F493611

General Info

Members Datasets Scaffolds Average Seq Length
1393 671 1158 156

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_104850|Ga0500645_104850_113_661
Length 182
Sequence MSRRRQADKREVLPDPRFNDIELTKFMNSLMYDGKKSAAENIVYGALELLEKRAANDKGAKTEEASADENVATTSGGAVVTHKGLITFYKALKNVAPHVEVRSRRVGGATYQVPVEVRFDRARALARRWLIDAARRRGEKTMRERLAGEIQEASNNRGNAVKKREDTHKMAEANKAFAHYRW

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
18 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
19 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
20 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
21 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
22 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
23 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
24 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
25 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
26 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
27 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
28 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
29 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
30 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
31 2643221651 Afipia sp. Root123D2 Isolate Unclassified
32 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
33 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
34 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
35 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
36 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
37 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
38 2791355199
39 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
40 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
41 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
42 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
43 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
44 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
45 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
46 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
47 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
48 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
49 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
50 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
51 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
52 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
53 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
54 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
55 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
56 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
57 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
58 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
59 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
60 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
61 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
62 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
63 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
64 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
65 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
66 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
67 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
68 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
69 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
70 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
71 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
72 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
73 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
74 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
75 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
76 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
77 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
78 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
79 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
80 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
81 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
82 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
83 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
84 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
85 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
86 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
87 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
88 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
89 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
90 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
91 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
92 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
93 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
94 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
95 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
96 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
97 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
98 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
99 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
100 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
101 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
102 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
103 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
104 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
105 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
106 2904699407
107 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
108 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
109 2906610324
110 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
111 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
112 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
113 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
114 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
115 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
116 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
117 2909042592 Labrys sp. LIt4 Isolate Nodule
118 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
119 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
120 2922368715
121 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
122 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
123 2922425934
124 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
125 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
126 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
127 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
128 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
129 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
130 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
131 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
132 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
133 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
134 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
135 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
136 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
137 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
138 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
139 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
140 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
141 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
142 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
143 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
144 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
145 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
146 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
147 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
148 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
149 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
150 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
151 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
152 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
153 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
154 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
155 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
156 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
157 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
158 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
159 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
160 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
161 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
162 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
163 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
164 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
165 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
166 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
167 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
168 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
169 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
170 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
171 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
172 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
173 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
174 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
175 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
176 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
177 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
178 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
179 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
180 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
181 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
182 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
183 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
184 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
185 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
186 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
187 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
188 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
189 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
190 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
191 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
192 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
193 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
194 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
195 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
196 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
197 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
198 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
199 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
200 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
201 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
202 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
203 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
204 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
205 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
206 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
207 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
209 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
212 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
214 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
215 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
216 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
217 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
218 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
219 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
220 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
221 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
222 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
223 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
224 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
225 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
226 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
227 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
228 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
229 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
230 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
231 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
232 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
233 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
234 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
235 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
236 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
237 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
238 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
239 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
240 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
241 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
242 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
243 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
244 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
245 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
246 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
247 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
248 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
249 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
250 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
251 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
252 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
253 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
254 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
255 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
256 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
257 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
258 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
259 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
260 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
261 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
262 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
263 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
264 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
265 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
266 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
267 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
268 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
269 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
270 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
271 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
272 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
273 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
274 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
275 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
276 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
277 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
278 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
279 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
280 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
281 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
282 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
283 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
284 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
285 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
286 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
287 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
288 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
289 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
290 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
291 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
292 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
293 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
294 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
295 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
296 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
297 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
298 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
299 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
300 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
301 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
302 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
303 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
304 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
305 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
306 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
307 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
308 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
309 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
310 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
311 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
312 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
313 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
314 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
315 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
316 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
317 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
318 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
319 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
320 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
321 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
322 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
323 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
324 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
325 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
326 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
327 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
328 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
329 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
330 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
331 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
332 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
333 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
334 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
335 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
336 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
337 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
338 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
339 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
340 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
341 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
342 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
343 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
344 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
345 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
346 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
347 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
348 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
349 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
350 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
351 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
418 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
419 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
423 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
424 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
425 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
426 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
427 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
428 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
429 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
430 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
431 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
432 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
433 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
434 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
435 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
436 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
437 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
438 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
439 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
440 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
441 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
442 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
443 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
444 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
445 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
446 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
447 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
448 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
450 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
451 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
452 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
453 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
454 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
455 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
456 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
457 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
458 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
459 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
460 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
461 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
462 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
463 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
464 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
465 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
466 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
467 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
468 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
469 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
470 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
471 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
472 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
473 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
474 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
475 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
476 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
477 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
478 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
479 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
480 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
481 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
482 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
483 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
484 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
485 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
486 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
487 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
488 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
489 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
490 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
491 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
492 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
493 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
494 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
495 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
496 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
497 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
498 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
499 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
500 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
501 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
502 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
503 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
504 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
505 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
506 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
507 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
508 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
509 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
510 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
511 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
512 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
513 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
514 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
515 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
516 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
517 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
518 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
519 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
520 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
521 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
522 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
523 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
524 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
525 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
526 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
527 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
528 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
529 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
530 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
531 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
532 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
533 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
534 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
535 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
536 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
537 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
538 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
539 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
540 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
541 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
542 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
543 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
544 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
545 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
546 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
547 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
548 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
549 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
550 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
551 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
552 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
553 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
554 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
555 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
556 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
557 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
558 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
559 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
560 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
561 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
562 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
563 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
564 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
565 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
566 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
567 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
568 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
569 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
574 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
575 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
576 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
577 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
578 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
579 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
580 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
581 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
582 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
583 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
584 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
585 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
586 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
587 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
588 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
589 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
590 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
591 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
592 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
593 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
595 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
596 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
597 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
598 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
599 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
600 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
601 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
602 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
603 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
604 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
605 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
606 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
607 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
608 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
609 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
610 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
611 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
612 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
613 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
614 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
615 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
616 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
617 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
618 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
619 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
620 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
621 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
622 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
623 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
628 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
629 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
630 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
631 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
632 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
633 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
634 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
635 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
636 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
637 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
638 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
639 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
640 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
641 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
642 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
643 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
644 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
645 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
646 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
647 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
648 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
649 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
650 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
651 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
652 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
653 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
654 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
655 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
656 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
657 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
658 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
659 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
660 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
661 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
662 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
663 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
664 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
665 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
666 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
667 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
668 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
669 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
670 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
671 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.63
Metatranscriptomes 1.8
Isolates 16.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 11.84
Rhizoplane 2.01
Rhizosphere 76.74
Stem 0
Stem Tuber 0
Unclassified 6.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001311 3300001976 Bacteria 3362
2 JGI24743J22301_10160210 3300001991 Bacteria 508
3 JGI24748J21848_1024821 3300002074 Bacteria 730
4 JGI24749J21850_1001881 3300002076 Bacteria 2967
5 JGI24744J21845_10041717 3300002077 Bacteria 857
6 JGI24035J26624_1020509 3300002126 Bacteria 696
7 JGI24034J26672_10002015 3300002239 Bacteria 2754
8 JGI24742J22300_10034719 3300002244 Bacteria 888
9 JGI24751J29686_10015977 3300002459 Bacteria 1548
10 JGI25406J46586_10118333 3300003203 Bacteria 781
11 rootH2_10110168 3300003320 Bacteria 2865
12 Ga0007416J51690_1017726 3300003577 Bacteria 1282
13 JGI25404J52841_10004339 3300003659 Bacteria 2866
14 JGI25404J52841_10038933 3300003659 Bacteria 1008
15 Ga0032354_1061987 3300003693 Bacteria 1295
16 Ga0058859_11594462 3300004798 Bacteria 667
17 Ga0058859_11820684 3300004798 Bacteria 1398
18 Ga0058863_10056823 3300004799 Bacteria 915
19 Ga0058863_10080931 3300004799 Bacteria 811
20 Ga0058861_10030443 3300004800 Bacteria 1160
21 Ga0058861_10175812 3300004800 Bacteria 926
22 Ga0058861_11851124 3300004800 Bacteria 691
23 Ga0058860_11861917 3300004801 Bacteria 847
24 Ga0058860_12158433 3300004801 Bacteria 1313
25 Ga0058862_10078448 3300004803 Bacteria 1114
26 Ga0058862_10111058 3300004803 Bacteria 1074
27 Ga0058862_10160436 3300004803 Bacteria 5467
28 Ga0065704_10312968 3300005289 Bacteria 865
29 Ga0065712_10109692 3300005290 Bacteria 1851
30 Ga0065712_10175657 3300005290 Bacteria 1219
31 Ga0065715_10096781 3300005293 Bacteria 3819
32 Ga0065715_10593290 3300005293 Bacteria 700
33 Ga0065707_10105665 3300005295 Bacteria 2629
34 Ga0065707_10155043 3300005295 Bacteria 1617
35 Ga0070658_10001321 3300005327 Bacteria 21139
36 Ga0070676_10000380 3300005328 Bacteria 20558
37 Ga0070676_10313408 3300005328 Bacteria 1067
38 Ga0070683_100000033 3300005329 Bacteria 135305
39 Ga0070683_100036594 3300005329 Bacteria 4492
40 Ga0070683_100152551 3300005329 Bacteria 2190
41 Ga0070690_100011157 3300005330 Bacteria 5249
42 Ga0070690_100046988 3300005330 Bacteria 2745
43 Ga0070690_100150920 3300005330 Bacteria 1585
44 Ga0070670_100003921 3300005331 Bacteria 12413
45 Ga0070670_100012257 3300005331 Bacteria 7335
46 Ga0070670_100045805 3300005331 Bacteria 3760
47 Ga0070670_100082102 3300005331 Bacteria 2770
48 Ga0070670_100562757 3300005331 Bacteria 1018
49 Ga0070677_10000135 3300005333 Bacteria 24603
50 Ga0070677_10058986 3300005333 Bacteria 1577
51 Ga0070677_10155312 3300005333 Bacteria 1069
52 Ga0070677_10693157 3300005333 Bacteria 573
53 Ga0068869_100000118 3300005334 Bacteria 38113
54 Ga0068869_100044269 3300005334 Bacteria 3200
55 Ga0068869_100618371 3300005334 Bacteria 917
56 Ga0070666_10001221 3300005335 Bacteria 15513
57 Ga0070666_10002914 3300005335 Bacteria 10347
58 Ga0070666_10010376 3300005335 Bacteria 5825
59 Ga0070680_100025773 3300005336 Bacteria 4701
60 Ga0070680_100261308 3300005336 Bacteria 1465
61 Ga0070680_100339940 3300005336 Bacteria 1275
62 Ga0070680_100723710 3300005336 Bacteria 856
63 Ga0070680_100961876 3300005336 Bacteria 737
64 Ga0070682_100000036 3300005337 Bacteria 149965
65 Ga0070682_100182381 3300005337 Bacteria 1467
66 Ga0070682_100500128 3300005337 Bacteria 942
67 Ga0068868_100000723 3300005338 Bacteria 22297
68 Ga0068868_100000912 3300005338 Bacteria 20077
69 Ga0068868_100014237 3300005338 Bacteria 5858
70 Ga0068868_100041603 3300005338 Bacteria 3580
71 Ga0068868_101035301 3300005338 Bacteria 752
72 Ga0070660_100000631 3300005339 Bacteria 23479
73 Ga0070660_100135988 3300005339 Bacteria 1969
74 Ga0070689_100000443 3300005340 Bacteria 24402
75 Ga0070689_100015182 3300005340 Bacteria 5612
76 Ga0070689_100019995 3300005340 Bacteria 4962
77 Ga0070689_100060765 3300005340 Bacteria 2939
78 Ga0070689_101006720 3300005340 Bacteria 741
79 Ga0070691_10130801 3300005341 Bacteria 1272
80 Ga0070687_100005653 3300005343 Bacteria 5071
81 Ga0070687_100014217 3300005343 Bacteria 3571
82 Ga0070687_100207292 3300005343 Bacteria 1192
83 Ga0070687_100776215 3300005343 Bacteria 677
84 Ga0070661_100009001 3300005344 Bacteria 6908
85 Ga0070661_100077614 3300005344 Bacteria 2449
86 Ga0070692_10156770 3300005345 Bacteria 1301
87 Ga0070692_10704524 3300005345 Bacteria 680
88 Ga0070668_100000076 3300005347 Bacteria 60771
89 Ga0070668_100036317 3300005347 Bacteria 3760
90 Ga0070668_100466288 3300005347 Bacteria 1088
91 Ga0070668_100980307 3300005347 Bacteria 759
92 Ga0070668_100986416 3300005347 Bacteria 757
93 Ga0070669_100000096 3300005353 Bacteria 86930
94 Ga0070669_100032654 3300005353 Bacteria 3760
95 Ga0070669_100045874 3300005353 Bacteria 3185
96 Ga0070669_100057829 3300005353 Bacteria 2846
97 Ga0070669_100124436 3300005353 Bacteria 1971
98 Ga0070675_100000559 3300005354 Bacteria 25636
99 Ga0070675_100017111 3300005354 Bacteria 5761
100 Ga0070675_100018869 3300005354 Bacteria 5492
101 Ga0070675_100052834 3300005354 Bacteria 3341
102 Ga0070675_100148076 3300005354 Bacteria 2011
103 Ga0070675_100474509 3300005354 Bacteria 1124
104 Ga0070675_100485534 3300005354 Bacteria 1112
105 Ga0070671_100000045 3300005355 Bacteria 85779
106 Ga0070671_100001952 3300005355 Bacteria 15828
107 Ga0070671_100042395 3300005355 Bacteria 3782
108 Ga0070671_100350254 3300005355 Bacteria 1260
109 Ga0070671_100358067 3300005355 Bacteria 1246
110 Ga0070671_100553913 3300005355 Bacteria 992
111 Ga0070674_100000922 3300005356 Bacteria 15331
112 Ga0070674_100146244 3300005356 Bacteria 1779
113 Ga0070674_100206191 3300005356 Bacteria 1521
114 Ga0070674_100269913 3300005356 Bacteria 1344
115 Ga0070674_100614464 3300005356 Bacteria 920
116 Ga0070673_100001307 3300005364 Bacteria 14516
117 Ga0070673_100002114 3300005364 Bacteria 12012
118 Ga0070673_100058949 3300005364 Bacteria 3037
119 Ga0070673_100194356 3300005364 Bacteria 1744
120 Ga0070673_100252144 3300005364 Bacteria 1539
121 Ga0070673_100540477 3300005364 Bacteria 1058
122 Ga0070688_100007941 3300005365 Bacteria 5739
123 Ga0070688_100052606 3300005365 Bacteria 2544
124 Ga0070688_100438694 3300005365 Bacteria 974
125 Ga0070659_100000088 3300005366 Bacteria 69112
126 Ga0070659_100084712 3300005366 Bacteria 2534
127 Ga0070667_100000025 3300005367 Bacteria 190744
128 Ga0070667_100003534 3300005367 Bacteria 13313
129 Ga0070667_100007729 3300005367 Bacteria 8912
130 Ga0070667_100022068 3300005367 Bacteria 5281
131 Ga0070667_100032953 3300005367 Bacteria 4324
132 Ga0070667_100469753 3300005367 Bacteria 1151
133 Ga0070713_100306206 3300005436 Bacteria 1464
134 Ga0070710_10840348 3300005437 Bacteria 659
135 Ga0070701_10053241 3300005438 Bacteria 2106
136 Ga0070711_100582287 3300005439 Bacteria 932
137 Ga0070705_100000956 3300005440 Bacteria 16188
138 Ga0070705_100368521 3300005440 Bacteria 1053
139 Ga0070700_100102202 3300005441 Bacteria 1890
140 Ga0070700_100144679 3300005441 Bacteria 1619
141 Ga0070700_100573676 3300005441 Bacteria 880
142 Ga0070700_100623759 3300005441 Bacteria 848
143 Ga0070694_100575120 3300005444 Bacteria 905
144 Ga0070708_100004467 3300005445 Bacteria 11001
145 Ga0070708_100497899 3300005445 Bacteria 1149
146 Ga0070663_100015416 3300005455 Bacteria 4933
147 Ga0070678_100000461 3300005456 Bacteria 19447
148 Ga0070678_100194825 3300005456 Bacteria 1668
149 Ga0070678_100354391 3300005456 Bacteria 1263
150 Ga0070678_100642780 3300005456 Bacteria 951
151 Ga0070678_101249501 3300005456 Bacteria 690
152 Ga0070662_100000976 3300005457 Bacteria 17505
153 Ga0070662_100027519 3300005457 Bacteria 3947
154 Ga0070681_10077480 3300005458 Bacteria 3282
155 Ga0070681_10209829 3300005458 Bacteria 1864
156 Ga0070681_10288163 3300005458 Bacteria 1552
157 Ga0070681_10304780 3300005458 Bacteria 1502
158 Ga0070681_10327027 3300005458 Bacteria 1443
159 Ga0068867_100022286 3300005459 Bacteria 4528
160 Ga0068867_100118640 3300005459 Bacteria 2041
161 Ga0068867_100192373 3300005459 Bacteria 1629
162 Ga0068867_100402525 3300005459 Bacteria 1155
163 Ga0070685_10000585 3300005466 Bacteria 20257
164 Ga0070685_10060815 3300005466 Bacteria 2210
165 Ga0070685_10209483 3300005466 Bacteria 1271
166 Ga0070685_10624909 3300005466 Bacteria 778
167 Ga0070707_100021471 3300005468 Bacteria 6103
168 Ga0070698_100194930 3300005471 Bacteria 1963
169 Ga0070698_100519048 3300005471 Bacteria 1130
170 Ga0070698_100786664 3300005471 Bacteria 895
171 Ga0070699_100128090 3300005518 Bacteria 2236
172 Ga0070699_100662949 3300005518 Bacteria 953
173 Ga0070679_100030992 3300005530 Bacteria 5283
174 Ga0070679_100100465 3300005530 Bacteria 2879
175 Ga0070679_100149984 3300005530 Bacteria 2308
176 Ga0070679_100211006 3300005530 Bacteria 1906
177 Ga0070679_100420175 3300005530 Bacteria 1282
178 Ga0070679_101057699 3300005530 Bacteria 756
179 Ga0070684_100010702 3300005535 Bacteria 7276
180 Ga0070684_100054901 3300005535 Bacteria 3471
181 Ga0070684_100109082 3300005535 Bacteria 2480
182 Ga0070684_100192199 3300005535 Bacteria 1858
183 Ga0070697_100004239 3300005536 Bacteria 10989
184 Ga0070697_100238499 3300005536 Bacteria 1552
185 Ga0068853_100000472 3300005539 Bacteria 27445
186 Ga0068853_100170573 3300005539 Bacteria 1968
187 Ga0070672_100000581 3300005543 Bacteria 21483
188 Ga0070672_100005460 3300005543 Bacteria 8428
189 Ga0070672_100048521 3300005543 Bacteria 3300
190 Ga0070672_100076957 3300005543 Bacteria 2667
191 Ga0070672_100576426 3300005543 Bacteria 979
192 Ga0070686_100000708 3300005544 Bacteria 19370
193 Ga0070686_100059609 3300005544 Bacteria 2460
194 Ga0070686_100210392 3300005544 Bacteria 1400
195 Ga0070686_100219016 3300005544 Bacteria 1374
196 Ga0070686_100796249 3300005544 Bacteria 761
197 Ga0070695_100098141 3300005545 Bacteria 1968
198 Ga0070695_100181760 3300005545 Bacteria 1491
199 Ga0070696_100078380 3300005546 Bacteria 2336
200 Ga0070696_100225948 3300005546 Bacteria 1407
201 Ga0070693_100034250 3300005547 Bacteria 2809
202 Ga0070693_100392828 3300005547 Bacteria 960
203 Ga0070665_100061650 3300005548 Bacteria 3760
204 Ga0070665_100103384 3300005548 Bacteria 2852
205 Ga0070665_100571036 3300005548 Bacteria 1144
206 Ga0070665_100838043 3300005548 Bacteria 933
207 Ga0068855_100002917 3300005563 Bacteria 20934
208 Ga0068855_101258081 3300005563 Bacteria 767
209 Ga0068855_101617578 3300005563 Bacteria 662
210 Ga0070664_100000540 3300005564 Bacteria 28865
211 Ga0070664_100001968 3300005564 Bacteria 16471
212 Ga0070664_100017196 3300005564 Bacteria 5937
213 Ga0070664_100023966 3300005564 Bacteria 5042
214 Ga0070664_100513685 3300005564 Bacteria 1105
215 Ga0068857_100004949 3300005577 Bacteria 11316
216 Ga0068857_100740951 3300005577 Bacteria 935
217 Ga0068854_100008432 3300005578 Bacteria 6626
218 Ga0068856_100000972 3300005614 Bacteria 30573
219 Ga0068856_100008110 3300005614 Bacteria 10251
220 Ga0068856_102086557 3300005614 Bacteria 577
221 Ga0070702_100174354 3300005615 Bacteria 1402
222 Ga0070702_100268867 3300005615 Bacteria 1165
223 Ga0070702_100322131 3300005615 Bacteria 1078
224 Ga0070702_100520717 3300005615 Bacteria 877
225 Ga0068852_100000931 3300005616 Bacteria 19323
226 Ga0068852_100998686 3300005616 Bacteria 855
227 Ga0068859_100000162 3300005617 Bacteria 65033
228 Ga0068859_100000703 3300005617 Bacteria 33591
229 Ga0068859_100001363 3300005617 Bacteria 24912
230 Ga0068859_100002579 3300005617 Bacteria 18428
231 Ga0068859_100116937 3300005617 Bacteria 2731
232 Ga0068859_100662919 3300005617 Bacteria 1135
233 Ga0068864_100000406 3300005618 Bacteria 37364
234 Ga0068864_100000677 3300005618 Bacteria 28506
235 Ga0068864_100001203 3300005618 Bacteria 21489
236 Ga0068864_100018418 3300005618 Bacteria 5835
237 Ga0068864_100077202 3300005618 Bacteria 2912
238 Ga0068864_100081439 3300005618 Bacteria 2838
239 Ga0068864_101501252 3300005618 Bacteria 677
240 Ga0068866_10002337 3300005718 Bacteria 7856
241 Ga0068866_10164411 3300005718 Bacteria 1297
242 Ga0068866_10396826 3300005718 Bacteria 889
243 Ga0068866_10674739 3300005718 Bacteria 706
244 Ga0068861_100000205 3300005719 Bacteria 31483
245 Ga0068861_100086895 3300005719 Bacteria 2459
246 Ga0068861_100350673 3300005719 Bacteria 1294
247 Ga0068851_10000663 3300005834 Bacteria 14698
248 Ga0068870_10001380 3300005840 Bacteria 9803
249 Ga0068870_10061307 3300005840 Bacteria 2022
250 Ga0068870_10206190 3300005840 Bacteria 1195
251 Ga0068863_100000067 3300005841 Bacteria 117275
252 Ga0068863_100000784 3300005841 Bacteria 31931
253 Ga0068863_100000969 3300005841 Bacteria 28867
254 Ga0068863_100002121 3300005841 Bacteria 19668
255 Ga0068863_100593629 3300005841 Bacteria 1096
256 Ga0068858_100008722 3300005842 Bacteria 9734
257 Ga0068858_100026802 3300005842 Bacteria 5354
258 Ga0068858_100027525 3300005842 Bacteria 5281
259 Ga0068858_100036951 3300005842 Bacteria 4528
260 Ga0068858_100208213 3300005842 Bacteria 1850
261 Ga0068858_100277835 3300005842 Bacteria 1594
262 Ga0068858_100320333 3300005842 Bacteria 1482
263 Ga0068858_100570992 3300005842 Bacteria 1096
264 Ga0068860_100004945 3300005843 Bacteria 13583
265 Ga0068860_100014085 3300005843 Bacteria 7846
266 Ga0068860_100039250 3300005843 Bacteria 4528
267 Ga0068860_100045537 3300005843 Bacteria 4184
268 Ga0068860_100048778 3300005843 Bacteria 4035
269 Ga0068860_100270458 3300005843 Bacteria 1658
270 Ga0068862_100001387 3300005844 Bacteria 22482
271 Ga0068862_100022281 3300005844 Bacteria 5298
272 Ga0068862_100066024 3300005844 Bacteria 3117
273 Ga0068862_100083287 3300005844 Bacteria 2777
274 Ga0068862_100360246 3300005844 Bacteria 1351
275 Ga0068862_100843691 3300005844 Bacteria 897
276 Ga0068862_101424395 3300005844 Bacteria 697
277 Ga0081455_10310939 3300005937 Bacteria 1126
278 Ga0081540_1000785 3300005983 Bacteria 29131
279 Ga0081540_1001166 3300005983 Bacteria 23099
280 Ga0081540_1006864 3300005983 Bacteria 8216
281 Ga0081540_1062215 3300005983 Bacteria 1774
282 Ga0081540_1164081 3300005983 Bacteria 857
283 Ga0081539_10079757 3300005985 Bacteria 1724
284 Ga0070717_10171221 3300006028 Bacteria 1889
285 Ga0070717_10558537 3300006028 Bacteria 1037
286 Ga0070717_11360808 3300006028 Bacteria 645
287 Ga0075365_10000107 3300006038 Bacteria 24426
288 Ga0075365_10105578 3300006038 Bacteria 1932
289 Ga0075365_10373490 3300006038 Bacteria 1006
290 Ga0075368_10014839 3300006042 Bacteria 2882
291 Ga0075363_100118852 3300006048 Bacteria 1474
292 Ga0075363_100125728 3300006048 Bacteria 1435
293 Ga0075364_10003335 3300006051 Bacteria 9112
294 Ga0075364_10044569 3300006051 Bacteria 2885
295 Ga0075364_10374723 3300006051 Bacteria 971
296 Ga0075432_10315806 3300006058 Bacteria 653
297 Ga0070712_101019032 3300006175 Bacteria 717
298 Ga0075362_10007455 3300006177 Bacteria 4145
299 Ga0075362_10008082 3300006177 Bacteria 4009
300 Ga0075367_10009044 3300006178 Bacteria 5189
301 Ga0075367_10685474 3300006178 Bacteria 652
302 Ga0075369_10005796 3300006186 Bacteria 4637
303 Ga0075369_10031098 3300006186 Bacteria 2250
304 Ga0075366_10029169 3300006195 Bacteria 3241
305 Ga0097621_100011773 3300006237 Bacteria 6460
306 Ga0097621_100094680 3300006237 Bacteria 2504
307 Ga0097621_100163361 3300006237 Bacteria 1915
308 Ga0097621_100671959 3300006237 Bacteria 952
309 Ga0097621_100792630 3300006237 Bacteria 877
310 Ga0075370_10292143 3300006353 Bacteria 969
311 Ga0075370_10498765 3300006353 Bacteria 735
312 Ga0068871_100043089 3300006358 Bacteria 3625
313 Ga0068871_100070590 3300006358 Bacteria 2871
314 Ga0068871_100243130 3300006358 Bacteria 1565
315 Ga0068871_100278956 3300006358 Bacteria 1461
316 Ga0075428_100130169 3300006844 Bacteria 2737
317 Ga0075428_100179551 3300006844 Bacteria 2292
318 Ga0075428_100531359 3300006844 Bacteria 1258
319 Ga0075428_100821334 3300006844 Bacteria 988
320 Ga0075428_100863332 3300006844 Bacteria 961
321 Ga0075428_100971034 3300006844 Bacteria 900
322 Ga0075428_101080949 3300006844 Bacteria 848
323 Ga0075428_101955078 3300006844 Bacteria 608
324 Ga0075431_100013381 3300006847 Bacteria 8290
325 Ga0075431_100043853 3300006847 Bacteria 4613
326 Ga0075431_100500274 3300006847 Bacteria 1207
327 Ga0075431_100667935 3300006847 Bacteria 1019
328 Ga0075433_10066503 3300006852 Bacteria 3163
329 Ga0075433_10816227 3300006852 Bacteria 815
330 Ga0075434_100087559 3300006871 Bacteria 3115
331 Ga0075434_100151263 3300006871 Bacteria 2341
332 Ga0075434_100242253 3300006871 Bacteria 1823
333 Ga0075434_100519765 3300006871 Bacteria 1211
334 Ga0075434_100770822 3300006871 Bacteria 978
335 Ga0075429_100088416 3300006880 Bacteria 2700
336 Ga0075429_100187435 3300006880 Bacteria 1813
337 Ga0075429_100677885 3300006880 Bacteria 903
338 Ga0075429_100705152 3300006880 Bacteria 884
339 Ga0075429_100833012 3300006880 Bacteria 808
340 Ga0075429_101006129 3300006880 Bacteria 729
341 Ga0075429_101177838 3300006880 Bacteria 669
342 Ga0068865_100027476 3300006881 Bacteria 3760
343 Ga0068865_100503925 3300006881 Bacteria 1010
344 Ga0068865_101130059 3300006881 Bacteria 691
345 Ga0075436_100499175 3300006914 Bacteria 890
346 Ga0075436_100565424 3300006914 Bacteria 836
347 Ga0097620_100000162 3300006931 Bacteria 65033
348 Ga0097620_100000703 3300006931 Bacteria 33591
349 Ga0097620_100001363 3300006931 Bacteria 24912
350 Ga0097620_100002579 3300006931 Bacteria 18428
351 Ga0097620_100116933 3300006931 Bacteria 2731
352 Ga0097620_100662813 3300006931 Bacteria 1135
353 Ga0075435_100261942 3300007076 Bacteria 1473
354 Ga0075435_100379856 3300007076 Bacteria 1213
355 Ga0075435_100710220 3300007076 Bacteria 874
356 Ga0075435_101167389 3300007076 Bacteria 673
357 Ga0099794_10067852 3300007265 Bacteria 1743
358 Ga0099795_10552627 3300007788 Bacteria 543
359 Ga0105250_10007794 3300009092 Bacteria 4584
360 Ga0105240_10006530 3300009093 Bacteria 17125
361 Ga0105240_11153961 3300009093 Bacteria 822
362 Ga0111539_10000022 3300009094 Bacteria 240838
363 Ga0111539_10040340 3300009094 Bacteria 5621
364 Ga0111539_10076709 3300009094 Bacteria 3935
365 Ga0111539_10104137 3300009094 Bacteria 3330
366 Ga0111539_10145119 3300009094 Bacteria 2779
367 Ga0111539_10381999 3300009094 Bacteria 1640
368 Ga0111539_10915989 3300009094 Bacteria 1019
369 Ga0111539_11172000 3300009094 Bacteria 893
370 Ga0111539_11817078 3300009094 Bacteria 707
371 Ga0105245_10000010 3300009098 Bacteria 278233
372 Ga0105245_10000166 3300009098 Bacteria 62554
373 Ga0105245_10038622 3300009098 Bacteria 4247
374 Ga0105245_10351851 3300009098 Bacteria 1460
375 Ga0105245_10392735 3300009098 Bacteria 1384
376 Ga0105247_10000778 3300009101 Bacteria 24488
377 Ga0105247_10005540 3300009101 Bacteria 7940
378 Ga0105247_11763610 3300009101 Bacteria 514
379 Ga0114129_10092785 3300009147 Bacteria 4183
380 Ga0114129_10121065 3300009147 Bacteria 3602
381 Ga0114129_10152522 3300009147 Bacteria 3161
382 Ga0114129_10292313 3300009147 Bacteria 2174
383 Ga0114129_10606618 3300009147 Bacteria 1417
384 Ga0114129_11128009 3300009147 Bacteria 980
385 Ga0114129_11474887 3300009147 Bacteria 837
386 Ga0114129_11640064 3300009147 Bacteria 786
387 Ga0114129_12639473 3300009147 Bacteria 599
388 Ga0105243_10021643 3300009148 Bacteria 4882
389 Ga0105243_10781543 3300009148 Bacteria 939
390 Ga0105241_10000628 3300009174 Bacteria 26570
391 Ga0105242_10009762 3300009176 Bacteria 7354
392 Ga0105242_10425270 3300009176 Bacteria 1246
393 Ga0105242_10661511 3300009176 Bacteria 1017
394 Ga0105242_10794877 3300009176 Bacteria 936
395 Ga0105242_11246583 3300009176 Bacteria 765
396 Ga0105242_12302834 3300009176 Bacteria 585
397 Ga0105248_10001106 3300009177 Bacteria 29895
398 Ga0105248_10034053 3300009177 Bacteria 5694
399 Ga0105248_10098171 3300009177 Bacteria 3300
400 Ga0105248_10199651 3300009177 Bacteria 2253
401 Ga0105248_10446231 3300009177 Bacteria 1458
402 Ga0105248_10851610 3300009177 Bacteria 1029
403 Ga0105248_11028380 3300009177 Bacteria 931
404 Ga0105248_11084329 3300009177 Bacteria 905
405 Ga0105248_11793594 3300009177 Bacteria 696
406 Ga0105248_11865745 3300009177 Bacteria 682
407 Ga0105237_10000740 3300009545 Bacteria 45064
408 Ga0105238_10000002 3300009551 Bacteria 772711
409 Ga0105238_10001986 3300009551 Bacteria 20595
410 Ga0105249_10001061 3300009553 Bacteria 24372
411 Ga0105249_10002192 3300009553 Bacteria 16910
412 Ga0105249_10711388 3300009553 Bacteria 1065
413 Ga0105249_11037129 3300009553 Bacteria 889
414 Ga0105239_10001250 3300010375 Bacteria 34519
415 Ga0105239_10002930 3300010375 Bacteria 21309
416 Ga0105246_10128367 3300011119 Bacteria 1890
417 Ga0105246_10154324 3300011119 Bacteria 1742
418 Ga0105246_10176286 3300011119 Bacteria 1642
419 Ga0157373_10033827 3300013100 Bacteria 3673
420 Ga0157373_10264084 3300013100 Bacteria 1218
421 Ga0157373_10750171 3300013100 Bacteria 717
422 Ga0157371_10031254 3300013102 Bacteria 3836
423 Ga0157371_10594347 3300013102 Bacteria 823
424 Ga0157369_10001943 3300013105 Bacteria 24887
425 Ga0157369_10003299 3300013105 Bacteria 19204
426 Ga0157374_10000005 3300013296 Bacteria 646767
427 Ga0157374_10045770 3300013296 Bacteria 4050
428 Ga0157378_10000167 3300013297 Bacteria 62921
429 Ga0157378_10039360 3300013297 Bacteria 4193
430 Ga0157378_10209845 3300013297 Bacteria 1846
431 Ga0157378_10376225 3300013297 Bacteria 1394
432 Ga0157378_10665271 3300013297 Bacteria 1058
433 Ga0157378_11049199 3300013297 Bacteria 851
434 Ga0163162_10000823 3300013306 Bacteria 28858
435 Ga0163162_10002337 3300013306 Bacteria 17801
436 Ga0163162_10007545 3300013306 Bacteria 10594
437 Ga0163162_10096376 3300013306 Bacteria 3046
438 Ga0163162_10340610 3300013306 Bacteria 1632
439 Ga0163162_10391891 3300013306 Bacteria 1522
440 Ga0157372_10091324 3300013307 Bacteria 3463
441 Ga0157372_10373408 3300013307 Bacteria 1662
442 Ga0157372_11073191 3300013307 Bacteria 932
443 Ga0157375_10000055 3300013308 Bacteria 126704
444 Ga0157375_10001345 3300013308 Bacteria 21189
445 Ga0157375_10001418 3300013308 Bacteria 20617
446 Ga0157375_10082844 3300013308 Bacteria 3251
447 Ga0157375_10158566 3300013308 Bacteria 2404
448 Ga0157375_12000318 3300013308 Bacteria 689
449 Ga0157375_12202148 3300013308 Bacteria 657
450 Ga0163163_10009168 3300014325 Bacteria 8822
451 Ga0163163_10142986 3300014325 Bacteria 2435
452 Ga0163163_10369195 3300014325 Bacteria 1492
453 Ga0163163_10558186 3300014325 Bacteria 1208
454 Ga0163163_10561969 3300014325 Bacteria 1204
455 Ga0163163_12255054 3300014325 Bacteria 603
456 Ga0157380_10118167 3300014326 Bacteria 2241
457 Ga0157380_10148581 3300014326 Bacteria 2023
458 Ga0157380_10295874 3300014326 Bacteria 1488
459 Ga0157380_10366891 3300014326 Bacteria 1353
460 Ga0157380_10551512 3300014326 Bacteria 1131
461 Ga0157380_10701762 3300014326 Bacteria 1017
462 Ga0157380_11076523 3300014326 Bacteria 842
463 Ga0157377_10000026 3300014745 Bacteria 138648
464 Ga0157377_10000296 3300014745 Bacteria 23341
465 Ga0157377_10001264 3300014745 Bacteria 10813
466 Ga0157377_10122387 3300014745 Bacteria 1578
467 Ga0157377_10399171 3300014745 Bacteria 936
468 Ga0157377_11153035 3300014745 Bacteria 597
469 Ga0157379_10000025 3300014968 Bacteria 90070
470 Ga0157379_10000562 3300014968 Bacteria 29935
471 Ga0157379_10043366 3300014968 Bacteria 4016
472 Ga0157379_10324834 3300014968 Bacteria 1405
473 Ga0157379_10693633 3300014968 Bacteria 955
474 Ga0157379_10883384 3300014968 Bacteria 847
475 Ga0157379_11493319 3300014968 Bacteria 657
476 Ga0157379_11836295 3300014968 Bacteria 596
477 Ga0157376_10000003 3300014969 Bacteria 568634
478 Ga0157376_10003404 3300014969 Bacteria 10945
479 Ga0157376_10089508 3300014969 Bacteria 2661
480 Ga0163161_10014953 3300017792 Bacteria 5406
481 Ga0163161_10073389 3300017792 Bacteria 2507
482 Ga0163161_10077880 3300017792 Bacteria 2436
483 Ga0163161_10111267 3300017792 Bacteria 2047
484 Ga0163161_10545687 3300017792 Bacteria 949
485 Ga0163161_10686890 3300017792 Bacteria 851
486 Ga0206355_1166500 3300020076 Bacteria 1425
487 Ga0206352_10354123 3300020078 Bacteria 1103
488 Ga0206353_11044236 3300020082 Bacteria 656
489 Ga0206353_11127814 3300020082 Bacteria 580
490 Ga0213873_10000721 3300021358 Bacteria 5340
491 Ga0213874_10207480 3300021377 Bacteria 707
492 Ga0213876_10000009 3300021384 Bacteria 496136
493 Ga0207673_1010380 3300025290 Bacteria 1198
494 Ga0209257_1063601 3300025304 Bacteria 995
495 Ga0207697_10003661 3300025315 Bacteria 7528
496 Ga0207697_10011132 3300025315 Bacteria 3813
497 Ga0207697_10191667 3300025315 Bacteria 898
498 Ga0207656_10052062 3300025321 Bacteria 1772
499 Ga0207696_1052439 3300025711 Bacteria 1163
500 Ga0207682_10000315 3300025893 Bacteria 21984
501 Ga0207682_10003051 3300025893 Bacteria 7350
502 Ga0207682_10177372 3300025893 Bacteria 972
503 Ga0207642_10004671 3300025899 Bacteria 4425
504 Ga0207642_10571812 3300025899 Bacteria 700
505 Ga0207710_10004541 3300025900 Bacteria 6032
506 Ga0207710_10007497 3300025900 Bacteria 4621
507 Ga0207688_10026904 3300025901 Bacteria 3164
508 Ga0207680_10000156 3300025903 Bacteria 33323
509 Ga0207680_10002207 3300025903 Bacteria 9093
510 Ga0207680_10002463 3300025903 Bacteria 8640
511 Ga0207680_10345296 3300025903 Bacteria 1045
512 Ga0207680_10440388 3300025903 Bacteria 924
513 Ga0207647_10001294 3300025904 Bacteria 19260
514 Ga0207685_10239392 3300025905 Bacteria 872
515 Ga0207645_10000031 3300025907 Bacteria 93071
516 Ga0207645_10072924 3300025907 Bacteria 2198
517 Ga0207643_10000030 3300025908 Bacteria 97831
518 Ga0207643_10027333 3300025908 Bacteria 3162
519 Ga0207643_10062760 3300025908 Bacteria 2123
520 Ga0207643_10434898 3300025908 Bacteria 833
521 Ga0207643_10462185 3300025908 Bacteria 808
522 Ga0207705_10082987 3300025909 Bacteria 2338
523 Ga0207705_10297961 3300025909 Bacteria 1236
524 Ga0207705_10619940 3300025909 Bacteria 841
525 Ga0207684_10006000 3300025910 Bacteria 11116
526 Ga0207684_10155584 3300025910 Bacteria 1968
527 Ga0207684_10551363 3300025910 Bacteria 986
528 Ga0207684_10954250 3300025910 Bacteria 719
529 Ga0207654_10046503 3300025911 Bacteria 2475
530 Ga0207654_10680511 3300025911 Bacteria 738
531 Ga0207707_10073376 3300025912 Bacteria 2984
532 Ga0207707_10217654 3300025912 Bacteria 1663
533 Ga0207695_10249706 3300025913 Bacteria 1674
534 Ga0207671_10015931 3300025914 Bacteria 5862
535 Ga0207671_10144851 3300025914 Bacteria 1832
536 Ga0207663_11037228 3300025916 Bacteria 658
537 Ga0207660_10129345 3300025917 Bacteria 1920
538 Ga0207660_10494141 3300025917 Bacteria 992
539 Ga0207662_10000271 3300025918 Bacteria 23849
540 Ga0207662_10008804 3300025918 Bacteria 5538
541 Ga0207662_10133430 3300025918 Bacteria 1567
542 Ga0207662_10522370 3300025918 Bacteria 819
543 Ga0207657_10000011 3300025919 Bacteria 186233
544 Ga0207657_10049742 3300025919 Bacteria 3650
545 Ga0207649_10008316 3300025920 Bacteria 5655
546 Ga0207649_10212744 3300025920 Bacteria 1372
547 Ga0207652_10009551 3300025921 Bacteria 7800
548 Ga0207652_10078554 3300025921 Bacteria 2882
549 Ga0207652_10147672 3300025921 Bacteria 2104
550 Ga0207652_10685177 3300025921 Bacteria 915
551 Ga0207652_10907633 3300025921 Bacteria 778
552 Ga0207646_10037380 3300025922 Bacteria 4377
553 Ga0207646_10107113 3300025922 Bacteria 2507
554 Ga0207646_10866942 3300025922 Bacteria 802
555 Ga0207646_11028223 3300025922 Bacteria 727
556 Ga0207681_10000030 3300025923 Bacteria 173766
557 Ga0207681_10002254 3300025923 Bacteria 12259
558 Ga0207681_10040426 3300025923 Bacteria 3103
559 Ga0207681_10050455 3300025923 Bacteria 2816
560 Ga0207681_10528867 3300025923 Bacteria 968
561 Ga0207694_10000001 3300025924 Bacteria 4078485
562 Ga0207694_10018119 3300025924 Bacteria 5324
563 Ga0207694_10706353 3300025924 Bacteria 850
564 Ga0207650_10000082 3300025925 Bacteria 128722
565 Ga0207650_10003671 3300025925 Bacteria 10500
566 Ga0207650_10083832 3300025925 Bacteria 2422
567 Ga0207650_10088283 3300025925 Bacteria 2364
568 Ga0207650_10286188 3300025925 Bacteria 1343
569 Ga0207650_10414501 3300025925 Bacteria 1117
570 Ga0207650_11448574 3300025925 Bacteria 584
571 Ga0207659_10000169 3300025926 Bacteria 39159
572 Ga0207659_10000843 3300025926 Bacteria 18152
573 Ga0207659_10003434 3300025926 Bacteria 9499
574 Ga0207659_10008702 3300025926 Bacteria 6317
575 Ga0207659_10014994 3300025926 Bacteria 5011
576 Ga0207659_10655067 3300025926 Bacteria 898
577 Ga0207659_11000666 3300025926 Bacteria 719
578 Ga0207687_10000005 3300025927 Bacteria 770649
579 Ga0207687_10019566 3300025927 Bacteria 4486
580 Ga0207687_10025639 3300025927 Bacteria 3945
581 Ga0207687_10355127 3300025927 Bacteria 1195
582 Ga0207687_10454432 3300025927 Bacteria 1063
583 Ga0207664_11889263 3300025929 Bacteria 520
584 Ga0207644_10000017 3300025931 Bacteria 177818
585 Ga0207644_10001196 3300025931 Bacteria 16709
586 Ga0207644_10010834 3300025931 Bacteria 6018
587 Ga0207644_10015417 3300025931 Bacteria 5129
588 Ga0207644_10278590 3300025931 Bacteria 1342
589 Ga0207644_10396069 3300025931 Bacteria 1128
590 Ga0207644_10785485 3300025931 Bacteria 796
591 Ga0207690_10005181 3300025932 Bacteria 7689
592 Ga0207690_10155537 3300025932 Bacteria 1699
593 Ga0207690_10365538 3300025932 Bacteria 1144
594 Ga0207706_10000034 3300025933 Bacteria 139105
595 Ga0207706_10202278 3300025933 Bacteria 1742
596 Ga0207686_10036644 3300025934 Bacteria 2954
597 Ga0207686_10289976 3300025934 Bacteria 1211
598 Ga0207686_10772179 3300025934 Bacteria 769
599 Ga0207686_10855988 3300025934 Bacteria 732
600 Ga0207709_10035416 3300025935 Bacteria 2951
601 Ga0207709_10349548 3300025935 Bacteria 1115
602 Ga0207670_10001213 3300025936 Bacteria 13605
603 Ga0207670_10014044 3300025936 Bacteria 4742
604 Ga0207670_10055322 3300025936 Bacteria 2681
605 Ga0207670_10465613 3300025936 Bacteria 1021
606 Ga0207669_10003369 3300025937 Bacteria 6911
607 Ga0207669_10029450 3300025937 Bacteria 3037
608 Ga0207669_10468273 3300025937 Bacteria 1002
609 Ga0207669_10878782 3300025937 Bacteria 748
610 Ga0207704_10001582 3300025938 Bacteria 10219
611 Ga0207704_10309810 3300025938 Bacteria 1213
612 Ga0207704_11339769 3300025938 Bacteria 612
613 Ga0207665_10124947 3300025939 Bacteria 1821
614 Ga0207665_10507278 3300025939 Bacteria 932
615 Ga0207691_10002377 3300025940 Bacteria 18419
616 Ga0207691_10019115 3300025940 Bacteria 6486
617 Ga0207691_10028502 3300025940 Bacteria 5228
618 Ga0207691_10065795 3300025940 Bacteria 3280
619 Ga0207691_10130939 3300025940 Bacteria 2216
620 Ga0207691_10146662 3300025940 Bacteria 2077
621 Ga0207691_10535902 3300025940 Bacteria 993
622 Ga0207711_10002481 3300025941 Bacteria 16454
623 Ga0207711_10003920 3300025941 Bacteria 12809
624 Ga0207711_10011639 3300025941 Bacteria 7310
625 Ga0207711_10022799 3300025941 Bacteria 5239
626 Ga0207711_10451419 3300025941 Bacteria 1197
627 Ga0207711_11264963 3300025941 Bacteria 680
628 Ga0207689_10000641 3300025942 Bacteria 33407
629 Ga0207689_10042822 3300025942 Bacteria 3744
630 Ga0207689_10437590 3300025942 Bacteria 1092
631 Ga0207689_10455115 3300025942 Bacteria 1070
632 Ga0207661_10000006 3300025944 Bacteria 537727
633 Ga0207661_10019215 3300025944 Bacteria 5090
634 Ga0207661_11230030 3300025944 Bacteria 689
635 Ga0207679_10000559 3300025945 Bacteria 25007
636 Ga0207679_10007400 3300025945 Bacteria 6960
637 Ga0207679_10025854 3300025945 Bacteria 4042
638 Ga0207679_10496921 3300025945 Bacteria 1088
639 Ga0207679_10506541 3300025945 Bacteria 1078
640 Ga0207667_10044132 3300025949 Bacteria 4726
641 Ga0207667_11068780 3300025949 Bacteria 791
642 Ga0207667_11476237 3300025949 Bacteria 652
643 Ga0207651_10000455 3300025960 Bacteria 17270
644 Ga0207651_10005338 3300025960 Bacteria 6587
645 Ga0207651_10479816 3300025960 Bacteria 1071
646 Ga0207651_11063499 3300025960 Bacteria 724
647 Ga0207712_10004830 3300025961 Bacteria 8516
648 Ga0207712_10307697 3300025961 Bacteria 1303
649 Ga0207712_10426834 3300025961 Bacteria 1119
650 Ga0207712_10846409 3300025961 Bacteria 806
651 Ga0207712_10899409 3300025961 Bacteria 782
652 Ga0207668_10000058 3300025972 Bacteria 92179
653 Ga0207668_10000402 3300025972 Bacteria 27270
654 Ga0207668_10001084 3300025972 Bacteria 16228
655 Ga0207668_10713656 3300025972 Bacteria 882
656 Ga0207668_11790493 3300025972 Bacteria 554
657 Ga0207640_10001483 3300025981 Bacteria 12652
658 Ga0207640_10518093 3300025981 Bacteria 996
659 Ga0207658_10000023 3300025986 Bacteria 190806
660 Ga0207658_10006186 3300025986 Bacteria 8173
661 Ga0207658_10015862 3300025986 Bacteria 5172
662 Ga0207658_10056354 3300025986 Bacteria 2916
663 Ga0207658_10272420 3300025986 Bacteria 1447
664 Ga0207658_10390448 3300025986 Bacteria 1221
665 Ga0207677_10000101 3300026023 Bacteria 70739
666 Ga0207677_10000141 3300026023 Bacteria 59003
667 Ga0207677_10000597 3300026023 Bacteria 22260
668 Ga0207677_10013756 3300026023 Bacteria 4698
669 Ga0207677_11367572 3300026023 Bacteria 652
670 Ga0207703_10000646 3300026035 Bacteria 34969
671 Ga0207703_10003772 3300026035 Bacteria 12596
672 Ga0207703_10011288 3300026035 Bacteria 6948
673 Ga0207703_10025509 3300026035 Bacteria 4649
674 Ga0207703_10036709 3300026035 Bacteria 3902
675 Ga0207703_10152213 3300026035 Bacteria 2018
676 Ga0207703_10297900 3300026035 Bacteria 1470
677 Ga0207703_10637144 3300026035 Bacteria 1010
678 Ga0207639_10012024 3300026041 Bacteria 6022
679 Ga0207639_10212479 3300026041 Bacteria 1666
680 Ga0207678_10000382 3300026067 Bacteria 40278
681 Ga0207678_10473580 3300026067 Bacteria 1090
682 Ga0207708_10019083 3300026075 Bacteria 5163
683 Ga0207708_10107478 3300026075 Bacteria 2163
684 Ga0207708_10454848 3300026075 Bacteria 1067
685 Ga0207702_10000747 3300026078 Bacteria 34730
686 Ga0207702_10003061 3300026078 Bacteria 15548
687 Ga0207702_11129708 3300026078 Bacteria 778
688 Ga0207641_10000119 3300026088 Bacteria 117312
689 Ga0207641_10000293 3300026088 Bacteria 62674
690 Ga0207641_10002454 3300026088 Bacteria 17139
691 Ga0207641_10002919 3300026088 Bacteria 15481
692 Ga0207641_10278913 3300026088 Bacteria 1571
693 Ga0207641_10373131 3300026088 Bacteria 1364
694 Ga0207641_10507609 3300026088 Bacteria 1172
695 Ga0207648_10000117 3300026089 Bacteria 77423
696 Ga0207648_10335963 3300026089 Bacteria 1360
697 Ga0207648_10652183 3300026089 Bacteria 973
698 Ga0207676_10000023 3300026095 Bacteria 266848
699 Ga0207676_10001632 3300026095 Bacteria 16524
700 Ga0207676_10007495 3300026095 Bacteria 7743
701 Ga0207676_10014815 3300026095 Bacteria 5617
702 Ga0207676_10047880 3300026095 Bacteria 3315
703 Ga0207676_10171181 3300026095 Bacteria 1892
704 Ga0207676_10188717 3300026095 Bacteria 1812
705 Ga0207674_10001256 3300026116 Bacteria 33148
706 Ga0207674_10097350 3300026116 Bacteria 2926
707 Ga0207674_10133067 3300026116 Bacteria 2450
708 Ga0207674_10405949 3300026116 Bacteria 1317
709 Ga0207674_10451737 3300026116 Bacteria 1242
710 Ga0207674_11191987 3300026116 Bacteria 731
711 Ga0207675_100000221 3300026118 Bacteria 53325
712 Ga0207675_100000748 3300026118 Bacteria 32341
713 Ga0207675_100379760 3300026118 Bacteria 1389
714 Ga0207675_100539314 3300026118 Bacteria 1165
715 Ga0207683_10000052 3300026121 Bacteria 86161
716 Ga0207683_10001846 3300026121 Bacteria 18729
717 Ga0207683_10157782 3300026121 Bacteria 2050
718 Ga0207683_10386835 3300026121 Bacteria 1286
719 Ga0207683_10821957 3300026121 Bacteria 862
720 Ga0207698_10001612 3300026142 Bacteria 13137
721 Ga0207698_11071165 3300026142 Bacteria 818
722 Ga0209588_1000034 3300027671 Bacteria 66337
723 Ga0209588_1034864 3300027671 Bacteria 1617
724 Ga0209813_10019110 3300027866 Bacteria 1901
725 Ga0207428_10000030 3300027907 Bacteria 240846
726 Ga0207428_10015732 3300027907 Bacteria 6533
727 Ga0207428_10112819 3300027907 Bacteria 2090
728 Ga0207428_10345276 3300027907 Bacteria 1096
729 Ga0268266_10003323 3300028379 Bacteria 16140
730 Ga0268266_10209431 3300028379 Bacteria 1787
731 Ga0268266_10251851 3300028379 Bacteria 1634
732 Ga0268265_10000074 3300028380 Bacteria 127599
733 Ga0268265_10001297 3300028380 Bacteria 21480
734 Ga0268265_10083495 3300028380 Bacteria 2529
735 Ga0268265_10289007 3300028380 Bacteria 1471
736 Ga0268265_10730524 3300028380 Bacteria 959
737 Ga0268264_10000215 3300028381 Bacteria 113994
738 Ga0268264_10001288 3300028381 Bacteria 23669
739 Ga0268264_10001574 3300028381 Bacteria 21156
740 Ga0268264_10005869 3300028381 Bacteria 10392
741 Ga0268264_10028969 3300028381 Bacteria 4533
742 Ga0268264_10042912 3300028381 Bacteria 3746
743 Ga0268264_11113467 3300028381 Bacteria 798
744 Ga0268264_11698265 3300028381 Bacteria 642
745 Ga0265334_10094472 3300028573 Bacteria 1088
746 Ga0265334_10117342 3300028573 Bacteria 953
747 Ga0265318_10001354 3300028577 Bacteria 14601
748 Ga0307515_10456415 3300028794 Bacteria 893
749 Ga0265338_10086311 3300028800 Bacteria 2612
750 Ga0265338_10156521 3300028800 Bacteria 1764
751 Ga0311001_1065531 3300029277 Bacteria 860
752 Ga0310981_1062149 3300029285 Bacteria 1421
753 Ga0307511_10035882 3300030521 Bacteria 4321
754 Ga0265330_10012809 3300031235 Bacteria 3914
755 Ga0265332_10322798 3300031238 Bacteria 637
756 Ga0265328_10079426 3300031239 Bacteria 1209
757 Ga0265320_10035011 3300031240 Bacteria 2548
758 Ga0265325_10021301 3300031241 Bacteria 3562
759 Ga0265325_10060212 3300031241 Bacteria 1929
760 Ga0265340_10024603 3300031247 Bacteria 3056
761 Ga0265340_10068202 3300031247 Bacteria 1689
762 Ga0265339_10006973 3300031249 Bacteria 7344
763 Ga0265339_10028147 3300031249 Bacteria 3198
764 Ga0265316_10020371 3300031344 Bacteria 5646
765 Ga0265316_10131015 3300031344 Bacteria 1888
766 Ga0265316_10331934 3300031344 Bacteria 1103
767 Ga0307408_100475168 3300031548 Bacteria 1089
768 Ga0307408_100637780 3300031548 Bacteria 951
769 Ga0307408_101306425 3300031548 Bacteria 680
770 Ga0265313_10011254 3300031595 Bacteria 5574
771 Ga0265313_10039145 3300031595 Bacteria 2354
772 Ga0307508_10056336 3300031616 Bacteria 3481
773 Ga0316579_10033296 3300031691 Bacteria 2366
774 Ga0265314_10049655 3300031711 Bacteria 2935
775 Ga0265314_10087198 3300031711 Bacteria 2041
776 Ga0265342_10000677 3300031712 Bacteria 35579
777 Ga0265342_10003703 3300031712 Bacteria 12389
778 Ga0307405_11103554 3300031731 Bacteria 682
779 Ga0307405_11583799 3300031731 Bacteria 578
780 Ga0307413_10854422 3300031824 Bacteria 769
781 Ga0307406_11012386 3300031901 Bacteria 713
782 Ga0307412_11478717 3300031911 Bacteria 617
783 Ga0307412_11916637 3300031911 Bacteria 547
784 Ga0307409_100438146 3300031995 Bacteria 1258
785 Ga0316593_10009085 3300032168 Bacteria 2794
786 Ga0307510_10255491 3300033180 Bacteria 1237
787 Ga0373930_0060566 3300034816 Bacteria 844
788 Ga0373934_0127623 3300035086 Bacteria 1036
789 Ga0373951_0130114 3300035091 Bacteria 692
790 Ga0373923_0157419 3300035111 Bacteria 1035
791 Ga0373939_0055304 3300035114 Bacteria 1246
792 Ga0373941_0012714 3300035115 Bacteria 2207
793 Ga0373941_0242102 3300035115 Bacteria 701
794 Ga0373953_0026669 3300035117 Bacteria 2215
795 Ga0373954_0087403 3300035118 Bacteria 1494
796 Ga0373954_0197171 3300035118 Bacteria 989
797 Ga0373956_0323722 3300035119 Bacteria 735
798 Ga0373946_0249273 3300035171 Bacteria 866
799 Ga0373946_0530438 3300035171 Bacteria 606
800 Ga0373946_0609317 3300035171 Bacteria 567
801 Ga0373955_0339445 3300035172 Bacteria 909
802 Ga0373942_0132723 3300035207 Bacteria 787
803 Ga0373961_0006112 3300035241 Bacteria 2892
804 Ga0373961_0081113 3300035241 Bacteria 1021
805 Ga0373962_0117210 3300035242 Bacteria 846
806 Ga0316574_0111493 3300035398 Bacteria 1754
807 Ga0373931_0108446 3300035691 Bacteria 1572
808 Ga0373931_0469816 3300035691 Bacteria 807
809 Ga0373931_0563852 3300035691 Bacteria 741
810 Ga0373935_0324241 3300035692 Bacteria 1093
811 Ga0373933_0266107 3300035724 Bacteria 1106
812 Ga0373947_0175682 3300035725 Bacteria 1392
813 Ga0373947_0204773 3300035725 Bacteria 1292
814 Ga0373937_0078196 3300036401 Bacteria 3057
815 Ga0373937_0123566 3300036401 Bacteria 2413
816 Ga0373937_0875140 3300036401 Bacteria 847
817 Ga0316582_0281182 3300036647 Bacteria 1142
818 Ga0373925_0263373 3300037068 Bacteria 1385
819 Ga0373925_0955722 3300037068 Bacteria 706
820 Ga0395899_0242304 3300037312 Bacteria 1240
821 Ga0395899_0269986 3300037312 Bacteria 1160
822 Ga0395900_0112357 3300037418 Bacteria 2797
823 Ga0395900_0137697 3300037418 Bacteria 2501
824 Ga0395900_0273577 3300037418 Bacteria 1683
825 Ga0395898_0118813 3300037466 Bacteria 2532
826 Ga0395898_0161600 3300037466 Bacteria 2142
827 Ga0395898_0715060 3300037466 Bacteria 943
828 Ga0395898_1201500 3300037466 Bacteria 689
829 Ga0395905_0953119 3300037471 Bacteria 761
830 Ga0436364_0088257 3300037853 Bacteria 716
831 Ga0436364_0947734 3300037853 Bacteria 1001
832 Ga0395901_0077174 3300038443 Bacteria 3477
833 Ga0395901_0093453 3300038443 Bacteria 3149
834 Ga0436365_0179814 3300039437 Bacteria 665
835 Ga0436365_0197039 3300039437 Bacteria 92371
836 Ga0436365_1510825 3300039437 Bacteria 619
837 Ga0436360_1030095 3300039438 Bacteria 907
838 Ga0436363_1487013 3300039450 Bacteria 968
839 Ga0436363_1554023 3300039450 Bacteria 1509
840 Ga0436363_1709560 3300039450 Bacteria 1403
841 Ga0436362_0549823 3300039453 Bacteria 514
842 Ga0436362_0795304 3300039453 Bacteria 1297
843 Ga0436362_1063276 3300039453 Bacteria 20265
844 Ga0451798_0719119 3300041458 Bacteria 638
845 Ga0451855_1960161 3300041511 Bacteria 782
846 Ga0439455_0002430 3300042012 Bacteria 3384
847 Ga0450923_138805 3300042125 Bacteria 583
848 Ga0450902_061543 3300042137 Bacteria 650
849 Ga0439434_0010819 3300042435 Bacteria 2693
850 Ga0439459_0102457 3300042438 Bacteria 702
851 Ga0439464_0103232 3300042439 Bacteria 868
852 Ga0439460_0015566 3300042461 Bacteria 2015
853 Ga0451577_0011021 3300042876 Bacteria 8587
854 Ga0451577_0049881 3300042876 Bacteria 3736
855 Ga0451577_0071974 3300042876 Bacteria 3083
856 Ga0451577_0174276 3300042876 Bacteria 1938
857 Ga0451577_0197157 3300042876 Bacteria 1817
858 Ga0466972_0051802 3300044658 Bacteria 1980
859 Ga0466972_0065614 3300044658 Bacteria 1736
860 Ga0453683_0001246 3300044673 Bacteria 22711
861 Ga0453683_0007125 3300044673 Bacteria 7617
862 Ga0453683_0007146 3300044673 Bacteria 7609
863 Ga0453683_0015865 3300044673 Bacteria 4870
864 Ga0453683_0026252 3300044673 Bacteria 3699
865 Ga0466963_0030514 3300044694 Bacteria 3479
866 Ga0453684_0007935 3300044712 Bacteria 19255
867 Ga0453684_0018536 3300044712 Bacteria 10671
868 Ga0466957_0094687 3300044842 Bacteria 1875
869 Ga0466957_0558926 3300044842 Bacteria 798
870 Ga0466957_0920102 3300044842 Bacteria 625
871 Ga0451576_0000111 3300045051 Bacteria 209824
872 Ga0451576_0004454 3300045051 Bacteria 18163
873 Ga0451576_0046783 3300045051 Bacteria 4554
874 Ga0451576_0175522 3300045051 Bacteria 2237
875 Ga0451576_0544333 3300045051 Bacteria 1220
876 Ga0451576_0745148 3300045051 Bacteria 1029
877 Ga0451576_1144712 3300045051 Bacteria 813
878 Ga0466967_0025273 3300045976 Bacteria 4895
879 Ga0466967_0722947 3300045976 Bacteria 987
880 Ga0466967_0770455 3300045976 Bacteria 955
881 Ga0495592_0036142 3300046454 Bacteria 3721
882 Ga0495592_0118607 3300046454 Bacteria 1864
883 Ga0495629_0072313 3300046459 Bacteria 2407
884 Ga0495651_0191065 3300046462 Bacteria 1441
885 Ga0495651_0650703 3300046462 Bacteria 661
886 Ga0495650_0003288 3300046471 Bacteria 11949
887 Ga0495580_0082266 3300046472 Bacteria 2244
888 Ga0495580_0107955 3300046472 Bacteria 1933
889 Ga0495580_0395404 3300046472 Bacteria 932
890 Ga0495580_0813812 3300046472 Bacteria 605
891 Ga0495605_0058483 3300046474 Bacteria 1853
892 Ga0495662_0066154 3300046476 Bacteria 1748
893 Ga0495664_0035203 3300046477 Bacteria 2948
894 Ga0495608_0010700 3300046511 Bacteria 6400
895 Ga0495608_0403862 3300046511 Bacteria 835
896 Ga0495618_0104683 3300046514 Bacteria 1812
897 Ga0495618_0207056 3300046514 Bacteria 1240
898 Ga0495628_0320942 3300046516 Bacteria 1143
899 Ga0495628_1082799 3300046516 Bacteria 548
900 Ga0495630_0291352 3300046517 Bacteria 1247
901 Ga0495631_0381839 3300046518 Bacteria 600
902 Ga0495642_0226844 3300046528 Bacteria 816
903 Ga0495654_0163918 3300046530 Bacteria 974
904 Ga0495586_0097597 3300046535 Bacteria 1628
905 Ga0495586_0360711 3300046535 Bacteria 835
906 Ga0495587_0272272 3300046536 Bacteria 950
907 Ga0495598_0023404 3300046537 Bacteria 1663
908 Ga0495598_0075735 3300046537 Bacteria 1069
909 Ga0495598_0170017 3300046537 Bacteria 772
910 Ga0495621_0008145 3300046539 Bacteria 3131
911 Ga0495621_0342253 3300046539 Bacteria 626
912 Ga0495622_0056063 3300046557 Bacteria 1827
913 Ga0495667_0019223 3300046559 Bacteria 4610
914 Ga0495667_0275771 3300046559 Bacteria 1068
915 Ga0495656_0032177 3300046615 Bacteria 2133
916 Ga0495656_0129108 3300046615 Bacteria 1201
917 Ga0495656_0262518 3300046615 Bacteria 875
918 Ga0495634_0073151 3300046642 Bacteria 2254
919 Ga0495625_0118368 3300046660 Bacteria 1805
920 Ga0495625_0524427 3300046660 Bacteria 721
921 Ga0495635_0397037 3300046663 Bacteria 916
922 Ga0495588_0169117 3300046674 Bacteria 1156
923 Ga0495657_0003663 3300046675 Bacteria 12468
924 Ga0495599_0066457 3300046678 Bacteria 2252
925 Ga0495599_0436628 3300046678 Bacteria 776
926 Ga0495623_0357100 3300046679 Bacteria 795
927 Ga0495646_0300812 3300046680 Bacteria 849
928 Ga0495647_0052339 3300046681 Bacteria 1590
929 Ga0495658_0007992 3300046683 Bacteria 5240
930 Ga0495658_0078984 3300046683 Bacteria 1927
931 Ga0495658_0170796 3300046683 Bacteria 1345
932 Ga0495658_0213147 3300046683 Bacteria 1207
933 Ga0495613_0077777 3300046689 Bacteria 2413
934 Ga0495613_0191613 3300046689 Bacteria 1445
935 Ga0495671_0216584 3300046692 Bacteria 927
936 Ga0495604_0092906 3300047317 Bacteria 2234
937 Ga0495636_0008939 3300047318 Bacteria 3946
938 Ga0495636_0121635 3300047318 Bacteria 1155
939 Ga0495636_0142961 3300047318 Bacteria 1069
940 Ga0495674_0045230 3300047319 Bacteria 3909
941 Ga0495674_1075686 3300047319 Bacteria 613
942 Ga0495674_1129582 3300047319 Bacteria 595
943 Ga0495672_0048433 3300047320 Bacteria 2520
944 Ga0495680_0485530 3300047322 Bacteria 841
945 Ga0495675_0147189 3300047444 Bacteria 1457
946 Ga0495685_024682 3300047447 Bacteria 2069
947 Ga0495685_145644 3300047447 Bacteria 770
948 Ga0495684_0049455 3300047471 Bacteria 3212
949 Ga0495684_0204759 3300047471 Bacteria 1453
950 Ga0495602_0065592 3300048088 Bacteria 3133
951 Ga0495615_0001222 3300048090 Bacteria 3741
952 Ga0495615_0137478 3300048090 Bacteria 718
953 Ga0496100_0267809 3300048903 Bacteria 1269
954 Ga0496100_0416605 3300048903 Bacteria 1025
955 Ga0496101_0485761 3300048904 Bacteria 975
956 Ga0496102_0026473 3300048905 Bacteria 5173
957 Ga0496103_0070047 3300048906 Bacteria 2194
958 Ga0496104_0064959 3300048907 Bacteria 3462
959 Ga0496104_0449561 3300048907 Bacteria 1200
960 Ga0496104_0811981 3300048907 Bacteria 841
961 Ga0496105_0915270 3300048908 Bacteria 660
962 Ga0496106_0051437 3300048909 Bacteria 3106
963 Ga0496106_0118271 3300048909 Bacteria 2069
964 Ga0496108_0047479 3300048911 Bacteria 3589
965 Ga0496108_0676423 3300048911 Bacteria 896
966 Ga0496109_0048256 3300048912 Bacteria 3874
967 Ga0496109_0570939 3300048912 Bacteria 1066
968 Ga0496112_0001881 3300048915 Bacteria 16542
969 Ga0496112_0046095 3300048915 Bacteria 4275
970 Ga0496112_0449655 3300048915 Bacteria 1226
971 Ga0496112_0465343 3300048915 Bacteria 1202
972 Ga0496112_1500049 3300048915 Bacteria 588
973 Ga0496113_0047258 3300048916 Bacteria 3198
974 Ga0496114_0188257 3300048917 Bacteria 1805
975 Ga0496114_0521036 3300048917 Bacteria 1051
976 Ga0496115_0319671 3300048918 Bacteria 1270
977 Ga0496115_0526063 3300048918 Bacteria 948
978 Ga0496117_0090809 3300048920 Bacteria 1967
979 Ga0496118_0139113 3300048921 Bacteria 1543
980 Ga0496121_0129576 3300048924 Bacteria 1891
981 Ga0496124_0242913 3300048927 Bacteria 1338
982 Ga0496126_0304812 3300048929 Bacteria 1313
983 Ga0501031_0152935 3300049568 Bacteria 1508
984 Ga0501031_0153796 3300049568 Bacteria 1503
985 Ga0501032_0274872 3300049569 Bacteria 1091
986 Ga0501032_0320325 3300049569 Bacteria 1001
987 Ga0501032_0379967 3300049569 Bacteria 908
988 Ga0501033_0016169 3300049570 Bacteria 5650
989 Ga0501033_0305511 3300049570 Bacteria 1119
990 Ga0501034_0609764 3300049571 Bacteria 996
991 Ga0501034_0734737 3300049571 Bacteria 883
992 Ga0501036_0065956 3300049572 Bacteria 3063
993 Ga0501036_1037048 3300049572 Bacteria 671
994 Ga0501037_0412319 3300049573 Bacteria 925
995 Ga0501037_0459168 3300049573 Bacteria 868
996 Ga0501038_0229312 3300049574 Bacteria 1478
997 Ga0501038_0242797 3300049574 Bacteria 1429
998 Ga0501038_0644696 3300049574 Bacteria 798
999 Ga0501039_0217604 3300049575 Bacteria 1502
1000 Ga0501039_0243510 3300049575 Bacteria 1414
1001 Ga0501039_0373946 3300049575 Bacteria 1119
1002 Ga0501040_0137947 3300049576 Bacteria 1717
1003 Ga0501040_0234445 3300049576 Bacteria 1307
1004 Ga0501040_0501718 3300049576 Bacteria 875
1005 Ga0501041_0030975 3300049577 Bacteria 3229
1006 Ga0501041_0614632 3300049577 Bacteria 694
1007 Ga0501042_0114816 3300049578 Bacteria 1939
1008 Ga0501042_0487907 3300049578 Bacteria 894
1009 Ga0501043_0223695 3300049579 Bacteria 1455
1010 Ga0501043_0715987 3300049579 Bacteria 730
1011 Ga0501043_0757533 3300049579 Bacteria 705
1012 Ga0501046_0050901 3300049580 Bacteria 3271
1013 Ga0501046_0806479 3300049580 Bacteria 658
1014 Ga0501047_0003663 3300049581 Bacteria 14480
1015 Ga0501047_0083044 3300049581 Bacteria 3079
1016 Ga0501047_0110366 3300049581 Bacteria 2633
1017 Ga0501047_0220847 3300049581 Bacteria 1751
1018 Ga0501047_0727284 3300049581 Bacteria 809
1019 Ga0501048_0029347 3300049582 Bacteria 3989
1020 Ga0501048_0278568 3300049582 Bacteria 1189
1021 Ga0501067_0142140 3300049583 Bacteria 1336
1022 Ga0501069_0770629 3300049585 Bacteria 582
1023 Ga0501071_0216397 3300049587 Bacteria 1441
1024 Ga0501071_0271111 3300049587 Bacteria 1283
1025 Ga0501071_0473090 3300049587 Bacteria 960
1026 Ga0501072_0072540 3300049588 Bacteria 2721
1027 Ga0501072_0170249 3300049588 Bacteria 1738
1028 Ga0501073_0339821 3300049589 Bacteria 1036
1029 Ga0501073_0483357 3300049589 Bacteria 856
1030 Ga0501073_0564823 3300049589 Bacteria 786
1031 Ga0501073_0783609 3300049589 Bacteria 657
1032 Ga0501074_0165656 3300049590 Bacteria 1578
1033 Ga0501074_0299453 3300049590 Bacteria 1142
1034 Ga0501074_0494273 3300049590 Bacteria 867
1035 Ga0501074_0918862 3300049590 Bacteria 616
1036 Ga0501075_0019376 3300049591 Bacteria 4935
1037 Ga0501075_0807827 3300049591 Bacteria 714
1038 Ga0501076_0034438 3300049592 Bacteria 3958
1039 Ga0501077_0165530 3300049593 Bacteria 1405
1040 Ga0501077_0289589 3300049593 Bacteria 1043
1041 Ga0501077_0403661 3300049593 Bacteria 874
1042 Ga0501077_0442928 3300049593 Bacteria 832
1043 Ga0501077_0552859 3300049593 Bacteria 739
1044 Ga0501238_006454 3300049671 Bacteria 1512
1045 Ga0501079_0206220 3300049741 Bacteria 1535
1046 Ga0501079_0373683 3300049741 Bacteria 1117
1047 Ga0501080_0002922 3300049742 Bacteria 15012
1048 Ga0501080_0005645 3300049742 Bacteria 11182
1049 Ga0501080_0079724 3300049742 Bacteria 3044
1050 Ga0501080_0243872 3300049742 Bacteria 1639
1051 Ga0501080_0821172 3300049742 Bacteria 814
1052 Ga0501081_0188157 3300049743 Bacteria 1494
1053 Ga0501081_0328053 3300049743 Bacteria 1126
1054 Ga0501081_0369036 3300049743 Bacteria 1059
1055 Ga0501081_0733143 3300049743 Bacteria 742
1056 Ga0501081_0817036 3300049743 Bacteria 702
1057 Ga0501083_0004955 3300049744 Bacteria 9433
1058 Ga0501083_0555067 3300049744 Bacteria 747
1059 Ga0501083_0599928 3300049744 Bacteria 716
1060 Ga0501241_047777 3300049758 Bacteria 840
1061 Ga0501269_013888 3300049766 Bacteria 987
1062 Ga0501035_0000846 3300049822 Bacteria 32725
1063 Ga0501035_0005931 3300049822 Bacteria 11499
1064 Ga0501035_0339713 3300049822 Bacteria 1258
1065 Ga0501035_1044297 3300049822 Bacteria 641
1066 Ga0501044_0083371 3300049823 Bacteria 3233
1067 Ga0501045_0064750 3300049824 Bacteria 2683
1068 Ga0501045_0415852 3300049824 Bacteria 1000
1069 Ga0501045_0823222 3300049824 Bacteria 683
1070 nmdc:mga03683_3558_c1 3300050489 Bacteria 5047
1071 nmdc:mga03n38_220507_c1 3300050490 Bacteria 990
1072 nmdc:mga03n38_265177_c1 3300050490 Bacteria 912
1073 nmdc:mga00v17_15446_c1 3300050491 Bacteria 4286
1074 nmdc:mga00v17_75294_c1 3300050491 Bacteria 2099
1075 nmdc:mga0yw44_539059_c1 3300050492 Bacteria 792
1076 nmdc:mga0k408_8408_c1 3300050493 Bacteria 5539
1077 nmdc:mga06z11_336225_c1 3300050494 Bacteria 902
1078 nmdc:mga06z11_42917_c1 3300050494 Bacteria 2272
1079 nmdc:mga06z11_610871_c1 3300050494 Bacteria 663
1080 nmdc:mga04h51_12737_c1 3300050495 Bacteria 2368
1081 nmdc:mga07m45_208382_c1 3300050496 Bacteria 1137
1082 nmdc:mga07m45_412390_c1 3300050496 Bacteria 784
1083 nmdc:mga05p37_1025701_c1 3300050507 Bacteria 873
1084 nmdc:mga05p37_1166400_c1 3300050507 Bacteria 800
1085 nmdc:mga05p37_1310291_c1 3300050507 Bacteria 737
1086 nmdc:mga05p37_133260_c1 3300050507 Bacteria 3048
1087 nmdc:mga05p37_154302_c1 3300050507 Bacteria 2807
1088 nmdc:mga05p37_1690684_c1 3300050507 Bacteria 618
1089 nmdc:mga05p37_449385_c1 3300050507 Bacteria 1492
1090 nmdc:mga05p37_672497_c1 3300050507 Bacteria 1155
1091 nmdc:mga05p37_75430_c1 3300050507 Bacteria 4151
1092 nmdc:mga05p37_829381_c1 3300050507 Bacteria 1007
1093 nmdc:mga09592_40777_c1 3300050508 Bacteria 3901
1094 nmdc:mga09592_458426_c1 3300050508 Bacteria 1099
1095 nmdc:mga09592_494399_c1 3300050508 Bacteria 1053
1096 nmdc:mga09592_602893_c1 3300050508 Bacteria 941
1097 nmdc:mga09592_906705_c1 3300050508 Bacteria 741
1098 nmdc:mga0qj67_133188_c1 3300050509 Bacteria 2013
1099 nmdc:mga06r32_183757_c1 3300050510 Bacteria 2077
1100 nmdc:mga06r32_263611_c1 3300050510 Bacteria 1711
1101 nmdc:mga06r32_36731_c1 3300050510 Bacteria 4632
1102 nmdc:mga06r32_631650_c1 3300050510 Bacteria 1040
1103 nmdc:mga08y16_170026_c1 3300050511 Bacteria 2264
1104 nmdc:mga08y16_220465_c1 3300050511 Bacteria 1964
1105 nmdc:mga08y16_245224_c1 3300050511 Bacteria 1851
1106 nmdc:mga08y16_24_c1 3300050511 Bacteria 240846
1107 nmdc:mga08y16_253285_c1 3300050511 Bacteria 1819
1108 nmdc:mga08y16_51099_c1 3300050511 Bacteria 4325
1109 nmdc:mga08y16_687632_c1 3300050511 Bacteria 1024
1110 nmdc:mga08y16_794313_c1 3300050511 Bacteria 940
1111 nmdc:mga0n895_1195010_c1 3300050512 Bacteria 735
1112 nmdc:mga0n895_187311_c1 3300050512 Bacteria 2100
1113 nmdc:mga0n895_212802_c1 3300050512 Bacteria 1963
1114 nmdc:mga0n895_36271_c1 3300050512 Bacteria 4761
1115 nmdc:mga0n895_4474_c1 3300050512 Bacteria 11485
1116 nmdc:mga0n895_47539_c1 3300050512 Bacteria 4195
1117 nmdc:mga0n895_612349_c1 3300050512 Bacteria 1090
1118 nmdc:mga0n895_76676_c1 3300050512 Bacteria 3324
1119 nmdc:mga0rr50_273683_c1 3300050513 Bacteria 1408
1120 nmdc:mga0rr50_366010_c1 3300050513 Bacteria 1214
1121 nmdc:mga0rr50_48478_c1 3300050513 Bacteria 3140
1122 nmdc:mga0rr50_61265_c1 3300050513 Bacteria 2834
1123 nmdc:mga0rr50_619836_c1 3300050513 Bacteria 923
1124 nmdc:mga08x19_175948_c1 3300050514 Bacteria 1459
1125 nmdc:mga08x19_72375_c1 3300050514 Bacteria 2248
1126 nmdc:mga08x19_76140_c1 3300050514 Bacteria 2195
1127 nmdc:mga0a205_101698_c1 3300050515 Bacteria 2773
1128 nmdc:mga0a205_17718_c1 3300050515 Bacteria 6683
1129 nmdc:mga0a205_711411_c1 3300050515 Bacteria 854
1130 nmdc:mga0a205_953948_c1 3300050515 Bacteria 704
1131 nmdc:mga0sz30_5881_c1 3300050516 Bacteria 4525
1132 Ga0495601_0314594 3300053077 Bacteria 1020
1133 Ga0495595_0251079 3300053084 Bacteria 886
1134 Ga0495595_0365379 3300053084 Bacteria 729
1135 Ga0495595_0488473 3300053084 Bacteria 627
1136 Ga0495619_0162694 3300053085 Bacteria 1542
1137 Ga0500643_009467 3300053087 Bacteria 3721
1138 Ga0500562_004475 3300053108 Bacteria 3533
1139 Ga0500594_0020014 3300053118 Bacteria 1665
1140 Ga0500608_265300 3300053122 Bacteria 660
1141 Ga0500616_0039467 3300053153 Bacteria 2545
1142 Ga0500645_019607 3300053730 Bacteria 2102
1143 Ga0500645_104850 3300053730 Bacteria 795
1144 Ga0501084_0041457 3300054114 Bacteria 3851
1145 Ga0501084_0647331 3300054114 Bacteria 892
1146 Ga0587080_162691 3300059503 Bacteria 524
1147 Ga0587083_0090773 3300059505 Bacteria 744
1148 Ga0587115_008996 3300059626 Bacteria 1217
1149 Ga0587107_013294 3300059652 Bacteria 1041
1150 Ga0501082_0187061 3300060353 Bacteria 1802
1151 Ga0501082_0258583 3300060353 Bacteria 1514
1152 Ga0501082_0716355 3300060353 Bacteria 876
1153 Ga0501082_0723849 3300060353 Bacteria 871
1154 Ga0466962_0279927 3300061719 Bacteria 823
1155 Ga0530510_0071728 3300061734 Bacteria 2514
1156 Ga0530510_0108992 3300061734 Bacteria 2027
1157 Ga0530510_0591101 3300061734 Bacteria 844
1158 Ga0530510_1263601 3300061734 Bacteria 566

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10110168 rootH2_101101682 147
2 3300053108 Ga0500562_004475 Ga0500562_004475_2469_3017 148
3 iso_pu_bacteria 2507262055 2507509786 152
4 iso_pu_bacteria 2508501009 2508543802 152
5 iso_pu_bacteria 2508501042 2508698410 152
6 iso_pu_bacteria 2510917021 2511127743 152
7 iso_pu_bacteria 2511231028 2511396986 152
8 iso_pu_bacteria 2513237092 2513625264 152
9 iso_pu_bacteria 2513237094 2513644581 152
10 iso_pu_bacteria 2513237095 2513646148 152
11 iso_pu_bacteria 2513237096 2513658384 152
12 iso_pu_bacteria 2513237098 2513678623 152
13 iso_pu_bacteria 2513237101 2513695945 152
14 iso_pu_bacteria 2513237102 2513701027 152
15 iso_pu_bacteria 2513237104 2513715024 152
16 iso_pu_bacteria 2513237137 2513857540 152
17 iso_pu_bacteria 2513237139 2513875864 152
18 iso_pu_bacteria 2513237141 2513894223 152
19 iso_pu_bacteria 2513237145 2513920124 152
20 iso_pu_bacteria 2513237161 2514011469 152
21 iso_pu_bacteria 2515154112 2515630002 152
22 iso_pu_bacteria 2517093001 2517103514 152
23 iso_pu_bacteria 2517572143 2517893493 152
24 iso_pu_bacteria 2524023205 2524441023 152
25 iso_pu_bacteria 2524023210 2524469965 152
26 iso_pu_bacteria 2524023228 2524537998 152
27 iso_pu_bacteria 2528768022 2528856469 152
28 iso_pu_bacteria 2602042107 2603857120 152
29 iso_pu_bacteria 2617270735 2617349310 152
30 iso_pu_bacteria 2617270741 2617378167 152
31 iso_pu_bacteria 2643221547 2643755775 152
32 iso_pu_bacteria 2643221651 2644287948 152
33 iso_pu_bacteria 2667528175 2671118131 152
34 iso_pu_bacteria 2721755755 2723846177 152
35 iso_pu_bacteria 2728368998 2728747744 152
36 iso_pu_bacteria 2744054633 2745082454 152
37 iso_pu_bacteria 2791355196 2793060240 152
38 iso_pu_bacteria 2791355197 2793071750 152
39 iso_pu_bacteria 2791355199 2793076653 152
40 iso_pu_bacteria 2802429603 2805917606 152
41 iso_pu_bacteria 2816332527 2818241513 152
42 iso_pu_bacteria 2824600985 2824602109 152
43 iso_pu_bacteria 2824609381 2824610097 152
44 iso_pu_bacteria 2824617872 2824620095 152
45 iso_pu_bacteria 2824626560 2824627694 152
46 iso_pu_bacteria 2824635225 2824636737 152
47 iso_pu_bacteria 2824644064 2824645030 152
48 iso_pu_bacteria 2824653114 2824654953 152
49 iso_pu_bacteria 2824661429 2824662351 152
50 iso_pu_bacteria 2824671348 2824672600 152
51 iso_pu_bacteria 2824679649 2824680850 152
52 iso_pu_bacteria 2824687955 2824689067 152
53 iso_pu_bacteria 2824696289 2824697434 152
54 iso_pu_bacteria 2824704595 2824706668 152
55 iso_pu_bacteria 2824714736 2824715408 152
56 iso_pu_bacteria 2824723954 2824724737 152
57 iso_pu_bacteria 2824732956 2824733565 152
58 iso_pu_bacteria 2824746037 2824746940 152
59 iso_pu_bacteria 2824753945 2824759410 152
60 iso_pu_bacteria 2824763712 2824769646 152
61 iso_pu_bacteria 2824773399 2824774043 152
62 iso_pu_bacteria 2838122688 2838130092 152
63 iso_pu_bacteria 2841941048 2841941249 152
64 iso_pu_bacteria 2841949485 2841952724 152
65 iso_pu_bacteria 2841957949 2841962237 152
66 iso_pu_bacteria 2841966195 2841967404 152
67 iso_pu_bacteria 2841974524 2841979198 152
68 iso_pu_bacteria 2841983080 2841990774 152
69 iso_pu_bacteria 2842038055 2842038614 152
70 iso_pu_bacteria 2842045827 2842048441 152
71 iso_pu_bacteria 2844315083 2844318012 152
72 iso_pu_bacteria 2847930680 2847934823 152
73 iso_pu_bacteria 2847939898 2847945388 152
74 iso_pu_bacteria 2849076700 2849080424 152
75 iso_pu_bacteria 2857509624 2857510223 152
76 iso_pu_bacteria 2857524615 2857528523 152
77 iso_pu_bacteria 2874590934 2874595105 152
78 iso_pu_bacteria 2874604998 2874610913 152
79 iso_pu_bacteria 2874612657 2874615662 152
80 iso_pu_bacteria 2874620515 2874621685 152
81 iso_pu_bacteria 2874628541 2874632681 152
82 iso_pu_bacteria 2874645413 2874650966 152
83 iso_pu_bacteria 2876761206 2876765720 152
84 iso_pu_bacteria 2876771140 2876775041 152
85 iso_pu_bacteria 2876808645 2876810426 152
86 iso_pu_bacteria 2876818435 2876823856 152
87 iso_pu_bacteria 2879074833 2879080484 152
88 iso_pu_bacteria 2879083081 2879089270 152
89 iso_pu_bacteria 2879099564 2879109332 152
90 iso_pu_bacteria 2879110137 2879110526 152
91 iso_pu_bacteria 2879127579 2879134910 152
92 iso_pu_bacteria 2881364244 2881366217 152
93 iso_pu_bacteria 2881665667 2881671558 152
94 iso_pu_bacteria 2885366525 2885372810 152
95 iso_pu_bacteria 2885374607 2885380954 152
96 iso_pu_bacteria 2885383462 2885384451 152
97 iso_pu_bacteria 2885409591 2885413067 152
98 iso_pu_bacteria 2888388044 2888394991 152
99 iso_pu_bacteria 2888419890 2888423288 152
100 iso_pu_bacteria 2889033259 2889041126 152
101 iso_pu_bacteria 2893066018 2893070161 152
102 iso_pu_bacteria 2903727486 2903729679 152
103 iso_pu_bacteria 2903748898 2903758271 152
104 iso_pu_bacteria 2903768456 2903770868 152
105 iso_pu_bacteria 2904666416 2904668598 152
106 iso_pu_bacteria 2904690495 2904696887 152
107 iso_pu_bacteria 2904699407 2904701650 152
108 iso_pu_bacteria 2904711408 2904716680 152
109 iso_pu_bacteria 2906602504 2906605827 152
110 iso_pu_bacteria 2906610324 2906610378 152
111 iso_pu_bacteria 2906626472 2906628277 152
112 iso_pu_bacteria 2906635258 2906642793 152
113 iso_pu_bacteria 2906643746 2906644190 152
114 iso_pu_bacteria 2906660503 2906665928 152
115 iso_pu_bacteria 2908739725 2908743899 152
116 iso_pu_bacteria 2908756301 2908761463 152
117 iso_pu_bacteria 2908775508 2908778931 152
118 iso_pu_bacteria 2909042592 2909043592 152
119 iso_pu_bacteria 2919073203 2919076112 152
120 iso_pu_bacteria 2922361189 2922361973 152
121 iso_pu_bacteria 2922368715 2922375231 152
122 iso_pu_bacteria 2922386360 2922392021 152
123 iso_pu_bacteria 2922393267 2922395217 152
124 iso_pu_bacteria 2922425934 2922428983 152
125 iso_pu_bacteria 2929615660 2929615919 152
126 iso_pu_bacteria 2929624759 2929630532 152
127 iso_pu_bacteria 2932784394 2932792443 152
128 iso_pu_bacteria 2932794094 2932800411 152
129 iso_pu_bacteria 2932801729 2932804584 152
130 iso_pu_bacteria 2932809354 2932813942 152
131 iso_pu_bacteria 2932818245 2932819546 152
132 iso_pu_bacteria 2932828146 2932833748 152
133 iso_pu_bacteria 2933577622 2933578795 152
134 iso_pu_bacteria 2935608549 2935611355 152
135 iso_pu_bacteria 2935616580 2935618748 152
136 iso_pu_bacteria 2935630451 2935637754 152
137 iso_pu_bacteria 2935638405 2935644412 152
138 iso_pu_bacteria 2935648319 2935648739 152
139 iso_pu_bacteria 2935656913 2935657178 152
140 iso_pu_bacteria 2935665750 2935674150 152
141 iso_pu_bacteria 2935675223 2935678568 152
142 iso_pu_bacteria 2935684952 2935687935 152
143 iso_pu_bacteria 2935694250 2935701453 152
144 iso_pu_bacteria 2935703347 2935708269 152
145 iso_pu_bacteria 2935713505 2935714955 152
146 iso_pu_bacteria 2935722832 2935726480 152
147 iso_pu_bacteria 2935732158 2935733773 152
148 iso_pu_bacteria 2935741537 2935743152 152
149 iso_pu_bacteria 2935750917 2935754809 152
150 iso_pu_bacteria 2935760218 2935765517 152
151 iso_pu_bacteria 2935769743 2935775270 152
152 iso_pu_bacteria 2935777560 2935779530 152
153 iso_pu_bacteria 2935785616 2935791532 152
154 iso_pu_bacteria 2935793552 2935799844 152
155 iso_pu_bacteria 2935801545 2935805470 152
156 iso_pu_bacteria 2935810662 2935816764 152
157 iso_pu_bacteria 2935819856 2935820832 152
158 iso_pu_bacteria 2935827899 2935833839 152
159 iso_pu_bacteria 2935837841 2935839476 152
160 iso_pu_bacteria 2935847175 2935850908 152
161 iso_pu_bacteria 2935855204 2935857113 152
162 iso_pu_bacteria 2935864058 2935864657 152
163 iso_pu_bacteria 2935873716 2935876435 152
164 iso_pu_bacteria 2935883170 2935889778 152
165 iso_pu_bacteria 2935908558 2935913725 152
166 iso_pu_bacteria 2935916978 2935920285 152
167 iso_pu_bacteria 2935926038 2935930624 152
168 iso_pu_bacteria 2935934488 2935939403 152
169 iso_pu_bacteria 2935942939 2935946352 152
170 iso_pu_bacteria 2935951376 2935955809 152
171 iso_pu_bacteria 2935967501 2935972481 152
172 iso_pu_bacteria 2935975950 2935981688 152
173 iso_pu_bacteria 2935984226 2935991063 152
174 iso_pu_bacteria 2935992306 2935997596 152
175 iso_pu_bacteria 2936002035 2936007114 152
176 iso_pu_bacteria 2936011229 2936011649 152
177 iso_pu_bacteria 2936019824 2936020244 152
178 iso_pu_bacteria 2936028420 2936028939 152
179 iso_pu_bacteria 2936037263 2936042974 152
180 iso_pu_bacteria 2936046547 2936046967 152
181 iso_pu_bacteria 2936055302 2936058153 152
182 iso_pu_bacteria 2940556831 2940559814 152
183 iso_pu_bacteria 2941507105 2941514427 152
184 iso_pu_bacteria 2941515067 2941522323 152
185 iso_pu_bacteria 2941523033 2941530158 152
186 iso_pu_bacteria 2941531003 2941536096 152
187 iso_pu_bacteria 2941538514 2941540165 152
188 iso_pu_bacteria 3005474847 3005479128 152
189 iso_pu_bacteria 3005483717 3005488137 152
190 iso_pu_bacteria 3005506211 3005512715 152
191 iso_pu_bacteria 3005587118 3005590481 152
192 iso_pu_bacteria 3005594810 3005598062 152
193 iso_pu_bacteria 3005710791 3005713741 152
194 iso_pu_bacteria 3005718088 3005721252 152
195 iso_pu_bacteria 8006926726 8006930050 152
196 iso_pu_bacteria 8006933436 8006942220 152
197 iso_pu_bacteria 8006964411 8006964531 152
198 iso_pu_bacteria 8006973647 8006981954 152
199 iso_pu_bacteria 8006984368 8006986850 152
200 iso_pu_bacteria 8006994254 8006996069 152
201 iso_pu_bacteria 8016511872 8016514690 152
202 iso_pu_bacteria 8016522445 8016530788 152
203 iso_pu_bacteria 8016530956 8016536079 152
204 iso_pu_bacteria 8016539877 8016540360 152
205 iso_pu_bacteria 8016548790 8016552873 152
206 iso_pu_bacteria 8016557553 8016561251 152
207 iso_pu_bacteria 8016566248 8016574425 152
208 iso_pu_bacteria 8016575299 8016578524 152
209 iso_pu_bacteria 8016583857 8016591236 152
210 iso_pu_bacteria 8016595262 8016599108 152
211 iso_pu_bacteria 8016603502 8016611940 152
212 iso_pu_bacteria 8016613128 8016621864 152
213 iso_pu_bacteria 8016622563 8016627991 152
214 iso_pu_bacteria 8016630954 8016632313 152
215 iso_pu_bacteria 8017057580 8017061745 152
216 iso_pu_bacteria 8019530166 8019535804 152
217 iso_pu_bacteria 8019538911 8019543673 152
218 iso_pu_bacteria 8019547302 8019555101 152
219 iso_pu_bacteria 8019555841 8019557942 152
220 iso_pu_bacteria 8019576017 8019581243 152
221 iso_pu_bacteria 8019586578 8019588872 152
222 iso_pu_bacteria 8019597564 8019602362 152
223 iso_pu_bacteria 8019608314 8019616199 152
224 iso_pu_bacteria 8019629233 8019635693 152
225 iso_pu_bacteria 8019638758 8019643991 152
226 iso_pu_bacteria 8019659431 8019663491 152
227 iso_pu_bacteria 8019668869 8019673105 152
228 iso_pu_bacteria 8019678201 8019683036 152
229 iso_pu_bacteria 8019687851 8019688734 152
230 iso_pu_bacteria 8054302542 8054304454 152
231 iso_pu_bacteria 8055742211 8055747566 152
232 iso_pu_bacteria 8056673599 8056680459 152
233 iso_pu_bacteria 8056681323 8056684514 152
234 iso_pu_bacteria 8056689827 8056691224 152
235 iso_pu_bacteria 8056967851 8056972358 152
236 iso_pu_bacteria 8019619141 8019626817 153
237 3300005471 Ga0070698_100786664 Ga0070698_1007866642 155
238 3300005545 Ga0070695_100098141 Ga0070695_1000981411 155
239 3300005614 Ga0068856_100000972 Ga0068856_10000097223 155
240 3300006844 Ga0075428_100179551 Ga0075428_1001795512 155
241 3300006880 Ga0075429_100187435 Ga0075429_1001874352 155
242 3300009147 Ga0114129_10152522 Ga0114129_101525222 155
243 3300026078 Ga0207702_10000747 Ga0207702_1000074724 155
244 3300049570 Ga0501033_0305511 Ga0501033_0305511_378_845 155
245 3300050507 nmdc:mga05p37_154302_c1 nmdc:mga05p37_154302_c1_1000_1467 155
246 3300050508 nmdc:mga09592_40777_c1 nmdc:mga09592_40777_c1_2869_3336 155
247 3300001976 JGI24752J21851_1001311 JGI24752J21851_10013114 156
248 3300001991 JGI24743J22301_10160210 JGI24743J22301_101602101 156
249 3300002074 JGI24748J21848_1024821 JGI24748J21848_10248211 156
250 3300002076 JGI24749J21850_1001881 JGI24749J21850_10018812 156
251 3300002077 JGI24744J21845_10041717 JGI24744J21845_100417172 156
252 3300002126 JGI24035J26624_1020509 JGI24035J26624_10205091 156
253 3300002239 JGI24034J26672_10002015 JGI24034J26672_100020152 156
254 3300002244 JGI24742J22300_10034719 JGI24742J22300_100347191 156
255 3300002459 JGI24751J29686_10015977 JGI24751J29686_100159772 156
256 3300003203 JGI25406J46586_10118333 JGI25406J46586_101183332 156
257 3300003577 Ga0007416J51690_1017726 Ga0007416J51690_10177262 156
258 3300003659 JGI25404J52841_10004339 JGI25404J52841_100043392 156
259 3300003659 JGI25404J52841_10038933 JGI25404J52841_100389332 156
260 3300003693 Ga0032354_1061987 Ga0032354_10619872 156
261 3300004798 Ga0058859_11594462 Ga0058859_115944622 156
262 3300004798 Ga0058859_11820684 Ga0058859_118206842 156
263 3300004799 Ga0058863_10056823 Ga0058863_100568232 156
264 3300004799 Ga0058863_10080931 Ga0058863_100809311 156
265 3300004800 Ga0058861_10030443 Ga0058861_100304432 156
266 3300004800 Ga0058861_10175812 Ga0058861_101758121 156
267 3300004800 Ga0058861_11851124 Ga0058861_118511241 156
268 3300004801 Ga0058860_11861917 Ga0058860_118619172 156
269 3300004801 Ga0058860_12158433 Ga0058860_121584332 156
270 3300004803 Ga0058862_10078448 Ga0058862_100784482 156
271 3300004803 Ga0058862_10111058 Ga0058862_101110582 156
272 3300004803 Ga0058862_10160436 Ga0058862_101604367 156
273 3300005289 Ga0065704_10312968 Ga0065704_103129681 156
274 3300005290 Ga0065712_10109692 Ga0065712_101096922 156
275 3300005290 Ga0065712_10175657 Ga0065712_101756571 156
276 3300005293 Ga0065715_10096781 Ga0065715_100967812 156
277 3300005293 Ga0065715_10593290 Ga0065715_105932901 156
278 3300005295 Ga0065707_10105665 Ga0065707_101056652 156
279 3300005295 Ga0065707_10155043 Ga0065707_101550433 156
280 3300005327 Ga0070658_10001321 Ga0070658_100013212 156
281 3300005328 Ga0070676_10000380 Ga0070676_100003804 156
282 3300005328 Ga0070676_10313408 Ga0070676_103134082 156
283 3300005329 Ga0070683_100000033 Ga0070683_100000033103 156
284 3300005329 Ga0070683_100036594 Ga0070683_1000365944 156
285 3300005329 Ga0070683_100152551 Ga0070683_1001525513 156
286 3300005330 Ga0070690_100011157 Ga0070690_1000111572 156
287 3300005330 Ga0070690_100046988 Ga0070690_1000469882 156
288 3300005330 Ga0070690_100150920 Ga0070690_1001509203 156
289 3300005331 Ga0070670_100003921 Ga0070670_1000039213 156
290 3300005331 Ga0070670_100012257 Ga0070670_10001225710 156
291 3300005331 Ga0070670_100045805 Ga0070670_1000458053 156
292 3300005331 Ga0070670_100082102 Ga0070670_1000821022 156
293 3300005331 Ga0070670_100562757 Ga0070670_1005627572 156
294 3300005333 Ga0070677_10000135 Ga0070677_1000013515 156
295 3300005333 Ga0070677_10058986 Ga0070677_100589862 156
296 3300005333 Ga0070677_10155312 Ga0070677_101553122 156
297 3300005333 Ga0070677_10693157 Ga0070677_106931571 156
298 3300005334 Ga0068869_100000118 Ga0068869_10000011835 156
299 3300005334 Ga0068869_100044269 Ga0068869_1000442693 156
300 3300005334 Ga0068869_100618371 Ga0068869_1006183711 156
301 3300005335 Ga0070666_10001221 Ga0070666_100012212 156
302 3300005335 Ga0070666_10002914 Ga0070666_1000291411 156
303 3300005335 Ga0070666_10010376 Ga0070666_100103765 156
304 3300005336 Ga0070680_100025773 Ga0070680_1000257731 156
305 3300005336 Ga0070680_100261308 Ga0070680_1002613082 156
306 3300005336 Ga0070680_100339940 Ga0070680_1003399402 156
307 3300005336 Ga0070680_100723710 Ga0070680_1007237102 156
308 3300005336 Ga0070680_100961876 Ga0070680_1009618761 156
309 3300005337 Ga0070682_100000036 Ga0070682_10000003616 156
310 3300005337 Ga0070682_100182381 Ga0070682_1001823813 156
311 3300005337 Ga0070682_100500128 Ga0070682_1005001281 156
312 3300005338 Ga0068868_100000723 Ga0068868_10000072327 156
313 3300005338 Ga0068868_100000912 Ga0068868_10000091216 156
314 3300005338 Ga0068868_100014237 Ga0068868_1000142375 156
315 3300005338 Ga0068868_100041603 Ga0068868_1000416031 156
316 3300005338 Ga0068868_101035301 Ga0068868_1010353011 156
317 3300005339 Ga0070660_100000631 Ga0070660_1000006318 156
318 3300005339 Ga0070660_100135988 Ga0070660_1001359884 156
319 3300005340 Ga0070689_100000443 Ga0070689_10000044321 156
320 3300005340 Ga0070689_100015182 Ga0070689_1000151825 156
321 3300005340 Ga0070689_100019995 Ga0070689_1000199952 156
322 3300005340 Ga0070689_100060765 Ga0070689_1000607652 156
323 3300005340 Ga0070689_101006720 Ga0070689_1010067201 156
324 3300005341 Ga0070691_10130801 Ga0070691_101308012 156
325 3300005343 Ga0070687_100005653 Ga0070687_1000056536 156
326 3300005343 Ga0070687_100014217 Ga0070687_1000142174 156
327 3300005343 Ga0070687_100207292 Ga0070687_1002072922 156
328 3300005343 Ga0070687_100776215 Ga0070687_1007762152 156
329 3300005344 Ga0070661_100009001 Ga0070661_1000090014 156
330 3300005344 Ga0070661_100077614 Ga0070661_1000776142 156
331 3300005345 Ga0070692_10156770 Ga0070692_101567702 156
332 3300005345 Ga0070692_10704524 Ga0070692_107045241 156
333 3300005347 Ga0070668_100000076 Ga0070668_10000007631 156
334 3300005347 Ga0070668_100036317 Ga0070668_1000363173 156
335 3300005347 Ga0070668_100466288 Ga0070668_1004662882 156
336 3300005347 Ga0070668_100980307 Ga0070668_1009803071 156
337 3300005347 Ga0070668_100986416 Ga0070668_1009864161 156
338 3300005353 Ga0070669_100000096 Ga0070669_10000009672 156
339 3300005353 Ga0070669_100032654 Ga0070669_1000326543 156
340 3300005353 Ga0070669_100045874 Ga0070669_1000458745 156
341 3300005353 Ga0070669_100057829 Ga0070669_1000578295 156
342 3300005353 Ga0070669_100124436 Ga0070669_1001244361 156
343 3300005354 Ga0070675_100000559 Ga0070675_1000005592 156
344 3300005354 Ga0070675_100017111 Ga0070675_1000171113 156
345 3300005354 Ga0070675_100018869 Ga0070675_1000188694 156
346 3300005354 Ga0070675_100052834 Ga0070675_1000528343 156
347 3300005354 Ga0070675_100148076 Ga0070675_1001480762 156
348 3300005354 Ga0070675_100474509 Ga0070675_1004745092 156
349 3300005354 Ga0070675_100485534 Ga0070675_1004855342 156
350 3300005355 Ga0070671_100000045 Ga0070671_10000004540 156
351 3300005355 Ga0070671_100001952 Ga0070671_10000195213 156
352 3300005355 Ga0070671_100042395 Ga0070671_1000423952 156
353 3300005355 Ga0070671_100350254 Ga0070671_1003502542 156
354 3300005355 Ga0070671_100358067 Ga0070671_1003580672 156
355 3300005355 Ga0070671_100553913 Ga0070671_1005539132 156
356 3300005356 Ga0070674_100000922 Ga0070674_10000092214 156
357 3300005356 Ga0070674_100146244 Ga0070674_1001462442 156
358 3300005356 Ga0070674_100206191 Ga0070674_1002061912 156
359 3300005356 Ga0070674_100269913 Ga0070674_1002699132 156
360 3300005356 Ga0070674_100614464 Ga0070674_1006144642 156
361 3300005364 Ga0070673_100001307 Ga0070673_10000130712 156
362 3300005364 Ga0070673_100002114 Ga0070673_1000021142 156
363 3300005364 Ga0070673_100058949 Ga0070673_1000589495 156
364 3300005364 Ga0070673_100194356 Ga0070673_1001943561 156
365 3300005364 Ga0070673_100252144 Ga0070673_1002521442 156
366 3300005364 Ga0070673_100540477 Ga0070673_1005404772 156
367 3300005365 Ga0070688_100007941 Ga0070688_1000079415 156
368 3300005365 Ga0070688_100052606 Ga0070688_1000526062 156
369 3300005365 Ga0070688_100438694 Ga0070688_1004386942 156
370 3300005366 Ga0070659_100000088 Ga0070659_10000008872 156
371 3300005366 Ga0070659_100084712 Ga0070659_1000847123 156
372 3300005367 Ga0070667_100000025 Ga0070667_10000002581 156
373 3300005367 Ga0070667_100003534 Ga0070667_1000035343 156
374 3300005367 Ga0070667_100007729 Ga0070667_1000077297 156
375 3300005367 Ga0070667_100022068 Ga0070667_1000220685 156
376 3300005367 Ga0070667_100032953 Ga0070667_1000329532 156
377 3300005367 Ga0070667_100469753 Ga0070667_1004697532 156
378 3300005436 Ga0070713_100306206 Ga0070713_1003062062 156
379 3300005437 Ga0070710_10840348 Ga0070710_108403481 156
380 3300005438 Ga0070701_10053241 Ga0070701_100532413 156
381 3300005439 Ga0070711_100582287 Ga0070711_1005822872 156
382 3300005440 Ga0070705_100000956 Ga0070705_10000095614 156
383 3300005440 Ga0070705_100368521 Ga0070705_1003685212 156
384 3300005441 Ga0070700_100102202 Ga0070700_1001022023 156
385 3300005441 Ga0070700_100144679 Ga0070700_1001446792 156
386 3300005441 Ga0070700_100573676 Ga0070700_1005736762 156
387 3300005441 Ga0070700_100623759 Ga0070700_1006237592 156
388 3300005444 Ga0070694_100575120 Ga0070694_1005751202 156
389 3300005445 Ga0070708_100004467 Ga0070708_1000044673 156
390 3300005445 Ga0070708_100497899 Ga0070708_1004978992 156
391 3300005455 Ga0070663_100015416 Ga0070663_1000154162 156
392 3300005456 Ga0070678_100000461 Ga0070678_10000046120 156
393 3300005456 Ga0070678_100194825 Ga0070678_1001948252 156
394 3300005456 Ga0070678_100354391 Ga0070678_1003543912 156
395 3300005456 Ga0070678_100642780 Ga0070678_1006427802 156
396 3300005456 Ga0070678_101249501 Ga0070678_1012495011 156
397 3300005457 Ga0070662_100000976 Ga0070662_10000097613 156
398 3300005457 Ga0070662_100027519 Ga0070662_1000275192 156
399 3300005458 Ga0070681_10077480 Ga0070681_100774803 156
400 3300005458 Ga0070681_10209829 Ga0070681_102098291 156
401 3300005458 Ga0070681_10288163 Ga0070681_102881631 156
402 3300005458 Ga0070681_10304780 Ga0070681_103047803 156
403 3300005458 Ga0070681_10327027 Ga0070681_103270272 156
404 3300005459 Ga0068867_100022286 Ga0068867_1000222863 156
405 3300005459 Ga0068867_100118640 Ga0068867_1001186402 156
406 3300005459 Ga0068867_100192373 Ga0068867_1001923732 156
407 3300005459 Ga0068867_100402525 Ga0068867_1004025251 156
408 3300005466 Ga0070685_10000585 Ga0070685_100005854 156
409 3300005466 Ga0070685_10060815 Ga0070685_100608152 156
410 3300005466 Ga0070685_10209483 Ga0070685_102094832 156
411 3300005466 Ga0070685_10624909 Ga0070685_106249092 156
412 3300005468 Ga0070707_100021471 Ga0070707_1000214712 156
413 3300005471 Ga0070698_100194930 Ga0070698_1001949302 156
414 3300005471 Ga0070698_100519048 Ga0070698_1005190482 156
415 3300005518 Ga0070699_100128090 Ga0070699_1001280902 156
416 3300005518 Ga0070699_100662949 Ga0070699_1006629491 156
417 3300005530 Ga0070679_100030992 Ga0070679_1000309923 156
418 3300005530 Ga0070679_100100465 Ga0070679_1001004654 156
419 3300005530 Ga0070679_100149984 Ga0070679_1001499842 156
420 3300005530 Ga0070679_100211006 Ga0070679_1002110064 156
421 3300005530 Ga0070679_100420175 Ga0070679_1004201751 156
422 3300005530 Ga0070679_101057699 Ga0070679_1010576992 156
423 3300005535 Ga0070684_100010702 Ga0070684_1000107024 156
424 3300005535 Ga0070684_100054901 Ga0070684_1000549012 156
425 3300005535 Ga0070684_100109082 Ga0070684_1001090822 156
426 3300005535 Ga0070684_100192199 Ga0070684_1001921992 156
427 3300005536 Ga0070697_100004239 Ga0070697_1000042393 156
428 3300005536 Ga0070697_100238499 Ga0070697_1002384992 156
429 3300005539 Ga0068853_100000472 Ga0068853_1000004727 156
430 3300005539 Ga0068853_100170573 Ga0068853_1001705733 156
431 3300005543 Ga0070672_100000581 Ga0070672_10000058119 156
432 3300005543 Ga0070672_100005460 Ga0070672_1000054602 156
433 3300005543 Ga0070672_100048521 Ga0070672_1000485212 156
434 3300005543 Ga0070672_100076957 Ga0070672_1000769572 156
435 3300005543 Ga0070672_100576426 Ga0070672_1005764262 156
436 3300005544 Ga0070686_100000708 Ga0070686_1000007086 156
437 3300005544 Ga0070686_100059609 Ga0070686_1000596092 156
438 3300005544 Ga0070686_100210392 Ga0070686_1002103922 156
439 3300005544 Ga0070686_100219016 Ga0070686_1002190162 156
440 3300005544 Ga0070686_100796249 Ga0070686_1007962491 156
441 3300005545 Ga0070695_100181760 Ga0070695_1001817602 156
442 3300005546 Ga0070696_100078380 Ga0070696_1000783802 156
443 3300005546 Ga0070696_100225948 Ga0070696_1002259481 156
444 3300005547 Ga0070693_100034250 Ga0070693_1000342502 156
445 3300005547 Ga0070693_100392828 Ga0070693_1003928281 156
446 3300005548 Ga0070665_100061650 Ga0070665_1000616503 156
447 3300005548 Ga0070665_100103384 Ga0070665_1001033844 156
448 3300005548 Ga0070665_100571036 Ga0070665_1005710361 156
449 3300005548 Ga0070665_100838043 Ga0070665_1008380431 156
450 3300005563 Ga0068855_100002917 Ga0068855_1000029177 156
451 3300005563 Ga0068855_101258081 Ga0068855_1012580812 156
452 3300005563 Ga0068855_101617578 Ga0068855_1016175781 156
453 3300005564 Ga0070664_100000540 Ga0070664_10000054013 156
454 3300005564 Ga0070664_100001968 Ga0070664_1000019683 156
455 3300005564 Ga0070664_100017196 Ga0070664_1000171963 156
456 3300005564 Ga0070664_100023966 Ga0070664_1000239662 156
457 3300005564 Ga0070664_100513685 Ga0070664_1005136852 156
458 3300005577 Ga0068857_100004949 Ga0068857_1000049494 156
459 3300005577 Ga0068857_100740951 Ga0068857_1007409512 156
460 3300005578 Ga0068854_100008432 Ga0068854_1000084323 156
461 3300005614 Ga0068856_100008110 Ga0068856_10000811010 156
462 3300005614 Ga0068856_102086557 Ga0068856_1020865571 156
463 3300005615 Ga0070702_100174354 Ga0070702_1001743542 156
464 3300005615 Ga0070702_100268867 Ga0070702_1002688672 156
465 3300005615 Ga0070702_100322131 Ga0070702_1003221312 156
466 3300005615 Ga0070702_100520717 Ga0070702_1005207171 156
467 3300005616 Ga0068852_100000931 Ga0068852_1000009313 156
468 3300005616 Ga0068852_100998686 Ga0068852_1009986862 156
469 3300005617 Ga0068859_100000162 Ga0068859_10000016240 156
470 3300005617 Ga0068859_100000703 Ga0068859_10000070338 156
471 3300005617 Ga0068859_100001363 Ga0068859_10000136312 156
472 3300005617 Ga0068859_100002579 Ga0068859_10000257915 156
473 3300005617 Ga0068859_100116937 Ga0068859_1001169372 156
474 3300005617 Ga0068859_100662919 Ga0068859_1006629192 156
475 3300005618 Ga0068864_100000406 Ga0068864_10000040631 156
476 3300005618 Ga0068864_100000677 Ga0068864_10000067717 156
477 3300005618 Ga0068864_100001203 Ga0068864_10000120317 156
478 3300005618 Ga0068864_100018418 Ga0068864_1000184185 156
479 3300005618 Ga0068864_100077202 Ga0068864_1000772026 156
480 3300005618 Ga0068864_100081439 Ga0068864_1000814392 156
481 3300005618 Ga0068864_101501252 Ga0068864_1015012522 156
482 3300005718 Ga0068866_10002337 Ga0068866_100023373 156
483 3300005718 Ga0068866_10164411 Ga0068866_101644112 156
484 3300005718 Ga0068866_10396826 Ga0068866_103968262 156
485 3300005718 Ga0068866_10674739 Ga0068866_106747392 156
486 3300005719 Ga0068861_100000205 Ga0068861_10000020517 156
487 3300005719 Ga0068861_100086895 Ga0068861_1000868955 156
488 3300005719 Ga0068861_100350673 Ga0068861_1003506732 156
489 3300005834 Ga0068851_10000663 Ga0068851_100006632 156
490 3300005840 Ga0068870_10001380 Ga0068870_100013808 156
491 3300005840 Ga0068870_10061307 Ga0068870_100613072 156
492 3300005840 Ga0068870_10206190 Ga0068870_102061902 156
493 3300005841 Ga0068863_100000067 Ga0068863_10000006781 156
494 3300005841 Ga0068863_100000784 Ga0068863_10000078427 156
495 3300005841 Ga0068863_100000969 Ga0068863_1000009693 156
496 3300005841 Ga0068863_100002121 Ga0068863_1000021216 156
497 3300005841 Ga0068863_100593629 Ga0068863_1005936292 156
498 3300005842 Ga0068858_100008722 Ga0068858_10000872214 156
499 3300005842 Ga0068858_100026802 Ga0068858_1000268023 156
500 3300005842 Ga0068858_100027525 Ga0068858_1000275253 156
501 3300005842 Ga0068858_100036951 Ga0068858_1000369513 156
502 3300005842 Ga0068858_100208213 Ga0068858_1002082132 156
503 3300005842 Ga0068858_100277835 Ga0068858_1002778352 156
504 3300005842 Ga0068858_100320333 Ga0068858_1003203332 156
505 3300005842 Ga0068858_100570992 Ga0068858_1005709922 156
506 3300005843 Ga0068860_100004945 Ga0068860_1000049452 156
507 3300005843 Ga0068860_100014085 Ga0068860_1000140855 156
508 3300005843 Ga0068860_100039250 Ga0068860_1000392503 156
509 3300005843 Ga0068860_100045537 Ga0068860_1000455375 156
510 3300005843 Ga0068860_100048778 Ga0068860_1000487782 156
511 3300005843 Ga0068860_100270458 Ga0068860_1002704583 156
512 3300005844 Ga0068862_100001387 Ga0068862_1000013872 156
513 3300005844 Ga0068862_100022281 Ga0068862_1000222815 156
514 3300005844 Ga0068862_100066024 Ga0068862_1000660242 156
515 3300005844 Ga0068862_100083287 Ga0068862_1000832873 156
516 3300005844 Ga0068862_100360246 Ga0068862_1003602462 156
517 3300005844 Ga0068862_100843691 Ga0068862_1008436912 156
518 3300005844 Ga0068862_101424395 Ga0068862_1014243951 156
519 3300005937 Ga0081455_10310939 Ga0081455_103109392 156
520 3300005983 Ga0081540_1000785 Ga0081540_100078520 156
521 3300005983 Ga0081540_1001166 Ga0081540_100116625 156
522 3300005983 Ga0081540_1006864 Ga0081540_10068649 156
523 3300005983 Ga0081540_1062215 Ga0081540_10622152 156
524 3300005983 Ga0081540_1164081 Ga0081540_11640812 156
525 3300005985 Ga0081539_10079757 Ga0081539_100797572 156
526 3300006028 Ga0070717_10171221 Ga0070717_101712213 156
527 3300006028 Ga0070717_10558537 Ga0070717_105585372 156
528 3300006028 Ga0070717_11360808 Ga0070717_113608081 156
529 3300006038 Ga0075365_10000107 Ga0075365_1000010713 156
530 3300006038 Ga0075365_10105578 Ga0075365_101055783 156
531 3300006038 Ga0075365_10373490 Ga0075365_103734902 156
532 3300006042 Ga0075368_10014839 Ga0075368_100148392 156
533 3300006048 Ga0075363_100118852 Ga0075363_1001188522 156
534 3300006048 Ga0075363_100125728 Ga0075363_1001257282 156
535 3300006051 Ga0075364_10003335 Ga0075364_100033356 156
536 3300006051 Ga0075364_10044569 Ga0075364_100445692 156
537 3300006051 Ga0075364_10374723 Ga0075364_103747232 156
538 3300006058 Ga0075432_10315806 Ga0075432_103158061 156
539 3300006175 Ga0070712_101019032 Ga0070712_1010190322 156
540 3300006177 Ga0075362_10007455 Ga0075362_100074553 156
541 3300006177 Ga0075362_10008082 Ga0075362_100080823 156
542 3300006178 Ga0075367_10009044 Ga0075367_100090443 156
543 3300006178 Ga0075367_10685474 Ga0075367_106854742 156
544 3300006186 Ga0075369_10005796 Ga0075369_100057962 156
545 3300006186 Ga0075369_10031098 Ga0075369_100310984 156
546 3300006195 Ga0075366_10029169 Ga0075366_100291693 156
547 3300006237 Ga0097621_100011773 Ga0097621_1000117732 156
548 3300006237 Ga0097621_100094680 Ga0097621_1000946805 156
549 3300006237 Ga0097621_100163361 Ga0097621_1001633612 156
550 3300006237 Ga0097621_100671959 Ga0097621_1006719592 156
551 3300006237 Ga0097621_100792630 Ga0097621_1007926302 156
552 3300006353 Ga0075370_10292143 Ga0075370_102921432 156
553 3300006353 Ga0075370_10498765 Ga0075370_104987652 156
554 3300006358 Ga0068871_100043089 Ga0068871_1000430892 156
555 3300006358 Ga0068871_100070590 Ga0068871_1000705903 156
556 3300006358 Ga0068871_100243130 Ga0068871_1002431303 156
557 3300006358 Ga0068871_100278956 Ga0068871_1002789562 156
558 3300006844 Ga0075428_100130169 Ga0075428_1001301692 156
559 3300006844 Ga0075428_100531359 Ga0075428_1005313592 156
560 3300006844 Ga0075428_100821334 Ga0075428_1008213341 156
561 3300006844 Ga0075428_100863332 Ga0075428_1008633321 156
562 3300006844 Ga0075428_100971034 Ga0075428_1009710341 156
563 3300006844 Ga0075428_101080949 Ga0075428_1010809492 156
564 3300006844 Ga0075428_101955078 Ga0075428_1019550781 156
565 3300006847 Ga0075431_100013381 Ga0075431_1000133814 156
566 3300006847 Ga0075431_100043853 Ga0075431_1000438531 156
567 3300006847 Ga0075431_100500274 Ga0075431_1005002742 156
568 3300006847 Ga0075431_100667935 Ga0075431_1006679352 156
569 3300006852 Ga0075433_10066503 Ga0075433_100665032 156
570 3300006852 Ga0075433_10816227 Ga0075433_108162272 156
571 3300006871 Ga0075434_100087559 Ga0075434_1000875592 156
572 3300006871 Ga0075434_100151263 Ga0075434_1001512632 156
573 3300006871 Ga0075434_100242253 Ga0075434_1002422532 156
574 3300006871 Ga0075434_100519765 Ga0075434_1005197652 156
575 3300006871 Ga0075434_100770822 Ga0075434_1007708222 156
576 3300006880 Ga0075429_100088416 Ga0075429_1000884162 156
577 3300006880 Ga0075429_100677885 Ga0075429_1006778852 156
578 3300006880 Ga0075429_100705152 Ga0075429_1007051522 156
579 3300006880 Ga0075429_100833012 Ga0075429_1008330122 156
580 3300006880 Ga0075429_101006129 Ga0075429_1010061291 156
581 3300006880 Ga0075429_101177838 Ga0075429_1011778381 156
582 3300006881 Ga0068865_100027476 Ga0068865_1000274763 156
583 3300006881 Ga0068865_100503925 Ga0068865_1005039251 156
584 3300006881 Ga0068865_101130059 Ga0068865_1011300592 156
585 3300006914 Ga0075436_100499175 Ga0075436_1004991752 156
586 3300006914 Ga0075436_100565424 Ga0075436_1005654242 156
587 3300006931 Ga0097620_100000162 Ga0097620_10000016240 156
588 3300006931 Ga0097620_100000703 Ga0097620_10000070338 156
589 3300006931 Ga0097620_100001363 Ga0097620_10000136312 156
590 3300006931 Ga0097620_100002579 Ga0097620_10000257915 156
591 3300006931 Ga0097620_100116933 Ga0097620_1001169334 156
592 3300006931 Ga0097620_100662813 Ga0097620_1006628132 156
593 3300007076 Ga0075435_100261942 Ga0075435_1002619423 156
594 3300007076 Ga0075435_100379856 Ga0075435_1003798562 156
595 3300007076 Ga0075435_100710220 Ga0075435_1007102202 156
596 3300007076 Ga0075435_101167389 Ga0075435_1011673892 156
597 3300007265 Ga0099794_10067852 Ga0099794_100678523 156
598 3300007788 Ga0099795_10552627 Ga0099795_105526271 156
599 3300009092 Ga0105250_10007794 Ga0105250_100077945 156
600 3300009093 Ga0105240_10006530 Ga0105240_1000653014 156
601 3300009093 Ga0105240_11153961 Ga0105240_111539612 156
602 3300009094 Ga0111539_10000022 Ga0111539_1000002246 156
603 3300009094 Ga0111539_10040340 Ga0111539_100403402 156
604 3300009094 Ga0111539_10076709 Ga0111539_100767092 156
605 3300009094 Ga0111539_10104137 Ga0111539_101041373 156
606 3300009094 Ga0111539_10145119 Ga0111539_101451194 156
607 3300009094 Ga0111539_10381999 Ga0111539_103819993 156
608 3300009094 Ga0111539_10915989 Ga0111539_109159892 156
609 3300009094 Ga0111539_11172000 Ga0111539_111720001 156
610 3300009094 Ga0111539_11817078 Ga0111539_118170781 156
611 3300009098 Ga0105245_10000010 Ga0105245_100000102 156
612 3300009098 Ga0105245_10000166 Ga0105245_100001662 156
613 3300009098 Ga0105245_10038622 Ga0105245_100386222 156
614 3300009098 Ga0105245_10351851 Ga0105245_103518512 156
615 3300009098 Ga0105245_10392735 Ga0105245_103927353 156
616 3300009101 Ga0105247_10000778 Ga0105247_1000077817 156
617 3300009101 Ga0105247_10005540 Ga0105247_100055407 156
618 3300009101 Ga0105247_11763610 Ga0105247_117636101 156
619 3300009147 Ga0114129_10092785 Ga0114129_100927852 156
620 3300009147 Ga0114129_10121065 Ga0114129_101210652 156
621 3300009147 Ga0114129_10292313 Ga0114129_102923132 156
622 3300009147 Ga0114129_10606618 Ga0114129_106066182 156
623 3300009147 Ga0114129_11128009 Ga0114129_111280092 156
624 3300009147 Ga0114129_11474887 Ga0114129_114748872 156
625 3300009147 Ga0114129_11640064 Ga0114129_116400642 156
626 3300009147 Ga0114129_12639473 Ga0114129_126394731 156
627 3300009148 Ga0105243_10021643 Ga0105243_100216432 156
628 3300009148 Ga0105243_10781543 Ga0105243_107815432 156
629 3300009174 Ga0105241_10000628 Ga0105241_1000062816 156
630 3300009176 Ga0105242_10009762 Ga0105242_100097627 156
631 3300009176 Ga0105242_10425270 Ga0105242_104252701 156
632 3300009176 Ga0105242_10661511 Ga0105242_106615112 156
633 3300009176 Ga0105242_10794877 Ga0105242_107948772 156
634 3300009176 Ga0105242_11246583 Ga0105242_112465832 156
635 3300009176 Ga0105242_12302834 Ga0105242_123028341 156
636 3300009177 Ga0105248_10001106 Ga0105248_100011063 156
637 3300009177 Ga0105248_10034053 Ga0105248_100340535 156
638 3300009177 Ga0105248_10098171 Ga0105248_100981712 156
639 3300009177 Ga0105248_10199651 Ga0105248_101996512 156
640 3300009177 Ga0105248_10446231 Ga0105248_104462312 156
641 3300009177 Ga0105248_10851610 Ga0105248_108516102 156
642 3300009177 Ga0105248_11028380 Ga0105248_110283802 156
643 3300009177 Ga0105248_11084329 Ga0105248_110843291 156
644 3300009177 Ga0105248_11793594 Ga0105248_117935941 156
645 3300009177 Ga0105248_11865745 Ga0105248_118657451 156
646 3300009545 Ga0105237_10000740 Ga0105237_1000074045 156
647 3300009551 Ga0105238_10000002 Ga0105238_10000002499 156
648 3300009551 Ga0105238_10001986 Ga0105238_1000198616 156
649 3300009553 Ga0105249_10001061 Ga0105249_1000106128 156
650 3300009553 Ga0105249_10002192 Ga0105249_100021923 156
651 3300009553 Ga0105249_10711388 Ga0105249_107113881 156
652 3300009553 Ga0105249_11037129 Ga0105249_110371292 156
653 3300010375 Ga0105239_10001250 Ga0105239_1000125017 156
654 3300010375 Ga0105239_10002930 Ga0105239_1000293036 156
655 3300011119 Ga0105246_10128367 Ga0105246_101283672 156
656 3300011119 Ga0105246_10154324 Ga0105246_101543241 156
657 3300011119 Ga0105246_10176286 Ga0105246_101762863 156
658 3300013100 Ga0157373_10033827 Ga0157373_100338273 156
659 3300013100 Ga0157373_10264084 Ga0157373_102640842 156
660 3300013100 Ga0157373_10750171 Ga0157373_107501711 156
661 3300013102 Ga0157371_10031254 Ga0157371_100312542 156
662 3300013102 Ga0157371_10594347 Ga0157371_105943472 156
663 3300013105 Ga0157369_10001943 Ga0157369_100019437 156
664 3300013105 Ga0157369_10003299 Ga0157369_100032992 156
665 3300013296 Ga0157374_10000005 Ga0157374_10000005572 156
666 3300013296 Ga0157374_10045770 Ga0157374_100457705 156
667 3300013297 Ga0157378_10000167 Ga0157378_100001674 156
668 3300013297 Ga0157378_10039360 Ga0157378_100393603 156
669 3300013297 Ga0157378_10209845 Ga0157378_102098451 156
670 3300013297 Ga0157378_10376225 Ga0157378_103762253 156
671 3300013297 Ga0157378_10665271 Ga0157378_106652712 156
672 3300013297 Ga0157378_11049199 Ga0157378_110491992 156
673 3300013306 Ga0163162_10000823 Ga0163162_1000082334 156
674 3300013306 Ga0163162_10002337 Ga0163162_1000233714 156
675 3300013306 Ga0163162_10007545 Ga0163162_100075457 156
676 3300013306 Ga0163162_10096376 Ga0163162_100963762 156
677 3300013306 Ga0163162_10340610 Ga0163162_103406102 156
678 3300013306 Ga0163162_10391891 Ga0163162_103918911 156
679 3300013307 Ga0157372_10091324 Ga0157372_100913242 156
680 3300013307 Ga0157372_10373408 Ga0157372_103734082 156
681 3300013307 Ga0157372_11073191 Ga0157372_110731912 156
682 3300013308 Ga0157375_10000055 Ga0157375_1000005598 156
683 3300013308 Ga0157375_10001345 Ga0157375_100013454 156
684 3300013308 Ga0157375_10001418 Ga0157375_100014185 156
685 3300013308 Ga0157375_10082844 Ga0157375_100828442 156
686 3300013308 Ga0157375_10158566 Ga0157375_101585664 156
687 3300013308 Ga0157375_12000318 Ga0157375_120003182 156
688 3300013308 Ga0157375_12202148 Ga0157375_122021481 156
689 3300014325 Ga0163163_10009168 Ga0163163_100091683 156
690 3300014325 Ga0163163_10142986 Ga0163163_101429864 156
691 3300014325 Ga0163163_10369195 Ga0163163_103691952 156
692 3300014325 Ga0163163_10558186 Ga0163163_105581862 156
693 3300014325 Ga0163163_10561969 Ga0163163_105619692 156
694 3300014325 Ga0163163_12255054 Ga0163163_122550541 156
695 3300014326 Ga0157380_10118167 Ga0157380_101181672 156
696 3300014326 Ga0157380_10148581 Ga0157380_101485812 156
697 3300014326 Ga0157380_10295874 Ga0157380_102958742 156
698 3300014326 Ga0157380_10366891 Ga0157380_103668911 156
699 3300014326 Ga0157380_10551512 Ga0157380_105515122 156
700 3300014326 Ga0157380_10701762 Ga0157380_107017622 156
701 3300014326 Ga0157380_11076523 Ga0157380_110765232 156
702 3300014745 Ga0157377_10000026 Ga0157377_10000026129 156
703 3300014745 Ga0157377_10000296 Ga0157377_1000029626 156
704 3300014745 Ga0157377_10001264 Ga0157377_100012649 156
705 3300014745 Ga0157377_10122387 Ga0157377_101223872 156
706 3300014745 Ga0157377_10399171 Ga0157377_103991712 156
707 3300014745 Ga0157377_11153035 Ga0157377_111530351 156
708 3300014968 Ga0157379_10000025 Ga0157379_1000002515 156
709 3300014968 Ga0157379_10000562 Ga0157379_100005623 156
710 3300014968 Ga0157379_10043366 Ga0157379_100433666 156
711 3300014968 Ga0157379_10324834 Ga0157379_103248342 156
712 3300014968 Ga0157379_10693633 Ga0157379_106936331 156
713 3300014968 Ga0157379_10883384 Ga0157379_108833841 156
714 3300014968 Ga0157379_11493319 Ga0157379_114933191 156
715 3300014968 Ga0157379_11836295 Ga0157379_118362951 156
716 3300014969 Ga0157376_10000003 Ga0157376_10000003232 156
717 3300014969 Ga0157376_10003404 Ga0157376_1000340410 156
718 3300014969 Ga0157376_10089508 Ga0157376_100895083 156
719 3300017792 Ga0163161_10014953 Ga0163161_100149535 156
720 3300017792 Ga0163161_10073389 Ga0163161_100733892 156
721 3300017792 Ga0163161_10077880 Ga0163161_100778802 156
722 3300017792 Ga0163161_10111267 Ga0163161_101112673 156
723 3300017792 Ga0163161_10545687 Ga0163161_105456872 156
724 3300017792 Ga0163161_10686890 Ga0163161_106868901 156
725 3300020076 Ga0206355_1166500 Ga0206355_11665002 156
726 3300020078 Ga0206352_10354123 Ga0206352_103541232 156
727 3300020082 Ga0206353_11044236 Ga0206353_110442361 156
728 3300020082 Ga0206353_11127814 Ga0206353_111278141 156
729 3300021358 Ga0213873_10000721 Ga0213873_100007213 156
730 3300021377 Ga0213874_10207480 Ga0213874_102074802 156
731 3300021384 Ga0213876_10000009 Ga0213876_10000009212 156
732 3300025290 Ga0207673_1010380 Ga0207673_10103802 156
733 3300025304 Ga0209257_1063601 Ga0209257_10636012 156
734 3300025315 Ga0207697_10003661 Ga0207697_100036617 156
735 3300025315 Ga0207697_10011132 Ga0207697_100111322 156
736 3300025315 Ga0207697_10191667 Ga0207697_101916672 156
737 3300025321 Ga0207656_10052062 Ga0207656_100520622 156
738 3300025711 Ga0207696_1052439 Ga0207696_10524392 156
739 3300025893 Ga0207682_10000315 Ga0207682_1000031513 156
740 3300025893 Ga0207682_10003051 Ga0207682_100030515 156
741 3300025893 Ga0207682_10177372 Ga0207682_101773722 156
742 3300025899 Ga0207642_10004671 Ga0207642_100046713 156
743 3300025899 Ga0207642_10571812 Ga0207642_105718122 156
744 3300025900 Ga0207710_10004541 Ga0207710_100045416 156
745 3300025900 Ga0207710_10007497 Ga0207710_100074973 156
746 3300025901 Ga0207688_10026904 Ga0207688_100269042 156
747 3300025903 Ga0207680_10000156 Ga0207680_1000015621 156
748 3300025903 Ga0207680_10002207 Ga0207680_100022072 156
749 3300025903 Ga0207680_10002463 Ga0207680_100024632 156
750 3300025903 Ga0207680_10345296 Ga0207680_103452962 156
751 3300025903 Ga0207680_10440388 Ga0207680_104403882 156
752 3300025904 Ga0207647_10001294 Ga0207647_100012946 156
753 3300025905 Ga0207685_10239392 Ga0207685_102393922 156
754 3300025907 Ga0207645_10000031 Ga0207645_1000003174 156
755 3300025907 Ga0207645_10072924 Ga0207645_100729242 156
756 3300025908 Ga0207643_10000030 Ga0207643_1000003047 156
757 3300025908 Ga0207643_10027333 Ga0207643_100273332 156
758 3300025908 Ga0207643_10062760 Ga0207643_100627602 156
759 3300025908 Ga0207643_10434898 Ga0207643_104348982 156
760 3300025908 Ga0207643_10462185 Ga0207643_104621852 156
761 3300025909 Ga0207705_10082987 Ga0207705_100829872 156
762 3300025909 Ga0207705_10297961 Ga0207705_102979612 156
763 3300025909 Ga0207705_10619940 Ga0207705_106199401 156
764 3300025910 Ga0207684_10006000 Ga0207684_100060008 156
765 3300025910 Ga0207684_10155584 Ga0207684_101555842 156
766 3300025910 Ga0207684_10551363 Ga0207684_105513632 156
767 3300025910 Ga0207684_10954250 Ga0207684_109542501 156
768 3300025911 Ga0207654_10046503 Ga0207654_100465032 156
769 3300025911 Ga0207654_10680511 Ga0207654_106805111 156
770 3300025912 Ga0207707_10073376 Ga0207707_100733763 156
771 3300025912 Ga0207707_10217654 Ga0207707_102176542 156
772 3300025913 Ga0207695_10249706 Ga0207695_102497062 156
773 3300025914 Ga0207671_10015931 Ga0207671_100159313 156
774 3300025914 Ga0207671_10144851 Ga0207671_101448512 156
775 3300025916 Ga0207663_11037228 Ga0207663_110372282 156
776 3300025917 Ga0207660_10129345 Ga0207660_101293452 156
777 3300025917 Ga0207660_10494141 Ga0207660_104941412 156
778 3300025918 Ga0207662_10000271 Ga0207662_100002719 156
779 3300025918 Ga0207662_10008804 Ga0207662_100088044 156
780 3300025918 Ga0207662_10133430 Ga0207662_101334302 156
781 3300025918 Ga0207662_10522370 Ga0207662_105223702 156
782 3300025919 Ga0207657_10000011 Ga0207657_1000001173 156
783 3300025919 Ga0207657_10049742 Ga0207657_100497422 156
784 3300025920 Ga0207649_10008316 Ga0207649_100083164 156
785 3300025920 Ga0207649_10212744 Ga0207649_102127442 156
786 3300025921 Ga0207652_10009551 Ga0207652_100095515 156
787 3300025921 Ga0207652_10078554 Ga0207652_100785542 156
788 3300025921 Ga0207652_10147672 Ga0207652_101476724 156
789 3300025921 Ga0207652_10685177 Ga0207652_106851771 156
790 3300025921 Ga0207652_10907633 Ga0207652_109076332 156
791 3300025922 Ga0207646_10037380 Ga0207646_100373806 156
792 3300025922 Ga0207646_10107113 Ga0207646_101071132 156
793 3300025922 Ga0207646_10866942 Ga0207646_108669422 156
794 3300025922 Ga0207646_11028223 Ga0207646_110282231 156
795 3300025923 Ga0207681_10000030 Ga0207681_10000030129 156
796 3300025923 Ga0207681_10002254 Ga0207681_100022546 156
797 3300025923 Ga0207681_10040426 Ga0207681_100404262 156
798 3300025923 Ga0207681_10050455 Ga0207681_100504552 156
799 3300025923 Ga0207681_10528867 Ga0207681_105288672 156
800 3300025924 Ga0207694_10000001 Ga0207694_10000001497 156
801 3300025924 Ga0207694_10018119 Ga0207694_100181194 156
802 3300025924 Ga0207694_10706353 Ga0207694_107063532 156
803 3300025925 Ga0207650_10000082 Ga0207650_1000008217 156
804 3300025925 Ga0207650_10003671 Ga0207650_100036714 156
805 3300025925 Ga0207650_10083832 Ga0207650_100838323 156
806 3300025925 Ga0207650_10088283 Ga0207650_100882833 156
807 3300025925 Ga0207650_10286188 Ga0207650_102861882 156
808 3300025925 Ga0207650_10414501 Ga0207650_104145012 156
809 3300025925 Ga0207650_11448574 Ga0207650_114485741 156
810 3300025926 Ga0207659_10000169 Ga0207659_1000016925 156
811 3300025926 Ga0207659_10000843 Ga0207659_100008436 156
812 3300025926 Ga0207659_10003434 Ga0207659_100034347 156
813 3300025926 Ga0207659_10008702 Ga0207659_100087022 156
814 3300025926 Ga0207659_10014994 Ga0207659_100149944 156
815 3300025926 Ga0207659_10655067 Ga0207659_106550672 156
816 3300025926 Ga0207659_11000666 Ga0207659_110006662 156
817 3300025927 Ga0207687_10000005 Ga0207687_10000005438 156
818 3300025927 Ga0207687_10019566 Ga0207687_100195664 156
819 3300025927 Ga0207687_10025639 Ga0207687_100256394 156
820 3300025927 Ga0207687_10355127 Ga0207687_103551272 156
821 3300025927 Ga0207687_10454432 Ga0207687_104544322 156
822 3300025929 Ga0207664_11889263 Ga0207664_118892631 156
823 3300025931 Ga0207644_10000017 Ga0207644_10000017131 156
824 3300025931 Ga0207644_10001196 Ga0207644_1000119614 156
825 3300025931 Ga0207644_10010834 Ga0207644_100108342 156
826 3300025931 Ga0207644_10015417 Ga0207644_100154175 156
827 3300025931 Ga0207644_10278590 Ga0207644_102785902 156
828 3300025931 Ga0207644_10396069 Ga0207644_103960692 156
829 3300025931 Ga0207644_10785485 Ga0207644_107854851 156
830 3300025932 Ga0207690_10005181 Ga0207690_100051816 156
831 3300025932 Ga0207690_10155537 Ga0207690_101555372 156
832 3300025932 Ga0207690_10365538 Ga0207690_103655382 156
833 3300025933 Ga0207706_10000034 Ga0207706_1000003417 156
834 3300025933 Ga0207706_10202278 Ga0207706_102022782 156
835 3300025934 Ga0207686_10036644 Ga0207686_100366442 156
836 3300025934 Ga0207686_10289976 Ga0207686_102899762 156
837 3300025934 Ga0207686_10772179 Ga0207686_107721792 156
838 3300025934 Ga0207686_10855988 Ga0207686_108559882 156
839 3300025935 Ga0207709_10035416 Ga0207709_100354162 156
840 3300025935 Ga0207709_10349548 Ga0207709_103495482 156
841 3300025936 Ga0207670_10001213 Ga0207670_1000121313 156
842 3300025936 Ga0207670_10014044 Ga0207670_100140444 156
843 3300025936 Ga0207670_10055322 Ga0207670_100553222 156
844 3300025936 Ga0207670_10465613 Ga0207670_104656132 156
845 3300025937 Ga0207669_10003369 Ga0207669_100033694 156
846 3300025937 Ga0207669_10029450 Ga0207669_100294502 156
847 3300025937 Ga0207669_10468273 Ga0207669_104682732 156
848 3300025937 Ga0207669_10878782 Ga0207669_108787822 156
849 3300025938 Ga0207704_10001582 Ga0207704_100015827 156
850 3300025938 Ga0207704_10309810 Ga0207704_103098102 156
851 3300025938 Ga0207704_11339769 Ga0207704_113397692 156
852 3300025939 Ga0207665_10124947 Ga0207665_101249472 156
853 3300025939 Ga0207665_10507278 Ga0207665_105072782 156
854 3300025940 Ga0207691_10002377 Ga0207691_1000237716 156
855 3300025940 Ga0207691_10019115 Ga0207691_100191152 156
856 3300025940 Ga0207691_10028502 Ga0207691_100285027 156
857 3300025940 Ga0207691_10065795 Ga0207691_100657952 156
858 3300025940 Ga0207691_10130939 Ga0207691_101309394 156
859 3300025940 Ga0207691_10146662 Ga0207691_101466623 156
860 3300025940 Ga0207691_10535902 Ga0207691_105359022 156
861 3300025941 Ga0207711_10002481 Ga0207711_1000248112 156
862 3300025941 Ga0207711_10003920 Ga0207711_100039203 156
863 3300025941 Ga0207711_10011639 Ga0207711_100116392 156
864 3300025941 Ga0207711_10022799 Ga0207711_100227994 156
865 3300025941 Ga0207711_10451419 Ga0207711_104514192 156
866 3300025941 Ga0207711_11264963 Ga0207711_112649632 156
867 3300025942 Ga0207689_10000641 Ga0207689_1000064117 156
868 3300025942 Ga0207689_10042822 Ga0207689_100428222 156
869 3300025942 Ga0207689_10437590 Ga0207689_104375902 156
870 3300025942 Ga0207689_10455115 Ga0207689_104551152 156
871 3300025944 Ga0207661_10000006 Ga0207661_10000006470 156
872 3300025944 Ga0207661_10019215 Ga0207661_100192155 156
873 3300025944 Ga0207661_11230030 Ga0207661_112300301 156
874 3300025945 Ga0207679_10000559 Ga0207679_1000055913 156
875 3300025945 Ga0207679_10007400 Ga0207679_100074004 156
876 3300025945 Ga0207679_10025854 Ga0207679_100258543 156
877 3300025945 Ga0207679_10496921 Ga0207679_104969212 156
878 3300025945 Ga0207679_10506541 Ga0207679_105065412 156
879 3300025949 Ga0207667_10044132 Ga0207667_100441324 156
880 3300025949 Ga0207667_11068780 Ga0207667_110687801 156
881 3300025949 Ga0207667_11476237 Ga0207667_114762371 156
882 3300025960 Ga0207651_10000455 Ga0207651_100004555 156
883 3300025960 Ga0207651_10005338 Ga0207651_100053382 156
884 3300025960 Ga0207651_10479816 Ga0207651_104798161 156
885 3300025960 Ga0207651_11063499 Ga0207651_110634991 156
886 3300025961 Ga0207712_10004830 Ga0207712_100048303 156
887 3300025961 Ga0207712_10307697 Ga0207712_103076973 156
888 3300025961 Ga0207712_10426834 Ga0207712_104268341 156
889 3300025961 Ga0207712_10846409 Ga0207712_108464092 156
890 3300025961 Ga0207712_10899409 Ga0207712_108994091 156
891 3300025972 Ga0207668_10000058 Ga0207668_1000005813 156
892 3300025972 Ga0207668_10000402 Ga0207668_1000040233 156
893 3300025972 Ga0207668_10001084 Ga0207668_100010845 156
894 3300025972 Ga0207668_10713656 Ga0207668_107136562 156
895 3300025972 Ga0207668_11790493 Ga0207668_117904931 156
896 3300025981 Ga0207640_10001483 Ga0207640_100014832 156
897 3300025981 Ga0207640_10518093 Ga0207640_105180932 156
898 3300025986 Ga0207658_10000023 Ga0207658_1000002380 156
899 3300025986 Ga0207658_10006186 Ga0207658_100061866 156
900 3300025986 Ga0207658_10015862 Ga0207658_100158625 156
901 3300025986 Ga0207658_10056354 Ga0207658_100563543 156
902 3300025986 Ga0207658_10272420 Ga0207658_102724202 156
903 3300025986 Ga0207658_10390448 Ga0207658_103904482 156
904 3300026023 Ga0207677_10000101 Ga0207677_1000010178 156
905 3300026023 Ga0207677_10000141 Ga0207677_1000014160 156
906 3300026023 Ga0207677_10000597 Ga0207677_1000059710 156
907 3300026023 Ga0207677_10013756 Ga0207677_100137563 156
908 3300026023 Ga0207677_11367572 Ga0207677_113675722 156
909 3300026035 Ga0207703_10000646 Ga0207703_1000064614 156
910 3300026035 Ga0207703_10003772 Ga0207703_100037728 156
911 3300026035 Ga0207703_10011288 Ga0207703_100112884 156
912 3300026035 Ga0207703_10025509 Ga0207703_100255093 156
913 3300026035 Ga0207703_10036709 Ga0207703_100367092 156
914 3300026035 Ga0207703_10152213 Ga0207703_101522132 156
915 3300026035 Ga0207703_10297900 Ga0207703_102979002 156
916 3300026035 Ga0207703_10637144 Ga0207703_106371442 156
917 3300026041 Ga0207639_10012024 Ga0207639_100120245 156
918 3300026041 Ga0207639_10212479 Ga0207639_102124792 156
919 3300026067 Ga0207678_10000382 Ga0207678_1000038231 156
920 3300026067 Ga0207678_10473580 Ga0207678_104735802 156
921 3300026075 Ga0207708_10019083 Ga0207708_100190835 156
922 3300026075 Ga0207708_10107478 Ga0207708_101074782 156
923 3300026075 Ga0207708_10454848 Ga0207708_104548482 156
924 3300026078 Ga0207702_10003061 Ga0207702_1000306112 156
925 3300026078 Ga0207702_11129708 Ga0207702_111297081 156
926 3300026088 Ga0207641_10000119 Ga0207641_1000011938 156
927 3300026088 Ga0207641_10000293 Ga0207641_1000029321 156
928 3300026088 Ga0207641_10002454 Ga0207641_100024542 156
929 3300026088 Ga0207641_10002919 Ga0207641_100029199 156
930 3300026088 Ga0207641_10278913 Ga0207641_102789131 156
931 3300026088 Ga0207641_10373131 Ga0207641_103731312 156
932 3300026088 Ga0207641_10507609 Ga0207641_105076093 156
933 3300026089 Ga0207648_10000117 Ga0207648_1000011774 156
934 3300026089 Ga0207648_10335963 Ga0207648_103359632 156
935 3300026089 Ga0207648_10652183 Ga0207648_106521832 156
936 3300026095 Ga0207676_10000023 Ga0207676_10000023185 156
937 3300026095 Ga0207676_10001632 Ga0207676_100016324 156
938 3300026095 Ga0207676_10007495 Ga0207676_100074953 156
939 3300026095 Ga0207676_10014815 Ga0207676_100148153 156
940 3300026095 Ga0207676_10047880 Ga0207676_100478805 156
941 3300026095 Ga0207676_10171181 Ga0207676_101711812 156
942 3300026095 Ga0207676_10188717 Ga0207676_101887173 156
943 3300026116 Ga0207674_10001256 Ga0207674_1000125615 156
944 3300026116 Ga0207674_10097350 Ga0207674_100973503 156
945 3300026116 Ga0207674_10133067 Ga0207674_101330672 156
946 3300026116 Ga0207674_10405949 Ga0207674_104059492 156
947 3300026116 Ga0207674_10451737 Ga0207674_104517371 156
948 3300026116 Ga0207674_11191987 Ga0207674_111919871 156
949 3300026118 Ga0207675_100000221 Ga0207675_10000022140 156
950 3300026118 Ga0207675_100000748 Ga0207675_10000074814 156
951 3300026118 Ga0207675_100379760 Ga0207675_1003797602 156
952 3300026118 Ga0207675_100539314 Ga0207675_1005393142 156
953 3300026121 Ga0207683_10000052 Ga0207683_1000005270 156
954 3300026121 Ga0207683_10001846 Ga0207683_1000184628 156
955 3300026121 Ga0207683_10157782 Ga0207683_101577822 156
956 3300026121 Ga0207683_10386835 Ga0207683_103868352 156
957 3300026121 Ga0207683_10821957 Ga0207683_108219572 156
958 3300026142 Ga0207698_10001612 Ga0207698_100016127 156
959 3300026142 Ga0207698_11071165 Ga0207698_110711651 156
960 3300027671 Ga0209588_1000034 Ga0209588_100003457 156
961 3300027671 Ga0209588_1034864 Ga0209588_10348643 156
962 3300027866 Ga0209813_10019110 Ga0209813_100191102 156
963 3300027907 Ga0207428_10000030 Ga0207428_1000003046 156
964 3300027907 Ga0207428_10015732 Ga0207428_100157326 156
965 3300027907 Ga0207428_10112819 Ga0207428_101128192 156
966 3300027907 Ga0207428_10345276 Ga0207428_103452762 156
967 3300028379 Ga0268266_10003323 Ga0268266_100033232 156
968 3300028379 Ga0268266_10209431 Ga0268266_102094311 156
969 3300028379 Ga0268266_10251851 Ga0268266_102518512 156
970 3300028380 Ga0268265_10000074 Ga0268265_1000007446 156
971 3300028380 Ga0268265_10001297 Ga0268265_1000129714 156
972 3300028380 Ga0268265_10083495 Ga0268265_100834951 156
973 3300028380 Ga0268265_10289007 Ga0268265_102890071 156
974 3300028380 Ga0268265_10730524 Ga0268265_107305241 156
975 3300028381 Ga0268264_10000215 Ga0268264_1000021566 156
976 3300028381 Ga0268264_10001288 Ga0268264_100012883 156
977 3300028381 Ga0268264_10001574 Ga0268264_100015747 156
978 3300028381 Ga0268264_10005869 Ga0268264_100058698 156
979 3300028381 Ga0268264_10028969 Ga0268264_100289695 156
980 3300028381 Ga0268264_10042912 Ga0268264_100429124 156
981 3300028381 Ga0268264_11113467 Ga0268264_111134671 156
982 3300028381 Ga0268264_11698265 Ga0268264_116982651 156
983 3300028573 Ga0265334_10094472 Ga0265334_100944721 156
984 3300028573 Ga0265334_10117342 Ga0265334_101173421 156
985 3300028577 Ga0265318_10001354 Ga0265318_1000135426 156
986 3300028794 Ga0307515_10456415 Ga0307515_104564152 156
987 3300028800 Ga0265338_10086311 Ga0265338_100863112 156
988 3300028800 Ga0265338_10156521 Ga0265338_101565212 156
989 3300029277 Ga0311001_1065531 Ga0311001_10655312 156
990 3300029285 Ga0310981_1062149 Ga0310981_10621492 156
991 3300030521 Ga0307511_10035882 Ga0307511_100358824 156
992 3300031235 Ga0265330_10012809 Ga0265330_100128092 156
993 3300031238 Ga0265332_10322798 Ga0265332_103227982 156
994 3300031239 Ga0265328_10079426 Ga0265328_100794262 156
995 3300031240 Ga0265320_10035011 Ga0265320_100350113 156
996 3300031241 Ga0265325_10021301 Ga0265325_100213013 156
997 3300031241 Ga0265325_10060212 Ga0265325_100602123 156
998 3300031247 Ga0265340_10024603 Ga0265340_100246032 156
999 3300031247 Ga0265340_10068202 Ga0265340_100682023 156
1000 3300031249 Ga0265339_10006973 Ga0265339_100069736 156
1001 3300031249 Ga0265339_10028147 Ga0265339_100281472 156
1002 3300031344 Ga0265316_10020371 Ga0265316_100203717 156
1003 3300031344 Ga0265316_10131015 Ga0265316_101310152 156
1004 3300031344 Ga0265316_10331934 Ga0265316_103319341 156
1005 3300031548 Ga0307408_100475168 Ga0307408_1004751682 156
1006 3300031548 Ga0307408_100637780 Ga0307408_1006377802 156
1007 3300031548 Ga0307408_101306425 Ga0307408_1013064252 156
1008 3300031595 Ga0265313_10011254 Ga0265313_100112542 156
1009 3300031595 Ga0265313_10039145 Ga0265313_100391453 156
1010 3300031616 Ga0307508_10056336 Ga0307508_100563363 156
1011 3300031691 Ga0316579_10033296 Ga0316579_100332962 156
1012 3300031711 Ga0265314_10049655 Ga0265314_100496553 156
1013 3300031711 Ga0265314_10087198 Ga0265314_100871982 156
1014 3300031712 Ga0265342_10000677 Ga0265342_1000067745 156
1015 3300031712 Ga0265342_10003703 Ga0265342_100037035 156
1016 3300031731 Ga0307405_11103554 Ga0307405_111035542 156
1017 3300031731 Ga0307405_11583799 Ga0307405_115837992 156
1018 3300031824 Ga0307413_10854422 Ga0307413_108544221 156
1019 3300031901 Ga0307406_11012386 Ga0307406_110123861 156
1020 3300031911 Ga0307412_11478717 Ga0307412_114787171 156
1021 3300031911 Ga0307412_11916637 Ga0307412_119166371 156
1022 3300031995 Ga0307409_100438146 Ga0307409_1004381462 156
1023 3300032168 Ga0316593_10009085 Ga0316593_100090852 156
1024 3300033180 Ga0307510_10255491 Ga0307510_102554912 156
1025 3300034816 Ga0373930_0060566 Ga0373930_0060566_308_778 156
1026 3300035086 Ga0373934_0127623 Ga0373934_0127623_236_706 156
1027 3300035091 Ga0373951_0130114 Ga0373951_0130114_118_588 156
1028 3300035111 Ga0373923_0157419 Ga0373923_0157419_48_518 156
1029 3300035114 Ga0373939_0055304 Ga0373939_0055304_355_825 156
1030 3300035115 Ga0373941_0012714 Ga0373941_0012714_373_843 156
1031 3300035115 Ga0373941_0242102 Ga0373941_0242102_132_602 156
1032 3300035117 Ga0373953_0026669 Ga0373953_0026669_921_1391 156
1033 3300035118 Ga0373954_0087403 Ga0373954_0087403_675_1145 156
1034 3300035118 Ga0373954_0197171 Ga0373954_0197171_123_593 156
1035 3300035119 Ga0373956_0323722 Ga0373956_0323722_127_615 156
1036 3300035171 Ga0373946_0249273 Ga0373946_0249273_22_492 156
1037 3300035171 Ga0373946_0530438 Ga0373946_0530438_90_560 156
1038 3300035171 Ga0373946_0609317 Ga0373946_0609317_30_500 156
1039 3300035172 Ga0373955_0339445 Ga0373955_0339445_52_522 156
1040 3300035207 Ga0373942_0132723 Ga0373942_0132723_143_613 156
1041 3300035241 Ga0373961_0006112 Ga0373961_0006112_1075_1545 156
1042 3300035241 Ga0373961_0081113 Ga0373961_0081113_396_866 156
1043 3300035242 Ga0373962_0117210 Ga0373962_0117210_147_617 156
1044 3300035398 Ga0316574_0111493 Ga0316574_0111493_667_1137 156
1045 3300035691 Ga0373931_0108446 Ga0373931_0108446_59_529 156
1046 3300035691 Ga0373931_0469816 Ga0373931_0469816_77_547 156
1047 3300035691 Ga0373931_0563852 Ga0373931_0563852_100_570 156
1048 3300035692 Ga0373935_0324241 Ga0373935_0324241_608_1078 156
1049 3300035724 Ga0373933_0266107 Ga0373933_0266107_85_555 156
1050 3300035725 Ga0373947_0175682 Ga0373947_0175682_143_613 156
1051 3300035725 Ga0373947_0204773 Ga0373947_0204773_645_1115 156
1052 3300036401 Ga0373937_0078196 Ga0373937_0078196_1530_2000 156
1053 3300036401 Ga0373937_0123566 Ga0373937_0123566_1772_2242 156
1054 3300036401 Ga0373937_0875140 Ga0373937_0875140_85_555 156
1055 3300036647 Ga0316582_0281182 Ga0316582_0281182_233_703 156
1056 3300037068 Ga0373925_0263373 Ga0373925_0263373_825_1295 156
1057 3300037068 Ga0373925_0955722 Ga0373925_0955722_167_637 156
1058 3300037312 Ga0395899_0242304 Ga0395899_0242304_620_1090 156
1059 3300037312 Ga0395899_0269986 Ga0395899_0269986_135_605 156
1060 3300037418 Ga0395900_0112357 Ga0395900_0112357_2192_2662 156
1061 3300037418 Ga0395900_0137697 Ga0395900_0137697_136_606 156
1062 3300037418 Ga0395900_0273577 Ga0395900_0273577_870_1340 156
1063 3300037466 Ga0395898_0118813 Ga0395898_0118813_1555_2025 156
1064 3300037466 Ga0395898_0161600 Ga0395898_0161600_1107_1577 156
1065 3300037466 Ga0395898_0715060 Ga0395898_0715060_69_539 156
1066 3300037466 Ga0395898_1201500 Ga0395898_1201500_176_646 156
1067 3300037471 Ga0395905_0953119 Ga0395905_0953119_198_668 156
1068 3300037853 Ga0436364_0088257 Ga0436364_0088257_52_522 156
1069 3300037853 Ga0436364_0947734 Ga0436364_0947734_141_611 156
1070 3300038443 Ga0395901_0077174 Ga0395901_0077174_1482_1952 156
1071 3300038443 Ga0395901_0093453 Ga0395901_0093453_1107_1577 156
1072 3300039437 Ga0436365_0179814 Ga0436365_0179814_68_538 156
1073 3300039437 Ga0436365_0197039 Ga0436365_0197039_4070_4540 156
1074 3300039437 Ga0436365_1510825 Ga0436365_1510825_45_515 156
1075 3300039438 Ga0436360_1030095 Ga0436360_1030095_410_880 156
1076 3300039450 Ga0436363_1487013 Ga0436363_1487013_457_927 156
1077 3300039450 Ga0436363_1554023 Ga0436363_1554023_689_1159 156
1078 3300039450 Ga0436363_1709560 Ga0436363_1709560_465_953 156
1079 3300039453 Ga0436362_0549823 Ga0436362_0549823_29_499 156
1080 3300039453 Ga0436362_0795304 Ga0436362_0795304_546_1016 156
1081 3300039453 Ga0436362_1063276 Ga0436362_1063276_2362_2832 156
1082 3300041458 Ga0451798_0719119 Ga0451798_0719119_153_623 156
1083 3300041511 Ga0451855_1960161 Ga0451855_1960161_295_765 156
1084 3300042012 Ga0439455_0002430 Ga0439455_0002430_1750_2220 156
1085 3300042125 Ga0450923_138805 Ga0450923_138805_59_529 156
1086 3300042137 Ga0450902_061543 Ga0450902_061543_68_538 156
1087 3300042435 Ga0439434_0010819 Ga0439434_0010819_1166_1636 156
1088 3300042438 Ga0439459_0102457 Ga0439459_0102457_210_680 156
1089 3300042439 Ga0439464_0103232 Ga0439464_0103232_204_674 156
1090 3300042461 Ga0439460_0015566 Ga0439460_0015566_90_560 156
1091 3300042876 Ga0451577_0011021 Ga0451577_0011021_344_814 156
1092 3300042876 Ga0451577_0049881 Ga0451577_0049881_1938_2408 156
1093 3300042876 Ga0451577_0071974 Ga0451577_0071974_902_1372 156
1094 3300042876 Ga0451577_0174276 Ga0451577_0174276_431_901 156
1095 3300042876 Ga0451577_0197157 Ga0451577_0197157_85_555 156
1096 3300044658 Ga0466972_0051802 Ga0466972_0051802_1404_1892 156
1097 3300044658 Ga0466972_0065614 Ga0466972_0065614_28_498 156
1098 3300044673 Ga0453683_0001246 Ga0453683_0001246_2746_3216 156
1099 3300044673 Ga0453683_0007125 Ga0453683_0007125_522_992 156
1100 3300044673 Ga0453683_0007146 Ga0453683_0007146_6619_7089 156
1101 3300044673 Ga0453683_0015865 Ga0453683_0015865_1948_2418 156
1102 3300044673 Ga0453683_0026252 Ga0453683_0026252_506_976 156
1103 3300044694 Ga0466963_0030514 Ga0466963_0030514_864_1334 156
1104 3300044712 Ga0453684_0007935 Ga0453684_0007935_10961_11431 156
1105 3300044712 Ga0453684_0018536 Ga0453684_0018536_7749_8219 156
1106 3300044842 Ga0466957_0094687 Ga0466957_0094687_1111_1581 156
1107 3300044842 Ga0466957_0558926 Ga0466957_0558926_52_522 156
1108 3300044842 Ga0466957_0920102 Ga0466957_0920102_104_574 156
1109 3300045051 Ga0451576_0000111 Ga0451576_0000111_206919_207389 156
1110 3300045051 Ga0451576_0004454 Ga0451576_0004454_506_976 156
1111 3300045051 Ga0451576_0046783 Ga0451576_0046783_1434_1904 156
1112 3300045051 Ga0451576_0175522 Ga0451576_0175522_1237_1707 156
1113 3300045051 Ga0451576_0544333 Ga0451576_0544333_298_768 156
1114 3300045051 Ga0451576_0745148 Ga0451576_0745148_172_642 156
1115 3300045051 Ga0451576_1144712 Ga0451576_1144712_148_621 156
1116 3300045976 Ga0466967_0025273 Ga0466967_0025273_862_1332 156
1117 3300045976 Ga0466967_0722947 Ga0466967_0722947_193_681 156
1118 3300045976 Ga0466967_0770455 Ga0466967_0770455_365_835 156
1119 3300046454 Ga0495592_0036142 Ga0495592_0036142_1954_2424 156
1120 3300046454 Ga0495592_0118607 Ga0495592_0118607_366_854 156
1121 3300046459 Ga0495629_0072313 Ga0495629_0072313_162_632 156
1122 3300046462 Ga0495651_0191065 Ga0495651_0191065_329_817 156
1123 3300046462 Ga0495651_0650703 Ga0495651_0650703_59_529 156
1124 3300046471 Ga0495650_0003288 Ga0495650_0003288_1965_2435 156
1125 3300046472 Ga0495580_0082266 Ga0495580_0082266_1681_2151 156
1126 3300046472 Ga0495580_0107955 Ga0495580_0107955_347_817 156
1127 3300046472 Ga0495580_0395404 Ga0495580_0395404_211_681 156
1128 3300046472 Ga0495580_0813812 Ga0495580_0813812_82_552 156
1129 3300046474 Ga0495605_0058483 Ga0495605_0058483_165_635 156
1130 3300046476 Ga0495662_0066154 Ga0495662_0066154_787_1257 156
1131 3300046477 Ga0495664_0035203 Ga0495664_0035203_1525_1995 156
1132 3300046511 Ga0495608_0010700 Ga0495608_0010700_862_1332 156
1133 3300046511 Ga0495608_0403862 Ga0495608_0403862_34_522 156
1134 3300046514 Ga0495618_0104683 Ga0495618_0104683_1269_1739 156
1135 3300046514 Ga0495618_0207056 Ga0495618_0207056_688_1158 156
1136 3300046516 Ga0495628_0320942 Ga0495628_0320942_99_587 156
1137 3300046516 Ga0495628_1082799 Ga0495628_1082799_16_504 156
1138 3300046517 Ga0495630_0291352 Ga0495630_0291352_512_982 156
1139 3300046518 Ga0495631_0381839 Ga0495631_0381839_117_587 156
1140 3300046528 Ga0495642_0226844 Ga0495642_0226844_247_717 156
1141 3300046530 Ga0495654_0163918 Ga0495654_0163918_156_626 156
1142 3300046535 Ga0495586_0097597 Ga0495586_0097597_1040_1510 156
1143 3300046535 Ga0495586_0360711 Ga0495586_0360711_273_743 156
1144 3300046536 Ga0495587_0272272 Ga0495587_0272272_358_846 156
1145 3300046537 Ga0495598_0023404 Ga0495598_0023404_351_821 156
1146 3300046537 Ga0495598_0075735 Ga0495598_0075735_531_1001 156
1147 3300046537 Ga0495598_0170017 Ga0495598_0170017_204_674 156
1148 3300046539 Ga0495621_0008145 Ga0495621_0008145_1277_1747 156
1149 3300046539 Ga0495621_0342253 Ga0495621_0342253_117_587 156
1150 3300046557 Ga0495622_0056063 Ga0495622_0056063_1310_1780 156
1151 3300046559 Ga0495667_0019223 Ga0495667_0019223_2412_2882 156
1152 3300046559 Ga0495667_0275771 Ga0495667_0275771_186_674 156
1153 3300046615 Ga0495656_0032177 Ga0495656_0032177_1369_1839 156
1154 3300046615 Ga0495656_0129108 Ga0495656_0129108_467_937 156
1155 3300046615 Ga0495656_0262518 Ga0495656_0262518_343_813 156
1156 3300046642 Ga0495634_0073151 Ga0495634_0073151_998_1468 156
1157 3300046660 Ga0495625_0118368 Ga0495625_0118368_1095_1565 156
1158 3300046660 Ga0495625_0524427 Ga0495625_0524427_114_584 156
1159 3300046663 Ga0495635_0397037 Ga0495635_0397037_267_755 156
1160 3300046674 Ga0495588_0169117 Ga0495588_0169117_238_708 156
1161 3300046675 Ga0495657_0003663 Ga0495657_0003663_9433_9903 156
1162 3300046678 Ga0495599_0066457 Ga0495599_0066457_1182_1652 156
1163 3300046678 Ga0495599_0436628 Ga0495599_0436628_266_736 156
1164 3300046679 Ga0495623_0357100 Ga0495623_0357100_11_499 156
1165 3300046680 Ga0495646_0300812 Ga0495646_0300812_337_807 156
1166 3300046681 Ga0495647_0052339 Ga0495647_0052339_1100_1570 156
1167 3300046683 Ga0495658_0007992 Ga0495658_0007992_4262_4732 156
1168 3300046683 Ga0495658_0078984 Ga0495658_0078984_78_548 156
1169 3300046683 Ga0495658_0170796 Ga0495658_0170796_745_1215 156
1170 3300046683 Ga0495658_0213147 Ga0495658_0213147_83_553 156
1171 3300046689 Ga0495613_0077777 Ga0495613_0077777_1792_2262 156
1172 3300046689 Ga0495613_0191613 Ga0495613_0191613_785_1273 156
1173 3300046692 Ga0495671_0216584 Ga0495671_0216584_295_765 156
1174 3300047317 Ga0495604_0092906 Ga0495604_0092906_1550_2038 156
1175 3300047318 Ga0495636_0008939 Ga0495636_0008939_1722_2192 156
1176 3300047318 Ga0495636_0121635 Ga0495636_0121635_46_516 156
1177 3300047318 Ga0495636_0142961 Ga0495636_0142961_376_846 156
1178 3300047319 Ga0495674_0045230 Ga0495674_0045230_1196_1666 156
1179 3300047319 Ga0495674_1075686 Ga0495674_1075686_24_494 156
1180 3300047319 Ga0495674_1129582 Ga0495674_1129582_88_558 156
1181 3300047320 Ga0495672_0048433 Ga0495672_0048433_1610_2080 156
1182 3300047322 Ga0495680_0485530 Ga0495680_0485530_57_527 156
1183 3300047444 Ga0495675_0147189 Ga0495675_0147189_478_966 156
1184 3300047447 Ga0495685_024682 Ga0495685_024682_1016_1486 156
1185 3300047447 Ga0495685_145644 Ga0495685_145644_172_642 156
1186 3300047471 Ga0495684_0049455 Ga0495684_0049455_1189_1659 156
1187 3300047471 Ga0495684_0204759 Ga0495684_0204759_906_1376 156
1188 3300048088 Ga0495602_0065592 Ga0495602_0065592_2593_3081 156
1189 3300048090 Ga0495615_0001222 Ga0495615_0001222_2209_2679 156
1190 3300048090 Ga0495615_0137478 Ga0495615_0137478_217_687 156
1191 3300048903 Ga0496100_0267809 Ga0496100_0267809_539_1009 156
1192 3300048903 Ga0496100_0416605 Ga0496100_0416605_382_852 156
1193 3300048904 Ga0496101_0485761 Ga0496101_0485761_349_819 156
1194 3300048905 Ga0496102_0026473 Ga0496102_0026473_2193_2663 156
1195 3300048906 Ga0496103_0070047 Ga0496103_0070047_899_1369 156
1196 3300048907 Ga0496104_0064959 Ga0496104_0064959_444_914 156
1197 3300048907 Ga0496104_0449561 Ga0496104_0449561_716_1186 156
1198 3300048907 Ga0496104_0811981 Ga0496104_0811981_350_820 156
1199 3300048908 Ga0496105_0915270 Ga0496105_0915270_176_646 156
1200 3300048909 Ga0496106_0051437 Ga0496106_0051437_2359_2829 156
1201 3300048909 Ga0496106_0118271 Ga0496106_0118271_952_1422 156
1202 3300048911 Ga0496108_0047479 Ga0496108_0047479_754_1224 156
1203 3300048911 Ga0496108_0676423 Ga0496108_0676423_374_844 156
1204 3300048912 Ga0496109_0048256 Ga0496109_0048256_2341_2811 156
1205 3300048912 Ga0496109_0570939 Ga0496109_0570939_478_948 156
1206 3300048915 Ga0496112_0001881 Ga0496112_0001881_12066_12536 156
1207 3300048915 Ga0496112_0046095 Ga0496112_0046095_2128_2616 156
1208 3300048915 Ga0496112_0449655 Ga0496112_0449655_109_579 156
1209 3300048915 Ga0496112_0465343 Ga0496112_0465343_171_659 156
1210 3300048915 Ga0496112_1500049 Ga0496112_1500049_91_561 156
1211 3300048916 Ga0496113_0047258 Ga0496113_0047258_417_887 156
1212 3300048917 Ga0496114_0188257 Ga0496114_0188257_558_1028 156
1213 3300048917 Ga0496114_0521036 Ga0496114_0521036_184_654 156
1214 3300048918 Ga0496115_0319671 Ga0496115_0319671_440_910 156
1215 3300048918 Ga0496115_0526063 Ga0496115_0526063_287_757 156
1216 3300048920 Ga0496117_0090809 Ga0496117_0090809_1244_1714 156
1217 3300048921 Ga0496118_0139113 Ga0496118_0139113_368_838 156
1218 3300048924 Ga0496121_0129576 Ga0496121_0129576_1385_1855 156
1219 3300048927 Ga0496124_0242913 Ga0496124_0242913_412_882 156
1220 3300048929 Ga0496126_0304812 Ga0496126_0304812_164_634 156
1221 3300049568 Ga0501031_0152935 Ga0501031_0152935_188_658 156
1222 3300049568 Ga0501031_0153796 Ga0501031_0153796_416_886 156
1223 3300049569 Ga0501032_0274872 Ga0501032_0274872_109_579 156
1224 3300049569 Ga0501032_0320325 Ga0501032_0320325_357_827 156
1225 3300049569 Ga0501032_0379967 Ga0501032_0379967_169_639 156
1226 3300049570 Ga0501033_0016169 Ga0501033_0016169_575_1045 156
1227 3300049571 Ga0501034_0609764 Ga0501034_0609764_249_719 156
1228 3300049571 Ga0501034_0734737 Ga0501034_0734737_183_653 156
1229 3300049572 Ga0501036_0065956 Ga0501036_0065956_2556_3026 156
1230 3300049572 Ga0501036_1037048 Ga0501036_1037048_30_500 156
1231 3300049573 Ga0501037_0412319 Ga0501037_0412319_41_511 156
1232 3300049573 Ga0501037_0459168 Ga0501037_0459168_151_621 156
1233 3300049574 Ga0501038_0229312 Ga0501038_0229312_10_480 156
1234 3300049574 Ga0501038_0242797 Ga0501038_0242797_451_921 156
1235 3300049574 Ga0501038_0644696 Ga0501038_0644696_99_569 156
1236 3300049575 Ga0501039_0217604 Ga0501039_0217604_813_1283 156
1237 3300049575 Ga0501039_0243510 Ga0501039_0243510_930_1400 156
1238 3300049575 Ga0501039_0373946 Ga0501039_0373946_407_877 156
1239 3300049576 Ga0501040_0137947 Ga0501040_0137947_520_990 156
1240 3300049576 Ga0501040_0234445 Ga0501040_0234445_562_1032 156
1241 3300049576 Ga0501040_0501718 Ga0501040_0501718_302_772 156
1242 3300049577 Ga0501041_0030975 Ga0501041_0030975_627_1097 156
1243 3300049577 Ga0501041_0614632 Ga0501041_0614632_206_676 156
1244 3300049578 Ga0501042_0114816 Ga0501042_0114816_1051_1521 156
1245 3300049578 Ga0501042_0487907 Ga0501042_0487907_307_777 156
1246 3300049579 Ga0501043_0223695 Ga0501043_0223695_479_949 156
1247 3300049579 Ga0501043_0715987 Ga0501043_0715987_91_561 156
1248 3300049579 Ga0501043_0757533 Ga0501043_0757533_192_662 156
1249 3300049580 Ga0501046_0050901 Ga0501046_0050901_301_771 156
1250 3300049580 Ga0501046_0806479 Ga0501046_0806479_101_571 156
1251 3300049581 Ga0501047_0003663 Ga0501047_0003663_2243_2713 156
1252 3300049581 Ga0501047_0083044 Ga0501047_0083044_61_531 156
1253 3300049581 Ga0501047_0110366 Ga0501047_0110366_2150_2620 156
1254 3300049581 Ga0501047_0220847 Ga0501047_0220847_208_678 156
1255 3300049581 Ga0501047_0727284 Ga0501047_0727284_167_637 156
1256 3300049582 Ga0501048_0029347 Ga0501048_0029347_643_1113 156
1257 3300049582 Ga0501048_0278568 Ga0501048_0278568_161_631 156
1258 3300049583 Ga0501067_0142140 Ga0501067_0142140_209_679 156
1259 3300049585 Ga0501069_0770629 Ga0501069_0770629_35_505 156
1260 3300049587 Ga0501071_0216397 Ga0501071_0216397_479_949 156
1261 3300049587 Ga0501071_0271111 Ga0501071_0271111_113_583 156
1262 3300049587 Ga0501071_0473090 Ga0501071_0473090_233_703 156
1263 3300049588 Ga0501072_0072540 Ga0501072_0072540_491_961 156
1264 3300049588 Ga0501072_0170249 Ga0501072_0170249_1099_1569 156
1265 3300049589 Ga0501073_0339821 Ga0501073_0339821_510_980 156
1266 3300049589 Ga0501073_0483357 Ga0501073_0483357_198_668 156
1267 3300049589 Ga0501073_0564823 Ga0501073_0564823_156_626 156
1268 3300049589 Ga0501073_0783609 Ga0501073_0783609_64_534 156
1269 3300049590 Ga0501074_0165656 Ga0501074_0165656_1054_1524 156
1270 3300049590 Ga0501074_0299453 Ga0501074_0299453_79_549 156
1271 3300049590 Ga0501074_0494273 Ga0501074_0494273_134_604 156
1272 3300049590 Ga0501074_0918862 Ga0501074_0918862_133_603 156
1273 3300049591 Ga0501075_0019376 Ga0501075_0019376_3260_3730 156
1274 3300049591 Ga0501075_0807827 Ga0501075_0807827_233_703 156
1275 3300049592 Ga0501076_0034438 Ga0501076_0034438_1062_1532 156
1276 3300049593 Ga0501077_0165530 Ga0501077_0165530_221_691 156
1277 3300049593 Ga0501077_0289589 Ga0501077_0289589_538_1008 156
1278 3300049593 Ga0501077_0403661 Ga0501077_0403661_228_698 156
1279 3300049593 Ga0501077_0442928 Ga0501077_0442928_224_694 156
1280 3300049593 Ga0501077_0552859 Ga0501077_0552859_152_622 156
1281 3300049671 Ga0501238_006454 Ga0501238_006454_435_905 156
1282 3300049741 Ga0501079_0206220 Ga0501079_0206220_876_1346 156
1283 3300049741 Ga0501079_0373683 Ga0501079_0373683_232_702 156
1284 3300049742 Ga0501080_0002922 Ga0501080_0002922_5373_5843 156
1285 3300049742 Ga0501080_0005645 Ga0501080_0005645_469_939 156
1286 3300049742 Ga0501080_0079724 Ga0501080_0079724_2205_2675 156
1287 3300049742 Ga0501080_0243872 Ga0501080_0243872_290_760 156
1288 3300049742 Ga0501080_0821172 Ga0501080_0821172_176_646 156
1289 3300049743 Ga0501081_0188157 Ga0501081_0188157_371_841 156
1290 3300049743 Ga0501081_0328053 Ga0501081_0328053_47_517 156
1291 3300049743 Ga0501081_0369036 Ga0501081_0369036_199_669 156
1292 3300049743 Ga0501081_0733143 Ga0501081_0733143_156_626 156
1293 3300049743 Ga0501081_0817036 Ga0501081_0817036_188_658 156
1294 3300049744 Ga0501083_0004955 Ga0501083_0004955_4443_4913 156
1295 3300049744 Ga0501083_0555067 Ga0501083_0555067_180_650 156
1296 3300049744 Ga0501083_0599928 Ga0501083_0599928_117_587 156
1297 3300049758 Ga0501241_047777 Ga0501241_047777_269_739 156
1298 3300049766 Ga0501269_013888 Ga0501269_013888_111_581 156
1299 3300049822 Ga0501035_0000846 Ga0501035_0000846_2460_2930 156
1300 3300049822 Ga0501035_0005931 Ga0501035_0005931_8696_9166 156
1301 3300049822 Ga0501035_0339713 Ga0501035_0339713_256_726 156
1302 3300049822 Ga0501035_1044297 Ga0501035_1044297_81_551 156
1303 3300049823 Ga0501044_0083371 Ga0501044_0083371_1434_1904 156
1304 3300049824 Ga0501045_0064750 Ga0501045_0064750_654_1124 156
1305 3300049824 Ga0501045_0415852 Ga0501045_0415852_218_688 156
1306 3300049824 Ga0501045_0823222 Ga0501045_0823222_159_629 156
1307 3300050489 nmdc:mga03683_3558_c1 nmdc:mga03683_3558_c1_3081_3551 156
1308 3300050490 nmdc:mga03n38_220507_c1 nmdc:mga03n38_220507_c1_359_829 156
1309 3300050490 nmdc:mga03n38_265177_c1 nmdc:mga03n38_265177_c1_156_626 156
1310 3300050491 nmdc:mga00v17_15446_c1 nmdc:mga00v17_15446_c1_140_610 156
1311 3300050491 nmdc:mga00v17_75294_c1 nmdc:mga00v17_75294_c1_1483_1953 156
1312 3300050492 nmdc:mga0yw44_539059_c1 nmdc:mga0yw44_539059_c1_257_727 156
1313 3300050493 nmdc:mga0k408_8408_c1 nmdc:mga0k408_8408_c1_2224_2694 156
1314 3300050494 nmdc:mga06z11_336225_c1 nmdc:mga06z11_336225_c1_153_623 156
1315 3300050494 nmdc:mga06z11_42917_c1 nmdc:mga06z11_42917_c1_1529_1999 156
1316 3300050494 nmdc:mga06z11_610871_c1 nmdc:mga06z11_610871_c1_150_620 156
1317 3300050495 nmdc:mga04h51_12737_c1 nmdc:mga04h51_12737_c1_412_882 156
1318 3300050496 nmdc:mga07m45_208382_c1 nmdc:mga07m45_208382_c1_301_771 156
1319 3300050496 nmdc:mga07m45_412390_c1 nmdc:mga07m45_412390_c1_230_700 156
1320 3300050507 nmdc:mga05p37_1025701_c1 nmdc:mga05p37_1025701_c1_135_605 156
1321 3300050507 nmdc:mga05p37_1166400_c1 nmdc:mga05p37_1166400_c1_300_770 156
1322 3300050507 nmdc:mga05p37_1310291_c1 nmdc:mga05p37_1310291_c1_79_549 156
1323 3300050507 nmdc:mga05p37_133260_c1 nmdc:mga05p37_133260_c1_2319_2789 156
1324 3300050507 nmdc:mga05p37_1690684_c1 nmdc:mga05p37_1690684_c1_87_557 156
1325 3300050507 nmdc:mga05p37_449385_c1 nmdc:mga05p37_449385_c1_486_956 156
1326 3300050507 nmdc:mga05p37_672497_c1 nmdc:mga05p37_672497_c1_472_942 156
1327 3300050507 nmdc:mga05p37_75430_c1 nmdc:mga05p37_75430_c1_1455_1925 156
1328 3300050507 nmdc:mga05p37_829381_c1 nmdc:mga05p37_829381_c1_27_497 156
1329 3300050508 nmdc:mga09592_458426_c1 nmdc:mga09592_458426_c1_175_645 156
1330 3300050508 nmdc:mga09592_494399_c1 nmdc:mga09592_494399_c1_377_847 156
1331 3300050508 nmdc:mga09592_602893_c1 nmdc:mga09592_602893_c1_98_568 156
1332 3300050508 nmdc:mga09592_906705_c1 nmdc:mga09592_906705_c1_217_687 156
1333 3300050509 nmdc:mga0qj67_133188_c1 nmdc:mga0qj67_133188_c1_609_1079 156
1334 3300050510 nmdc:mga06r32_183757_c1 nmdc:mga06r32_183757_c1_324_794 156
1335 3300050510 nmdc:mga06r32_263611_c1 nmdc:mga06r32_263611_c1_302_772 156
1336 3300050510 nmdc:mga06r32_36731_c1 nmdc:mga06r32_36731_c1_102_572 156
1337 3300050510 nmdc:mga06r32_631650_c1 nmdc:mga06r32_631650_c1_329_799 156
1338 3300050511 nmdc:mga08y16_170026_c1 nmdc:mga08y16_170026_c1_307_777 156
1339 3300050511 nmdc:mga08y16_220465_c1 nmdc:mga08y16_220465_c1_868_1338 156
1340 3300050511 nmdc:mga08y16_245224_c1 nmdc:mga08y16_245224_c1_1065_1535 156
1341 3300050511 nmdc:mga08y16_24_c1 nmdc:mga08y16_24_c1_50373_50843 156
1342 3300050511 nmdc:mga08y16_253285_c1 nmdc:mga08y16_253285_c1_269_739 156
1343 3300050511 nmdc:mga08y16_51099_c1 nmdc:mga08y16_51099_c1_1602_2072 156
1344 3300050511 nmdc:mga08y16_687632_c1 nmdc:mga08y16_687632_c1_209_781 156
1345 3300050511 nmdc:mga08y16_794313_c1 nmdc:mga08y16_794313_c1_443_913 156
1346 3300050512 nmdc:mga0n895_1195010_c1 nmdc:mga0n895_1195010_c1_150_620 156
1347 3300050512 nmdc:mga0n895_187311_c1 nmdc:mga0n895_187311_c1_1212_1682 156
1348 3300050512 nmdc:mga0n895_212802_c1 nmdc:mga0n895_212802_c1_488_958 156
1349 3300050512 nmdc:mga0n895_36271_c1 nmdc:mga0n895_36271_c1_2233_2703 156
1350 3300050512 nmdc:mga0n895_4474_c1 nmdc:mga0n895_4474_c1_3592_4062 156
1351 3300050512 nmdc:mga0n895_47539_c1 nmdc:mga0n895_47539_c1_744_1214 156
1352 3300050512 nmdc:mga0n895_612349_c1 nmdc:mga0n895_612349_c1_113_583 156
1353 3300050512 nmdc:mga0n895_76676_c1 nmdc:mga0n895_76676_c1_1029_1499 156
1354 3300050513 nmdc:mga0rr50_273683_c1 nmdc:mga0rr50_273683_c1_541_1011 156
1355 3300050513 nmdc:mga0rr50_366010_c1 nmdc:mga0rr50_366010_c1_226_696 156
1356 3300050513 nmdc:mga0rr50_48478_c1 nmdc:mga0rr50_48478_c1_588_1058 156
1357 3300050513 nmdc:mga0rr50_61265_c1 nmdc:mga0rr50_61265_c1_1422_1892 156
1358 3300050513 nmdc:mga0rr50_619836_c1 nmdc:mga0rr50_619836_c1_242_712 156
1359 3300050514 nmdc:mga08x19_175948_c1 nmdc:mga08x19_175948_c1_696_1166 156
1360 3300050514 nmdc:mga08x19_72375_c1 nmdc:mga08x19_72375_c1_1700_2170 156
1361 3300050514 nmdc:mga08x19_76140_c1 nmdc:mga08x19_76140_c1_47_517 156
1362 3300050515 nmdc:mga0a205_101698_c1 nmdc:mga0a205_101698_c1_1669_2139 156
1363 3300050515 nmdc:mga0a205_17718_c1 nmdc:mga0a205_17718_c1_3063_3533 156
1364 3300050515 nmdc:mga0a205_711411_c1 nmdc:mga0a205_711411_c1_209_679 156
1365 3300050515 nmdc:mga0a205_953948_c1 nmdc:mga0a205_953948_c1_48_518 156
1366 3300050516 nmdc:mga0sz30_5881_c1 nmdc:mga0sz30_5881_c1_500_970 156
1367 3300053077 Ga0495601_0314594 Ga0495601_0314594_445_915 156
1368 3300053084 Ga0495595_0251079 Ga0495595_0251079_347_835 156
1369 3300053084 Ga0495595_0365379 Ga0495595_0365379_45_515 156
1370 3300053084 Ga0495595_0488473 Ga0495595_0488473_117_587 156
1371 3300053085 Ga0495619_0162694 Ga0495619_0162694_818_1306 156
1372 3300053087 Ga0500643_009467 Ga0500643_009467_1892_2362 156
1373 3300053118 Ga0500594_0020014 Ga0500594_0020014_978_1448 156
1374 3300053122 Ga0500608_265300 Ga0500608_265300_25_495 156
1375 3300053153 Ga0500616_0039467 Ga0500616_0039467_1411_1881 156
1376 3300053730 Ga0500645_019607 Ga0500645_019607_1297_1767 156
1377 3300053730 Ga0500645_104850 Ga0500645_104850_113_661 156
1378 3300054114 Ga0501084_0041457 Ga0501084_0041457_2246_2716 156
1379 3300054114 Ga0501084_0647331 Ga0501084_0647331_64_534 156
1380 3300059503 Ga0587080_162691 Ga0587080_162691_17_487 156
1381 3300059505 Ga0587083_0090773 Ga0587083_0090773_79_549 156
1382 3300059626 Ga0587115_008996 Ga0587115_008996_119_589 156
1383 3300059652 Ga0587107_013294 Ga0587107_013294_537_1007 156
1384 3300060353 Ga0501082_0187061 Ga0501082_0187061_199_669 156
1385 3300060353 Ga0501082_0258583 Ga0501082_0258583_380_850 156
1386 3300060353 Ga0501082_0716355 Ga0501082_0716355_39_509 156
1387 3300060353 Ga0501082_0723849 Ga0501082_0723849_31_501 156
1388 3300061719 Ga0466962_0279927 Ga0466962_0279927_161_631 156
1389 3300061734 Ga0530510_0071728 Ga0530510_0071728_365_835 156
1390 3300061734 Ga0530510_0108992 Ga0530510_0108992_1292_1762 156
1391 3300061734 Ga0530510_0591101 Ga0530510_0591101_295_765 156
1392 3300061734 Ga0530510_1263601 Ga0530510_1263601_44_514 156
1393 iso_pu_bacteria 2508501128 2509149638 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

2

175

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cdv-assembly1.cif.gz_H rnase r bound to a 30s degradation intermediate (state ii) 0.9827 18 127
7p7u-assembly1.cif.gz_h e. faecalis 70s ribosome with p-trna, state iv 0.9792 8 154
7nhn-assembly1.cif.gz_h vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.977 12 151
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.9764 12 151
7nhm-assembly1.cif.gz_h 70s ribosome from staphylococcus aureus 0.9724 8 150
ID Description Score Start End Superfamily
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9697 3 156 1.10.455.10
5x8rg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9673 8 151 1.10.455.10
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9662 10 148 1.10.455.10
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9592 10 148 1.10.455.10
5mmjg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.958 2 155 1.10.455.10
ID Description Score Start End GO Terms
AF-A0A3S1UAE0-F1-model_v4 30S ribosomal protein S7 0.9975 34 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A7Y2PLF6-F1-model_v4 Ribosomal protein S7 0.993 12 149 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A838VDW6-F1-model_v4 30S ribosomal protein S7 0.99 51 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A3S1UAE0-F1-model_v4 30S ribosomal protein S7 0.9895 34 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A2V2RP19-F1-model_v4 30S ribosomal protein S7 0.9869 53 156 GO:0003735
GO:0006412
GO:0015935
GO:0019843

Feature Viewer

pLDDT pTM Quality
90.92 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map