0495589_0029213 | 3300046794 | Bacteria | 2779 |
| 1006 | Ga0495589_0029794 | 3300046794 | Bacteria | 2751 |
| 1007 | Ga0495589_0033697 | 3300046794 | Bacteria | 2571 |
| 1008 | Ga0495589_0096889 | 3300046794 | Bacteria | 1429 |
| 1009 | Ga0495589_0156361 | 3300046794 | Bacteria | 1087 |
| 1010 | Ga0495600_0012680 | 3300046809 | Bacteria | 5276 |
| 1011 | Ga0495600_0043503 | 3300046809 | Bacteria | 2929 |
| 1012 | Ga0495600_0064915 | 3300046809 | Bacteria | 2386 |
| 1013 | Ga0495660_0006653 | 3300046810 | Bacteria | 6830 |
| 1014 | Ga0495660_0018126 | 3300046810 | Bacteria | 4048 |
| 1015 | Ga0495660_0033020 | 3300046810 | Bacteria | 2904 |
| 1016 | Ga0495660_0045751 | 3300046810 | Bacteria | 2401 |
| 1017 | Ga0495660_0064519 | 3300046810 | Bacteria | 1957 |
| 1018 | Ga0495660_0095304 | 3300046810 | Bacteria | 1539 |
| 1019 | Ga0495660_0102597 | 3300046810 | Bacteria | 1470 |
| 1020 | Ga0495660_0103292 | 3300046810 | Bacteria | 1464 |
| 1021 | Ga0495660_0170138 | 3300046810 | Bacteria | 1062 |
| 1022 | Ga0495660_0297654 | 3300046810 | Bacteria | 732 |
| 1023 | Ga0495581_0024181 | 3300047315 | Bacteria | 3520 |
| 1024 | Ga0495581_0048836 | 3300047315 | Bacteria | 2443 |
| 1025 | Ga0495581_0049215 | 3300047315 | Bacteria | 2433 |
| 1026 | Ga0495581_0059618 | 3300047315 | Bacteria | 2205 |
| 1027 | Ga0495581_0067339 | 3300047315 | Bacteria | 2070 |
| 1028 | Ga0495581_0305727 | 3300047315 | Bacteria | 929 |
| 1029 | Ga0495604_0029049 | 3300047317 | Bacteria | 4400 |
| 1030 | Ga0495604_0035632 | 3300047317 | Bacteria | 3928 |
| 1031 | Ga0495604_0091755 | 3300047317 | Bacteria | 2252 |
| 1032 | Ga0495604_0254824 | 3300047317 | Bacteria | 1195 |
| 1033 | Ga0495604_0267923 | 3300047317 | Bacteria | 1158 |
| 1034 | Ga0495604_0430012 | 3300047317 | Bacteria | 865 |
| 1035 | Ga0495604_0612328 | 3300047317 | Bacteria | 697 |
| 1036 | Ga0495636_0005023 | 3300047318 | Bacteria | 5193 |
| 1037 | Ga0495636_0051454 | 3300047318 | Bacteria | 1726 |
| 1038 | Ga0495636_0084804 | 3300047318 | Bacteria | 1368 |
| 1039 | Ga0495636_0326516 | 3300047318 | Bacteria | 721 |
| 1040 | Ga0495674_0104908 | 3300047319 | Bacteria | 2403 |
| 1041 | Ga0495674_0106139 | 3300047319 | Bacteria | 2386 |
| 1042 | Ga0495674_1043329 | 3300047319 | Bacteria | 625 |
| 1043 | Ga0495672_0000031 | 3300047320 | Bacteria | 298258 |
| 1044 | Ga0495672_0000178 | 3300047320 | Bacteria | 91834 |
| 1045 | Ga0495672_0008348 | 3300047320 | Bacteria | 7660 |
| 1046 | Ga0495672_0019596 | 3300047320 | Bacteria | 4459 |
| 1047 | Ga0495672_0024609 | 3300047320 | Bacteria | 3874 |
| 1048 | Ga0495672_0115555 | 3300047320 | Bacteria | 1434 |
| 1049 | Ga0495672_0321717 | 3300047320 | Bacteria | 726 |
| 1050 | Ga0495676_0037581 | 3300047321 | Bacteria | 4028 |
| 1051 | Ga0495676_0071155 | 3300047321 | Bacteria | 2675 |
| 1052 | Ga0495676_0102200 | 3300047321 | Bacteria | 2118 |
| 1053 | Ga0495676_0117394 | 3300047321 | Bacteria | 1941 |
| 1054 | Ga0495676_0373360 | 3300047321 | Bacteria | 950 |
| 1055 | Ga0495676_0810652 | 3300047321 | Bacteria | 602 |
| 1056 | Ga0495680_0045790 | 3300047322 | Bacteria | 3452 |
| 1057 | Ga0495680_0240671 | 3300047322 | Bacteria | 1285 |
| 1058 | Ga0495683_0001145 | 3300047323 | Bacteria | 18245 |
| 1059 | Ga0495683_0012100 | 3300047323 | Bacteria | 4536 |
| 1060 | Ga0495683_0072006 | 3300047323 | Bacteria | 1695 |
| 1061 | Ga0495683_0100586 | 3300047323 | Bacteria | 1390 |
| 1062 | Ga0495683_0103684 | 3300047323 | Bacteria | 1365 |
| 1063 | Ga0495683_0118858 | 3300047323 | Bacteria | 1256 |
| 1064 | Ga0495683_0147789 | 3300047323 | Bacteria | 1096 |
| 1065 | Ga0495687_000012 | 3300047443 | Bacteria | 391586 |
| 1066 | Ga0495687_000407 | 3300047443 | Bacteria | 53252 |
| 1067 | Ga0495687_010545 | 3300047443 | Bacteria | 5060 |
| 1068 | Ga0495687_010619 | 3300047443 | Bacteria | 5037 |
| 1069 | Ga0495687_017002 | 3300047443 | Bacteria | 3642 |
| 1070 | Ga0495687_022051 | 3300047443 | Bacteria | 3065 |
| 1071 | Ga0495687_025311 | 3300047443 | Bacteria | 2808 |
| 1072 | Ga0495687_087608 | 3300047443 | Bacteria | 1201 |
| 1073 | Ga0495675_0023477 | 3300047444 | Bacteria | 3929 |
| 1074 | Ga0495675_0053941 | 3300047444 | Bacteria | 2551 |
| 1075 | Ga0495675_0146055 | 3300047444 | Bacteria | 1463 |
| 1076 | Ga0495675_0175213 | 3300047444 | Bacteria | 1315 |
| 1077 | Ga0495675_0406157 | 3300047444 | Bacteria | 793 |
| 1078 | Ga0495675_0515171 | 3300047444 | Bacteria | 685 |
| 1079 | Ga0495677_0000029 | 3300047445 | Bacteria | 91481 |
| 1080 | Ga0495677_0009885 | 3300047445 | Bacteria | 3513 |
| 1081 | Ga0495677_0013909 | 3300047445 | Bacteria | 2929 |
| 1082 | Ga0495677_0031852 | 3300047445 | Bacteria | 1919 |
| 1083 | Ga0495677_0033060 | 3300047445 | Bacteria | 1884 |
| 1084 | Ga0495677_0039358 | 3300047445 | Bacteria | 1728 |
| 1085 | Ga0495677_0073660 | 3300047445 | Bacteria | 1274 |
| 1086 | Ga0495677_0175767 | 3300047445 | Bacteria | 829 |
| 1087 | Ga0495677_0204131 | 3300047445 | Bacteria | 768 |
| 1088 | Ga0495677_0273381 | 3300047445 | Bacteria | 662 |
| 1089 | Ga0495677_0328872 | 3300047445 | Bacteria | 602 |
| 1090 | Ga0495679_006393 | 3300047446 | Bacteria | 5080 |
| 1091 | Ga0495679_013445 | 3300047446 | Bacteria | 3073 |
| 1092 | Ga0495679_038255 | 3300047446 | Bacteria | 1503 |
| 1093 | Ga0495679_090912 | 3300047446 | Bacteria | 856 |
| 1094 | Ga0495685_017538 | 3300047447 | Bacteria | 2452 |
| 1095 | Ga0495685_026444 | 3300047447 | Bacteria | 1997 |
| 1096 | Ga0495685_045059 | 3300047447 | Bacteria | 1503 |
| 1097 | Ga0495685_087144 | 3300047447 | Bacteria | 1036 |
| 1098 | Ga0495685_093592 | 3300047447 | Bacteria | 995 |
| 1099 | Ga0495673_0000028 | 3300047469 | Bacteria | 473418 |
| 1100 | Ga0495673_0068348 | 3300047469 | Bacteria | 1501 |
| 1101 | Ga0495681_0016324 | 3300047470 | Bacteria | 4166 |
| 1102 | Ga0495681_0017670 | 3300047470 | Bacteria | 3951 |
| 1103 | Ga0495681_0020448 | 3300047470 | Bacteria | 3592 |
| 1104 | Ga0495681_0030366 | 3300047470 | Bacteria | 2752 |
| 1105 | Ga0495681_0036098 | 3300047470 | Bacteria | 2448 |
| 1106 | Ga0495681_0053925 | 3300047470 | Bacteria | 1880 |
| 1107 | Ga0495681_0055838 | 3300047470 | Bacteria | 1840 |
| 1108 | Ga0495681_0063129 | 3300047470 | Bacteria | 1700 |
| 1109 | Ga0495681_0134559 | 3300047470 | Bacteria | 1049 |
| 1110 | Ga0495681_0203622 | 3300047470 | Bacteria | 801 |
| 1111 | Ga0495684_0048834 | 3300047471 | Bacteria | 3235 |
| 1112 | Ga0495686_0000738 | 3300047472 | Bacteria | 43615 |
| 1113 | Ga0495686_0008189 | 3300047472 | Bacteria | 7713 |
| 1114 | Ga0495686_0045612 | 3300047472 | Bacteria | 2772 |
| 1115 | Ga0495686_0050961 | 3300047472 | Bacteria | 2599 |
| 1116 | Ga0495686_0095474 | 3300047472 | Bacteria | 1800 |
| 1117 | Ga0495593_0015115 | 3300047673 | Bacteria | 4383 |
| 1118 | Ga0495593_0120015 | 3300047673 | Bacteria | 1338 |
| 1119 | Ga0495593_0129475 | 3300047673 | Bacteria | 1281 |
| 1120 | Ga0495593_0245510 | 3300047673 | Bacteria | 896 |
| 1121 | Ga0495602_0059295 | 3300048088 | Bacteria | 3342 |
| 1122 | Ga0495602_0165470 | 3300048088 | Bacteria | 1722 |
| 1123 | Ga0495602_0194167 | 3300048088 | Bacteria | 1554 |
| 1124 | Ga0495602_0211613 | 3300048088 | Bacteria | 1471 |
| 1125 | Ga0495602_0295523 | 3300048088 | Bacteria | 1187 |
| 1126 | Ga0495614_0003050 | 3300048089 | Bacteria | 7465 |
| 1127 | Ga0495614_0052023 | 3300048089 | Bacteria | 1755 |
| 1128 | Ga0495614_0080005 | 3300048089 | Bacteria | 1415 |
| 1129 | Ga0495614_0186307 | 3300048089 | Bacteria | 935 |
| 1130 | Ga0495615_0041128 | 3300048090 | Bacteria | 1154 |
| 1131 | Ga0495626_0000017 | 3300048091 | Bacteria | 231648 |
| 1132 | Ga0495626_0000028 | 3300048091 | Bacteria | 204580 |
| 1133 | Ga0495626_0005379 | 3300048091 | Bacteria | 7516 |
| 1134 | Ga0495626_0009200 | 3300048091 | Bacteria | 5347 |
| 1135 | Ga0495626_0016880 | 3300048091 | Bacteria | 3698 |
| 1136 | Ga0495626_0020411 | 3300048091 | Bacteria | 3302 |
| 1137 | Ga0495626_0032667 | 3300048091 | Bacteria | 2497 |
| 1138 | Ga0495626_0037023 | 3300048091 | Bacteria | 2321 |
| 1139 | Ga0495626_0038291 | 3300048091 | Bacteria | 2274 |
| 1140 | Ga0495626_0042808 | 3300048091 | Bacteria | 2126 |
| 1141 | Ga0495626_0045212 | 3300048091 | Bacteria | 2056 |
| 1142 | Ga0495626_0053144 | 3300048091 | Bacteria | 1865 |
| 1143 | Ga0495626_0056957 | 3300048091 | Bacteria | 1788 |
| 1144 | Ga0495626_0072865 | 3300048091 | Bacteria | 1539 |
| 1145 | Ga0495626_0074583 | 3300048091 | Bacteria | 1517 |
| 1146 | Ga0495626_0113461 | 3300048091 | Bacteria | 1171 |
| 1147 | Ga0495626_0115701 | 3300048091 | Bacteria | 1157 |
| 1148 | Ga0495626_0160139 | 3300048091 | Bacteria | 944 |
| 1149 | Ga0495626_0218578 | 3300048091 | Bacteria | 775 |
| 1150 | Ga0496100_0030264 | 3300048903 | Bacteria | 3357 |
| 1151 | Ga0496100_0058178 | 3300048903 | Bacteria | 2535 |
| 1152 | Ga0496100_0150897 | 3300048903 | Bacteria | 1657 |
| 1153 | Ga0496100_0245245 | 3300048903 | Bacteria | 1323 |
| 1154 | Ga0496100_0604127 | 3300048903 | Bacteria | 852 |
| 1155 | Ga0496100_0927713 | 3300048903 | Bacteria | 684 |
| 1156 | Ga0496100_1011616 | 3300048903 | Bacteria | 654 |
| 1157 | Ga0496101_0044130 | 3300048904 | Bacteria | 3189 |
| 1158 | Ga0496101_0114312 | 3300048904 | Bacteria | 2035 |
| 1159 | Ga0496101_0164657 | 3300048904 | Bacteria | 1702 |
| 1160 | Ga0496102_0000166 | 3300048905 | Bacteria | 88956 |
| 1161 | Ga0496102_0000198 | 3300048905 | Bacteria | 81732 |
| 1162 | Ga0496102_0043495 | 3300048905 | Bacteria | 4073 |
| 1163 | Ga0496102_0165660 | 3300048905 | Bacteria | 2080 |
| 1164 | Ga0496102_0213392 | 3300048905 | Bacteria | 1819 |
| 1165 | Ga0496102_0246002 | 3300048905 | Bacteria | 1686 |
| 1166 | Ga0496102_0282195 | 3300048905 | Bacteria | 1565 |
| 1167 | Ga0496102_0463421 | 3300048905 | Bacteria | 1188 |
| 1168 | Ga0496103_0014421 | 3300048906 | Bacteria | 4691 |
| 1169 | Ga0496103_0035137 | 3300048906 | Bacteria | 3068 |
| 1170 | Ga0496103_0210807 | 3300048906 | Bacteria | 1249 |
| 1171 | Ga0496103_0293764 | 3300048906 | Bacteria | 1045 |
| 1172 | Ga0496104_0011806 | 3300048907 | Bacteria | 7839 |
| 1173 | Ga0496104_0348537 | 3300048907 | Bacteria | 1393 |
| 1174 | Ga0496104_0407011 | 3300048907 | Bacteria | 1273 |
| 1175 | Ga0496105_0107014 | 3300048908 | Bacteria | 2308 |
| 1176 | Ga0496105_0137128 | 3300048908 | Bacteria | 2015 |
| 1177 | Ga0496105_0181153 | 3300048908 | Bacteria | 1725 |
| 1178 | Ga0496105_0207257 | 3300048908 | Bacteria | 1599 |
| 1179 | Ga0496106_0037440 | 3300048909 | Bacteria | 3629 |
| 1180 | Ga0496106_0325155 | 3300048909 | Bacteria | 1234 |
| 1181 | Ga0496106_0518710 | 3300048909 | Bacteria | 957 |
| 1182 | Ga0496106_0748867 | 3300048909 | Bacteria | 777 |
| 1183 | Ga0496106_1019680 | 3300048909 | Bacteria | 650 |
| 1184 | Ga0496107_0008333 | 3300048910 | Bacteria | 7172 |
| 1185 | Ga0496107_0057289 | 3300048910 | Bacteria | 2817 |
| 1186 | Ga0496107_0110601 | 3300048910 | Bacteria | 2019 |
| 1187 | Ga0496107_0385055 | 3300048910 | Bacteria | 1043 |
| 1188 | Ga0496108_0049209 | 3300048911 | Bacteria | 3525 |
| 1189 | Ga0496108_0213912 | 3300048911 | Bacteria | 1674 |
| 1190 | Ga0496108_0373266 | 3300048911 | Bacteria | 1245 |
| 1191 | Ga0496108_0620238 | 3300048911 | Bacteria | 942 |
| 1192 | Ga0496108_0665374 | 3300048911 | Bacteria | 904 |
| 1193 | Ga0496109_0005807 | 3300048912 | Bacteria | 10336 |
| 1194 | Ga0496109_0069130 | 3300048912 | Bacteria | 3238 |
| 1195 | Ga0496109_0102125 | 3300048912 | Bacteria | 2661 |
| 1196 | Ga0496109_0108227 | 3300048912 | Bacteria | 2583 |
| 1197 | Ga0496109_0559998 | 3300048912 | Bacteria | 1078 |
| 1198 | Ga0496109_0702029 | 3300048912 | Bacteria | 949 |
| 1199 | Ga0496110_0017718 | 3300048913 | Bacteria | 5958 |
| 1200 | Ga0496110_0060817 | 3300048913 | Bacteria | 3332 |
| 1201 | Ga0496110_1042823 | 3300048913 | Bacteria | 725 |
| 1202 | Ga0496110_1253604 | 3300048913 | Bacteria | 650 |
| 1203 | Ga0496111_0009592 | 3300048914 | Bacteria | 6467 |
| 1204 | Ga0496111_0027877 | 3300048914 | Bacteria | 4000 |
| 1205 | Ga0496111_0055656 | 3300048914 | Bacteria | 2861 |
| 1206 | Ga0496112_0033696 | 3300048915 | Bacteria | 4980 |
| 1207 | Ga0496112_0952363 | 3300048915 | Bacteria | 779 |
| 1208 | Ga0496113_0033447 | 3300048916 | Bacteria | 3743 |
| 1209 | Ga0496113_0091492 | 3300048916 | Bacteria | 2345 |
| 1210 | Ga0496113_0147673 | 3300048916 | Bacteria | 1853 |
| 1211 | Ga0496113_1324230 | 3300048916 | Bacteria | 559 |
| 1212 | Ga0496113_1420521 | 3300048916 | Bacteria | 537 |
| 1213 | Ga0496114_0011526 | 3300048917 | Bacteria | 7065 |
| 1214 | Ga0496114_0041652 | 3300048917 | Bacteria | 3806 |
| 1215 | Ga0496114_0065479 | 3300048917 | Bacteria | 3045 |
| 1216 | Ga0496114_0095236 | 3300048917 | Bacteria | 2533 |
| 1217 | Ga0496114_0212790 | 3300048917 | Bacteria | 1696 |
| 1218 | Ga0496115_0078080 | 3300048918 | Bacteria | 2693 |
| 1219 | Ga0496115_0093660 | 3300048918 | Bacteria | 2457 |
| 1220 | Ga0496115_0098112 | 3300048918 | Bacteria | 2399 |
| 1221 | Ga0496115_0140263 | 3300048918 | Bacteria | 1994 |
| 1222 | Ga0496115_0217993 | 3300048918 | Bacteria | 1575 |
| 1223 | Ga0496115_0267873 | 3300048918 | Bacteria | 1404 |
| 1224 | Ga0496115_0270790 | 3300048918 | Bacteria | 1395 |
| 1225 | Ga0496115_0282430 | 3300048918 | Bacteria | 1363 |
| 1226 | Ga0496115_0454362 | 3300048918 | Bacteria | 1034 |
| 1227 | Ga0496115_0462476 | 3300048918 | Bacteria | 1023 |
| 1228 | Ga0496116_0017608 | 3300048919 | Bacteria | 5537 |
| 1229 | Ga0496116_0044500 | 3300048919 | Bacteria | 3014 |
| 1230 | Ga0496117_0000045 | 3300048920 | Bacteria | 301047 |
| 1231 | Ga0496117_0380648 | 3300048920 | Bacteria | 719 |
| 1232 | Ga0496118_0000041 | 3300048921 | Bacteria | 301047 |
| 1233 | Ga0496118_0059002 | 3300048921 | Bacteria | 2862 |
| 1234 | Ga0496121_0051062 | 3300048924 | Bacteria | 3486 |
| 1235 | Ga0496121_0134001 | 3300048924 | Bacteria | 1849 |
| 1236 | Ga0496121_0193253 | 3300048924 | Bacteria | 1457 |
| 1237 | Ga0496121_0198348 | 3300048924 | Bacteria | 1433 |
| 1238 | Ga0496121_0596685 | 3300048924 | Bacteria | 682 |
| 1239 | Ga0496122_0032256 | 3300048925 | Bacteria | 4336 |
| 1240 | Ga0496122_0036552 | 3300048925 | Bacteria | 3968 |
| 1241 | Ga0496122_0038511 | 3300048925 | Bacteria | 3829 |
| 1242 | Ga0496122_0057424 | 3300048925 | Bacteria | 2890 |
| 1243 | Ga0496122_0414699 | 3300048925 | Bacteria | 679 |
| 1244 | Ga0496123_0018844 | 3300048926 | Bacteria | 5467 |
| 1245 | Ga0496123_0028191 | 3300048926 | Bacteria | 4163 |
| 1246 | Ga0496123_0034600 | 3300048926 | Bacteria | 3615 |
| 1247 | Ga0496123_0047040 | 3300048926 | Bacteria | 2919 |
| 1248 | Ga0496123_0279648 | 3300048926 | Bacteria | 807 |
| 1249 | Ga0496124_0016097 | 3300048927 | Bacteria | 7134 |
| 1250 | Ga0496124_0064567 | 3300048927 | Bacteria | 3055 |
| 1251 | Ga0496124_0206378 | 3300048927 | Bacteria | 1490 |
| 1252 | Ga0496124_0297982 | 3300048927 | Bacteria | 1166 |
| 1253 | Ga0496124_0319355 | 3300048927 | Bacteria | 1112 |
| 1254 | Ga0496125_0040174 | 3300048928 | Bacteria | 4015 |
| 1255 | Ga0496125_0041078 | 3300048928 | Bacteria | 3959 |
| 1256 | Ga0496125_0045082 | 3300048928 | Bacteria | 3717 |
| 1257 | Ga0496125_0218463 | 3300048928 | Bacteria | 1230 |
| 1258 | Ga0496125_0243330 | 3300048928 | Bacteria | 1140 |
| 1259 | Ga0496125_0429383 | 3300048928 | Bacteria | 763 |
| 1260 | Ga0496126_0246866 | 3300048929 | Bacteria | 1489 |
| 1261 | Ga0496126_0518587 | 3300048929 | Bacteria | 950 |
| 1262 | Ga0496126_0567801 | 3300048929 | Bacteria | 898 |
| 1263 | Ga0501308_006152 | 3300049128 | Bacteria | 1221 |
| 1264 | Ga0501310_009961 | 3300049130 | Bacteria | 1054 |
| 1265 | Ga0501304_003915 | 3300049160 | Bacteria | 1111 |
| 1266 | Ga0501305_022539 | 3300049161 | Bacteria | 937 |
| 1267 | Ga0495678_000769 | 3300049459 | Bacteria | 28986 |
| 1268 | Ga0495678_001549 | 3300049459 | Bacteria | 17735 |
| 1269 | Ga0495678_002684 | 3300049459 | Bacteria | 11749 |
| 1270 | Ga0495678_017365 | 3300049459 | Bacteria | 3263 |
| 1271 | Ga0495678_017933 | 3300049459 | Bacteria | 3195 |
| 1272 | Ga0495678_019925 | 3300049459 | Bacteria | 2980 |
| 1273 | Ga0495678_021048 | 3300049459 | Bacteria | 2877 |
| 1274 | Ga0495682_0010066 | 3300049460 | Bacteria | 3672 |
| 1275 | Ga0495682_0010283 | 3300049460 | Bacteria | 3628 |
| 1276 | Ga0495682_0010389 | 3300049460 | Bacteria | 3607 |
| 1277 | Ga0495682_0012989 | 3300049460 | Bacteria | 3178 |
| 1278 | Ga0495682_0036125 | 3300049460 | Bacteria | 1819 |
| 1279 | Ga0495682_0075768 | 3300049460 | Bacteria | 1210 |
| 1280 | Ga0501290_013158 | 3300049513 | Bacteria | 1077 |
| 1281 | Ga0501312_065007 | 3300049528 | Bacteria | 638 |
| 1282 | Ga0501313_042918 | 3300049529 | Bacteria | 612 |
| 1283 | Ga0501316_076069 | 3300049532 | Bacteria | 514 |
| 1284 | Ga0501321_045258 | 3300049537 | Bacteria | 630 |
| 1285 | Ga0501323_013047 | 3300049539 | Bacteria | 1023 |
| 1286 | Ga0501032_0003171 | 3300049569 | Bacteria | 12656 |
| 1287 | Ga0501034_0009859 | 3300049571 | Bacteria | 9988 |
| 1288 | Ga0501034_0114782 | 3300049571 | Bacteria | 2682 |
| 1289 | Ga0501034_0242332 | 3300049571 | Bacteria | 1749 |
| 1290 | Ga0501036_0279472 | 3300049572 | Bacteria | 1397 |
| 1291 | Ga0501038_0007948 | 3300049574 | Bacteria | 9773 |
| 1292 | Ga0501043_0098860 | 3300049579 | Bacteria | 2294 |
| 1293 | Ga0501048_0884975 | 3300049582 | Bacteria | 642 |
| 1294 | Ga0501067_0302894 | 3300049583 | Bacteria | 890 |
| 1295 | Ga0501068_0757150 | 3300049584 | Bacteria | 636 |
| 1296 | Ga0501069_0380873 | 3300049585 | Bacteria | 833 |
| 1297 | Ga0501076_0387328 | 3300049592 | Bacteria | 1149 |
| 1298 | Ga0501222_007677 | 3300049662 | Bacteria | 1439 |
| 1299 | Ga0501238_004953 | 3300049671 | Bacteria | 1677 |
| 1300 | Ga0501240_058404 | 3300049673 | Bacteria | 676 |
| 1301 | Ga0501269_005909 | 3300049766 | Bacteria | 1473 |
| 1302 | Ga0501035_0036589 | 3300049822 | Bacteria | 4448 |
| 1303 | Ga0501035_0073224 | 3300049822 | Bacteria | 3031 |
| 1304 | Ga0501035_0443727 | 3300049822 | Bacteria | 1074 |
| 1305 | Ga0501044_0812920 | 3300049823 | Bacteria | 813 |
| 1306 | nmdc:mga0yw44_30617_c1 | 3300050492 | Bacteria | 3121 |
| 1307 | nmdc:mga0k408_63061_c1 | 3300050493 | Bacteria | 2155 |
| 1308 | nmdc:mga05p37_1065231_c1 | 3300050507 | Bacteria | 851 |
| 1309 | nmdc:mga05p37_243942_c1 | 3300050507 | Bacteria | 2158 |
| 1310 | nmdc:mga09592_65296_c1 | 3300050508 | Bacteria | 3083 |
| 1311 | nmdc:mga08y16_8362_c1 | 3300050511 | Bacteria | 10827 |
| 1312 | nmdc:mga08y16_98284_c1 | 3300050511 | Bacteria | 3048 |
| 1313 | nmdc:mga0n895_1247043_c1 | 3300050512 | Bacteria | 716 |
| 1314 | nmdc:mga0n895_382601_c1 | 3300050512 | Bacteria | 1424 |
| 1315 | nmdc:mga0rr50_128334_c1 | 3300050513 | Bacteria | 2027 |
| 1316 | nmdc:mga0rr50_76770_c1 | 3300050513 | Bacteria | 2565 |
| 1317 | nmdc:mga0rr50_962289_c1 | 3300050513 | Bacteria | 728 |
| 1318 | nmdc:mga08x19_160257_c1 | 3300050514 | Bacteria | 1528 |
| 1319 | nmdc:mga0a205_1306724_c1 | 3300050515 | Bacteria | 573 |
| 1320 | nmdc:mga0a205_194502_c1 | 3300050515 | Bacteria | 1919 |
| 1321 | Ga0495601_0017775 | 3300053077 | Bacteria | 4320 |
| 1322 | Ga0495612_0318104 | 3300053078 | Bacteria | 700 |
| 1323 | Ga0495595_0097296 | 3300053084 | Bacteria | 1418 |
| 1324 | Ga0495595_0168686 | 3300053084 | Bacteria | 1083 |
| 1325 | Ga0495619_0235247 | 3300053085 | Bacteria | 1269 |
| 1326 | Ga0500608_155571 | 3300053122 | Bacteria | 997 |
| 1327 | Ga0500618_006829 | 3300053125 | Bacteria | 3311 |
| 1328 | Ga0500574_012739 | 3300053141 | Bacteria | 1935 |
| 1329 | Ga0500600_0006158 | 3300053149 | Bacteria | 7132 |
| 1330 | Ga0500619_007351 | 3300053154 | Bacteria | 2603 |
| 1331 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 1332 | Ga0587070_026373 | 3300059491 | Bacteria | 1021 |
| 1333 | Ga0587082_062226 | 3300059504 | Bacteria | 738 |
| 1334 | Ga0587083_0103339 | 3300059505 | Bacteria | 713 |
| 1335 | Ga0587088_030882 | 3300059508 | Bacteria | 957 |
| 1336 | Ga0587090_004715 | 3300059510 | Bacteria | 1671 |
| 1337 | Ga0587125_023600 | 3300059607 | Bacteria | 743 |
| 1338 | Ga0587062_043488 | 3300059639 | Bacteria | 737 |
| 1339 | Ga0587067_017566 | 3300059640 | Bacteria | 1189 |
| 1340 | Ga0587068_000071 | 3300059641 | Bacteria | 6070 |
| 1341 | Ga0587079_022009 | 3300059647 | Bacteria | 1153 |
| 1342 | Ga0587079_058217 | 3300059647 | Bacteria | 830 |
| 1343 | Ga0587102_027498 | 3300059649 | Bacteria | 678 |
| 1344 | Ga0587107_014070 | 3300059652 | Bacteria | 1024 |
| 1345 | Ga0587071_110099 | 3300060344 | Bacteria | 647 |
| 1346 | Ga0587111_0003898 | 3300060346 | Bacteria | 2171 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021361 | Ga0213872_10000442 | Ga0213872_1000044214 | 126 |
| 2 | 3300039447 | Ga0436361_0061503 | Ga0436361_0061503_45162_45695 | 126 |
| 3 | 3300002737 | JGI25162J39368_1000091 | JGI25162J39368_100009112 | 133 |
| 4 | 3300003214 | JGI25165J46597_1000172 | JGI25165J46597_100017212 | 133 |
| 5 | 3300003751 | Ga0055538_1000063 | Ga0055538_100006380 | 133 |
| 6 | 3300003752 | Ga0055539_1000096 | Ga0055539_100009680 | 133 |
| 7 | 3300003756 | Ga0055533_1000107 | Ga0055533_100010780 | 133 |
| 8 | 3300003759 | Ga0055525_1000140 | Ga0055525_100014080 | 133 |
| 9 | 3300003841 | Ga0055541_1000064 | Ga0055541_100006480 | 133 |
| 10 | 3300015262 | Ga0182007_10008097 | Ga0182007_100080973 | 133 |
| 11 | 3300015262 | Ga0182007_10025147 | Ga0182007_100251472 | 133 |
| 12 | 3300015265 | Ga0182005_1008205 | Ga0182005_10082052 | 133 |
| 13 | 3300025207 | Ga0209760_104093 | Ga0209760_1040931 | 133 |
| 14 | 3300025224 | Ga0209784_100079 | Ga0209784_100079132 | 133 |
| 15 | 3300025225 | Ga0209566_100093 | Ga0209566_100093132 | 133 |
| 16 | 3300025226 | Ga0209674_100115 | Ga0209674_100115132 | 133 |
| 17 | 3300025230 | Ga0209563_100113 | Ga0209563_100113132 | 133 |
| 18 | 3300025231 | Ga0207427_100262 | Ga0207427_10026226 | 133 |
| 19 | 3300025233 | Ga0209437_100176 | Ga0209437_100176132 | 133 |
| 20 | 3300025253 | Ga0209677_100072 | Ga0209677_100072132 | 133 |
| 21 | 3300025261 | Ga0209233_1000183 | Ga0209233_1000183132 | 133 |
| 22 | 3300046454 | Ga0495592_0047319 | Ga0495592_0047319_1219_1695 | 133 |
| 23 | 3300046462 | Ga0495651_0053029 | Ga0495651_0053029_2499_2975 | 133 |
| 24 | 3300046462 | Ga0495651_0108525 | Ga0495651_0108525_352_828 | 133 |
| 25 | 3300046463 | Ga0495653_0014598 | Ga0495653_0014598_4392_4868 | 133 |
| 26 | 3300046511 | Ga0495608_0303761 | Ga0495608_0303761_157_633 | 133 |
| 27 | 3300046516 | Ga0495628_0004010 | Ga0495628_0004010_10018_10494 | 133 |
| 28 | 3300046516 | Ga0495628_0025764 | Ga0495628_0025764_1679_2155 | 133 |
| 29 | 3300046516 | Ga0495628_0229240 | Ga0495628_0229240_835_1311 | 133 |
| 30 | 3300046529 | Ga0495652_0073263 | Ga0495652_0073263_800_1276 | 133 |
| 31 | 3300046529 | Ga0495652_0114911 | Ga0495652_0114911_1216_1692 | 133 |
| 32 | 3300046529 | Ga0495652_0326069 | Ga0495652_0326069_56_532 | 133 |
| 33 | 3300046543 | Ga0495645_0074182 | Ga0495645_0074182_851_1327 | 133 |
| 34 | 3300046557 | Ga0495622_0264232 | Ga0495622_0264232_124_600 | 133 |
| 35 | 3300046678 | Ga0495599_0014744 | Ga0495599_0014744_2613_3089 | 133 |
| 36 | 3300046679 | Ga0495623_0204858 | Ga0495623_0204858_92_568 | 133 |
| 37 | 3300046680 | Ga0495646_0011747 | Ga0495646_0011747_2711_3187 | 133 |
| 38 | 3300046680 | Ga0495646_0072612 | Ga0495646_0072612_395_871 | 133 |
| 39 | 3300046690 | Ga0495624_0021494 | Ga0495624_0021494_1148_1624 | 133 |
| 40 | 3300046690 | Ga0495624_0817440 | Ga0495624_0817440_44_520 | 133 |
| 41 | 3300046809 | Ga0495600_0064915 | Ga0495600_0064915_514_990 | 133 |
| 42 | 3300047317 | Ga0495604_0029049 | Ga0495604_0029049_2500_2976 | 133 |
| 43 | 3300048088 | Ga0495602_0211613 | Ga0495602_0211613_115_591 | 133 |
| 44 | 3300053077 | Ga0495601_0017775 | Ga0495601_0017775_2321_2797 | 133 |
| 45 | 3300053122 | Ga0500608_155571 | Ga0500608_155571_29_505 | 133 |
| 46 | 3300053141 | Ga0500574_012739 | Ga0500574_012739_1404_1880 | 133 |
| 47 | 3300053154 | Ga0500619_007351 | Ga0500619_007351_672_1148 | 133 |
| 48 | 3300025916 | Ga0207663_10174927 | Ga0207663_101749272 | 135 |
| 49 | 3300050492 | nmdc:mga0yw44_30617_c1 | nmdc:mga0yw44_30617_c1_899_1360 | 137 |
| 50 | iso_pu_bacteria | 2857558681 | 2857563320 | 140 |
| 51 | 3300046507 | Ga0495606_0012314 | Ga0495606_0012314_2659_3186 | 142 |
| 52 | 3300048907 | Ga0496104_0407011 | Ga0496104_0407011_283_717 | 142 |
| 53 | 3300044684 | Ga0466966_0019370 | Ga0466966_0019370_713_1189 | 144 |
| 54 | 3300044719 | Ga0466971_0137791 | Ga0466971_0137791_113_589 | 144 |
| 55 | 3300005337 | Ga0070682_100036629 | Ga0070682_1000366294 | 145 |
| 56 | 3300031548 | Ga0307408_100070573 | Ga0307408_1000705733 | 145 |
| 57 | 3300037312 | Ga0395899_0019639 | Ga0395899_0019639_1511_1987 | 146 |
| 58 | 3300037418 | Ga0395900_0039845 | Ga0395900_0039845_517_993 | 146 |
| 59 | 3300037466 | Ga0395898_0026637 | Ga0395898_0026637_4775_5251 | 146 |
| 60 | 3300038443 | Ga0395901_0314025 | Ga0395901_0314025_258_734 | 146 |
| 61 | 3300049579 | Ga0501043_0098860 | Ga0501043_0098860_1829_2284 | 150 |
| 62 | 3300031251 | Ga0265327_10028337 | Ga0265327_100283373 | 151 |
| 63 | 3300005444 | Ga0070694_100599341 | Ga0070694_1005993412 | 152 |
| 64 | 3300005445 | Ga0070708_100311262 | Ga0070708_1003112622 | 152 |
| 65 | 3300005467 | Ga0070706_100196877 | Ga0070706_1001968772 | 152 |
| 66 | 3300005468 | Ga0070707_100026857 | Ga0070707_1000268577 | 152 |
| 67 | 3300005471 | Ga0070698_100107855 | Ga0070698_1001078552 | 152 |
| 68 | 3300005518 | Ga0070699_100013389 | Ga0070699_1000133891 | 152 |
| 69 | 3300005530 | Ga0070679_101153528 | Ga0070679_1011535281 | 152 |
| 70 | 3300005536 | Ga0070697_100083105 | Ga0070697_1000831052 | 152 |
| 71 | 3300005545 | Ga0070695_100399192 | Ga0070695_1003991922 | 152 |
| 72 | 3300005546 | Ga0070696_100664883 | Ga0070696_1006648831 | 152 |
| 73 | 3300006871 | Ga0075434_100053373 | Ga0075434_1000533732 | 152 |
| 74 | 3300006914 | Ga0075436_100046190 | Ga0075436_1000461902 | 152 |
| 75 | 3300007076 | Ga0075435_100946792 | Ga0075435_1009467921 | 152 |
| 76 | 3300013105 | Ga0157369_10145101 | Ga0157369_101451012 | 152 |
| 77 | 3300025910 | Ga0207684_10097803 | Ga0207684_100978032 | 152 |
| 78 | 3300025910 | Ga0207684_10213069 | Ga0207684_102130692 | 152 |
| 79 | 3300025922 | Ga0207646_10005342 | Ga0207646_100053428 | 152 |
| 80 | 3300025922 | Ga0207646_10100336 | Ga0207646_101003362 | 152 |
| 81 | 3300031548 | Ga0307408_100189269 | Ga0307408_1001892692 | 152 |
| 82 | 3300031824 | Ga0307413_10152110 | Ga0307413_101521103 | 152 |
| 83 | 3300031824 | Ga0307413_10352374 | Ga0307413_103523741 | 152 |
| 84 | 3300031824 | Ga0307413_10592313 | Ga0307413_105923131 | 152 |
| 85 | 3300031852 | Ga0307410_10091192 | Ga0307410_100911922 | 152 |
| 86 | 3300031852 | Ga0307410_10168964 | Ga0307410_101689643 | 152 |
| 87 | 3300031911 | Ga0307412_10026102 | Ga0307412_100261021 | 152 |
| 88 | 3300031995 | Ga0307409_100013944 | Ga0307409_1000139442 | 152 |
| 89 | 3300032002 | Ga0307416_100012770 | Ga0307416_1000127702 | 152 |
| 90 | 3300032004 | Ga0307414_10240273 | Ga0307414_102402732 | 152 |
| 91 | 3300032005 | Ga0307411_10116293 | Ga0307411_101162931 | 152 |
| 92 | 3300032005 | Ga0307411_10276268 | Ga0307411_102762682 | 152 |
| 93 | 3300035083 | Ga0373926_0104149 | Ga0373926_0104149_65_526 | 152 |
| 94 | 3300035695 | Ga0373927_0012113 | Ga0373927_0012113_4296_4757 | 152 |
| 95 | 3300035725 | Ga0373947_0082116 | Ga0373947_0082116_1263_1724 | 152 |
| 96 | 3300044656 | Ga0466969_0439929 | Ga0466969_0439929_12_473 | 152 |
| 97 | 3300046472 | Ga0495580_0034101 | Ga0495580_0034101_1828_2289 | 152 |
| 98 | 3300046530 | Ga0495654_0032996 | Ga0495654_0032996_1444_1905 | 152 |
| 99 | 3300046615 | Ga0495656_0119286 | Ga0495656_0119286_128_589 | 152 |
| 100 | 3300048913 | Ga0496110_1042823 | Ga0496110_1042823_10_471 | 152 |
| 101 | 3300048928 | Ga0496125_0218463 | Ga0496125_0218463_300_761 | 152 |
| 102 | 3300049532 | Ga0501316_076069 | Ga0501316_076069_42_503 | 152 |
| 103 | 3300049584 | Ga0501068_0757150 | Ga0501068_0757150_113_574 | 152 |
| 104 | 3300049585 | Ga0501069_0380873 | Ga0501069_0380873_86_547 | 152 |
| 105 | 3300050493 | nmdc:mga0k408_63061_c1 | nmdc:mga0k408_63061_c1_1184_1645 | 152 |
| 106 | 3300050507 | nmdc:mga05p37_1065231_c1 | nmdc:mga05p37_1065231_c1_48_509 | 152 |
| 107 | 3300050507 | nmdc:mga05p37_243942_c1 | nmdc:mga05p37_243942_c1_687_1148 | 152 |
| 108 | 3300050508 | nmdc:mga09592_65296_c1 | nmdc:mga09592_65296_c1_840_1301 | 152 |
| 109 | 3300050511 | nmdc:mga08y16_8362_c1 | nmdc:mga08y16_8362_c1_1965_2426 | 152 |
| 110 | 3300050512 | nmdc:mga0n895_1247043_c1 | nmdc:mga0n895_1247043_c1_119_580 | 152 |
| 111 | 3300050513 | nmdc:mga0rr50_962289_c1 | nmdc:mga0rr50_962289_c1_188_649 | 152 |
| 112 | 3300050514 | nmdc:mga08x19_160257_c1 | nmdc:mga08x19_160257_c1_1025_1486 | 152 |
| 113 | 3300050515 | nmdc:mga0a205_1306724_c1 | nmdc:mga0a205_1306724_c1_11_472 | 152 |
| 114 | iso_pu_bacteria | 2643221556 | 2643802798 | 152 |
| 115 | iso_pu_bacteria | 2643221684 | 2644472303 | 152 |
| 116 | iso_pu_bacteria | 2808606418 | 2809142734 | 152 |
| 117 | iso_pu_bacteria | 8047673197 | 8047678602 | 152 |
| 118 | iso_pu_bacteria | 2511231003 | 2511249997 | 153 |
| 119 | iso_pu_bacteria | 2511231026 | 2511387750 | 153 |
| 120 | iso_pu_bacteria | 2521172590 | 2521557298 | 153 |
| 121 | iso_pu_bacteria | 2548876994 | 2550695279 | 153 |
| 122 | iso_pu_bacteria | 2551306416 | 2553005350 | 153 |
| 123 | iso_pu_bacteria | 2600255292 | 2601669878 | 153 |
| 124 | iso_pu_bacteria | 2643221554 | 2643790989 | 153 |
| 125 | iso_pu_bacteria | 2643221603 | 2644027801 | 153 |
| 126 | iso_pu_bacteria | 2643221638 | 2644211841 | 153 |
| 127 | iso_pu_bacteria | 2643221645 | 2644251911 | 153 |
| 128 | iso_pu_bacteria | 2643221664 | 2644360561 | 153 |
| 129 | iso_pu_bacteria | 2734482258 | 2735817934 | 153 |
| 130 | iso_pu_bacteria | 2738541280 | 2738740384 | 153 |
| 131 | iso_pu_bacteria | 2738541297 | 2738828846 | 153 |
| 132 | iso_pu_bacteria | 2738541300 | 2738843365 | 153 |
| 133 | iso_pu_bacteria | 2738541357 | 2739152642 | 153 |
| 134 | iso_pu_bacteria | 2738543003 | 2739194562 | 153 |
| 135 | iso_pu_bacteria | 2738543018 | 2739275562 | 153 |
| 136 | iso_pu_bacteria | 2738543026 | 2739321038 | 153 |
| 137 | iso_pu_bacteria | 2738543029 | 2739339279 | 153 |
| 138 | iso_pu_bacteria | 2738543030 | 2739344606 | 153 |
| 139 | iso_pu_bacteria | 2739367655 | 2739610758 | 153 |
| 140 | iso_pu_bacteria | 2765235838 | 2765568426 | 153 |
| 141 | iso_pu_bacteria | 2808606386 | 2808981181 | 153 |
| 142 | iso_pu_bacteria | 2808606415 | 2809131766 | 153 |
| 143 | iso_pu_bacteria | 2808606419 | 2809151422 | 153 |
| 144 | iso_pu_bacteria | 2818991436 | 2819541233 | 153 |
| 145 | iso_pu_bacteria | 2818991445 | 2819591981 | 153 |
| 146 | iso_pu_bacteria | 2818991449 | 2819617706 | 153 |
| 147 | iso_pu_bacteria | 2821131069 | 2821133080 | 153 |
| 148 | iso_pu_bacteria | 2852618963 | 2852620903 | 153 |
| 149 | iso_pu_bacteria | 2857542790 | 2857544826 | 153 |
| 150 | iso_pu_bacteria | 2857547612 | 2857551055 | 153 |
| 151 | iso_pu_bacteria | 2857553236 | 2857558350 | 153 |
| 152 | iso_pu_bacteria | 2857564685 | 2857567277 | 153 |
| 153 | iso_pu_bacteria | 2857576091 | 2857578454 | 153 |
| 154 | iso_pu_bacteria | 2884811622 | 2884814183 | 153 |
| 155 | iso_pu_bacteria | 2884836552 | 2884840606 | 153 |
| 156 | iso_pu_bacteria | 2884852848 | 2884855863 | 153 |
| 157 | iso_pu_bacteria | 2885080285 | 2885085803 | 153 |
| 158 | iso_pu_bacteria | 2887375801 | 2887379900 | 153 |
| 159 | iso_pu_bacteria | 2896154374 | 2896157212 | 153 |
| 160 | iso_pu_bacteria | 2904424332 | 2904427282 | 153 |
| 161 | iso_pu_bacteria | 2904589729 | 2904592699 | 153 |
| 162 | iso_pu_bacteria | 2919476304 | 2919479852 | 153 |
| 163 | iso_pu_bacteria | 2932410948 | 2932413367 | 153 |
| 164 | iso_pu_bacteria | 2932416698 | 2932417427 | 153 |
| 165 | iso_pu_bacteria | 2939631187 | 2939634758 | 153 |
| 166 | 3300046810 | Ga0495660_0297654 | Ga0495660_0297654_54_524 | 155 |
| 167 | 3300003163 | Ga0006759J45824_1054708 | Ga0006759J45824_10547081 | 156 |
| 168 | 3300003574 | Ga0007410J51695_1053832 | Ga0007410J51695_10538321 | 156 |
| 169 | 3300003575 | Ga0007409J51694_1018198 | Ga0007409J51694_10181982 | 156 |
| 170 | 3300003693 | Ga0032354_1019193 | Ga0032354_10191933 | 156 |
| 171 | 3300003759 | Ga0055525_1000047 | Ga0055525_100004712 | 156 |
| 172 | 3300005262 | Ga0065165_1004294 | Ga0065165_10042946 | 156 |
| 173 | 3300005288 | Ga0065714_10011408 | Ga0065714_100114082 | 156 |
| 174 | 3300005289 | Ga0065704_10411895 | Ga0065704_104118951 | 156 |
| 175 | 3300005327 | Ga0070658_10125326 | Ga0070658_101253264 | 156 |
| 176 | 3300005329 | Ga0070683_100196994 | Ga0070683_1001969943 | 156 |
| 177 | 3300005334 | Ga0068869_100240972 | Ga0068869_1002409721 | 156 |
| 178 | 3300005336 | Ga0070680_100373284 | Ga0070680_1003732842 | 156 |
| 179 | 3300005339 | Ga0070660_100648097 | Ga0070660_1006480972 | 156 |
| 180 | 3300005347 | Ga0070668_101048454 | Ga0070668_1010484541 | 156 |
| 181 | 3300005366 | Ga0070659_100710655 | Ga0070659_1007106552 | 156 |
| 182 | 3300005455 | Ga0070663_100161556 | Ga0070663_1001615562 | 156 |
| 183 | 3300005457 | Ga0070662_100306045 | Ga0070662_1003060452 | 156 |
| 184 | 3300005457 | Ga0070662_100624662 | Ga0070662_1006246622 | 156 |
| 185 | 3300005563 | Ga0068855_100020817 | Ga0068855_1000208178 | 156 |
| 186 | 3300005564 | Ga0070664_101144409 | Ga0070664_1011444092 | 156 |
| 187 | 3300005577 | Ga0068857_100387580 | Ga0068857_1003875802 | 156 |
| 188 | 3300005578 | Ga0068854_100465311 | Ga0068854_1004653112 | 156 |
| 189 | 3300006028 | Ga0070717_10225840 | Ga0070717_102258402 | 156 |
| 190 | 3300009036 | Ga0105244_10031110 | Ga0105244_100311103 | 156 |
| 191 | 3300009093 | Ga0105240_10450415 | Ga0105240_104504152 | 156 |
| 192 | 3300009098 | Ga0105245_10319855 | Ga0105245_103198552 | 156 |
| 193 | 3300009148 | Ga0105243_10461943 | Ga0105243_104619432 | 156 |
| 194 | 3300009174 | Ga0105241_10575566 | Ga0105241_105755662 | 156 |
| 195 | 3300009176 | Ga0105242_10049831 | Ga0105242_100498312 | 156 |
| 196 | 3300009545 | Ga0105237_10314393 | Ga0105237_103143931 | 156 |
| 197 | 3300009551 | Ga0105238_10455261 | Ga0105238_104552612 | 156 |
| 198 | 3300011119 | Ga0105246_10223182 | Ga0105246_102231822 | 156 |
| 199 | 3300013100 | Ga0157373_10186762 | Ga0157373_101867622 | 156 |
| 200 | 3300013102 | Ga0157371_10000013 | Ga0157371_1000001332 | 156 |
| 201 | 3300013104 | Ga0157370_10876603 | Ga0157370_108766032 | 156 |
| 202 | 3300013296 | Ga0157374_11424835 | Ga0157374_114248351 | 156 |
| 203 | 3300013297 | Ga0157378_10050117 | Ga0157378_100501175 | 156 |
| 204 | 3300013307 | Ga0157372_11786584 | Ga0157372_117865842 | 156 |
| 205 | 3300014497 | Ga0182008_10016736 | Ga0182008_100167362 | 156 |
| 206 | 3300014497 | Ga0182008_10019024 | Ga0182008_100190242 | 156 |
| 207 | 3300015261 | Ga0182006_1000035 | Ga0182006_1000035150 | 156 |
| 208 | 3300015261 | Ga0182006_1123458 | Ga0182006_11234581 | 156 |
| 209 | 3300015261 | Ga0182006_1127791 | Ga0182006_11277911 | 156 |
| 210 | 3300015262 | Ga0182007_10000040 | Ga0182007_1000004050 | 156 |
| 211 | 3300015262 | Ga0182007_10025272 | Ga0182007_100252722 | 156 |
| 212 | 3300015265 | Ga0182005_1000025 | Ga0182005_1000025150 | 156 |
| 213 | 3300017792 | Ga0163161_10125767 | Ga0163161_101257674 | 156 |
| 214 | 3300017792 | Ga0163161_10439697 | Ga0163161_104396972 | 156 |
| 215 | 3300020081 | Ga0206354_11479432 | Ga0206354_114794321 | 156 |
| 216 | 3300025230 | Ga0209563_100003 | Ga0209563_100003542 | 156 |
| 217 | 3300025253 | Ga0209677_104819 | Ga0209677_1048195 | 156 |
| 218 | 3300025254 | Ga0209148_1001634 | Ga0209148_10016342 | 156 |
| 219 | 3300025909 | Ga0207705_10014245 | Ga0207705_100142455 | 156 |
| 220 | 3300025911 | Ga0207654_10186779 | Ga0207654_101867792 | 156 |
| 221 | 3300025912 | Ga0207707_10529626 | Ga0207707_105296262 | 156 |
| 222 | 3300025913 | Ga0207695_10176575 | Ga0207695_101765752 | 156 |
| 223 | 3300025914 | Ga0207671_11230951 | Ga0207671_112309511 | 156 |
| 224 | 3300025917 | Ga0207660_10229022 | Ga0207660_102290222 | 156 |
| 225 | 3300025921 | Ga0207652_10362395 | Ga0207652_103623952 | 156 |
| 226 | 3300025924 | Ga0207694_10602158 | Ga0207694_106021582 | 156 |
| 227 | 3300025926 | Ga0207659_10534543 | Ga0207659_105345432 | 156 |
| 228 | 3300025927 | Ga0207687_10341379 | Ga0207687_103413792 | 156 |
| 229 | 3300025932 | Ga0207690_10039891 | Ga0207690_100398912 | 156 |
| 230 | 3300025933 | Ga0207706_10323662 | Ga0207706_103236622 | 156 |
| 231 | 3300025933 | Ga0207706_10630706 | Ga0207706_106307061 | 156 |
| 232 | 3300025934 | Ga0207686_10035088 | Ga0207686_100350882 | 156 |
| 233 | 3300025935 | Ga0207709_10587787 | Ga0207709_105877872 | 156 |
| 234 | 3300025938 | Ga0207704_10042123 | Ga0207704_100421232 | 156 |
| 235 | 3300025949 | Ga0207667_10066275 | Ga0207667_100662753 | 156 |
| 236 | 3300025981 | Ga0207640_11073868 | Ga0207640_110738681 | 156 |
| 237 | 3300026041 | Ga0207639_10149553 | Ga0207639_101495534 | 156 |
| 238 | 3300026067 | Ga0207678_10117634 | Ga0207678_101176342 | 156 |
| 239 | 3300026078 | Ga0207702_10163950 | Ga0207702_101639502 | 156 |
| 240 | 3300026116 | Ga0207674_10281410 | Ga0207674_102814102 | 156 |
| 241 | 3300032004 | Ga0307414_10271035 | Ga0307414_102710352 | 156 |
| 242 | 3300032004 | Ga0307414_11195266 | Ga0307414_111952662 | 156 |
| 243 | 3300037312 | Ga0395899_0000183 | Ga0395899_0000183_83528_84001 | 156 |
| 244 | 3300037312 | Ga0395899_0047299 | Ga0395899_0047299_1990_2463 | 156 |
| 245 | 3300037312 | Ga0395899_0049915 | Ga0395899_0049915_1136_1609 | 156 |
| 246 | 3300037312 | Ga0395899_0219765 | Ga0395899_0219765_57_530 | 156 |
| 247 | 3300037418 | Ga0395900_0000331 | Ga0395900_0000331_91_564 | 156 |
| 248 | 3300037418 | Ga0395900_0005509 | Ga0395900_0005509_12456_12929 | 156 |
| 249 | 3300037418 | Ga0395900_0116900 | Ga0395900_0116900_425_898 | 156 |
| 250 | 3300037418 | Ga0395900_0328331 | Ga0395900_0328331_485_958 | 156 |
| 251 | 3300037466 | Ga0395898_0118397 | Ga0395898_0118397_1061_1534 | 156 |
| 252 | 3300037466 | Ga0395898_0187514 | Ga0395898_0187514_1152_1625 | 156 |
| 253 | 3300037471 | Ga0395905_0237236 | Ga0395905_0237236_281_760 | 156 |
| 254 | 3300037471 | Ga0395905_0245926 | Ga0395905_0245926_106_579 | 156 |
| 255 | 3300037471 | Ga0395905_0778575 | Ga0395905_0778575_146_619 | 156 |
| 256 | 3300038443 | Ga0395901_0000097 | Ga0395901_0000097_33719_34192 | 156 |
| 257 | 3300038443 | Ga0395901_0030543 | Ga0395901_0030543_1685_2158 | 156 |
| 258 | 3300038443 | Ga0395901_0236417 | Ga0395901_0236417_1256_1729 | 156 |
| 259 | 3300038443 | Ga0395901_0553519 | Ga0395901_0553519_301_774 | 156 |
| 260 | 3300038443 | Ga0395901_1443153 | Ga0395901_1443153_132_605 | 156 |
| 261 | 3300042005 | Ga0439448_0037833 | Ga0439448_0037833_240_713 | 156 |
| 262 | 3300042007 | Ga0439449_0014317 | Ga0439449_0014317_445_918 | 156 |
| 263 | 3300042011 | Ga0439454_025630 | Ga0439454_025630_381_854 | 156 |
| 264 | 3300042012 | Ga0439455_0040097 | Ga0439455_0040097_546_1019 | 156 |
| 265 | 3300042157 | Ga0439458_0004250 | Ga0439458_0004250_2379_2852 | 156 |
| 266 | 3300044658 | Ga0466972_0022289 | Ga0466972_0022289_623_1096 | 156 |
| 267 | 3300044683 | Ga0466965_0034658 | Ga0466965_0034658_1018_1491 | 156 |
| 268 | 3300044683 | Ga0466965_0052576 | Ga0466965_0052576_562_1035 | 156 |
| 269 | 3300044683 | Ga0466965_0115875 | Ga0466965_0115875_220_693 | 156 |
| 270 | 3300044684 | Ga0466966_0106606 | Ga0466966_0106606_724_1197 | 156 |
| 271 | 3300044684 | Ga0466966_0108832 | Ga0466966_0108832_891_1364 | 156 |
| 272 | 3300044684 | Ga0466966_0184175 | Ga0466966_0184175_573_1046 | 156 |
| 273 | 3300044693 | Ga0466961_0164364 | Ga0466961_0164364_862_1335 | 156 |
| 274 | 3300044706 | Ga0466964_0005584 | Ga0466964_0005584_2565_3038 | 156 |
| 275 | 3300044706 | Ga0466964_0028701 | Ga0466964_0028701_737_1210 | 156 |
| 276 | 3300044719 | Ga0466971_0022364 | Ga0466971_0022364_1951_2424 | 156 |
| 277 | 3300044719 | Ga0466971_0680257 | Ga0466971_0680257_29_502 | 156 |
| 278 | 3300044735 | Ga0466968_0005700 | Ga0466968_0005700_504_977 | 156 |
| 279 | 3300044842 | Ga0466957_0038618 | Ga0466957_0038618_1558_2031 | 156 |
| 280 | 3300045049 | Ga0466959_0157211 | Ga0466959_0157211_75_548 | 156 |
| 281 | 3300045049 | Ga0466959_0242477 | Ga0466959_0242477_475_948 | 156 |
| 282 | 3300045049 | Ga0466959_0297089 | Ga0466959_0297089_91_564 | 156 |
| 283 | 3300045049 | Ga0466959_0995015 | Ga0466959_0995015_75_548 | 156 |
| 284 | 3300045836 | Ga0466958_0337462 | Ga0466958_0337462_443_916 | 156 |
| 285 | 3300045836 | Ga0466958_0950990 | Ga0466958_0950990_54_527 | 156 |
| 286 | 3300045976 | Ga0466967_0078869 | Ga0466967_0078869_2174_2647 | 156 |
| 287 | 3300045976 | Ga0466967_0336607 | Ga0466967_0336607_551_1024 | 156 |
| 288 | 3300046452 | Ga0495617_000009 | Ga0495617_000009_149566_150039 | 156 |
| 289 | 3300046452 | Ga0495617_026010 | Ga0495617_026010_427_900 | 156 |
| 290 | 3300046453 | Ga0495627_006670 | Ga0495627_006670_1316_1789 | 156 |
| 291 | 3300046453 | Ga0495627_058943 | Ga0495627_058943_634_1107 | 156 |
| 292 | 3300046455 | Ga0495603_0037909 | Ga0495603_0037909_726_1199 | 156 |
| 293 | 3300046457 | Ga0495590_0000054 | Ga0495590_0000054_85294_85767 | 156 |
| 294 | 3300046457 | Ga0495590_0043066 | Ga0495590_0043066_1084_1557 | 156 |
| 295 | 3300046457 | Ga0495590_0050954 | Ga0495590_0050954_624_1097 | 156 |
| 296 | 3300046457 | Ga0495590_0402027 | Ga0495590_0402027_35_508 | 156 |
| 297 | 3300046458 | Ga0495591_023034 | Ga0495591_023034_92_565 | 156 |
| 298 | 3300046458 | Ga0495591_026013 | Ga0495591_026013_740_1213 | 156 |
| 299 | 3300046459 | Ga0495629_0291919 | Ga0495629_0291919_376_849 | 156 |
| 300 | 3300046460 | Ga0495638_0022607 | Ga0495638_0022607_2720_3193 | 156 |
| 301 | 3300046460 | Ga0495638_0057841 | Ga0495638_0057841_266_739 | 156 |
| 302 | 3300046463 | Ga0495653_0033179 | Ga0495653_0033179_77_550 | 156 |
| 303 | 3300046463 | Ga0495653_0043178 | Ga0495653_0043178_2102_2575 | 156 |
| 304 | 3300046471 | Ga0495650_0000593 | Ga0495650_0000593_933_1406 | 156 |
| 305 | 3300046471 | Ga0495650_0028439 | Ga0495650_0028439_42_515 | 156 |
| 306 | 3300046472 | Ga0495580_0114350 | Ga0495580_0114350_332_805 | 156 |
| 307 | 3300046473 | Ga0495582_0018828 | Ga0495582_0018828_2560_3033 | 156 |
| 308 | 3300046474 | Ga0495605_0000024 | Ga0495605_0000024_72416_72889 | 156 |
| 309 | 3300046474 | Ga0495605_0000150 | Ga0495605_0000150_86752_87225 | 156 |
| 310 | 3300046474 | Ga0495605_0015140 | Ga0495605_0015140_2414_2887 | 156 |
| 311 | 3300046474 | Ga0495605_0017715 | Ga0495605_0017715_319_792 | 156 |
| 312 | 3300046474 | Ga0495605_0020086 | Ga0495605_0020086_718_1191 | 156 |
| 313 | 3300046474 | Ga0495605_0036410 | Ga0495605_0036410_627_1100 | 156 |
| 314 | 3300046474 | Ga0495605_0096022 | Ga0495605_0096022_726_1199 | 156 |
| 315 | 3300046474 | Ga0495605_0109442 | Ga0495605_0109442_535_1008 | 156 |
| 316 | 3300046474 | Ga0495605_0263300 | Ga0495605_0263300_236_709 | 156 |
| 317 | 3300046477 | Ga0495664_0291919 | Ga0495664_0291919_337_810 | 156 |
| 318 | 3300046491 | Ga0495584_0004700 | Ga0495584_0004700_2379_2852 | 156 |
| 319 | 3300046491 | Ga0495584_0010175 | Ga0495584_0010175_2036_2509 | 156 |
| 320 | 3300046491 | Ga0495584_0018909 | Ga0495584_0018909_2456_2929 | 156 |
| 321 | 3300046491 | Ga0495584_0026934 | Ga0495584_0026934_2338_2811 | 156 |
| 322 | 3300046491 | Ga0495584_0113124 | Ga0495584_0113124_131_604 | 156 |
| 323 | 3300046491 | Ga0495584_0527994 | Ga0495584_0527994_30_503 | 156 |
| 324 | 3300046492 | Ga0495585_0000130 | Ga0495585_0000130_1197_1670 | 156 |
| 325 | 3300046492 | Ga0495585_0017853 | Ga0495585_0017853_827_1300 | 156 |
| 326 | 3300046492 | Ga0495585_0017899 | Ga0495585_0017899_2376_2849 | 156 |
| 327 | 3300046492 | Ga0495585_0021109 | Ga0495585_0021109_673_1146 | 156 |
| 328 | 3300046492 | Ga0495585_0023091 | Ga0495585_0023091_2325_2798 | 156 |
| 329 | 3300046492 | Ga0495585_0031069 | Ga0495585_0031069_120_593 | 156 |
| 330 | 3300046492 | Ga0495585_0032805 | Ga0495585_0032805_61_534 | 156 |
| 331 | 3300046492 | Ga0495585_0036668 | Ga0495585_0036668_1983_2456 | 156 |
| 332 | 3300046492 | Ga0495585_0081286 | Ga0495585_0081286_616_1089 | 156 |
| 333 | 3300046492 | Ga0495585_0099296 | Ga0495585_0099296_1039_1512 | 156 |
| 334 | 3300046492 | Ga0495585_0111604 | Ga0495585_0111604_242_715 | 156 |
| 335 | 3300046492 | Ga0495585_0124731 | Ga0495585_0124731_564_1037 | 156 |
| 336 | 3300046492 | Ga0495585_0223744 | Ga0495585_0223744_12_485 | 156 |
| 337 | 3300046492 | Ga0495585_0302855 | Ga0495585_0302855_122_595 | 156 |
| 338 | 3300046499 | Ga0495594_0011814 | Ga0495594_0011814_3693_4166 | 156 |
| 339 | 3300046499 | Ga0495594_0042316 | Ga0495594_0042316_1245_1718 | 156 |
| 340 | 3300046499 | Ga0495594_0104279 | Ga0495594_0104279_967_1440 | 156 |
| 341 | 3300046499 | Ga0495594_0130258 | Ga0495594_0130258_376_849 | 156 |
| 342 | 3300046499 | Ga0495594_0148063 | Ga0495594_0148063_382_855 | 156 |
| 343 | 3300046500 | Ga0495596_0008779 | Ga0495596_0008779_576_1049 | 156 |
| 344 | 3300046500 | Ga0495596_0011263 | Ga0495596_0011263_2674_3147 | 156 |
| 345 | 3300046500 | Ga0495596_0011276 | Ga0495596_0011276_2849_3322 | 156 |
| 346 | 3300046500 | Ga0495596_0036439 | Ga0495596_0036439_190_663 | 156 |
| 347 | 3300046500 | Ga0495596_0038300 | Ga0495596_0038300_859_1332 | 156 |
| 348 | 3300046500 | Ga0495596_0056912 | Ga0495596_0056912_733_1206 | 156 |
| 349 | 3300046500 | Ga0495596_0094647 | Ga0495596_0094647_307_780 | 156 |
| 350 | 3300046501 | Ga0495607_0006535 | Ga0495607_0006535_5412_5885 | 156 |
| 351 | 3300046501 | Ga0495607_0011899 | Ga0495607_0011899_891_1364 | 156 |
| 352 | 3300046501 | Ga0495607_0022423 | Ga0495607_0022423_3057_3530 | 156 |
| 353 | 3300046501 | Ga0495607_0027341 | Ga0495607_0027341_1565_2038 | 156 |
| 354 | 3300046501 | Ga0495607_0036400 | Ga0495607_0036400_1887_2360 | 156 |
| 355 | 3300046501 | Ga0495607_0036883 | Ga0495607_0036883_1423_1896 | 156 |
| 356 | 3300046501 | Ga0495607_0099529 | Ga0495607_0099529_408_881 | 156 |
| 357 | 3300046501 | Ga0495607_0129827 | Ga0495607_0129827_111_584 | 156 |
| 358 | 3300046501 | Ga0495607_0167811 | Ga0495607_0167811_192_665 | 156 |
| 359 | 3300046506 | Ga0495583_0003595 | Ga0495583_0003595_2374_2847 | 156 |
| 360 | 3300046506 | Ga0495583_0016161 | Ga0495583_0016161_2763_3236 | 156 |
| 361 | 3300046506 | Ga0495583_0019334 | Ga0495583_0019334_2433_2906 | 156 |
| 362 | 3300046506 | Ga0495583_0021560 | Ga0495583_0021560_802_1275 | 156 |
| 363 | 3300046506 | Ga0495583_0024000 | Ga0495583_0024000_2412_2885 | 156 |
| 364 | 3300046506 | Ga0495583_0127006 | Ga0495583_0127006_150_623 | 156 |
| 365 | 3300046506 | Ga0495583_0236223 | Ga0495583_0236223_236_709 | 156 |
| 366 | 3300046507 | Ga0495606_0000111 | Ga0495606_0000111_105006_105482 | 156 |
| 367 | 3300046507 | Ga0495606_0031807 | Ga0495606_0031807_2367_2840 | 156 |
| 368 | 3300046507 | Ga0495606_0043133 | Ga0495606_0043133_1766_2239 | 156 |
| 369 | 3300046507 | Ga0495606_0088578 | Ga0495606_0088578_1142_1615 | 156 |
| 370 | 3300046507 | Ga0495606_0098299 | Ga0495606_0098299_803_1276 | 156 |
| 371 | 3300046507 | Ga0495606_0145603 | Ga0495606_0145603_817_1290 | 156 |
| 372 | 3300046507 | Ga0495606_0161695 | Ga0495606_0161695_202_675 | 156 |
| 373 | 3300046507 | Ga0495606_0296781 | Ga0495606_0296781_58_531 | 156 |
| 374 | 3300046512 | Ga0495610_0001639 | Ga0495610_0001639_12373_12846 | 156 |
| 375 | 3300046513 | Ga0495616_0005459 | Ga0495616_0005459_4298_4771 | 156 |
| 376 | 3300046513 | Ga0495616_0016582 | Ga0495616_0016582_2621_3094 | 156 |
| 377 | 3300046513 | Ga0495616_0019296 | Ga0495616_0019296_650_1123 | 156 |
| 378 | 3300046513 | Ga0495616_0021514 | Ga0495616_0021514_1256_1729 | 156 |
| 379 | 3300046513 | Ga0495616_0027344 | Ga0495616_0027344_641_1114 | 156 |
| 380 | 3300046513 | Ga0495616_0030519 | Ga0495616_0030519_1672_2145 | 156 |
| 381 | 3300046513 | Ga0495616_0063878 | Ga0495616_0063878_1134_1607 | 156 |
| 382 | 3300046513 | Ga0495616_0123861 | Ga0495616_0123861_256_729 | 156 |
| 383 | 3300046513 | Ga0495616_0154812 | Ga0495616_0154812_546_1019 | 156 |
| 384 | 3300046515 | Ga0495620_0033837 | Ga0495620_0033837_601_1074 | 156 |
| 385 | 3300046517 | Ga0495630_0033105 | Ga0495630_0033105_2599_3072 | 156 |
| 386 | 3300046518 | Ga0495631_0006593 | Ga0495631_0006593_2700_3173 | 156 |
| 387 | 3300046518 | Ga0495631_0014519 | Ga0495631_0014519_2451_2924 | 156 |
| 388 | 3300046518 | Ga0495631_0017281 | Ga0495631_0017281_679_1152 | 156 |
| 389 | 3300046518 | Ga0495631_0039169 | Ga0495631_0039169_789_1262 | 156 |
| 390 | 3300046518 | Ga0495631_0060501 | Ga0495631_0060501_423_896 | 156 |
| 391 | 3300046518 | Ga0495631_0150013 | Ga0495631_0150013_436_909 | 156 |
| 392 | 3300046518 | Ga0495631_0167828 | Ga0495631_0167828_288_761 | 156 |
| 393 | 3300046519 | Ga0495632_0005838 | Ga0495632_0005838_5130_5603 | 156 |
| 394 | 3300046519 | Ga0495632_0015712 | Ga0495632_0015712_1684_2157 | 156 |
| 395 | 3300046519 | Ga0495632_0017969 | Ga0495632_0017969_876_1349 | 156 |
| 396 | 3300046519 | Ga0495632_0018711 | Ga0495632_0018711_882_1355 | 156 |
| 397 | 3300046519 | Ga0495632_0022036 | Ga0495632_0022036_1044_1517 | 156 |
| 398 | 3300046519 | Ga0495632_0024467 | Ga0495632_0024467_730_1203 | 156 |
| 399 | 3300046519 | Ga0495632_0033167 | Ga0495632_0033167_2131_2604 | 156 |
| 400 | 3300046519 | Ga0495632_0293983 | Ga0495632_0293983_129_602 | 156 |
| 401 | 3300046520 | Ga0495637_0000317 | Ga0495637_0000317_3733_4206 | 156 |
| 402 | 3300046520 | Ga0495637_0067719 | Ga0495637_0067719_618_1091 | 156 |
| 403 | 3300046520 | Ga0495637_0076779 | Ga0495637_0076779_246_719 | 156 |
| 404 | 3300046522 | Ga0495643_0012630 | Ga0495643_0012630_2614_3087 | 156 |
| 405 | 3300046522 | Ga0495643_0030060 | Ga0495643_0030060_52_525 | 156 |
| 406 | 3300046522 | Ga0495643_0043149 | Ga0495643_0043149_316_789 | 156 |
| 407 | 3300046522 | Ga0495643_0052223 | Ga0495643_0052223_703_1176 | 156 |
| 408 | 3300046522 | Ga0495643_0072390 | Ga0495643_0072390_523_996 | 156 |
| 409 | 3300046522 | Ga0495643_0097693 | Ga0495643_0097693_954_1427 | 156 |
| 410 | 3300046523 | Ga0495644_0005136 | Ga0495644_0005136_2263_2736 | 156 |
| 411 | 3300046523 | Ga0495644_0009052 | Ga0495644_0009052_585_1058 | 156 |
| 412 | 3300046523 | Ga0495644_0015329 | Ga0495644_0015329_1214_1687 | 156 |
| 413 | 3300046523 | Ga0495644_0084782 | Ga0495644_0084782_41_514 | 156 |
| 414 | 3300046523 | Ga0495644_0280832 | Ga0495644_0280832_80_553 | 156 |
| 415 | 3300046524 | Ga0495648_0013732 | Ga0495648_0013732_2688_3161 | 156 |
| 416 | 3300046524 | Ga0495648_0022393 | Ga0495648_0022393_2941_3414 | 156 |
| 417 | 3300046524 | Ga0495648_0030178 | Ga0495648_0030178_1680_2153 | 156 |
| 418 | 3300046524 | Ga0495648_0031398 | Ga0495648_0031398_444_917 | 156 |
| 419 | 3300046524 | Ga0495648_0060544 | Ga0495648_0060544_76_549 | 156 |
| 420 | 3300046524 | Ga0495648_0257725 | Ga0495648_0257725_156_629 | 156 |
| 421 | 3300046525 | Ga0495663_0017407 | Ga0495663_0017407_129_602 | 156 |
| 422 | 3300046526 | Ga0495666_0004837 | Ga0495666_0004837_5463_5936 | 156 |
| 423 | 3300046526 | Ga0495666_0019043 | Ga0495666_0019043_2336_2809 | 156 |
| 424 | 3300046528 | Ga0495642_0003195 | Ga0495642_0003195_5401_5874 | 156 |
| 425 | 3300046528 | Ga0495642_0009672 | Ga0495642_0009672_2248_2721 | 156 |
| 426 | 3300046528 | Ga0495642_0011766 | Ga0495642_0011766_2180_2653 | 156 |
| 427 | 3300046528 | Ga0495642_0013208 | Ga0495642_0013208_2617_3090 | 156 |
| 428 | 3300046528 | Ga0495642_0015642 | Ga0495642_0015642_1818_2291 | 156 |
| 429 | 3300046528 | Ga0495642_0016149 | Ga0495642_0016149_1534_2007 | 156 |
| 430 | 3300046528 | Ga0495642_0018647 | Ga0495642_0018647_944_1417 | 156 |
| 431 | 3300046528 | Ga0495642_0038628 | Ga0495642_0038628_280_753 | 156 |
| 432 | 3300046528 | Ga0495642_0054932 | Ga0495642_0054932_500_973 | 156 |
| 433 | 3300046528 | Ga0495642_0551544 | Ga0495642_0551544_11_484 | 156 |
| 434 | 3300046529 | Ga0495652_0049885 | Ga0495652_0049885_3076_3549 | 156 |
| 435 | 3300046530 | Ga0495654_0034077 | Ga0495654_0034077_1136_1609 | 156 |
| 436 | 3300046530 | Ga0495654_0074326 | Ga0495654_0074326_318_791 | 156 |
| 437 | 3300046530 | Ga0495654_0236393 | Ga0495654_0236393_261_734 | 156 |
| 438 | 3300046531 | Ga0495665_0071333 | Ga0495665_0071333_767_1240 | 156 |
| 439 | 3300046531 | Ga0495665_0160698 | Ga0495665_0160698_166_639 | 156 |
| 440 | 3300046531 | Ga0495665_0200130 | Ga0495665_0200130_436_909 | 156 |
| 441 | 3300046533 | Ga0495640_0194312 | Ga0495640_0194312_433_906 | 156 |
| 442 | 3300046535 | Ga0495586_0028869 | Ga0495586_0028869_648_1121 | 156 |
| 443 | 3300046535 | Ga0495586_0061876 | Ga0495586_0061876_188_661 | 156 |
| 444 | 3300046536 | Ga0495587_0021577 | Ga0495587_0021577_963_1436 | 156 |
| 445 | 3300046536 | Ga0495587_0035530 | Ga0495587_0035530_858_1331 | 156 |
| 446 | 3300046538 | Ga0495609_0000030 | Ga0495609_0000030_87719_88192 | 156 |
| 447 | 3300046538 | Ga0495609_0010610 | Ga0495609_0010610_3001_3474 | 156 |
| 448 | 3300046538 | Ga0495609_0018320 | Ga0495609_0018320_211_684 | 156 |
| 449 | 3300046538 | Ga0495609_0035248 | Ga0495609_0035248_376_849 | 156 |
| 450 | 3300046538 | Ga0495609_0040781 | Ga0495609_0040781_970_1443 | 156 |
| 451 | 3300046538 | Ga0495609_0046675 | Ga0495609_0046675_1098_1571 | 156 |
| 452 | 3300046538 | Ga0495609_0054568 | Ga0495609_0054568_953_1426 | 156 |
| 453 | 3300046538 | Ga0495609_0065072 | Ga0495609_0065072_321_794 | 156 |
| 454 | 3300046538 | Ga0495609_0072288 | Ga0495609_0072288_518_991 | 156 |
| 455 | 3300046538 | Ga0495609_0117049 | Ga0495609_0117049_379_852 | 156 |
| 456 | 3300046538 | Ga0495609_0282615 | Ga0495609_0282615_26_499 | 156 |
| 457 | 3300046542 | Ga0495597_0013175 | Ga0495597_0013175_2406_2879 | 156 |
| 458 | 3300046542 | Ga0495597_0014538 | Ga0495597_0014538_1294_1767 | 156 |
| 459 | 3300046542 | Ga0495597_0021593 | Ga0495597_0021593_1579_2052 | 156 |
| 460 | 3300046542 | Ga0495597_0026824 | Ga0495597_0026824_455_928 | 156 |
| 461 | 3300046542 | Ga0495597_0056360 | Ga0495597_0056360_784_1257 | 156 |
| 462 | 3300046542 | Ga0495597_0058946 | Ga0495597_0058946_48_521 | 156 |
| 463 | 3300046543 | Ga0495645_0128066 | Ga0495645_0128066_797_1270 | 156 |
| 464 | 3300046543 | Ga0495645_0250011 | Ga0495645_0250011_17_490 | 156 |
| 465 | 3300046557 | Ga0495622_0050467 | Ga0495622_0050467_1082_1555 | 156 |
| 466 | 3300046557 | Ga0495622_0132103 | Ga0495622_0132103_11_484 | 156 |
| 467 | 3300046557 | Ga0495622_0138112 | Ga0495622_0138112_31_504 | 156 |
| 468 | 3300046558 | Ga0495633_0000271 | Ga0495633_0000271_854_1330 | 156 |
| 469 | 3300046558 | Ga0495633_0018039 | Ga0495633_0018039_690_1163 | 156 |
| 470 | 3300046558 | Ga0495633_0019858 | Ga0495633_0019858_2040_2513 | 156 |
| 471 | 3300046558 | Ga0495633_0033219 | Ga0495633_0033219_16_489 | 156 |
| 472 | 3300046558 | Ga0495633_0061485 | Ga0495633_0061485_512_985 | 156 |
| 473 | 3300046558 | Ga0495633_0087407 | Ga0495633_0087407_394_867 | 156 |
| 474 | 3300046558 | Ga0495633_0383003 | Ga0495633_0383003_92_565 | 156 |
| 475 | 3300046558 | Ga0495633_0434349 | Ga0495633_0434349_26_499 | 156 |
| 476 | 3300046615 | Ga0495656_0046119 | Ga0495656_0046119_168_641 | 156 |
| 477 | 3300046615 | Ga0495656_0106956 | Ga0495656_0106956_521_994 | 156 |
| 478 | 3300046615 | Ga0495656_0123765 | Ga0495656_0123765_45_518 | 156 |
| 479 | 3300046616 | Ga0495668_0002794 | Ga0495668_0002794_2935_3408 | 156 |
| 480 | 3300046616 | Ga0495668_0019080 | Ga0495668_0019080_964_1437 | 156 |
| 481 | 3300046616 | Ga0495668_0020751 | Ga0495668_0020751_699_1172 | 156 |
| 482 | 3300046616 | Ga0495668_0026520 | Ga0495668_0026520_2255_2728 | 156 |
| 483 | 3300046616 | Ga0495668_0052616 | Ga0495668_0052616_1055_1528 | 156 |
| 484 | 3300046616 | Ga0495668_0057592 | Ga0495668_0057592_670_1143 | 156 |
| 485 | 3300046616 | Ga0495668_0083035 | Ga0495668_0083035_274_747 | 156 |
| 486 | 3300046616 | Ga0495668_0090100 | Ga0495668_0090100_491_964 | 156 |
| 487 | 3300046616 | Ga0495668_0126074 | Ga0495668_0126074_578_1051 | 156 |
| 488 | 3300046616 | Ga0495668_0130157 | Ga0495668_0130157_878_1351 | 156 |
| 489 | 3300046616 | Ga0495668_0177276 | Ga0495668_0177276_187_660 | 156 |
| 490 | 3300046642 | Ga0495634_0030867 | Ga0495634_0030867_647_1120 | 156 |
| 491 | 3300046648 | Ga0495611_0000944 | Ga0495611_0000944_409_882 | 156 |
| 492 | 3300046648 | Ga0495611_0017645 | Ga0495611_0017645_1162_1635 | 156 |
| 493 | 3300046648 | Ga0495611_0021885 | Ga0495611_0021885_308_781 | 156 |
| 494 | 3300046648 | Ga0495611_0054713 | Ga0495611_0054713_1042_1563 | 156 |
| 495 | 3300046648 | Ga0495611_0067049 | Ga0495611_0067049_875_1348 | 156 |
| 496 | 3300046648 | Ga0495611_0073910 | Ga0495611_0073910_125_598 | 156 |
| 497 | 3300046660 | Ga0495625_0072104 | Ga0495625_0072104_1900_2373 | 156 |
| 498 | 3300046660 | Ga0495625_0169698 | Ga0495625_0169698_723_1196 | 156 |
| 499 | 3300046660 | Ga0495625_0186107 | Ga0495625_0186107_138_611 | 156 |
| 500 | 3300046660 | Ga0495625_0219210 | Ga0495625_0219210_560_1033 | 156 |
| 501 | 3300046660 | Ga0495625_0231242 | Ga0495625_0231242_713_1186 | 156 |
| 502 | 3300046663 | Ga0495635_0001055 | Ga0495635_0001055_16921_17394 | 156 |
| 503 | 3300046665 | Ga0495661_0003016 | Ga0495661_0003016_6465_6938 | 156 |
| 504 | 3300046665 | Ga0495661_0023036 | Ga0495661_0023036_1253_1726 | 156 |
| 505 | 3300046665 | Ga0495661_0026310 | Ga0495661_0026310_573_1046 | 156 |
| 506 | 3300046665 | Ga0495661_0038432 | Ga0495661_0038432_271_744 | 156 |
| 507 | 3300046665 | Ga0495661_0054848 | Ga0495661_0054848_605_1078 | 156 |
| 508 | 3300046665 | Ga0495661_0097043 | Ga0495661_0097043_723_1196 | 156 |
| 509 | 3300046665 | Ga0495661_0108389 | Ga0495661_0108389_645_1118 | 156 |
| 510 | 3300046665 | Ga0495661_0114471 | Ga0495661_0114471_728_1201 | 156 |
| 511 | 3300046665 | Ga0495661_0183882 | Ga0495661_0183882_421_894 | 156 |
| 512 | 3300046665 | Ga0495661_0218491 | Ga0495661_0218491_102_575 | 156 |
| 513 | 3300046665 | Ga0495661_0238678 | Ga0495661_0238678_125_598 | 156 |
| 514 | 3300046665 | Ga0495661_0395773 | Ga0495661_0395773_24_497 | 156 |
| 515 | 3300046665 | Ga0495661_0400422 | Ga0495661_0400422_93_566 | 156 |
| 516 | 3300046674 | Ga0495588_0000078 | Ga0495588_0000078_27235_27708 | 156 |
| 517 | 3300046674 | Ga0495588_0007873 | Ga0495588_0007873_312_785 | 156 |
| 518 | 3300046674 | Ga0495588_0021100 | Ga0495588_0021100_746_1219 | 156 |
| 519 | 3300046674 | Ga0495588_0031883 | Ga0495588_0031883_493_966 | 156 |
| 520 | 3300046674 | Ga0495588_0053202 | Ga0495588_0053202_1216_1689 | 156 |
| 521 | 3300046674 | Ga0495588_0053879 | Ga0495588_0053879_1105_1578 | 156 |
| 522 | 3300046674 | Ga0495588_0078835 | Ga0495588_0078835_259_732 | 156 |
| 523 | 3300046674 | Ga0495588_0345264 | Ga0495588_0345264_114_587 | 156 |
| 524 | 3300046678 | Ga0495599_0407877 | Ga0495599_0407877_305_778 | 156 |
| 525 | 3300046679 | Ga0495623_0033704 | Ga0495623_0033704_730_1203 | 156 |
| 526 | 3300046679 | Ga0495623_0144758 | Ga0495623_0144758_787_1260 | 156 |
| 527 | 3300046679 | Ga0495623_0551682 | Ga0495623_0551682_61_534 | 156 |
| 528 | 3300046680 | Ga0495646_0038428 | Ga0495646_0038428_2352_2825 | 156 |
| 529 | 3300046684 | Ga0495669_0000057 | Ga0495669_0000057_74301_74774 | 156 |
| 530 | 3300046684 | Ga0495669_0010183 | Ga0495669_0010183_674_1147 | 156 |
| 531 | 3300046684 | Ga0495669_0023293 | Ga0495669_0023293_247_720 | 156 |
| 532 | 3300046684 | Ga0495669_0025438 | Ga0495669_0025438_1004_1477 | 156 |
| 533 | 3300046684 | Ga0495669_0064491 | Ga0495669_0064491_998_1471 | 156 |
| 534 | 3300046689 | Ga0495613_0149515 | Ga0495613_0149515_475_948 | 156 |
| 535 | 3300046691 | Ga0495670_0041936 | Ga0495670_0041936_1141_1614 | 156 |
| 536 | 3300046691 | Ga0495670_0050890 | Ga0495670_0050890_653_1126 | 156 |
| 537 | 3300046691 | Ga0495670_0082759 | Ga0495670_0082759_499_972 | 156 |
| 538 | 3300046691 | Ga0495670_0191456 | Ga0495670_0191456_594_1067 | 156 |
| 539 | 3300046691 | Ga0495670_0422068 | Ga0495670_0422068_49_522 | 156 |
| 540 | 3300046691 | Ga0495670_0503078 | Ga0495670_0503078_145_618 | 156 |
| 541 | 3300046692 | Ga0495671_0014453 | Ga0495671_0014453_1062_1535 | 156 |
| 542 | 3300046692 | Ga0495671_0123409 | Ga0495671_0123409_403_876 | 156 |
| 543 | 3300046694 | Ga0495649_0007358 | Ga0495649_0007358_3053_3526 | 156 |
| 544 | 3300046694 | Ga0495649_0016251 | Ga0495649_0016251_598_1071 | 156 |
| 545 | 3300046694 | Ga0495649_0063095 | Ga0495649_0063095_353_826 | 156 |
| 546 | 3300046694 | Ga0495649_0079616 | Ga0495649_0079616_534_1007 | 156 |
| 547 | 3300046694 | Ga0495649_0163013 | Ga0495649_0163013_439_912 | 156 |
| 548 | 3300046694 | Ga0495649_0250581 | Ga0495649_0250581_352_825 | 156 |
| 549 | 3300046794 | Ga0495589_0000021 | Ga0495589_0000021_88019_88492 | 156 |
| 550 | 3300046794 | Ga0495589_0000193 | Ga0495589_0000193_31031_31504 | 156 |
| 551 | 3300046794 | Ga0495589_0015027 | Ga0495589_0015027_714_1187 | 156 |
| 552 | 3300046794 | Ga0495589_0018583 | Ga0495589_0018583_2127_2600 | 156 |
| 553 | 3300046794 | Ga0495589_0019463 | Ga0495589_0019463_1605_2078 | 156 |
| 554 | 3300046794 | Ga0495589_0024338 | Ga0495589_0024338_2289_2762 | 156 |
| 555 | 3300046794 | Ga0495589_0026665 | Ga0495589_0026665_1919_2392 | 156 |
| 556 | 3300046794 | Ga0495589_0029213 | Ga0495589_0029213_857_1330 | 156 |
| 557 | 3300046794 | Ga0495589_0029794 | Ga0495589_0029794_874_1347 | 156 |
| 558 | 3300046794 | Ga0495589_0033697 | Ga0495589_0033697_212_685 | 156 |
| 559 | 3300046794 | Ga0495589_0096889 | Ga0495589_0096889_563_1036 | 156 |
| 560 | 3300046794 | Ga0495589_0156361 | Ga0495589_0156361_456_929 | 156 |
| 561 | 3300046809 | Ga0495600_0043503 | Ga0495600_0043503_1858_2331 | 156 |
| 562 | 3300046810 | Ga0495660_0006653 | Ga0495660_0006653_1943_2416 | 156 |
| 563 | 3300046810 | Ga0495660_0018126 | Ga0495660_0018126_2603_3076 | 156 |
| 564 | 3300046810 | Ga0495660_0033020 | Ga0495660_0033020_262_735 | 156 |
| 565 | 3300046810 | Ga0495660_0045751 | Ga0495660_0045751_134_607 | 156 |
| 566 | 3300046810 | Ga0495660_0064519 | Ga0495660_0064519_1169_1642 | 156 |
| 567 | 3300046810 | Ga0495660_0095304 | Ga0495660_0095304_731_1204 | 156 |
| 568 | 3300046810 | Ga0495660_0102597 | Ga0495660_0102597_940_1413 | 156 |
| 569 | 3300046810 | Ga0495660_0103292 | Ga0495660_0103292_26_499 | 156 |
| 570 | 3300046810 | Ga0495660_0170138 | Ga0495660_0170138_419_892 | 156 |
| 571 | 3300047315 | Ga0495581_0024181 | Ga0495581_0024181_2645_3118 | 156 |
| 572 | 3300047317 | Ga0495604_0035632 | Ga0495604_0035632_716_1189 | 156 |
| 573 | 3300047317 | Ga0495604_0091755 | Ga0495604_0091755_1443_1916 | 156 |
| 574 | 3300047317 | Ga0495604_0612328 | Ga0495604_0612328_88_561 | 156 |
| 575 | 3300047319 | Ga0495674_1043329 | Ga0495674_1043329_75_548 | 156 |
| 576 | 3300047320 | Ga0495672_0000178 | Ga0495672_0000178_75528_76001 | 156 |
| 577 | 3300047320 | Ga0495672_0008348 | Ga0495672_0008348_6206_6679 | 156 |
| 578 | 3300047320 | Ga0495672_0019596 | Ga0495672_0019596_985_1458 | 156 |
| 579 | 3300047320 | Ga0495672_0024609 | Ga0495672_0024609_1371_1844 | 156 |
| 580 | 3300047320 | Ga0495672_0115555 | Ga0495672_0115555_813_1286 | 156 |
| 581 | 3300047321 | Ga0495676_0037581 | Ga0495676_0037581_945_1418 | 156 |
| 582 | 3300047321 | Ga0495676_0117394 | Ga0495676_0117394_845_1318 | 156 |
| 583 | 3300047322 | Ga0495680_0045790 | Ga0495680_0045790_2452_2925 | 156 |
| 584 | 3300047322 | Ga0495680_0240671 | Ga0495680_0240671_109_582 | 156 |
| 585 | 3300047323 | Ga0495683_0001145 | Ga0495683_0001145_14598_15071 | 156 |
| 586 | 3300047323 | Ga0495683_0012100 | Ga0495683_0012100_2186_2659 | 156 |
| 587 | 3300047323 | Ga0495683_0072006 | Ga0495683_0072006_484_957 | 156 |
| 588 | 3300047323 | Ga0495683_0100586 | Ga0495683_0100586_428_901 | 156 |
| 589 | 3300047323 | Ga0495683_0103684 | Ga0495683_0103684_328_801 | 156 |
| 590 | 3300047323 | Ga0495683_0147789 | Ga0495683_0147789_285_758 | 156 |
| 591 | 3300047443 | Ga0495687_000012 | Ga0495687_000012_326668_327141 | 156 |
| 592 | 3300047443 | Ga0495687_000407 | Ga0495687_000407_2991_3464 | 156 |
| 593 | 3300047443 | Ga0495687_010545 | Ga0495687_010545_1724_2197 | 156 |
| 594 | 3300047443 | Ga0495687_010619 | Ga0495687_010619_1928_2401 | 156 |
| 595 | 3300047443 | Ga0495687_017002 | Ga0495687_017002_1089_1562 | 156 |
| 596 | 3300047443 | Ga0495687_025311 | Ga0495687_025311_1925_2398 | 156 |
| 597 | 3300047443 | Ga0495687_087608 | Ga0495687_087608_44_517 | 156 |
| 598 | 3300047444 | Ga0495675_0023477 | Ga0495675_0023477_2274_2747 | 156 |
| 599 | 3300047444 | Ga0495675_0053941 | Ga0495675_0053941_1712_2185 | 156 |
| 600 | 3300047444 | Ga0495675_0146055 | Ga0495675_0146055_332_805 | 156 |
| 601 | 3300047444 | Ga0495675_0515171 | Ga0495675_0515171_71_544 | 156 |
| 602 | 3300047445 | Ga0495677_0000029 | Ga0495677_0000029_2990_3463 | 156 |
| 603 | 3300047445 | Ga0495677_0009885 | Ga0495677_0009885_602_1075 | 156 |
| 604 | 3300047445 | Ga0495677_0013909 | Ga0495677_0013909_2381_2854 | 156 |
| 605 | 3300047445 | Ga0495677_0031852 | Ga0495677_0031852_294_767 | 156 |
| 606 | 3300047445 | Ga0495677_0033060 | Ga0495677_0033060_727_1200 | 156 |
| 607 | 3300047445 | Ga0495677_0039358 | Ga0495677_0039358_961_1434 | 156 |
| 608 | 3300047445 | Ga0495677_0073660 | Ga0495677_0073660_104_577 | 156 |
| 609 | 3300047445 | Ga0495677_0175767 | Ga0495677_0175767_154_627 | 156 |
| 610 | 3300047445 | Ga0495677_0204131 | Ga0495677_0204131_66_539 | 156 |
| 611 | 3300047445 | Ga0495677_0273381 | Ga0495677_0273381_118_591 | 156 |
| 612 | 3300047446 | Ga0495679_006393 | Ga0495679_006393_3391_3864 | 156 |
| 613 | 3300047446 | Ga0495679_013445 | Ga0495679_013445_1901_2374 | 156 |
| 614 | 3300047446 | Ga0495679_038255 | Ga0495679_038255_872_1345 | 156 |
| 615 | 3300047446 | Ga0495679_090912 | Ga0495679_090912_170_643 | 156 |
| 616 | 3300047447 | Ga0495685_017538 | Ga0495685_017538_35_508 | 156 |
| 617 | 3300047447 | Ga0495685_045059 | Ga0495685_045059_848_1321 | 156 |
| 618 | 3300047447 | Ga0495685_087144 | Ga0495685_087144_393_866 | 156 |
| 619 | 3300047469 | Ga0495673_0068348 | Ga0495673_0068348_905_1378 | 156 |
| 620 | 3300047470 | Ga0495681_0016324 | Ga0495681_0016324_834_1307 | 156 |
| 621 | 3300047470 | Ga0495681_0017670 | Ga0495681_0017670_2459_2932 | 156 |
| 622 | 3300047470 | Ga0495681_0020448 | Ga0495681_0020448_954_1427 | 156 |
| 623 | 3300047470 | Ga0495681_0030366 | Ga0495681_0030366_385_858 | 156 |
| 624 | 3300047470 | Ga0495681_0053925 | Ga0495681_0053925_1115_1588 | 156 |
| 625 | 3300047470 | Ga0495681_0063129 | Ga0495681_0063129_960_1433 | 156 |
| 626 | 3300047470 | Ga0495681_0134559 | Ga0495681_0134559_283_756 | 156 |
| 627 | 3300047470 | Ga0495681_0203622 | Ga0495681_0203622_194_667 | 156 |
| 628 | 3300047472 | Ga0495686_0000738 | Ga0495686_0000738_39865_40338 | 156 |
| 629 | 3300047472 | Ga0495686_0008189 | Ga0495686_0008189_2831_3304 | 156 |
| 630 | 3300047472 | Ga0495686_0050961 | Ga0495686_0050961_1446_1922 | 156 |
| 631 | 3300047472 | Ga0495686_0095474 | Ga0495686_0095474_481_954 | 156 |
| 632 | 3300047673 | Ga0495593_0015115 | Ga0495593_0015115_1082_1555 | 156 |
| 633 | 3300047673 | Ga0495593_0120015 | Ga0495593_0120015_147_620 | 156 |
| 634 | 3300048088 | Ga0495602_0059295 | Ga0495602_0059295_2331_2804 | 156 |
| 635 | 3300048088 | Ga0495602_0165470 | Ga0495602_0165470_647_1120 | 156 |
| 636 | 3300048089 | Ga0495614_0003050 | Ga0495614_0003050_2614_3087 | 156 |
| 637 | 3300048089 | Ga0495614_0052023 | Ga0495614_0052023_558_1031 | 156 |
| 638 | 3300048091 | Ga0495626_0000017 | Ga0495626_0000017_230283_230756 | 156 |
| 639 | 3300048091 | Ga0495626_0000028 | Ga0495626_0000028_200945_201418 | 156 |
| 640 | 3300048091 | Ga0495626_0009200 | Ga0495626_0009200_2490_2963 | 156 |
| 641 | 3300048091 | Ga0495626_0016880 | Ga0495626_0016880_2438_2911 | 156 |
| 642 | 3300048091 | Ga0495626_0020411 | Ga0495626_0020411_1664_2137 | 156 |
| 643 | 3300048091 | Ga0495626_0032667 | Ga0495626_0032667_673_1146 | 156 |
| 644 | 3300048091 | Ga0495626_0037023 | Ga0495626_0037023_816_1289 | 156 |
| 645 | 3300048091 | Ga0495626_0038291 | Ga0495626_0038291_348_821 | 156 |
| 646 | 3300048091 | Ga0495626_0042808 | Ga0495626_0042808_1259_1732 | 156 |
| 647 | 3300048091 | Ga0495626_0045212 | Ga0495626_0045212_1093_1566 | 156 |
| 648 | 3300048091 | Ga0495626_0053144 | Ga0495626_0053144_1120_1593 | 156 |
| 649 | 3300048091 | Ga0495626_0056957 | Ga0495626_0056957_825_1298 | 156 |
| 650 | 3300048091 | Ga0495626_0072865 | Ga0495626_0072865_614_1087 | 156 |
| 651 | 3300048091 | Ga0495626_0074583 | Ga0495626_0074583_111_584 | 156 |
| 652 | 3300048091 | Ga0495626_0113461 | Ga0495626_0113461_630_1103 | 156 |
| 653 | 3300048091 | Ga0495626_0115701 | Ga0495626_0115701_35_508 | 156 |
| 654 | 3300048091 | Ga0495626_0160139 | Ga0495626_0160139_139_612 | 156 |
| 655 | 3300048091 | Ga0495626_0218578 | Ga0495626_0218578_209_682 | 156 |
| 656 | 3300048903 | Ga0496100_0150897 | Ga0496100_0150897_998_1471 | 156 |
| 657 | 3300048903 | Ga0496100_0604127 | Ga0496100_0604127_202_675 | 156 |
| 658 | 3300048903 | Ga0496100_1011616 | Ga0496100_1011616_135_608 | 156 |
| 659 | 3300048905 | Ga0496102_0000198 | Ga0496102_0000198_75678_76151 | 156 |
| 660 | 3300048905 | Ga0496102_0213392 | Ga0496102_0213392_552_1025 | 156 |
| 661 | 3300048905 | Ga0496102_0246002 | Ga0496102_0246002_312_785 | 156 |
| 662 | 3300048905 | Ga0496102_0282195 | Ga0496102_0282195_751_1224 | 156 |
| 663 | 3300048906 | Ga0496103_0210807 | Ga0496103_0210807_488_961 | 156 |
| 664 | 3300048906 | Ga0496103_0293764 | Ga0496103_0293764_189_662 | 156 |
| 665 | 3300048908 | Ga0496105_0107014 | Ga0496105_0107014_1825_2298 | 156 |
| 666 | 3300048908 | Ga0496105_0181153 | Ga0496105_0181153_1225_1698 | 156 |
| 667 | 3300048908 | Ga0496105_0207257 | Ga0496105_0207257_729_1202 | 156 |
| 668 | 3300048909 | Ga0496106_0325155 | Ga0496106_0325155_566_1039 | 156 |
| 669 | 3300048910 | Ga0496107_0057289 | Ga0496107_0057289_219_692 | 156 |
| 670 | 3300048911 | Ga0496108_0213912 | Ga0496108_0213912_512_985 | 156 |
| 671 | 3300048911 | Ga0496108_0620238 | Ga0496108_0620238_20_493 | 156 |
| 672 | 3300048912 | Ga0496109_0069130 | Ga0496109_0069130_388_861 | 156 |
| 673 | 3300048912 | Ga0496109_0702029 | Ga0496109_0702029_459_932 | 156 |
| 674 | 3300048913 | Ga0496110_0017718 | Ga0496110_0017718_3264_3737 | 156 |
| 675 | 3300048913 | Ga0496110_1253604 | Ga0496110_1253604_17_490 | 156 |
| 676 | 3300048914 | Ga0496111_0027877 | Ga0496111_0027877_1017_1493 | 156 |
| 677 | 3300048916 | Ga0496113_0033447 | Ga0496113_0033447_1641_2114 | 156 |
| 678 | 3300048916 | Ga0496113_0147673 | Ga0496113_0147673_1042_1515 | 156 |
| 679 | 3300048917 | Ga0496114_0065479 | Ga0496114_0065479_1230_1703 | 156 |
| 680 | 3300048918 | Ga0496115_0140263 | Ga0496115_0140263_1377_1850 | 156 |
| 681 | 3300048919 | Ga0496116_0017608 | Ga0496116_0017608_3943_4419 | 156 |
| 682 | 3300048920 | Ga0496117_0000045 | Ga0496117_0000045_70812_71288 | 156 |
| 683 | 3300048920 | Ga0496117_0380648 | Ga0496117_0380648_94_567 | 156 |
| 684 | 3300048921 | Ga0496118_0000041 | Ga0496118_0000041_70812_71288 | 156 |
| 685 | 3300048924 | Ga0496121_0134001 | Ga0496121_0134001_288_761 | 156 |
| 686 | 3300048924 | Ga0496121_0198348 | Ga0496121_0198348_226_699 | 156 |
| 687 | 3300048925 | Ga0496122_0032256 | Ga0496122_0032256_1192_1665 | 156 |
| 688 | 3300048925 | Ga0496122_0036552 | Ga0496122_0036552_2700_3176 | 156 |
| 689 | 3300048925 | Ga0496122_0057424 | Ga0496122_0057424_2369_2842 | 156 |
| 690 | 3300048925 | Ga0496122_0414699 | Ga0496122_0414699_174_647 | 156 |
| 691 | 3300048926 | Ga0496123_0028191 | Ga0496123_0028191_2637_3113 | 156 |
| 692 | 3300048926 | Ga0496123_0034600 | Ga0496123_0034600_2756_3229 | 156 |
| 693 | 3300048926 | Ga0496123_0047040 | Ga0496123_0047040_1569_2042 | 156 |
| 694 | 3300048926 | Ga0496123_0279648 | Ga0496123_0279648_266_739 | 156 |
| 695 | 3300048927 | Ga0496124_0016097 | Ga0496124_0016097_933_1406 | 156 |
| 696 | 3300048927 | Ga0496124_0064567 | Ga0496124_0064567_1038_1514 | 156 |
| 697 | 3300048927 | Ga0496124_0297982 | Ga0496124_0297982_404_877 | 156 |
| 698 | 3300048927 | Ga0496124_0319355 | Ga0496124_0319355_172_645 | 156 |
| 699 | 3300048928 | Ga0496125_0040174 | Ga0496125_0040174_901_1374 | 156 |
| 700 | 3300048928 | Ga0496125_0045082 | Ga0496125_0045082_2528_3001 | 156 |
| 701 | 3300048928 | Ga0496125_0429383 | Ga0496125_0429383_88_561 | 156 |
| 702 | 3300048929 | Ga0496126_0246866 | Ga0496126_0246866_627_1100 | 156 |
| 703 | 3300048929 | Ga0496126_0518587 | Ga0496126_0518587_347_820 | 156 |
| 704 | 3300048929 | Ga0496126_0567801 | Ga0496126_0567801_364_840 | 156 |
| 705 | 3300049128 | Ga0501308_006152 | Ga0501308_006152_587_1060 | 156 |
| 706 | 3300049160 | Ga0501304_003915 | Ga0501304_003915_583_1056 | 156 |
| 707 | 3300049459 | Ga0495678_000769 | Ga0495678_000769_25322_25795 | 156 |
| 708 | 3300049459 | Ga0495678_001549 | Ga0495678_001549_2236_2709 | 156 |
| 709 | 3300049459 | Ga0495678_017365 | Ga0495678_017365_356_829 | 156 |
| 710 | 3300049459 | Ga0495678_019925 | Ga0495678_019925_636_1109 | 156 |
| 711 | 3300049459 | Ga0495678_021048 | Ga0495678_021048_2286_2759 | 156 |
| 712 | 3300049460 | Ga0495682_0010066 | Ga0495682_0010066_853_1326 | 156 |
| 713 | 3300049460 | Ga0495682_0010283 | Ga0495682_0010283_1925_2398 | 156 |
| 714 | 3300049460 | Ga0495682_0010389 | Ga0495682_0010389_872_1345 | 156 |
| 715 | 3300049460 | Ga0495682_0012989 | Ga0495682_0012989_791_1267 | 156 |
| 716 | 3300049460 | Ga0495682_0036125 | Ga0495682_0036125_509_982 | 156 |
| 717 | 3300049460 | Ga0495682_0075768 | Ga0495682_0075768_157_630 | 156 |
| 718 | 3300049537 | Ga0501321_045258 | Ga0501321_045258_102_575 | 156 |
| 719 | 3300049571 | Ga0501034_0242332 | Ga0501034_0242332_973_1446 | 156 |
| 720 | 3300049572 | Ga0501036_0279472 | Ga0501036_0279472_246_719 | 156 |
| 721 | 3300049662 | Ga0501222_007677 | Ga0501222_007677_243_716 | 156 |
| 722 | 3300049822 | Ga0501035_0073224 | Ga0501035_0073224_1287_1760 | 156 |
| 723 | 3300059491 | Ga0587070_026373 | Ga0587070_026373_474_947 | 156 |
| 724 | 3300059504 | Ga0587082_062226 | Ga0587082_062226_101_574 | 156 |
| 725 | 3300059505 | Ga0587083_0103339 | Ga0587083_0103339_220_693 | 156 |
| 726 | 3300059508 | Ga0587088_030882 | Ga0587088_030882_392_865 | 156 |
| 727 | 3300059607 | Ga0587125_023600 | Ga0587125_023600_13_486 | 156 |
| 728 | 3300059640 | Ga0587067_017566 | Ga0587067_017566_594_1067 | 156 |
| 729 | 3300059641 | Ga0587068_000071 | Ga0587068_000071_285_758 | 156 |
| 730 | 3300059647 | Ga0587079_022009 | Ga0587079_022009_670_1143 | 156 |
| 731 | 3300059647 | Ga0587079_058217 | Ga0587079_058217_340_813 | 156 |
| 732 | 3300059649 | Ga0587102_027498 | Ga0587102_027498_123_596 | 156 |
| 733 | 3300059652 | Ga0587107_014070 | Ga0587107_014070_525_998 | 156 |
| 734 | 3300060344 | Ga0587071_110099 | Ga0587071_110099_133_606 | 156 |
| 735 | 2162886007 | SwRhRL2b_contig_2009666 | SwRhRL2b_0170.00002110 | 157 |
| 736 | 3300001979 | JGI24740J21852_10018967 | JGI24740J21852_100189674 | 157 |
| 737 | 3300001989 | JGI24739J22299_10013783 | JGI24739J22299_100137832 | 157 |
| 738 | 3300002704 | JGI25155J39150_1000275 | JGI25155J39150_100027514 | 157 |
| 739 | 3300002704 | JGI25155J39150_1001216 | JGI25155J39150_10012162 | 157 |
| 740 | 3300002705 | JGI25156J39149_1000654 | JGI25156J39149_10006542 | 157 |
| 741 | 3300002737 | JGI25162J39368_1002877 | JGI25162J39368_10028775 | 157 |
| 742 | 3300002738 | JGI25154J39366_1001008 | JGI25154J39366_10010082 | 157 |
| 743 | 3300002738 | JGI25154J39366_1001607 | JGI25154J39366_10016072 | 157 |
| 744 | 3300002741 | JGI25157J39369_1000620 | JGI25157J39369_10006202 | 157 |
| 745 | 3300002987 | JGI25159J45721_1013111 | JGI25159J45721_10131112 | 157 |
| 746 | 3300003163 | Ga0006759J45824_1099236 | Ga0006759J45824_10992361 | 157 |
| 747 | 3300003354 | JGI25160J50197_1016729 | JGI25160J50197_10167292 | 157 |
| 748 | 3300003574 | Ga0007410J51695_1045428 | Ga0007410J51695_10454281 | 157 |
| 749 | 3300003575 | Ga0007409J51694_1022844 | Ga0007409J51694_10228442 | 157 |
| 750 | 3300003577 | Ga0007416J51690_1014475 | Ga0007416J51690_10144752 | 157 |
| 751 | 3300003752 | Ga0055539_1000018 | Ga0055539_1000018118 | 157 |
| 752 | 3300003756 | Ga0055533_1000022 | Ga0055533_1000022118 | 157 |
| 753 | 3300003758 | Ga0055532_1000017 | Ga0055532_100001776 | 157 |
| 754 | 3300003759 | Ga0055525_1000024 | Ga0055525_1000024118 | 157 |
| 755 | 3300003761 | Ga0055535_1008032 | Ga0055535_10080322 | 157 |
| 756 | 3300003763 | Ga0055529_1000125 | Ga0055529_100012537 | 157 |
| 757 | 3300003771 | Ga0055526_1006167 | Ga0055526_10061675 | 157 |
| 758 | 3300003773 | Ga0055537_1047078 | Ga0055537_10470781 | 157 |
| 759 | 3300003841 | Ga0055541_1000013 | Ga0055541_1000013118 | 157 |
| 760 | 3300005288 | Ga0065714_10014940 | Ga0065714_100149402 | 157 |
| 761 | 3300005293 | Ga0065715_10011527 | Ga0065715_100115274 | 157 |
| 762 | 3300005295 | Ga0065707_10947712 | Ga0065707_109477121 | 157 |
| 763 | 3300005328 | Ga0070676_10298056 | Ga0070676_102980562 | 157 |
| 764 | 3300005330 | Ga0070690_100004194 | Ga0070690_10000419413 | 157 |
| 765 | 3300005331 | Ga0070670_100027159 | Ga0070670_1000271598 | 157 |
| 766 | 3300005334 | Ga0068869_100214337 | Ga0068869_1002143372 | 157 |
| 767 | 3300005334 | Ga0068869_100393022 | Ga0068869_1003930222 | 157 |
| 768 | 3300005335 | Ga0070666_10004984 | Ga0070666_100049847 | 157 |
| 769 | 3300005335 | Ga0070666_10083494 | Ga0070666_100834942 | 157 |
| 770 | 3300005337 | Ga0070682_100039649 | Ga0070682_1000396492 | 157 |
| 771 | 3300005337 | Ga0070682_100267747 | Ga0070682_1002677472 | 157 |
| 772 | 3300005338 | Ga0068868_100015599 | Ga0068868_1000155992 | 157 |
| 773 | 3300005338 | Ga0068868_100043085 | Ga0068868_1000430856 | 157 |
| 774 | 3300005339 | Ga0070660_100002183 | Ga0070660_1000021833 | 157 |
| 775 | 3300005339 | Ga0070660_100048636 | Ga0070660_1000486362 | 157 |
| 776 | 3300005340 | Ga0070689_100001985 | Ga0070689_10000198519 | 157 |
| 777 | 3300005344 | Ga0070661_100002329 | Ga0070661_1000023293 | 157 |
| 778 | 3300005345 | Ga0070692_10046908 | Ga0070692_100469082 | 157 |
| 779 | 3300005355 | Ga0070671_100092462 | Ga0070671_1000924621 | 157 |
| 780 | 3300005355 | Ga0070671_100234181 | Ga0070671_1002341812 | 157 |
| 781 | 3300005356 | Ga0070674_100001678 | Ga0070674_10000167815 | 157 |
| 782 | 3300005364 | Ga0070673_100000865 | Ga0070673_10000086517 | 157 |
| 783 | 3300005365 | Ga0070688_100007255 | Ga0070688_1000072552 | 157 |
| 784 | 3300005366 | Ga0070659_100001265 | Ga0070659_10000126522 | 157 |
| 785 | 3300005366 | Ga0070659_100090041 | Ga0070659_1000900412 | 157 |
| 786 | 3300005367 | Ga0070667_100003642 | Ga0070667_1000036427 | 157 |
| 787 | 3300005367 | Ga0070667_100064885 | Ga0070667_1000648852 | 157 |
| 788 | 3300005406 | Ga0070703_10033713 | Ga0070703_100337132 | 157 |
| 789 | 3300005406 | Ga0070703_10199612 | Ga0070703_101996122 | 157 |
| 790 | 3300005434 | Ga0070709_10027578 | Ga0070709_100275782 | 157 |
| 791 | 3300005434 | Ga0070709_10236133 | Ga0070709_102361331 | 157 |
| 792 | 3300005434 | Ga0070709_10496062 | Ga0070709_104960622 | 157 |
| 793 | 3300005435 | Ga0070714_100147756 | Ga0070714_1001477564 | 157 |
| 794 | 3300005436 | Ga0070713_100004316 | Ga0070713_1000043167 | 157 |
| 795 | 3300005436 | Ga0070713_100007320 | Ga0070713_10000732013 | 157 |
| 796 | 3300005436 | Ga0070713_101176746 | Ga0070713_1011767461 | 157 |
| 797 | 3300005437 | Ga0070710_10069751 | Ga0070710_100697512 | 157 |
| 798 | 3300005437 | Ga0070710_10124430 | Ga0070710_101244301 | 157 |
| 799 | 3300005437 | Ga0070710_10166235 | Ga0070710_101662352 | 157 |
| 800 | 3300005439 | Ga0070711_100001521 | Ga0070711_10000152116 | 157 |
| 801 | 3300005439 | Ga0070711_100009545 | Ga0070711_1000095454 | 157 |
| 802 | 3300005440 | Ga0070705_100003694 | Ga0070705_1000036942 | 157 |
| 803 | 3300005445 | Ga0070708_100565776 | Ga0070708_1005657762 | 157 |
| 804 | 3300005455 | Ga0070663_100167050 | Ga0070663_1001670502 | 157 |
| 805 | 3300005456 | Ga0070678_100004401 | Ga0070678_1000044012 | 157 |
| 806 | 3300005456 | Ga0070678_100057112 | Ga0070678_1000571122 | 157 |
| 807 | 3300005457 | Ga0070662_100003578 | Ga0070662_1000035782 | 157 |
| 808 | 3300005457 | Ga0070662_100228550 | Ga0070662_1002285502 | 157 |
| 809 | 3300005459 | Ga0068867_100021691 | Ga0068867_1000216919 | 157 |
| 810 | 3300005459 | Ga0068867_100554608 | Ga0068867_1005546081 | 157 |
| 811 | 3300005466 | Ga0070685_10016600 | Ga0070685_100166002 | 157 |
| 812 | 3300005467 | Ga0070706_100007439 | Ga0070706_1000074392 | 157 |
| 813 | 3300005468 | Ga0070707_100809908 | Ga0070707_1008099082 | 157 |
| 814 | 3300005468 | Ga0070707_100977031 | Ga0070707_1009770311 | 157 |
| 815 | 3300005518 | Ga0070699_100004740 | Ga0070699_1000047402 | 157 |
| 816 | 3300005518 | Ga0070699_100207883 | Ga0070699_1002078832 | 157 |
| 817 | 3300005530 | Ga0070679_100065686 | Ga0070679_1000656862 | 157 |
| 818 | 3300005536 | Ga0070697_100064107 | Ga0070697_1000641072 | 157 |
| 819 | 3300005539 | Ga0068853_100136981 | Ga0068853_1001369811 | 157 |
| 820 | 3300005543 | Ga0070672_100087313 | Ga0070672_1000873135 | 157 |
| 821 | 3300005544 | Ga0070686_100018101 | Ga0070686_1000181012 | 157 |
| 822 | 3300005545 | Ga0070695_100291793 | Ga0070695_1002917931 | 157 |
| 823 | 3300005546 | Ga0070696_100016414 | Ga0070696_10001641410 | 157 |
| 824 | 3300005547 | Ga0070693_100002246 | Ga0070693_1000022463 | 157 |
| 825 | 3300005547 | Ga0070693_100586533 | Ga0070693_1005865332 | 157 |
| 826 | 3300005548 | Ga0070665_100003995 | Ga0070665_10000399522 | 157 |
| 827 | 3300005549 | Ga0070704_100054101 | Ga0070704_1000541012 | 157 |
| 828 | 3300005563 | Ga0068855_100000037 | Ga0068855_10000003726 | 157 |
| 829 | 3300005563 | Ga0068855_100019104 | Ga0068855_1000191044 | 157 |
| 830 | 3300005563 | Ga0068855_100365741 | Ga0068855_1003657412 | 157 |
| 831 | 3300005577 | Ga0068857_100824397 | Ga0068857_1008243973 | 157 |
| 832 | 3300005578 | Ga0068854_100004704 | Ga0068854_1000047046 | 157 |
| 833 | 3300005578 | Ga0068854_100004957 | Ga0068854_1000049572 | 157 |
| 834 | 3300005578 | Ga0068854_100099655 | Ga0068854_1000996553 | 157 |
| 835 | 3300005614 | Ga0068856_100058353 | Ga0068856_1000583532 | 157 |
| 836 | 3300005614 | Ga0068856_100234204 | Ga0068856_1002342042 | 157 |
| 837 | 3300005614 | Ga0068856_100538641 | Ga0068856_1005386411 | 157 |
| 838 | 3300005614 | Ga0068856_100830858 | Ga0068856_1008308583 | 157 |
| 839 | 3300005615 | Ga0070702_100004699 | Ga0070702_10000469910 | 157 |
| 840 | 3300005615 | Ga0070702_100040445 | Ga0070702_1000404452 | 157 |
| 841 | 3300005615 | Ga0070702_100161199 | Ga0070702_1001611992 | 157 |
| 842 | 3300005615 | Ga0070702_100176951 | Ga0070702_1001769511 | 157 |
| 843 | 3300005616 | Ga0068852_100057370 | Ga0068852_1000573702 | 157 |
| 844 | 3300005617 | Ga0068859_100101205 | Ga0068859_1001012052 | 157 |
| 845 | 3300005617 | Ga0068859_100512453 | Ga0068859_1005124532 | 157 |
| 846 | 3300005618 | Ga0068864_100006955 | Ga0068864_1000069556 | 157 |
| 847 | 3300005718 | Ga0068866_10001499 | Ga0068866_1000149912 | 157 |
| 848 | 3300005718 | Ga0068866_10079945 | Ga0068866_100799452 | 157 |
| 849 | 3300005719 | Ga0068861_100822906 | Ga0068861_1008229062 | 157 |
| 850 | 3300005834 | Ga0068851_10511969 | Ga0068851_105119691 | 157 |
| 851 | 3300005841 | Ga0068863_100004894 | Ga0068863_1000048949 | 157 |
| 852 | 3300005842 | Ga0068858_100049032 | Ga0068858_1000490322 | 157 |
| 853 | 3300005842 | Ga0068858_100080949 | Ga0068858_1000809493 | 157 |
| 854 | 3300006028 | Ga0070717_10623054 | Ga0070717_106230541 | 157 |
| 855 | 3300006163 | Ga0070715_10010540 | Ga0070715_100105402 | 157 |
| 856 | 3300006163 | Ga0070715_10019155 | Ga0070715_100191555 | 157 |
| 857 | 3300006175 | Ga0070712_100004888 | Ga0070712_10000488812 | 157 |
| 858 | 3300006175 | Ga0070712_100089940 | Ga0070712_1000899403 | 157 |
| 859 | 3300006175 | Ga0070712_100214971 | Ga0070712_1002149712 | 157 |
| 860 | 3300006195 | Ga0075366_10528077 | Ga0075366_105280772 | 157 |
| 861 | 3300006237 | Ga0097621_100046101 | Ga0097621_1000461012 | 157 |
| 862 | 3300006237 | Ga0097621_100273988 | Ga0097621_1002739883 | 157 |
| 863 | 3300006358 | Ga0068871_100019735 | Ga0068871_1000197352 | 157 |
| 864 | 3300006358 | Ga0068871_100086114 | Ga0068871_1000861143 | 157 |
| 865 | 3300006844 | Ga0075428_100001737 | Ga0075428_10000173712 | 157 |
| 866 | 3300006847 | Ga0075431_100276628 | Ga0075431_1002766281 | 157 |
| 867 | 3300006871 | Ga0075434_100261086 | Ga0075434_1002610863 | 157 |
| 868 | 3300006880 | Ga0075429_100059174 | Ga0075429_1000591744 | 157 |
| 869 | 3300006881 | Ga0068865_100017695 | Ga0068865_1000176956 | 157 |
| 870 | 3300006881 | Ga0068865_100045549 | Ga0068865_1000455492 | 157 |
| 871 | 3300006914 | Ga0075436_100340341 | Ga0075436_1003403412 | 157 |
| 872 | 3300006931 | Ga0097620_100101201 | Ga0097620_1001012012 | 157 |
| 873 | 3300006931 | Ga0097620_100512459 | Ga0097620_1005124592 | 157 |
| 874 | 3300006946 | Ga0079104_1014796 | Ga0079104_10147962 | 157 |
| 875 | 3300006948 | Ga0099826_10000001 | Ga0099826_10000001642 | 157 |
| 876 | 3300007076 | Ga0075435_100084353 | Ga0075435_1000843533 | 157 |
| 877 | 3300007076 | Ga0075435_100332326 | Ga0075435_1003323262 | 157 |
| 878 | 3300009011 | Ga0105251_10156105 | Ga0105251_101561051 | 157 |
| 879 | 3300009036 | Ga0105244_10415334 | Ga0105244_104153341 | 157 |
| 880 | 3300009093 | Ga0105240_10027136 | Ga0105240_100271363 | 157 |
| 881 | 3300009093 | Ga0105240_10058534 | Ga0105240_100585344 | 157 |
| 882 | 3300009093 | Ga0105240_10355771 | Ga0105240_103557713 | 157 |
| 883 | 3300009094 | Ga0111539_10002714 | Ga0111539_100027144 | 157 |
| 884 | 3300009094 | Ga0111539_10043139 | Ga0111539_100431392 | 157 |
| 885 | 3300009098 | Ga0105245_10137680 | Ga0105245_101376802 | 157 |
| 886 | 3300009098 | Ga0105245_10192825 | Ga0105245_101928252 | 157 |
| 887 | 3300009098 | Ga0105245_10210530 | Ga0105245_102105302 | 157 |
| 888 | 3300009098 | Ga0105245_10331865 | Ga0105245_103318652 | 157 |
| 889 | 3300009101 | Ga0105247_10343261 | Ga0105247_103432612 | 157 |
| 890 | 3300009147 | Ga0114129_10164862 | Ga0114129_101648622 | 157 |
| 891 | 3300009148 | Ga0105243_10475361 | Ga0105243_104753611 | 157 |
| 892 | 3300009174 | Ga0105241_10012641 | Ga0105241_1001264111 | 157 |
| 893 | 3300009176 | Ga0105242_10022867 | Ga0105242_100228672 | 157 |
| 894 | 3300009176 | Ga0105242_11042383 | Ga0105242_110423831 | 157 |
| 895 | 3300009177 | Ga0105248_10001274 | Ga0105248_1000127412 | 157 |
| 896 | 3300009177 | Ga0105248_10274738 | Ga0105248_102747382 | 157 |
| 897 | 3300009545 | Ga0105237_10094387 | Ga0105237_100943872 | 157 |
| 898 | 3300009545 | Ga0105237_10203331 | Ga0105237_102033313 | 157 |
| 899 | 3300009545 | Ga0105237_10231685 | Ga0105237_102316852 | 157 |
| 900 | 3300009545 | Ga0105237_10477637 | Ga0105237_104776372 | 157 |
| 901 | 3300009551 | Ga0105238_10000955 | Ga0105238_100009554 | 157 |
| 902 | 3300009551 | Ga0105238_10073501 | Ga0105238_100735012 | 157 |
| 903 | 3300009551 | Ga0105238_10107469 | Ga0105238_101074692 | 157 |
| 904 | 3300009551 | Ga0105238_10215500 | Ga0105238_102155003 | 157 |
| 905 | 3300009551 | Ga0105238_10594166 | Ga0105238_105941662 | 157 |
| 906 | 3300010375 | Ga0105239_10013663 | Ga0105239_100136632 | 157 |
| 907 | 3300010375 | Ga0105239_10233571 | Ga0105239_102335712 | 157 |
| 908 | 3300010375 | Ga0105239_10686998 | Ga0105239_106869982 | 157 |
| 909 | 3300011119 | Ga0105246_10318267 | Ga0105246_103182672 | 157 |
| 910 | 3300011119 | Ga0105246_10450445 | Ga0105246_104504452 | 157 |
| 911 | 3300013100 | Ga0157373_10343115 | Ga0157373_103431152 | 157 |
| 912 | 3300013102 | Ga0157371_10393403 | Ga0157371_103934032 | 157 |
| 913 | 3300013296 | Ga0157374_10005037 | Ga0157374_100050372 | 157 |
| 914 | 3300013297 | Ga0157378_10004389 | Ga0157378_100043899 | 157 |
| 915 | 3300013297 | Ga0157378_10123878 | Ga0157378_101238783 | 157 |
| 916 | 3300013297 | Ga0157378_10360338 | Ga0157378_103603382 | 157 |
| 917 | 3300013306 | Ga0163162_10042566 | Ga0163162_100425662 | 157 |
| 918 | 3300013306 | Ga0163162_10087689 | Ga0163162_100876892 | 157 |
| 919 | 3300013307 | Ga0157372_10266332 | Ga0157372_102663322 | 157 |
| 920 | 3300013307 | Ga0157372_11056103 | Ga0157372_110561032 | 157 |
| 921 | 3300013308 | Ga0157375_10086067 | Ga0157375_100860672 | 157 |
| 922 | 3300013308 | Ga0157375_10696817 | Ga0157375_106968172 | 157 |
| 923 | 3300014325 | Ga0163163_10031257 | Ga0163163_100312572 | 157 |
| 924 | 3300014325 | Ga0163163_10186265 | Ga0163163_101862652 | 157 |
| 925 | 3300014497 | Ga0182008_10173520 | Ga0182008_101735202 | 157 |
| 926 | 3300014497 | Ga0182008_10233469 | Ga0182008_102334691 | 157 |
| 927 | 3300014745 | Ga0157377_10030450 | Ga0157377_100304502 | 157 |
| 928 | 3300014968 | Ga0157379_10019373 | Ga0157379_100193735 | 157 |
| 929 | 3300014968 | Ga0157379_10048413 | Ga0157379_100484132 | 157 |
| 930 | 3300014969 | Ga0157376_10027516 | Ga0157376_100275162 | 157 |
| 931 | 3300014969 | Ga0157376_10028649 | Ga0157376_100286492 | 157 |
| 932 | 3300014969 | Ga0157376_10188151 | Ga0157376_101881512 | 157 |
| 933 | 3300014969 | Ga0157376_10325238 | Ga0157376_103252382 | 157 |
| 934 | 3300015261 | Ga0182006_1015816 | Ga0182006_10158163 | 157 |
| 935 | 3300017792 | Ga0163161_10025359 | Ga0163161_100253592 | 157 |
| 936 | 3300025206 | Ga0209435_100015 | Ga0209435_10001589 | 157 |
| 937 | 3300025224 | Ga0209784_100005 | Ga0209784_100005605 | 157 |
| 938 | 3300025225 | Ga0209566_100005 | Ga0209566_100005605 | 157 |
| 939 | 3300025226 | Ga0209674_100009 | Ga0209674_100009605 | 157 |
| 940 | 3300025229 | Ga0209147_100004 | Ga0209147_1000041137 | 157 |
| 941 | 3300025230 | Ga0209563_100012 | Ga0209563_100012605 | 157 |
| 942 | 3300025233 | Ga0209437_100329 | Ga0209437_10032922 | 157 |
| 943 | 3300025242 | Ga0209258_100523 | Ga0209258_1005232 | 157 |
| 944 | 3300025246 | Ga0209646_1000020 | Ga0209646_100002071 | 157 |
| 945 | 3300025246 | Ga0209646_1000040 | Ga0209646_1000040119 | 157 |
| 946 | 3300025250 | Ga0209026_1000034 | Ga0209026_1000034200 | 157 |
| 947 | 3300025250 | Ga0209026_1001477 | Ga0209026_10014779 | 157 |
| 948 | 3300025253 | Ga0209677_100006 | Ga0209677_100006605 | 157 |
| 949 | 3300025256 | Ga0209759_1000049 | Ga0209759_10000493 | 157 |
| 950 | 3300025256 | Ga0209759_1000656 | Ga0209759_10006562 | 157 |
| 951 | 3300025263 | Ga0209565_1022947 | Ga0209565_10229473 | 157 |
| 952 | 3300025272 | Ga0209455_1000044 | Ga0209455_1000044276 | 157 |
| 953 | 3300025291 | Ga0209675_1014874 | Ga0209675_10148743 | 157 |
| 954 | 3300025295 | Ga0209564_1000007 | Ga0209564_1000007632 | 157 |
| 955 | 3300025295 | Ga0209564_1018332 | Ga0209564_10183325 | 157 |
| 956 | 3300025299 | Ga0209256_1000005 | Ga0209256_1000005949 | 157 |
| 957 | 3300025321 | Ga0207656_10268669 | Ga0207656_102686692 | 157 |
| 958 | 3300025735 | Ga0207713_1067643 | Ga0207713_10676431 | 157 |
| 959 | 3300025898 | Ga0207692_10065905 | Ga0207692_100659052 | 157 |
| 960 | 3300025898 | Ga0207692_10366682 | Ga0207692_103666821 | 157 |
| 961 | 3300025899 | Ga0207642_10006909 | Ga0207642_100069092 | 157 |
| 962 | 3300025899 | Ga0207642_10038420 | Ga0207642_100384203 | 157 |
| 963 | 3300025903 | Ga0207680_10203891 | Ga0207680_102038911 | 157 |
| 964 | 3300025905 | Ga0207685_10008483 | Ga0207685_100084832 | 157 |
| 965 | 3300025905 | Ga0207685_10094183 | Ga0207685_100941832 | 157 |
| 966 | 3300025906 | Ga0207699_10030839 | Ga0207699_100308396 | 157 |
| 967 | 3300025906 | Ga0207699_10204252 | Ga0207699_102042522 | 157 |
| 968 | 3300025906 | Ga0207699_10439686 | Ga0207699_104396861 | 157 |
| 969 | 3300025907 | Ga0207645_10095689 | Ga0207645_100956892 | 157 |
| 970 | 3300025911 | Ga0207654_10055339 | Ga0207654_100553392 | 157 |
| 971 | 3300025912 | Ga0207707_10023430 | Ga0207707_100234304 | 157 |
| 972 | 3300025913 | Ga0207695_10001485 | Ga0207695_1000148511 | 157 |
| 973 | 3300025913 | Ga0207695_10017853 | Ga0207695_100178534 | 157 |
| 974 | 3300025913 | Ga0207695_10263151 | Ga0207695_102631513 | 157 |
| 975 | 3300025913 | Ga0207695_10267304 | Ga0207695_102673043 | 157 |
| 976 | 3300025914 | Ga0207671_10014534 | Ga0207671_100145342 | 157 |
| 977 | 3300025914 | Ga0207671_10345078 | Ga0207671_103450781 | 157 |
| 978 | 3300025914 | Ga0207671_10419490 | Ga0207671_104194902 | 157 |
| 979 | 3300025914 | Ga0207671_10449138 | Ga0207671_104491382 | 157 |
| 980 | 3300025914 | Ga0207671_10844774 | Ga0207671_108447742 | 157 |
| 981 | 3300025915 | Ga0207693_10000325 | Ga0207693_1000032565 | 157 |
| 982 | 3300025915 | Ga0207693_10007147 | Ga0207693_1000714711 | 157 |
| 983 | 3300025915 | Ga0207693_10027499 | Ga0207693_100274993 | 157 |
| 984 | 3300025915 | Ga0207693_10311631 | Ga0207693_103116312 | 157 |
| 985 | 3300025916 | Ga0207663_10022607 | Ga0207663_100226076 | 157 |
| 986 | 3300025919 | Ga0207657_10000571 | Ga0207657_1000057133 | 157 |
| 987 | 3300025919 | Ga0207657_10003818 | Ga0207657_1000381815 | 157 |
| 988 | 3300025920 | Ga0207649_10013576 | Ga0207649_100135762 | 157 |
| 989 | 3300025920 | Ga0207649_10292979 | Ga0207649_102929792 | 157 |
| 990 | 3300025921 | Ga0207652_10702479 | Ga0207652_107024792 | 157 |
| 991 | 3300025924 | Ga0207694_10000783 | Ga0207694_100007833 | 157 |
| 992 | 3300025924 | Ga0207694_10270813 | Ga0207694_102708133 | 157 |
| 993 | 3300025925 | Ga0207650_10115157 | Ga0207650_101151573 | 157 |
| 994 | 3300025925 | Ga0207650_10316559 | Ga0207650_103165592 | 157 |
| 995 | 3300025927 | Ga0207687_10128423 | Ga0207687_101284232 | 157 |
| 996 | 3300025927 | Ga0207687_10234047 | Ga0207687_102340472 | 157 |
| 997 | 3300025927 | Ga0207687_10451959 | Ga0207687_104519592 | 157 |
| 998 | 3300025928 | Ga0207700_10182988 | Ga0207700_101829882 | 157 |
| 999 | 3300025928 | Ga0207700_10547143 | Ga0207700_105471431 | 157 |
| 1000 | 3300025931 | Ga0207644_10026128 | Ga0207644_100261283 | 157 |
| 1001 | 3300025931 | Ga0207644_10177885 | Ga0207644_101778853 | 157 |
| 1002 | 3300025932 | Ga0207690_10000971 | Ga0207690_100009712 | 157 |
| 1003 | 3300025932 | Ga0207690_10212353 | Ga0207690_102123532 | 157 |
| 1004 | 3300025933 | Ga0207706_10011440 | Ga0207706_100114402 | 157 |
| 1005 | 3300025934 | Ga0207686_10000118 | Ga0207686_1000011865 | 157 |
| 1006 | 3300025934 | Ga0207686_10061717 | Ga0207686_100617172 | 157 |
| 1007 | 3300025935 | Ga0207709_10278864 | Ga0207709_102788643 | 157 |
| 1008 | 3300025936 | Ga0207670_10192018 | Ga0207670_101920182 | 157 |
| 1009 | 3300025936 | Ga0207670_10685212 | Ga0207670_106852122 | 157 |
| 1010 | 3300025937 | Ga0207669_10071567 | Ga0207669_100715672 | 157 |
| 1011 | 3300025938 | Ga0207704_10036320 | Ga0207704_100363202 | 157 |
| 1012 | 3300025938 | Ga0207704_10395335 | Ga0207704_103953351 | 157 |
| 1013 | 3300025939 | Ga0207665_10008043 | Ga0207665_100080432 | 157 |
| 1014 | 3300025939 | Ga0207665_10011507 | Ga0207665_100115072 | 157 |
| 1015 | 3300025940 | Ga0207691_10122366 | Ga0207691_101223662 | 157 |
| 1016 | 3300025941 | Ga0207711_10140923 | Ga0207711_101409232 | 157 |
| 1017 | 3300025941 | Ga0207711_10204359 | Ga0207711_102043592 | 157 |
| 1018 | 3300025941 | Ga0207711_10442481 | Ga0207711_104424812 | 157 |
| 1019 | 3300025941 | Ga0207711_10549821 | Ga0207711_105498211 | 157 |
| 1020 | 3300025942 | Ga0207689_10271008 | Ga0207689_102710083 | 157 |
| 1021 | 3300025945 | Ga0207679_10003703 | Ga0207679_100037033 | 157 |
| 1022 | 3300025949 | Ga0207667_10000053 | Ga0207667_10000053159 | 157 |
| 1023 | 3300025949 | Ga0207667_10010379 | Ga0207667_1001037910 | 157 |
| 1024 | 3300025949 | Ga0207667_10041035 | Ga0207667_100410353 | 157 |
| 1025 | 3300025960 | Ga0207651_10040775 | Ga0207651_100407752 | 157 |
| 1026 | 3300025960 | Ga0207651_10627418 | Ga0207651_106274182 | 157 |
| 1027 | 3300025986 | Ga0207658_10236199 | Ga0207658_102361992 | 157 |
| 1028 | 3300025986 | Ga0207658_10321010 | Ga0207658_103210102 | 157 |
| 1029 | 3300026023 | Ga0207677_10089453 | Ga0207677_100894533 | 157 |
| 1030 | 3300026023 | Ga0207677_10137924 | Ga0207677_101379242 | 157 |
| 1031 | 3300026023 | Ga0207677_10151784 | Ga0207677_101517842 | 157 |
| 1032 | 3300026035 | Ga0207703_10032162 | Ga0207703_100321622 | 157 |
| 1033 | 3300026067 | Ga0207678_10037994 | Ga0207678_100379942 | 157 |
| 1034 | 3300026078 | Ga0207702_10097125 | Ga0207702_100971254 | 157 |
| 1035 | 3300026078 | Ga0207702_10249160 | Ga0207702_102491602 | 157 |
| 1036 | 3300026078 | Ga0207702_10270589 | Ga0207702_102705891 | 157 |
| 1037 | 3300026078 | Ga0207702_10399249 | Ga0207702_103992492 | 157 |
| 1038 | 3300026088 | Ga0207641_10093135 | Ga0207641_100931352 | 157 |
| 1039 | 3300026089 | Ga0207648_10026419 | Ga0207648_100264192 | 157 |
| 1040 | 3300026089 | Ga0207648_10230432 | Ga0207648_102304322 | 157 |
| 1041 | 3300026095 | Ga0207676_10299548 | Ga0207676_102995482 | 157 |
| 1042 | 3300026116 | Ga0207674_10005654 | Ga0207674_100056544 | 157 |
| 1043 | 3300026116 | Ga0207674_10258058 | Ga0207674_102580581 | 157 |
| 1044 | 3300026116 | Ga0207674_10302508 | Ga0207674_103025083 | 157 |
| 1045 | 3300026121 | Ga0207683_10003257 | Ga0207683_1000325712 | 157 |
| 1046 | 3300026121 | Ga0207683_10004973 | Ga0207683_100049732 | 157 |
| 1047 | 3300026142 | Ga0207698_10004178 | Ga0207698_100041787 | 157 |
| 1048 | 3300026142 | Ga0207698_10012444 | Ga0207698_100124444 | 157 |
| 1049 | 3300026142 | Ga0207698_10206330 | Ga0207698_102063302 | 157 |
| 1050 | 3300027666 | Ga0209282_1000001 | Ga0209282_10000011780 | 157 |
| 1051 | 3300027907 | Ga0207428_10004868 | Ga0207428_100048685 | 157 |
| 1052 | 3300027907 | Ga0207428_10363892 | Ga0207428_103638922 | 157 |
| 1053 | 3300028379 | Ga0268266_10233330 | Ga0268266_102333301 | 157 |
| 1054 | 3300028381 | Ga0268264_10222767 | Ga0268264_102227672 | 157 |
| 1055 | 3300028381 | Ga0268264_11548598 | Ga0268264_115485981 | 157 |
| 1056 | 3300030731 | Ga0316177_1056911 | Ga0316177_10569112 | 157 |
| 1057 | 3300030735 | Ga0316178_1070957 | Ga0316178_10709573 | 157 |
| 1058 | 3300030736 | Ga0316180_1080061 | Ga0316180_10800614 | 157 |
| 1059 | 3300030745 | Ga0316182_1091364 | Ga0316182_10913642 | 157 |
| 1060 | 3300030745 | Ga0316182_1138354 | Ga0316182_11383541 | 157 |
| 1061 | 3300031241 | Ga0265325_10000262 | Ga0265325_1000026215 | 157 |
| 1062 | 3300031251 | Ga0265327_10027789 | Ga0265327_100277892 | 157 |
| 1063 | 3300031548 | Ga0307408_100000294 | Ga0307408_1000002944 | 157 |
| 1064 | 3300031727 | Ga0316576_10014395 | Ga0316576_100143955 | 157 |
| 1065 | 3300031727 | Ga0316576_10119002 | Ga0316576_101190022 | 157 |
| 1066 | 3300031728 | Ga0316578_10005843 | Ga0316578_100058432 | 157 |
| 1067 | 3300031728 | Ga0316578_10698694 | Ga0316578_106986941 | 157 |
| 1068 | 3300031730 | Ga0307516_10248129 | Ga0307516_102481292 | 157 |
| 1069 | 3300031838 | Ga0307518_10028537 | Ga0307518_100285372 | 157 |
| 1070 | 3300031911 | Ga0307412_10661874 | Ga0307412_106618742 | 157 |
| 1071 | 3300032004 | Ga0307414_10133833 | Ga0307414_101338332 | 157 |
| 1072 | 3300032005 | Ga0307411_10089098 | Ga0307411_100890984 | 157 |
| 1073 | 3300032005 | Ga0307411_10180747 | Ga0307411_101807472 | 157 |
| 1074 | 3300032133 | Ga0316583_10000450 | Ga0316583_100004502 | 157 |
| 1075 | 3300032133 | Ga0316583_10007762 | Ga0316583_100077622 | 157 |
| 1076 | 3300032139 | Ga0316580_10154243 | Ga0316580_101542431 | 157 |
| 1077 | 3300033179 | Ga0307507_10059523 | Ga0307507_100595235 | 157 |
| 1078 | 3300033524 | Ga0316592_1003877 | Ga0316592_10038772 | 157 |
| 1079 | 3300033524 | Ga0316592_1005553 | Ga0316592_10055532 | 157 |
| 1080 | 3300033529 | Ga0316587_1028496 | Ga0316587_10284962 | 157 |
| 1081 | 3300033541 | Ga0316596_1000002 | Ga0316596_10000024 | 157 |
| 1082 | 3300033541 | Ga0316596_1000007 | Ga0316596_10000073 | 157 |
| 1083 | 3300035111 | Ga0373923_0073468 | Ga0373923_0073468_314_790 | 157 |
| 1084 | 3300035113 | Ga0373936_0020708 | Ga0373936_0020708_1409_1885 | 157 |
| 1085 | 3300035113 | Ga0373936_0131451 | Ga0373936_0131451_556_1032 | 157 |
| 1086 | 3300035114 | Ga0373939_0036290 | Ga0373939_0036290_630_1106 | 157 |
| 1087 | 3300035116 | Ga0373945_0017368 | Ga0373945_0017368_830_1306 | 157 |
| 1088 | 3300035117 | Ga0373953_0011867 | Ga0373953_0011867_2253_2729 | 157 |
| 1089 | 3300035118 | Ga0373954_0094093 | Ga0373954_0094093_281_757 | 157 |
| 1090 | 3300035119 | Ga0373956_0008504 | Ga0373956_0008504_1925_2401 | 157 |
| 1091 | 3300035119 | Ga0373956_0033825 | Ga0373956_0033825_1706_2182 | 157 |
| 1092 | 3300035119 | Ga0373956_0075954 | Ga0373956_0075954_460_936 | 157 |
| 1093 | 3300035170 | Ga0373943_0083321 | Ga0373943_0083321_368_844 | 157 |
| 1094 | 3300035170 | Ga0373943_0377635 | Ga0373943_0377635_39_515 | 157 |
| 1095 | 3300035171 | Ga0373946_0036344 | Ga0373946_0036344_954_1430 | 157 |
| 1096 | 3300035172 | Ga0373955_0044618 | Ga0373955_0044618_813_1289 | 157 |
| 1097 | 3300035172 | Ga0373955_0068759 | Ga0373955_0068759_317_793 | 157 |
| 1098 | 3300035398 | Ga0316574_0148984 | Ga0316574_0148984_582_1061 | 157 |
| 1099 | 3300035410 | Ga0373924_0050158 | Ga0373924_0050158_409_885 | 157 |
| 1100 | 3300035692 | Ga0373935_0059744 | Ga0373935_0059744_1697_2173 | 157 |
| 1101 | 3300035692 | Ga0373935_0073331 | Ga0373935_0073331_846_1322 | 157 |
| 1102 | 3300035695 | Ga0373927_0013469 | Ga0373927_0013469_2931_3407 | 157 |
| 1103 | 3300035695 | Ga0373927_0041604 | Ga0373927_0041604_1591_2067 | 157 |
| 1104 | 3300035695 | Ga0373927_0759692 | Ga0373927_0759692_136_612 | 157 |
| 1105 | 3300035695 | Ga0373927_0904829 | Ga0373927_0904829_57_533 | 157 |
| 1106 | 3300035724 | Ga0373933_0060334 | Ga0373933_0060334_168_644 | 157 |
| 1107 | 3300035724 | Ga0373933_0077401 | Ga0373933_0077401_1406_1882 | 157 |
| 1108 | 3300035724 | Ga0373933_0232091 | Ga0373933_0232091_186_662 | 157 |
| 1109 | 3300035725 | Ga0373947_0110948 | Ga0373947_0110948_544_1020 | 157 |
| 1110 | 3300035725 | Ga0373947_0127072 | Ga0373947_0127072_492_968 | 157 |
| 1111 | 3300035725 | Ga0373947_0444702 | Ga0373947_0444702_368_844 | 157 |
| 1112 | 3300036401 | Ga0373937_0004053 | Ga0373937_0004053_238_714 | 157 |
| 1113 | 3300036401 | Ga0373937_0076494 | Ga0373937_0076494_1938_2414 | 157 |
| 1114 | 3300036401 | Ga0373937_0177721 | Ga0373937_0177721_612_1088 | 157 |
| 1115 | 3300036401 | Ga0373937_0416795 | Ga0373937_0416795_786_1262 | 157 |
| 1116 | 3300036647 | Ga0316582_0004588 | Ga0316582_0004588_2328_2807 | 157 |
| 1117 | 3300036712 | Ga0316584_0169500 | Ga0316584_0169500_423_899 | 157 |
| 1118 | 3300036712 | Ga0316584_0237324 | Ga0316584_0237324_750_1226 | 157 |
| 1119 | 3300037068 | Ga0373925_0024531 | Ga0373925_0024531_3114_3590 | 157 |
| 1120 | 3300037068 | Ga0373925_0026948 | Ga0373925_0026948_721_1197 | 157 |
| 1121 | 3300037068 | Ga0373925_0055374 | Ga0373925_0055374_650_1126 | 157 |
| 1122 | 3300037312 | Ga0395899_0005514 | Ga0395899_0005514_1959_2435 | 157 |
| 1123 | 3300037312 | Ga0395899_0011802 | Ga0395899_0011802_6029_6505 | 157 |
| 1124 | 3300037312 | Ga0395899_0015482 | Ga0395899_0015482_2486_2962 | 157 |
| 1125 | 3300037312 | Ga0395899_0070098 | Ga0395899_0070098_669_1145 | 157 |
| 1126 | 3300037418 | Ga0395900_0013338 | Ga0395900_0013338_7866_8342 | 157 |
| 1127 | 3300037418 | Ga0395900_0061672 | Ga0395900_0061672_537_1013 | 157 |
| 1128 | 3300037418 | Ga0395900_0103143 | Ga0395900_0103143_1399_1875 | 157 |
| 1129 | 3300037466 | Ga0395898_0002939 | Ga0395898_0002939_8751_9227 | 157 |
| 1130 | 3300037466 | Ga0395898_0048112 | Ga0395898_0048112_2274_2750 | 157 |
| 1131 | 3300037471 | Ga0395905_0004758 | Ga0395905_0004758_4338_4814 | 157 |
| 1132 | 3300037471 | Ga0395905_0021934 | Ga0395905_0021934_2463_2939 | 157 |
| 1133 | 3300037471 | Ga0395905_0050257 | Ga0395905_0050257_3233_3709 | 157 |
| 1134 | 3300037471 | Ga0395905_0087348 | Ga0395905_0087348_695_1171 | 157 |
| 1135 | 3300037471 | Ga0395905_0234734 | Ga0395905_0234734_983_1459 | 157 |
| 1136 | 3300038443 | Ga0395901_0009352 | Ga0395901_0009352_6738_7214 | 157 |
| 1137 | 3300038443 | Ga0395901_0201311 | Ga0395901_0201311_459_935 | 157 |
| 1138 | 3300038443 | Ga0395901_0427788 | Ga0395901_0427788_15_491 | 157 |
| 1139 | 3300038443 | Ga0395901_0553742 | Ga0395901_0553742_673_1149 | 157 |
| 1140 | 3300039062 | Ga0400483_066879 | Ga0400483_066879_18567_19043 | 157 |
| 1141 | 3300039062 | Ga0400483_146612 | Ga0400483_146612_900_1376 | 157 |
| 1142 | 3300039438 | Ga0436360_0890123 | Ga0436360_0890123_134_610 | 157 |
| 1143 | 3300039447 | Ga0436361_0204853 | Ga0436361_0204853_7987_8463 | 157 |
| 1144 | 3300039447 | Ga0436361_0383429 | Ga0436361_0383429_636_1112 | 157 |
| 1145 | 3300041406 | Ga0439439_0003713 | Ga0439439_0003713_800_1276 | 157 |
| 1146 | 3300042007 | Ga0439449_0001658 | Ga0439449_0001658_4157_4633 | 157 |
| 1147 | 3300042139 | Ga0450904_008348 | Ga0450904_008348_521_1000 | 157 |
| 1148 | 3300042157 | Ga0439458_0020540 | Ga0439458_0020540_334_810 | 157 |
| 1149 | 3300042876 | Ga0451577_0128327 | Ga0451577_0128327_756_1238 | 157 |
| 1150 | 3300042876 | Ga0451577_1084677 | Ga0451577_1084677_37_513 | 157 |
| 1151 | 3300042876 | Ga0451577_1727726 | Ga0451577_1727726_44_520 | 157 |
| 1152 | 3300044658 | Ga0466972_0000275 | Ga0466972_0000275_31292_31771 | 157 |
| 1153 | 3300044658 | Ga0466972_0018121 | Ga0466972_0018121_674_1156 | 157 |
| 1154 | 3300044673 | Ga0453683_0909240 | Ga0453683_0909240_66_542 | 157 |
| 1155 | 3300044683 | Ga0466965_0031058 | Ga0466965_0031058_713_1195 | 157 |
| 1156 | 3300044683 | Ga0466965_0083479 | Ga0466965_0083479_81_557 | 157 |
| 1157 | 3300044706 | Ga0466964_0052875 | Ga0466964_0052875_349_831 | 157 |
| 1158 | 3300044706 | Ga0466964_0214098 | Ga0466964_0214098_153_632 | 157 |
| 1159 | 3300044712 | Ga0453684_0005853 | Ga0453684_0005853_12741_13223 | 157 |
| 1160 | 3300044765 | Ga0466970_0038578 | Ga0466970_0038578_1409_1885 | 157 |
| 1161 | 3300044901 | Ga0466960_0341790 | Ga0466960_0341790_214_693 | 157 |
| 1162 | 3300045051 | Ga0451576_0002470 | Ga0451576_0002470_10790_11266 | 157 |
| 1163 | 3300045051 | Ga0451576_0168707 | Ga0451576_0168707_1259_1735 | 157 |
| 1164 | 3300046455 | Ga0495603_0042128 | Ga0495603_0042128_291_767 | 157 |
| 1165 | 3300046455 | Ga0495603_0178895 | Ga0495603_0178895_465_944 | 157 |
| 1166 | 3300046459 | Ga0495629_0122521 | Ga0495629_0122521_725_1201 | 157 |
| 1167 | 3300046459 | Ga0495629_0442648 | Ga0495629_0442648_206_685 | 157 |
| 1168 | 3300046462 | Ga0495651_0155360 | Ga0495651_0155360_904_1380 | 157 |
| 1169 | 3300046463 | Ga0495653_0253295 | Ga0495653_0253295_135_614 | 157 |
| 1170 | 3300046472 | Ga0495580_0054857 | Ga0495580_0054857_1536_2012 | 157 |
| 1171 | 3300046472 | Ga0495580_0082784 | Ga0495580_0082784_800_1276 | 157 |
| 1172 | 3300046472 | Ga0495580_0151150 | Ga0495580_0151150_253_729 | 157 |
| 1173 | 3300046472 | Ga0495580_0179227 | Ga0495580_0179227_369_848 | 157 |
| 1174 | 3300046473 | Ga0495582_0018805 | Ga0495582_0018805_497_973 | 157 |
| 1175 | 3300046475 | Ga0495639_0121048 | Ga0495639_0121048_467_943 | 157 |
| 1176 | 3300046475 | Ga0495639_0275999 | Ga0495639_0275999_341_820 | 157 |
| 1177 | 3300046476 | Ga0495662_0024992 | Ga0495662_0024992_109_585 | 157 |
| 1178 | 3300046477 | Ga0495664_0103722 | Ga0495664_0103722_270_746 | 157 |
| 1179 | 3300046491 | Ga0495584_0168914 | Ga0495584_0168914_517_996 | 157 |
| 1180 | 3300046492 | Ga0495585_0144845 | Ga0495585_0144845_126_605 | 157 |
| 1181 | 3300046492 | Ga0495585_0331404 | Ga0495585_0331404_91_570 | 157 |
| 1182 | 3300046499 | Ga0495594_0026282 | Ga0495594_0026282_2052_2531 | 157 |
| 1183 | 3300046499 | Ga0495594_0173761 | Ga0495594_0173761_88_564 | 157 |
| 1184 | 3300046499 | Ga0495594_0541274 | Ga0495594_0541274_137_613 | 157 |
| 1185 | 3300046506 | Ga0495583_0000217 | Ga0495583_0000217_5235_5765 | 157 |
| 1186 | 3300046506 | Ga0495583_0014453 | Ga0495583_0014453_2940_3419 | 157 |
| 1187 | 3300046506 | Ga0495583_0017569 | Ga0495583_0017569_606_1085 | 157 |
| 1188 | 3300046506 | Ga0495583_0088318 | Ga0495583_0088318_163_642 | 157 |
| 1189 | 3300046507 | Ga0495606_0031459 | Ga0495606_0031459_1002_1481 | 157 |
| 1190 | 3300046507 | Ga0495606_0153040 | Ga0495606_0153040_313_792 | 157 |
| 1191 | 3300046511 | Ga0495608_0173893 | Ga0495608_0173893_623_1099 | 157 |
| 1192 | 3300046516 | Ga0495628_0030236 | Ga0495628_0030236_2183_2659 | 157 |
| 1193 | 3300046517 | Ga0495630_0162029 | Ga0495630_0162029_964_1443 | 157 |
| 1194 | 3300046518 | Ga0495631_0041961 | Ga0495631_0041961_572_1051 | 157 |
| 1195 | 3300046518 | Ga0495631_0080611 | Ga0495631_0080611_117_596 | 157 |
| 1196 | 3300046520 | Ga0495637_0271947 | Ga0495637_0271947_71_550 | 157 |
| 1197 | 3300046522 | Ga0495643_0001166 | Ga0495643_0001166_991_1470 | 157 |
| 1198 | 3300046522 | Ga0495643_0019193 | Ga0495643_0019193_2041_2517 | 157 |
| 1199 | 3300046522 | Ga0495643_0068217 | Ga0495643_0068217_1019_1495 | 157 |
| 1200 | 3300046522 | Ga0495643_0142034 | Ga0495643_0142034_71_550 | 157 |
| 1201 | 3300046525 | Ga0495663_0022183 | Ga0495663_0022183_788_1267 | 157 |
| 1202 | 3300046525 | Ga0495663_0068445 | Ga0495663_0068445_323_802 | 157 |
| 1203 | 3300046525 | Ga0495663_0082955 | Ga0495663_0082955_116_595 | 157 |
| 1204 | 3300046526 | Ga0495666_0019490 | Ga0495666_0019490_2463_2942 | 157 |
| 1205 | 3300046526 | Ga0495666_0021664 | Ga0495666_0021664_911_1390 | 157 |
| 1206 | 3300046526 | Ga0495666_0059007 | Ga0495666_0059007_719_1198 | 157 |
| 1207 | 3300046528 | Ga0495642_0149590 | Ga0495642_0149590_116_595 | 157 |
| 1208 | 3300046531 | Ga0495665_0028022 | Ga0495665_0028022_344_823 | 157 |
| 1209 | 3300046531 | Ga0495665_0034768 | Ga0495665_0034768_1052_1531 | 157 |
| 1210 | 3300046531 | Ga0495665_0399741 | Ga0495665_0399741_173_649 | 157 |
| 1211 | 3300046535 | Ga0495586_0034409 | Ga0495586_0034409_1425_1904 | 157 |
| 1212 | 3300046535 | Ga0495586_0062533 | Ga0495586_0062533_419_895 | 157 |
| 1213 | 3300046535 | Ga0495586_0294140 | Ga0495586_0294140_429_905 | 157 |
| 1214 | 3300046537 | Ga0495598_0011881 | Ga0495598_0011881_1123_1599 | 157 |
| 1215 | 3300046537 | Ga0495598_0056914 | Ga0495598_0056914_118_594 | 157 |
| 1216 | 3300046538 | Ga0495609_0041128 | Ga0495609_0041128_21_497 | 157 |
| 1217 | 3300046538 | Ga0495609_0155196 | Ga0495609_0155196_444_923 | 157 |
| 1218 | 3300046539 | Ga0495621_0016295 | Ga0495621_0016295_227_703 | 157 |
| 1219 | 3300046539 | Ga0495621_0025100 | Ga0495621_0025100_68_544 | 157 |
| 1220 | 3300046539 | Ga0495621_0112505 | Ga0495621_0112505_240_719 | 157 |
| 1221 | 3300046542 | Ga0495597_0006249 | Ga0495597_0006249_2957_3436 | 157 |
| 1222 | 3300046542 | Ga0495597_0085971 | Ga0495597_0085971_426_905 | 157 |
| 1223 | 3300046542 | Ga0495597_0145296 | Ga0495597_0145296_484_963 | 157 |
| 1224 | 3300046543 | Ga0495645_0243285 | Ga0495645_0243285_285_761 | 157 |
| 1225 | 3300046557 | Ga0495622_0037877 | Ga0495622_0037877_813_1292 | 157 |
| 1226 | 3300046557 | Ga0495622_0093388 | Ga0495622_0093388_552_1031 | 157 |
| 1227 | 3300046558 | Ga0495633_0097623 | Ga0495633_0097623_720_1199 | 157 |
| 1228 | 3300046558 | Ga0495633_0155708 | Ga0495633_0155708_485_967 | 157 |
| 1229 | 3300046559 | Ga0495667_0276671 | Ga0495667_0276671_433_912 | 157 |
| 1230 | 3300046616 | Ga0495668_0114739 | Ga0495668_0114739_33_512 | 157 |
| 1231 | 3300046642 | Ga0495634_0273699 | Ga0495634_0273699_408_887 | 157 |
| 1232 | 3300046648 | Ga0495611_0032757 | Ga0495611_0032757_487_966 | 157 |
| 1233 | 3300046660 | Ga0495625_0076921 | Ga0495625_0076921_1086_1568 | 157 |
| 1234 | 3300046660 | Ga0495625_0129086 | Ga0495625_0129086_688_1167 | 157 |
| 1235 | 3300046663 | Ga0495635_0370760 | Ga0495635_0370760_273_749 | 157 |
| 1236 | 3300046664 | Ga0495659_0044871 | Ga0495659_0044871_855_1334 | 157 |
| 1237 | 3300046664 | Ga0495659_0291515 | Ga0495659_0291515_24_503 | 157 |
| 1238 | 3300046665 | Ga0495661_0022811 | Ga0495661_0022811_144_620 | 157 |
| 1239 | 3300046665 | Ga0495661_0060721 | Ga0495661_0060721_877_1356 | 157 |
| 1240 | 3300046665 | Ga0495661_0175220 | Ga0495661_0175220_498_977 | 157 |
| 1241 | 3300046674 | Ga0495588_0013498 | Ga0495588_0013498_2266_2745 | 157 |
| 1242 | 3300046674 | Ga0495588_0045184 | Ga0495588_0045184_1527_2006 | 157 |
| 1243 | 3300046674 | Ga0495588_0079305 | Ga0495588_0079305_851_1330 | 157 |
| 1244 | 3300046674 | Ga0495588_0163724 | Ga0495588_0163724_67_546 | 157 |
| 1245 | 3300046674 | Ga0495588_0360871 | Ga0495588_0360871_185_664 | 157 |
| 1246 | 3300046675 | Ga0495657_0450986 | Ga0495657_0450986_220_696 | 157 |
| 1247 | 3300046679 | Ga0495623_0131306 | Ga0495623_0131306_156_635 | 157 |
| 1248 | 3300046679 | Ga0495623_0246794 | Ga0495623_0246794_328_804 | 157 |
| 1249 | 3300046679 | Ga0495623_0615013 | Ga0495623_0615013_50_526 | 157 |
| 1250 | 3300046683 | Ga0495658_0055078 | Ga0495658_0055078_1604_2080 | 157 |
| 1251 | 3300046683 | Ga0495658_0364847 | Ga0495658_0364847_150_626 | 157 |
| 1252 | 3300046689 | Ga0495613_0141044 | Ga0495613_0141044_515_994 | 157 |
| 1253 | 3300046690 | Ga0495624_0019960 | Ga0495624_0019960_487_966 | 157 |
| 1254 | 3300046691 | Ga0495670_0033139 | Ga0495670_0033139_434_913 | 157 |
| 1255 | 3300046691 | Ga0495670_0093245 | Ga0495670_0093245_623_1102 | 157 |
| 1256 | 3300046691 | Ga0495670_0304018 | Ga0495670_0304018_322_801 | 157 |
| 1257 | 3300046691 | Ga0495670_0414410 | Ga0495670_0414410_85_564 | 157 |
| 1258 | 3300046692 | Ga0495671_0063655 | Ga0495671_0063655_67_546 | 157 |
| 1259 | 3300046692 | Ga0495671_0066395 | Ga0495671_0066395_457_936 | 157 |
| 1260 | 3300046694 | Ga0495649_0103008 | Ga0495649_0103008_167_643 | 157 |
| 1261 | 3300046694 | Ga0495649_0351971 | Ga0495649_0351971_74_553 | 157 |
| 1262 | 3300046809 | Ga0495600_0012680 | Ga0495600_0012680_2590_3069 | 157 |
| 1263 | 3300047315 | Ga0495581_0048836 | Ga0495581_0048836_417_896 | 157 |
| 1264 | 3300047315 | Ga0495581_0049215 | Ga0495581_0049215_691_1170 | 157 |
| 1265 | 3300047315 | Ga0495581_0059618 | Ga0495581_0059618_1335_1814 | 157 |
| 1266 | 3300047315 | Ga0495581_0067339 | Ga0495581_0067339_1578_2054 | 157 |
| 1267 | 3300047315 | Ga0495581_0305727 | Ga0495581_0305727_376_855 | 157 |
| 1268 | 3300047317 | Ga0495604_0254824 | Ga0495604_0254824_27_506 | 157 |
| 1269 | 3300047317 | Ga0495604_0267923 | Ga0495604_0267923_159_635 | 157 |
| 1270 | 3300047317 | Ga0495604_0430012 | Ga0495604_0430012_351_830 | 157 |
| 1271 | 3300047318 | Ga0495636_0005023 | Ga0495636_0005023_3827_4306 | 157 |
| 1272 | 3300047318 | Ga0495636_0051454 | Ga0495636_0051454_677_1156 | 157 |
| 1273 | 3300047318 | Ga0495636_0084804 | Ga0495636_0084804_834_1313 | 157 |
| 1274 | 3300047318 | Ga0495636_0326516 | Ga0495636_0326516_157_636 | 157 |
| 1275 | 3300047319 | Ga0495674_0104908 | Ga0495674_0104908_552_1028 | 157 |
| 1276 | 3300047319 | Ga0495674_0106139 | Ga0495674_0106139_1287_1766 | 157 |
| 1277 | 3300047320 | Ga0495672_0000031 | Ga0495672_0000031_110727_111302 | 157 |
| 1278 | 3300047320 | Ga0495672_0321717 | Ga0495672_0321717_130_612 | 157 |
| 1279 | 3300047321 | Ga0495676_0071155 | Ga0495676_0071155_2038_2517 | 157 |
| 1280 | 3300047321 | Ga0495676_0102200 | Ga0495676_0102200_598_1077 | 157 |
| 1281 | 3300047321 | Ga0495676_0373360 | Ga0495676_0373360_229_708 | 157 |
| 1282 | 3300047321 | Ga0495676_0810652 | Ga0495676_0810652_100_579 | 157 |
| 1283 | 3300047323 | Ga0495683_0118858 | Ga0495683_0118858_514_993 | 157 |
| 1284 | 3300047443 | Ga0495687_022051 | Ga0495687_022051_189_665 | 157 |
| 1285 | 3300047444 | Ga0495675_0175213 | Ga0495675_0175213_709_1188 | 157 |
| 1286 | 3300047444 | Ga0495675_0406157 | Ga0495675_0406157_172_648 | 157 |
| 1287 | 3300047445 | Ga0495677_0328872 | Ga0495677_0328872_49_528 | 157 |
| 1288 | 3300047447 | Ga0495685_026444 | Ga0495685_026444_414_893 | 157 |
| 1289 | 3300047447 | Ga0495685_093592 | Ga0495685_093592_263_742 | 157 |
| 1290 | 3300047469 | Ga0495673_0000028 | Ga0495673_0000028_63584_64060 | 157 |
| 1291 | 3300047470 | Ga0495681_0036098 | Ga0495681_0036098_928_1407 | 157 |
| 1292 | 3300047470 | Ga0495681_0055838 | Ga0495681_0055838_650_1129 | 157 |
| 1293 | 3300047471 | Ga0495684_0048834 | Ga0495684_0048834_982_1458 | 157 |
| 1294 | 3300047472 | Ga0495686_0045612 | Ga0495686_0045612_1221_1700 | 157 |
| 1295 | 3300047673 | Ga0495593_0129475 | Ga0495593_0129475_459_938 | 157 |
| 1296 | 3300047673 | Ga0495593_0245510 | Ga0495593_0245510_28_507 | 157 |
| 1297 | 3300048088 | Ga0495602_0194167 | Ga0495602_0194167_794_1270 | 157 |
| 1298 | 3300048088 | Ga0495602_0295523 | Ga0495602_0295523_681_1160 | 157 |
| 1299 | 3300048089 | Ga0495614_0080005 | Ga0495614_0080005_783_1259 | 157 |
| 1300 | 3300048089 | Ga0495614_0186307 | Ga0495614_0186307_391_870 | 157 |
| 1301 | 3300048090 | Ga0495615_0041128 | Ga0495615_0041128_332_811 | 157 |
| 1302 | 3300048091 | Ga0495626_0005379 | Ga0495626_0005379_3069_3548 | 157 |
| 1303 | 3300048903 | Ga0496100_0030264 | Ga0496100_0030264_174_650 | 157 |
| 1304 | 3300048903 | Ga0496100_0058178 | Ga0496100_0058178_148_624 | 157 |
| 1305 | 3300048903 | Ga0496100_0245245 | Ga0496100_0245245_281_757 | 157 |
| 1306 | 3300048903 | Ga0496100_0927713 | Ga0496100_0927713_73_549 | 157 |
| 1307 | 3300048904 | Ga0496101_0044130 | Ga0496101_0044130_540_1016 | 157 |
| 1308 | 3300048904 | Ga0496101_0114312 | Ga0496101_0114312_868_1344 | 157 |
| 1309 | 3300048904 | Ga0496101_0164657 | Ga0496101_0164657_93_569 | 157 |
| 1310 | 3300048905 | Ga0496102_0000166 | Ga0496102_0000166_3168_3647 | 157 |
| 1311 | 3300048905 | Ga0496102_0043495 | Ga0496102_0043495_2954_3433 | 157 |
| 1312 | 3300048905 | Ga0496102_0165660 | Ga0496102_0165660_354_833 | 157 |
| 1313 | 3300048905 | Ga0496102_0463421 | Ga0496102_0463421_543_1022 | 157 |
| 1314 | 3300048906 | Ga0496103_0014421 | Ga0496103_0014421_1655_2134 | 157 |
| 1315 | 3300048906 | Ga0496103_0035137 | Ga0496103_0035137_297_773 | 157 |
| 1316 | 3300048907 | Ga0496104_0011806 | Ga0496104_0011806_882_1358 | 157 |
| 1317 | 3300048907 | Ga0496104_0348537 | Ga0496104_0348537_378_854 | 157 |
| 1318 | 3300048908 | Ga0496105_0137128 | Ga0496105_0137128_1140_1616 | 157 |
| 1319 | 3300048909 | Ga0496106_0037440 | Ga0496106_0037440_2526_3002 | 157 |
| 1320 | 3300048909 | Ga0496106_0518710 | Ga0496106_0518710_32_511 | 157 |
| 1321 | 3300048909 | Ga0496106_0748867 | Ga0496106_0748867_226_702 | 157 |
| 1322 | 3300048909 | Ga0496106_1019680 | Ga0496106_1019680_104_580 | 157 |
| 1323 | 3300048910 | Ga0496107_0008333 | Ga0496107_0008333_5739_6215 | 157 |
| 1324 | 3300048910 | Ga0496107_0110601 | Ga0496107_0110601_1176_1652 | 157 |
| 1325 | 3300048910 | Ga0496107_0385055 | Ga0496107_0385055_495_971 | 157 |
| 1326 | 3300048911 | Ga0496108_0049209 | Ga0496108_0049209_628_1104 | 157 |
| 1327 | 3300048911 | Ga0496108_0373266 | Ga0496108_0373266_73_549 | 157 |
| 1328 | 3300048911 | Ga0496108_0665374 | Ga0496108_0665374_315_791 | 157 |
| 1329 | 3300048912 | Ga0496109_0005807 | Ga0496109_0005807_3058_3534 | 157 |
| 1330 | 3300048912 | Ga0496109_0102125 | Ga0496109_0102125_1575_2051 | 157 |
| 1331 | 3300048912 | Ga0496109_0108227 | Ga0496109_0108227_826_1302 | 157 |
| 1332 | 3300048912 | Ga0496109_0559998 | Ga0496109_0559998_155_631 | 157 |
| 1333 | 3300048913 | Ga0496110_0060817 | Ga0496110_0060817_940_1416 | 157 |
| 1334 | 3300048914 | Ga0496111_0009592 | Ga0496111_0009592_5415_5891 | 157 |
| 1335 | 3300048914 | Ga0496111_0055656 | Ga0496111_0055656_608_1084 | 157 |
| 1336 | 3300048915 | Ga0496112_0033696 | Ga0496112_0033696_721_1197 | 157 |
| 1337 | 3300048915 | Ga0496112_0952363 | Ga0496112_0952363_289_765 | 157 |
| 1338 | 3300048916 | Ga0496113_0091492 | Ga0496113_0091492_1353_1829 | 157 |
| 1339 | 3300048916 | Ga0496113_1324230 | Ga0496113_1324230_56_532 | 157 |
| 1340 | 3300048916 | Ga0496113_1420521 | Ga0496113_1420521_30_506 | 157 |
| 1341 | 3300048917 | Ga0496114_0011526 | Ga0496114_0011526_6084_6560 | 157 |
| 1342 | 3300048917 | Ga0496114_0041652 | Ga0496114_0041652_2441_2917 | 157 |
| 1343 | 3300048917 | Ga0496114_0095236 | Ga0496114_0095236_1453_1929 | 157 |
| 1344 | 3300048917 | Ga0496114_0212790 | Ga0496114_0212790_1077_1553 | 157 |
| 1345 | 3300048918 | Ga0496115_0078080 | Ga0496115_0078080_1850_2329 | 157 |
| 1346 | 3300048918 | Ga0496115_0093660 | Ga0496115_0093660_587_1066 | 157 |
| 1347 | 3300048918 | Ga0496115_0098112 | Ga0496115_0098112_1571_2050 | 157 |
| 1348 | 3300048918 | Ga0496115_0217993 | Ga0496115_0217993_56_532 | 157 |
| 1349 | 3300048918 | Ga0496115_0267873 | Ga0496115_0267873_820_1299 | 157 |
| 1350 | 3300048918 | Ga0496115_0270790 | Ga0496115_0270790_166_642 | 157 |
| 1351 | 3300048918 | Ga0496115_0282430 | Ga0496115_0282430_275_751 | 157 |
| 1352 | 3300048918 | Ga0496115_0454362 | Ga0496115_0454362_389_868 | 157 |
| 1353 | 3300048918 | Ga0496115_0462476 | Ga0496115_0462476_315_794 | 157 |
| 1354 | 3300048919 | Ga0496116_0044500 | Ga0496116_0044500_1567_2049 | 157 |
| 1355 | 3300048921 | Ga0496118_0059002 | Ga0496118_0059002_156_638 | 157 |
| 1356 | 3300048924 | Ga0496121_0051062 | Ga0496121_0051062_2006_2488 | 157 |
| 1357 | 3300048924 | Ga0496121_0193253 | Ga0496121_0193253_678_1160 | 157 |
| 1358 | 3300048924 | Ga0496121_0596685 | Ga0496121_0596685_145_627 | 157 |
| 1359 | 3300048925 | Ga0496122_0038511 | Ga0496122_0038511_2366_2848 | 157 |
| 1360 | 3300048926 | Ga0496123_0018844 | Ga0496123_0018844_2358_2840 | 157 |
| 1361 | 3300048927 | Ga0496124_0206378 | Ga0496124_0206378_367_843 | 157 |
| 1362 | 3300048928 | Ga0496125_0041078 | Ga0496125_0041078_889_1371 | 157 |
| 1363 | 3300048928 | Ga0496125_0243330 | Ga0496125_0243330_561_1043 | 157 |
| 1364 | 3300049130 | Ga0501310_009961 | Ga0501310_009961_149_631 | 157 |
| 1365 | 3300049161 | Ga0501305_022539 | Ga0501305_022539_11_493 | 157 |
| 1366 | 3300049459 | Ga0495678_002684 | Ga0495678_002684_2257_2736 | 157 |
| 1367 | 3300049459 | Ga0495678_017933 | Ga0495678_017933_2332_2811 | 157 |
| 1368 | 3300049513 | Ga0501290_013158 | Ga0501290_013158_158_634 | 157 |
| 1369 | 3300049528 | Ga0501312_065007 | Ga0501312_065007_73_552 | 157 |
| 1370 | 3300049529 | Ga0501313_042918 | Ga0501313_042918_11_487 | 157 |
| 1371 | 3300049539 | Ga0501323_013047 | Ga0501323_013047_507_986 | 157 |
| 1372 | 3300049569 | Ga0501032_0003171 | Ga0501032_0003171_5807_6283 | 157 |
| 1373 | 3300049571 | Ga0501034_0009859 | Ga0501034_0009859_5647_6123 | 157 |
| 1374 | 3300049571 | Ga0501034_0114782 | Ga0501034_0114782_499_975 | 157 |
| 1375 | 3300049574 | Ga0501038_0007948 | Ga0501038_0007948_8941_9417 | 157 |
| 1376 | 3300049582 | Ga0501048_0884975 | Ga0501048_0884975_123_599 | 157 |
| 1377 | 3300049583 | Ga0501067_0302894 | Ga0501067_0302894_329_805 | 157 |
| 1378 | 3300049592 | Ga0501076_0387328 | Ga0501076_0387328_429_905 | 157 |
| 1379 | 3300049671 | Ga0501238_004953 | Ga0501238_004953_288_764 | 157 |
| 1380 | 3300049673 | Ga0501240_058404 | Ga0501240_058404_95_574 | 157 |
| 1381 | 3300049766 | Ga0501269_005909 | Ga0501269_005909_704_1186 | 157 |
| 1382 | 3300049822 | Ga0501035_0036589 | Ga0501035_0036589_748_1224 | 157 |
| 1383 | 3300049822 | Ga0501035_0443727 | Ga0501035_0443727_84_560 | 157 |
| 1384 | 3300049823 | Ga0501044_0812920 | Ga0501044_0812920_38_514 | 157 |
| 1385 | 3300050511 | nmdc:mga08y16_98284_c1 | nmdc:mga08y16_98284_c1_316_792 | 157 |
| 1386 | 3300050512 | nmdc:mga0n895_382601_c1 | nmdc:mga0n895_382601_c1_282_758 | 157 |
| 1387 | 3300050513 | nmdc:mga0rr50_128334_c1 | nmdc:mga0rr50_128334_c1_1205_1681 | 157 |
| 1388 | 3300050513 | nmdc:mga0rr50_76770_c1 | nmdc:mga0rr50_76770_c1_941_1417 | 157 |
| 1389 | 3300050515 | nmdc:mga0a205_194502_c1 | nmdc:mga0a205_194502_c1_256_786 | 157 |
| 1390 | 3300053078 | Ga0495612_0318104 | Ga0495612_0318104_190_666 | 157 |
| 1391 | 3300053084 | Ga0495595_0097296 | Ga0495595_0097296_880_1356 | 157 |
| 1392 | 3300053084 | Ga0495595_0168686 | Ga0495595_0168686_290_766 | 157 |
| 1393 | 3300053085 | Ga0495619_0235247 | Ga0495619_0235247_676_1152 | 157 |
| 1394 | 3300053125 | Ga0500618_006829 | Ga0500618_006829_2057_2533 | 157 |
| 1395 | 3300053149 | Ga0500600_0006158 | Ga0500600_0006158_433_954 | 157 |
| 1396 | 3300053156 | Ga0500622_0000002 | Ga0500622_0000002_546933_547409 | 157 |
| 1397 | 3300059510 | Ga0587090_004715 | Ga0587090_004715_966_1442 | 157 |
| 1398 | 3300059639 | Ga0587062_043488 | Ga0587062_043488_58_534 | 157 |
| 1399 | 3300060346 | Ga0587111_0003898 | Ga0587111_0003898_1410_1886 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1grj-assembly1.cif.gz_A | grea transcript cleavage factor from escherichia coli | 0.9625 | 3 | 157 |
| 1grj-assembly1.cif.gz_A | grea transcript cleavage factor from escherichia coli | 0.9501 | 3 | 157 |
| 3ta8-assembly1.cif.gz_A | crystal structure hp-nap from strain ys39 iron loaded (cocrystallization 5mm) | 0.9306 | 11 | 68 |
| 1ji4-assembly1.cif.gz_A | nap protein from helicobacter pylori | 0.9238 | 14 | 68 |
| 4pju-assembly1.cif.gz_A | crystal structure of human stromal antigen 2 (sa2) in complex with sister chromatid cohesion protein 1 (scc1) | 0.922 | 13 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6W5_1_75_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9999 | 1 | 74 | 1.10.287.180 |
| 1grjA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9854 | 3 | 74 | 1.10.287.180 |
| 1grjA02 | Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain | 0.9817 | 75 | 157 | 3.10.50.30 |
| af_P0A6W5_1_75_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9736 | 1 | 74 | 1.10.287.180 |
| 1grjA02 | Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain | 0.9693 | 75 | 157 | 3.10.50.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1WF27-F1-model_v4 | Transcription elongation factor GreA | 0.9946 | 86 | 157 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A2A7U692-F1-model_v4 | Transcription elongation factor GreA (Transcript cleavage factor GreA) | 0.9904 | 1 | 157 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A233RI48-F1-model_v4 | Transcription elongation factor GreA (Transcript cleavage factor GreA) | 0.9894 | 1 | 157 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A090V2Y6-F1-model_v4 | Transcription elongation factor GreA (Transcript cleavage factor GreA) | 0.9858 | 1 | 157 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A2T3K4A0-F1-model_v4 | deleted | 0.9854 | 1 | 157 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar