F493611
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1393 | 671 | 1158 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300053730|Ga0500645_104850|Ga0500645_104850_113_661 |
| Length | 182 |
| Sequence | MSRRRQADKREVLPDPRFNDIELTKFMNSLMYDGKKSAAENIVYGALELLEKRAANDKGAKTEEASADENVATTSGGAVVTHKGLITFYKALKNVAPHVEVRSRRVGGATYQVPVEVRFDRARALARRWLIDAARRRGEKTMRERLAGEIQEASNNRGNAVKKREDTHKMAEANKAFAHYRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 15 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 16 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 17 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 18 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 19 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 20 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 21 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 22 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 23 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 24 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 25 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 26 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 27 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 28 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 29 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 30 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 31 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 32 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 33 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 34 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 35 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 36 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 37 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 38 | 2791355199 | |||
| 39 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 40 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 41 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 42 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 43 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 44 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 45 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 46 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 47 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 48 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 49 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 50 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 51 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 52 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 53 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 54 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 55 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 56 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 57 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 58 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 59 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 60 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 61 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 62 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 63 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 64 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 65 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 66 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 67 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 68 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 69 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 70 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 71 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 72 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 73 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 74 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 75 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 76 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 77 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 78 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 79 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 80 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 81 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 82 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 83 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 84 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 85 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 86 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 87 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 88 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 89 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 90 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 91 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 92 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 93 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 94 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 95 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 96 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 97 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 98 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 99 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 100 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 101 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 102 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 103 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 104 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 105 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 106 | 2904699407 | |||
| 107 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 108 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 109 | 2906610324 | |||
| 110 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 111 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 112 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 113 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 114 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 115 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 116 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 117 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 118 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 119 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 120 | 2922368715 | |||
| 121 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 122 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 123 | 2922425934 | |||
| 124 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 125 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 126 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 127 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 128 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 129 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 130 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 131 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 132 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 133 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 134 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 135 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 136 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 137 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 138 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 139 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 140 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 141 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 142 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 143 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 144 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 145 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 146 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 147 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 148 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 149 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 150 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 151 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 152 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 153 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 154 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 155 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 156 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 157 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 158 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 159 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 160 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 161 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 162 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 163 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 164 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 165 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 166 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 167 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 168 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 169 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 170 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 171 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 172 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 173 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 174 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 175 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 176 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 177 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 178 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 179 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 180 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 181 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 182 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 183 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 184 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 185 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 186 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 187 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 188 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 189 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 190 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 191 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 192 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 193 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 194 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 195 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 196 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 197 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 198 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 199 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 200 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 201 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 202 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 203 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 204 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 205 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 206 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 207 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 209 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 212 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 214 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 215 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 216 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 217 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 220 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 221 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 224 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 226 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 227 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 228 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 230 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 231 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 232 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 234 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 241 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 244 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 245 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 246 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 249 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 250 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 255 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 256 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 257 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 258 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 259 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 261 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 262 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 263 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 264 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 266 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 267 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 271 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 273 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 274 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 275 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 277 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 278 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 279 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 280 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 281 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 282 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 283 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 284 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 285 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 286 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 287 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 288 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 289 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 290 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 291 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 292 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 293 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 294 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 295 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 296 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 297 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 298 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 299 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 300 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 301 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 303 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 304 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 305 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 306 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 307 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 308 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 309 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 310 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 311 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 313 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 314 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 315 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 341 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 343 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 344 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 345 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 346 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 347 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 348 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 349 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 350 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 419 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 423 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 424 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 425 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 426 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 427 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 428 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 429 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 430 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 431 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 432 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 433 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 434 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 435 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 436 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 437 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 438 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 439 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 440 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 441 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 442 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 443 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 444 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 445 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 446 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 447 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 448 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 450 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 451 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 452 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 453 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 454 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 455 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 456 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 457 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 458 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 459 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 460 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 461 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 462 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 463 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 464 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 465 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 466 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 467 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 468 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 469 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 470 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 471 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 472 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 473 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 474 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 475 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 476 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 477 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 478 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 479 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 480 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 481 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 482 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 483 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 484 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 485 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 486 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 487 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 488 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 489 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 490 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 491 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 492 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 493 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 494 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 495 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 496 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 497 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 498 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 499 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 544 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 545 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 546 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 547 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 548 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 549 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 550 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 551 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 552 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 553 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 554 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 555 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 556 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 557 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 558 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 559 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 560 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 561 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 562 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 563 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 564 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 565 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 567 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 568 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 569 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 574 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 575 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 576 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 578 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 580 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 581 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 583 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 586 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 591 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 592 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 593 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 596 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 597 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 598 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 599 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 600 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 601 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 602 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 603 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 604 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 605 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 606 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 607 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 608 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 609 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 610 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 611 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 612 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 613 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 617 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 618 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 619 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 620 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 621 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 622 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 623 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 624 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 625 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 626 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 627 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 628 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 629 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 630 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 631 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 632 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 633 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 634 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 635 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 636 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 637 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 638 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 639 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 640 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 641 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 642 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 643 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 644 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 645 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 646 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 647 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 648 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 649 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 650 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 651 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 652 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 653 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 654 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 655 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 656 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 657 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 658 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 659 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 660 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 661 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 662 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 663 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 664 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 665 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 666 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 667 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 668 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 669 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 670 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 671 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.63 |
| Metatranscriptomes | 1.8 |
| Isolates | 16.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.94 |
| Nodule | 11.84 |
| Rhizoplane | 2.01 |
| Rhizosphere | 76.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1001311 | 3300001976 | Bacteria | 3362 |
| 2 | JGI24743J22301_10160210 | 3300001991 | Bacteria | 508 |
| 3 | JGI24748J21848_1024821 | 3300002074 | Bacteria | 730 |
| 4 | JGI24749J21850_1001881 | 3300002076 | Bacteria | 2967 |
| 5 | JGI24744J21845_10041717 | 3300002077 | Bacteria | 857 |
| 6 | JGI24035J26624_1020509 | 3300002126 | Bacteria | 696 |
| 7 | JGI24034J26672_10002015 | 3300002239 | Bacteria | 2754 |
| 8 | JGI24742J22300_10034719 | 3300002244 | Bacteria | 888 |
| 9 | JGI24751J29686_10015977 | 3300002459 | Bacteria | 1548 |
| 10 | JGI25406J46586_10118333 | 3300003203 | Bacteria | 781 |
| 11 | rootH2_10110168 | 3300003320 | Bacteria | 2865 |
| 12 | Ga0007416J51690_1017726 | 3300003577 | Bacteria | 1282 |
| 13 | JGI25404J52841_10004339 | 3300003659 | Bacteria | 2866 |
| 14 | JGI25404J52841_10038933 | 3300003659 | Bacteria | 1008 |
| 15 | Ga0032354_1061987 | 3300003693 | Bacteria | 1295 |
| 16 | Ga0058859_11594462 | 3300004798 | Bacteria | 667 |
| 17 | Ga0058859_11820684 | 3300004798 | Bacteria | 1398 |
| 18 | Ga0058863_10056823 | 3300004799 | Bacteria | 915 |
| 19 | Ga0058863_10080931 | 3300004799 | Bacteria | 811 |
| 20 | Ga0058861_10030443 | 3300004800 | Bacteria | 1160 |
| 21 | Ga0058861_10175812 | 3300004800 | Bacteria | 926 |
| 22 | Ga0058861_11851124 | 3300004800 | Bacteria | 691 |
| 23 | Ga0058860_11861917 | 3300004801 | Bacteria | 847 |
| 24 | Ga0058860_12158433 | 3300004801 | Bacteria | 1313 |
| 25 | Ga0058862_10078448 | 3300004803 | Bacteria | 1114 |
| 26 | Ga0058862_10111058 | 3300004803 | Bacteria | 1074 |
| 27 | Ga0058862_10160436 | 3300004803 | Bacteria | 5467 |
| 28 | Ga0065704_10312968 | 3300005289 | Bacteria | 865 |
| 29 | Ga0065712_10109692 | 3300005290 | Bacteria | 1851 |
| 30 | Ga0065712_10175657 | 3300005290 | Bacteria | 1219 |
| 31 | Ga0065715_10096781 | 3300005293 | Bacteria | 3819 |
| 32 | Ga0065715_10593290 | 3300005293 | Bacteria | 700 |
| 33 | Ga0065707_10105665 | 3300005295 | Bacteria | 2629 |
| 34 | Ga0065707_10155043 | 3300005295 | Bacteria | 1617 |
| 35 | Ga0070658_10001321 | 3300005327 | Bacteria | 21139 |
| 36 | Ga0070676_10000380 | 3300005328 | Bacteria | 20558 |
| 37 | Ga0070676_10313408 | 3300005328 | Bacteria | 1067 |
| 38 | Ga0070683_100000033 | 3300005329 | Bacteria | 135305 |
| 39 | Ga0070683_100036594 | 3300005329 | Bacteria | 4492 |
| 40 | Ga0070683_100152551 | 3300005329 | Bacteria | 2190 |
| 41 | Ga0070690_100011157 | 3300005330 | Bacteria | 5249 |
| 42 | Ga0070690_100046988 | 3300005330 | Bacteria | 2745 |
| 43 | Ga0070690_100150920 | 3300005330 | Bacteria | 1585 |
| 44 | Ga0070670_100003921 | 3300005331 | Bacteria | 12413 |
| 45 | Ga0070670_100012257 | 3300005331 | Bacteria | 7335 |
| 46 | Ga0070670_100045805 | 3300005331 | Bacteria | 3760 |
| 47 | Ga0070670_100082102 | 3300005331 | Bacteria | 2770 |
| 48 | Ga0070670_100562757 | 3300005331 | Bacteria | 1018 |
| 49 | Ga0070677_10000135 | 3300005333 | Bacteria | 24603 |
| 50 | Ga0070677_10058986 | 3300005333 | Bacteria | 1577 |
| 51 | Ga0070677_10155312 | 3300005333 | Bacteria | 1069 |
| 52 | Ga0070677_10693157 | 3300005333 | Bacteria | 573 |
| 53 | Ga0068869_100000118 | 3300005334 | Bacteria | 38113 |
| 54 | Ga0068869_100044269 | 3300005334 | Bacteria | 3200 |
| 55 | Ga0068869_100618371 | 3300005334 | Bacteria | 917 |
| 56 | Ga0070666_10001221 | 3300005335 | Bacteria | 15513 |
| 57 | Ga0070666_10002914 | 3300005335 | Bacteria | 10347 |
| 58 | Ga0070666_10010376 | 3300005335 | Bacteria | 5825 |
| 59 | Ga0070680_100025773 | 3300005336 | Bacteria | 4701 |
| 60 | Ga0070680_100261308 | 3300005336 | Bacteria | 1465 |
| 61 | Ga0070680_100339940 | 3300005336 | Bacteria | 1275 |
| 62 | Ga0070680_100723710 | 3300005336 | Bacteria | 856 |
| 63 | Ga0070680_100961876 | 3300005336 | Bacteria | 737 |
| 64 | Ga0070682_100000036 | 3300005337 | Bacteria | 149965 |
| 65 | Ga0070682_100182381 | 3300005337 | Bacteria | 1467 |
| 66 | Ga0070682_100500128 | 3300005337 | Bacteria | 942 |
| 67 | Ga0068868_100000723 | 3300005338 | Bacteria | 22297 |
| 68 | Ga0068868_100000912 | 3300005338 | Bacteria | 20077 |
| 69 | Ga0068868_100014237 | 3300005338 | Bacteria | 5858 |
| 70 | Ga0068868_100041603 | 3300005338 | Bacteria | 3580 |
| 71 | Ga0068868_101035301 | 3300005338 | Bacteria | 752 |
| 72 | Ga0070660_100000631 | 3300005339 | Bacteria | 23479 |
| 73 | Ga0070660_100135988 | 3300005339 | Bacteria | 1969 |
| 74 | Ga0070689_100000443 | 3300005340 | Bacteria | 24402 |
| 75 | Ga0070689_100015182 | 3300005340 | Bacteria | 5612 |
| 76 | Ga0070689_100019995 | 3300005340 | Bacteria | 4962 |
| 77 | Ga0070689_100060765 | 3300005340 | Bacteria | 2939 |
| 78 | Ga0070689_101006720 | 3300005340 | Bacteria | 741 |
| 79 | Ga0070691_10130801 | 3300005341 | Bacteria | 1272 |
| 80 | Ga0070687_100005653 | 3300005343 | Bacteria | 5071 |
| 81 | Ga0070687_100014217 | 3300005343 | Bacteria | 3571 |
| 82 | Ga0070687_100207292 | 3300005343 | Bacteria | 1192 |
| 83 | Ga0070687_100776215 | 3300005343 | Bacteria | 677 |
| 84 | Ga0070661_100009001 | 3300005344 | Bacteria | 6908 |
| 85 | Ga0070661_100077614 | 3300005344 | Bacteria | 2449 |
| 86 | Ga0070692_10156770 | 3300005345 | Bacteria | 1301 |
| 87 | Ga0070692_10704524 | 3300005345 | Bacteria | 680 |
| 88 | Ga0070668_100000076 | 3300005347 | Bacteria | 60771 |
| 89 | Ga0070668_100036317 | 3300005347 | Bacteria | 3760 |
| 90 | Ga0070668_100466288 | 3300005347 | Bacteria | 1088 |
| 91 | Ga0070668_100980307 | 3300005347 | Bacteria | 759 |
| 92 | Ga0070668_100986416 | 3300005347 | Bacteria | 757 |
| 93 | Ga0070669_100000096 | 3300005353 | Bacteria | 86930 |
| 94 | Ga0070669_100032654 | 3300005353 | Bacteria | 3760 |
| 95 | Ga0070669_100045874 | 3300005353 | Bacteria | 3185 |
| 96 | Ga0070669_100057829 | 3300005353 | Bacteria | 2846 |
| 97 | Ga0070669_100124436 | 3300005353 | Bacteria | 1971 |
| 98 | Ga0070675_100000559 | 3300005354 | Bacteria | 25636 |
| 99 | Ga0070675_100017111 | 3300005354 | Bacteria | 5761 |
| 100 | Ga0070675_100018869 | 3300005354 | Bacteria | 5492 |
| 101 | Ga0070675_100052834 | 3300005354 | Bacteria | 3341 |
| 102 | Ga0070675_100148076 | 3300005354 | Bacteria | 2011 |
| 103 | Ga0070675_100474509 | 3300005354 | Bacteria | 1124 |
| 104 | Ga0070675_100485534 | 3300005354 | Bacteria | 1112 |
| 105 | Ga0070671_100000045 | 3300005355 | Bacteria | 85779 |
| 106 | Ga0070671_100001952 | 3300005355 | Bacteria | 15828 |
| 107 | Ga0070671_100042395 | 3300005355 | Bacteria | 3782 |
| 108 | Ga0070671_100350254 | 3300005355 | Bacteria | 1260 |
| 109 | Ga0070671_100358067 | 3300005355 | Bacteria | 1246 |
| 110 | Ga0070671_100553913 | 3300005355 | Bacteria | 992 |
| 111 | Ga0070674_100000922 | 3300005356 | Bacteria | 15331 |
| 112 | Ga0070674_100146244 | 3300005356 | Bacteria | 1779 |
| 113 | Ga0070674_100206191 | 3300005356 | Bacteria | 1521 |
| 114 | Ga0070674_100269913 | 3300005356 | Bacteria | 1344 |
| 115 | Ga0070674_100614464 | 3300005356 | Bacteria | 920 |
| 116 | Ga0070673_100001307 | 3300005364 | Bacteria | 14516 |
| 117 | Ga0070673_100002114 | 3300005364 | Bacteria | 12012 |
| 118 | Ga0070673_100058949 | 3300005364 | Bacteria | 3037 |
| 119 | Ga0070673_100194356 | 3300005364 | Bacteria | 1744 |
| 120 | Ga0070673_100252144 | 3300005364 | Bacteria | 1539 |
| 121 | Ga0070673_100540477 | 3300005364 | Bacteria | 1058 |
| 122 | Ga0070688_100007941 | 3300005365 | Bacteria | 5739 |
| 123 | Ga0070688_100052606 | 3300005365 | Bacteria | 2544 |
| 124 | Ga0070688_100438694 | 3300005365 | Bacteria | 974 |
| 125 | Ga0070659_100000088 | 3300005366 | Bacteria | 69112 |
| 126 | Ga0070659_100084712 | 3300005366 | Bacteria | 2534 |
| 127 | Ga0070667_100000025 | 3300005367 | Bacteria | 190744 |
| 128 | Ga0070667_100003534 | 3300005367 | Bacteria | 13313 |
| 129 | Ga0070667_100007729 | 3300005367 | Bacteria | 8912 |
| 130 | Ga0070667_100022068 | 3300005367 | Bacteria | 5281 |
| 131 | Ga0070667_100032953 | 3300005367 | Bacteria | 4324 |
| 132 | Ga0070667_100469753 | 3300005367 | Bacteria | 1151 |
| 133 | Ga0070713_100306206 | 3300005436 | Bacteria | 1464 |
| 134 | Ga0070710_10840348 | 3300005437 | Bacteria | 659 |
| 135 | Ga0070701_10053241 | 3300005438 | Bacteria | 2106 |
| 136 | Ga0070711_100582287 | 3300005439 | Bacteria | 932 |
| 137 | Ga0070705_100000956 | 3300005440 | Bacteria | 16188 |
| 138 | Ga0070705_100368521 | 3300005440 | Bacteria | 1053 |
| 139 | Ga0070700_100102202 | 3300005441 | Bacteria | 1890 |
| 140 | Ga0070700_100144679 | 3300005441 | Bacteria | 1619 |
| 141 | Ga0070700_100573676 | 3300005441 | Bacteria | 880 |
| 142 | Ga0070700_100623759 | 3300005441 | Bacteria | 848 |
| 143 | Ga0070694_100575120 | 3300005444 | Bacteria | 905 |
| 144 | Ga0070708_100004467 | 3300005445 | Bacteria | 11001 |
| 145 | Ga0070708_100497899 | 3300005445 | Bacteria | 1149 |
| 146 | Ga0070663_100015416 | 3300005455 | Bacteria | 4933 |
| 147 | Ga0070678_100000461 | 3300005456 | Bacteria | 19447 |
| 148 | Ga0070678_100194825 | 3300005456 | Bacteria | 1668 |
| 149 | Ga0070678_100354391 | 3300005456 | Bacteria | 1263 |
| 150 | Ga0070678_100642780 | 3300005456 | Bacteria | 951 |
| 151 | Ga0070678_101249501 | 3300005456 | Bacteria | 690 |
| 152 | Ga0070662_100000976 | 3300005457 | Bacteria | 17505 |
| 153 | Ga0070662_100027519 | 3300005457 | Bacteria | 3947 |
| 154 | Ga0070681_10077480 | 3300005458 | Bacteria | 3282 |
| 155 | Ga0070681_10209829 | 3300005458 | Bacteria | 1864 |
| 156 | Ga0070681_10288163 | 3300005458 | Bacteria | 1552 |
| 157 | Ga0070681_10304780 | 3300005458 | Bacteria | 1502 |
| 158 | Ga0070681_10327027 | 3300005458 | Bacteria | 1443 |
| 159 | Ga0068867_100022286 | 3300005459 | Bacteria | 4528 |
| 160 | Ga0068867_100118640 | 3300005459 | Bacteria | 2041 |
| 161 | Ga0068867_100192373 | 3300005459 | Bacteria | 1629 |
| 162 | Ga0068867_100402525 | 3300005459 | Bacteria | 1155 |
| 163 | Ga0070685_10000585 | 3300005466 | Bacteria | 20257 |
| 164 | Ga0070685_10060815 | 3300005466 | Bacteria | 2210 |
| 165 | Ga0070685_10209483 | 3300005466 | Bacteria | 1271 |
| 166 | Ga0070685_10624909 | 3300005466 | Bacteria | 778 |
| 167 | Ga0070707_100021471 | 3300005468 | Bacteria | 6103 |
| 168 | Ga0070698_100194930 | 3300005471 | Bacteria | 1963 |
| 169 | Ga0070698_100519048 | 3300005471 | Bacteria | 1130 |
| 170 | Ga0070698_100786664 | 3300005471 | Bacteria | 895 |
| 171 | Ga0070699_100128090 | 3300005518 | Bacteria | 2236 |
| 172 | Ga0070699_100662949 | 3300005518 | Bacteria | 953 |
| 173 | Ga0070679_100030992 | 3300005530 | Bacteria | 5283 |
| 174 | Ga0070679_100100465 | 3300005530 | Bacteria | 2879 |
| 175 | Ga0070679_100149984 | 3300005530 | Bacteria | 2308 |
| 176 | Ga0070679_100211006 | 3300005530 | Bacteria | 1906 |
| 177 | Ga0070679_100420175 | 3300005530 | Bacteria | 1282 |
| 178 | Ga0070679_101057699 | 3300005530 | Bacteria | 756 |
| 179 | Ga0070684_100010702 | 3300005535 | Bacteria | 7276 |
| 180 | Ga0070684_100054901 | 3300005535 | Bacteria | 3471 |
| 181 | Ga0070684_100109082 | 3300005535 | Bacteria | 2480 |
| 182 | Ga0070684_100192199 | 3300005535 | Bacteria | 1858 |
| 183 | Ga0070697_100004239 | 3300005536 | Bacteria | 10989 |
| 184 | Ga0070697_100238499 | 3300005536 | Bacteria | 1552 |
| 185 | Ga0068853_100000472 | 3300005539 | Bacteria | 27445 |
| 186 | Ga0068853_100170573 | 3300005539 | Bacteria | 1968 |
| 187 | Ga0070672_100000581 | 3300005543 | Bacteria | 21483 |
| 188 | Ga0070672_100005460 | 3300005543 | Bacteria | 8428 |
| 189 | Ga0070672_100048521 | 3300005543 | Bacteria | 3300 |
| 190 | Ga0070672_100076957 | 3300005543 | Bacteria | 2667 |
| 191 | Ga0070672_100576426 | 3300005543 | Bacteria | 979 |
| 192 | Ga0070686_100000708 | 3300005544 | Bacteria | 19370 |
| 193 | Ga0070686_100059609 | 3300005544 | Bacteria | 2460 |
| 194 | Ga0070686_100210392 | 3300005544 | Bacteria | 1400 |
| 195 | Ga0070686_100219016 | 3300005544 | Bacteria | 1374 |
| 196 | Ga0070686_100796249 | 3300005544 | Bacteria | 761 |
| 197 | Ga0070695_100098141 | 3300005545 | Bacteria | 1968 |
| 198 | Ga0070695_100181760 | 3300005545 | Bacteria | 1491 |
| 199 | Ga0070696_100078380 | 3300005546 | Bacteria | 2336 |
| 200 | Ga0070696_100225948 | 3300005546 | Bacteria | 1407 |
| 201 | Ga0070693_100034250 | 3300005547 | Bacteria | 2809 |
| 202 | Ga0070693_100392828 | 3300005547 | Bacteria | 960 |
| 203 | Ga0070665_100061650 | 3300005548 | Bacteria | 3760 |
| 204 | Ga0070665_100103384 | 3300005548 | Bacteria | 2852 |
| 205 | Ga0070665_100571036 | 3300005548 | Bacteria | 1144 |
| 206 | Ga0070665_100838043 | 3300005548 | Bacteria | 933 |
| 207 | Ga0068855_100002917 | 3300005563 | Bacteria | 20934 |
| 208 | Ga0068855_101258081 | 3300005563 | Bacteria | 767 |
| 209 | Ga0068855_101617578 | 3300005563 | Bacteria | 662 |
| 210 | Ga0070664_100000540 | 3300005564 | Bacteria | 28865 |
| 211 | Ga0070664_100001968 | 3300005564 | Bacteria | 16471 |
| 212 | Ga0070664_100017196 | 3300005564 | Bacteria | 5937 |
| 213 | Ga0070664_100023966 | 3300005564 | Bacteria | 5042 |
| 214 | Ga0070664_100513685 | 3300005564 | Bacteria | 1105 |
| 215 | Ga0068857_100004949 | 3300005577 | Bacteria | 11316 |
| 216 | Ga0068857_100740951 | 3300005577 | Bacteria | 935 |
| 217 | Ga0068854_100008432 | 3300005578 | Bacteria | 6626 |
| 218 | Ga0068856_100000972 | 3300005614 | Bacteria | 30573 |
| 219 | Ga0068856_100008110 | 3300005614 | Bacteria | 10251 |
| 220 | Ga0068856_102086557 | 3300005614 | Bacteria | 577 |
| 221 | Ga0070702_100174354 | 3300005615 | Bacteria | 1402 |
| 222 | Ga0070702_100268867 | 3300005615 | Bacteria | 1165 |
| 223 | Ga0070702_100322131 | 3300005615 | Bacteria | 1078 |
| 224 | Ga0070702_100520717 | 3300005615 | Bacteria | 877 |
| 225 | Ga0068852_100000931 | 3300005616 | Bacteria | 19323 |
| 226 | Ga0068852_100998686 | 3300005616 | Bacteria | 855 |
| 227 | Ga0068859_100000162 | 3300005617 | Bacteria | 65033 |
| 228 | Ga0068859_100000703 | 3300005617 | Bacteria | 33591 |
| 229 | Ga0068859_100001363 | 3300005617 | Bacteria | 24912 |
| 230 | Ga0068859_100002579 | 3300005617 | Bacteria | 18428 |
| 231 | Ga0068859_100116937 | 3300005617 | Bacteria | 2731 |
| 232 | Ga0068859_100662919 | 3300005617 | Bacteria | 1135 |
| 233 | Ga0068864_100000406 | 3300005618 | Bacteria | 37364 |
| 234 | Ga0068864_100000677 | 3300005618 | Bacteria | 28506 |
| 235 | Ga0068864_100001203 | 3300005618 | Bacteria | 21489 |
| 236 | Ga0068864_100018418 | 3300005618 | Bacteria | 5835 |
| 237 | Ga0068864_100077202 | 3300005618 | Bacteria | 2912 |
| 238 | Ga0068864_100081439 | 3300005618 | Bacteria | 2838 |
| 239 | Ga0068864_101501252 | 3300005618 | Bacteria | 677 |
| 240 | Ga0068866_10002337 | 3300005718 | Bacteria | 7856 |
| 241 | Ga0068866_10164411 | 3300005718 | Bacteria | 1297 |
| 242 | Ga0068866_10396826 | 3300005718 | Bacteria | 889 |
| 243 | Ga0068866_10674739 | 3300005718 | Bacteria | 706 |
| 244 | Ga0068861_100000205 | 3300005719 | Bacteria | 31483 |
| 245 | Ga0068861_100086895 | 3300005719 | Bacteria | 2459 |
| 246 | Ga0068861_100350673 | 3300005719 | Bacteria | 1294 |
| 247 | Ga0068851_10000663 | 3300005834 | Bacteria | 14698 |
| 248 | Ga0068870_10001380 | 3300005840 | Bacteria | 9803 |
| 249 | Ga0068870_10061307 | 3300005840 | Bacteria | 2022 |
| 250 | Ga0068870_10206190 | 3300005840 | Bacteria | 1195 |
| 251 | Ga0068863_100000067 | 3300005841 | Bacteria | 117275 |
| 252 | Ga0068863_100000784 | 3300005841 | Bacteria | 31931 |
| 253 | Ga0068863_100000969 | 3300005841 | Bacteria | 28867 |
| 254 | Ga0068863_100002121 | 3300005841 | Bacteria | 19668 |
| 255 | Ga0068863_100593629 | 3300005841 | Bacteria | 1096 |
| 256 | Ga0068858_100008722 | 3300005842 | Bacteria | 9734 |
| 257 | Ga0068858_100026802 | 3300005842 | Bacteria | 5354 |
| 258 | Ga0068858_100027525 | 3300005842 | Bacteria | 5281 |
| 259 | Ga0068858_100036951 | 3300005842 | Bacteria | 4528 |
| 260 | Ga0068858_100208213 | 3300005842 | Bacteria | 1850 |
| 261 | Ga0068858_100277835 | 3300005842 | Bacteria | 1594 |
| 262 | Ga0068858_100320333 | 3300005842 | Bacteria | 1482 |
| 263 | Ga0068858_100570992 | 3300005842 | Bacteria | 1096 |
| 264 | Ga0068860_100004945 | 3300005843 | Bacteria | 13583 |
| 265 | Ga0068860_100014085 | 3300005843 | Bacteria | 7846 |
| 266 | Ga0068860_100039250 | 3300005843 | Bacteria | 4528 |
| 267 | Ga0068860_100045537 | 3300005843 | Bacteria | 4184 |
| 268 | Ga0068860_100048778 | 3300005843 | Bacteria | 4035 |
| 269 | Ga0068860_100270458 | 3300005843 | Bacteria | 1658 |
| 270 | Ga0068862_100001387 | 3300005844 | Bacteria | 22482 |
| 271 | Ga0068862_100022281 | 3300005844 | Bacteria | 5298 |
| 272 | Ga0068862_100066024 | 3300005844 | Bacteria | 3117 |
| 273 | Ga0068862_100083287 | 3300005844 | Bacteria | 2777 |
| 274 | Ga0068862_100360246 | 3300005844 | Bacteria | 1351 |
| 275 | Ga0068862_100843691 | 3300005844 | Bacteria | 897 |
| 276 | Ga0068862_101424395 | 3300005844 | Bacteria | 697 |
| 277 | Ga0081455_10310939 | 3300005937 | Bacteria | 1126 |
| 278 | Ga0081540_1000785 | 3300005983 | Bacteria | 29131 |
| 279 | Ga0081540_1001166 | 3300005983 | Bacteria | 23099 |
| 280 | Ga0081540_1006864 | 3300005983 | Bacteria | 8216 |
| 281 | Ga0081540_1062215 | 3300005983 | Bacteria | 1774 |
| 282 | Ga0081540_1164081 | 3300005983 | Bacteria | 857 |
| 283 | Ga0081539_10079757 | 3300005985 | Bacteria | 1724 |
| 284 | Ga0070717_10171221 | 3300006028 | Bacteria | 1889 |
| 285 | Ga0070717_10558537 | 3300006028 | Bacteria | 1037 |
| 286 | Ga0070717_11360808 | 3300006028 | Bacteria | 645 |
| 287 | Ga0075365_10000107 | 3300006038 | Bacteria | 24426 |
| 288 | Ga0075365_10105578 | 3300006038 | Bacteria | 1932 |
| 289 | Ga0075365_10373490 | 3300006038 | Bacteria | 1006 |
| 290 | Ga0075368_10014839 | 3300006042 | Bacteria | 2882 |
| 291 | Ga0075363_100118852 | 3300006048 | Bacteria | 1474 |
| 292 | Ga0075363_100125728 | 3300006048 | Bacteria | 1435 |
| 293 | Ga0075364_10003335 | 3300006051 | Bacteria | 9112 |
| 294 | Ga0075364_10044569 | 3300006051 | Bacteria | 2885 |
| 295 | Ga0075364_10374723 | 3300006051 | Bacteria | 971 |
| 296 | Ga0075432_10315806 | 3300006058 | Bacteria | 653 |
| 297 | Ga0070712_101019032 | 3300006175 | Bacteria | 717 |
| 298 | Ga0075362_10007455 | 3300006177 | Bacteria | 4145 |
| 299 | Ga0075362_10008082 | 3300006177 | Bacteria | 4009 |
| 300 | Ga0075367_10009044 | 3300006178 | Bacteria | 5189 |
| 301 | Ga0075367_10685474 | 3300006178 | Bacteria | 652 |
| 302 | Ga0075369_10005796 | 3300006186 | Bacteria | 4637 |
| 303 | Ga0075369_10031098 | 3300006186 | Bacteria | 2250 |
| 304 | Ga0075366_10029169 | 3300006195 | Bacteria | 3241 |
| 305 | Ga0097621_100011773 | 3300006237 | Bacteria | 6460 |
| 306 | Ga0097621_100094680 | 3300006237 | Bacteria | 2504 |
| 307 | Ga0097621_100163361 | 3300006237 | Bacteria | 1915 |
| 308 | Ga0097621_100671959 | 3300006237 | Bacteria | 952 |
| 309 | Ga0097621_100792630 | 3300006237 | Bacteria | 877 |
| 310 | Ga0075370_10292143 | 3300006353 | Bacteria | 969 |
| 311 | Ga0075370_10498765 | 3300006353 | Bacteria | 735 |
| 312 | Ga0068871_100043089 | 3300006358 | Bacteria | 3625 |
| 313 | Ga0068871_100070590 | 3300006358 | Bacteria | 2871 |
| 314 | Ga0068871_100243130 | 3300006358 | Bacteria | 1565 |
| 315 | Ga0068871_100278956 | 3300006358 | Bacteria | 1461 |
| 316 | Ga0075428_100130169 | 3300006844 | Bacteria | 2737 |
| 317 | Ga0075428_100179551 | 3300006844 | Bacteria | 2292 |
| 318 | Ga0075428_100531359 | 3300006844 | Bacteria | 1258 |
| 319 | Ga0075428_100821334 | 3300006844 | Bacteria | 988 |
| 320 | Ga0075428_100863332 | 3300006844 | Bacteria | 961 |
| 321 | Ga0075428_100971034 | 3300006844 | Bacteria | 900 |
| 322 | Ga0075428_101080949 | 3300006844 | Bacteria | 848 |
| 323 | Ga0075428_101955078 | 3300006844 | Bacteria | 608 |
| 324 | Ga0075431_100013381 | 3300006847 | Bacteria | 8290 |
| 325 | Ga0075431_100043853 | 3300006847 | Bacteria | 4613 |
| 326 | Ga0075431_100500274 | 3300006847 | Bacteria | 1207 |
| 327 | Ga0075431_100667935 | 3300006847 | Bacteria | 1019 |
| 328 | Ga0075433_10066503 | 3300006852 | Bacteria | 3163 |
| 329 | Ga0075433_10816227 | 3300006852 | Bacteria | 815 |
| 330 | Ga0075434_100087559 | 3300006871 | Bacteria | 3115 |
| 331 | Ga0075434_100151263 | 3300006871 | Bacteria | 2341 |
| 332 | Ga0075434_100242253 | 3300006871 | Bacteria | 1823 |
| 333 | Ga0075434_100519765 | 3300006871 | Bacteria | 1211 |
| 334 | Ga0075434_100770822 | 3300006871 | Bacteria | 978 |
| 335 | Ga0075429_100088416 | 3300006880 | Bacteria | 2700 |
| 336 | Ga0075429_100187435 | 3300006880 | Bacteria | 1813 |
| 337 | Ga0075429_100677885 | 3300006880 | Bacteria | 903 |
| 338 | Ga0075429_100705152 | 3300006880 | Bacteria | 884 |
| 339 | Ga0075429_100833012 | 3300006880 | Bacteria | 808 |
| 340 | Ga0075429_101006129 | 3300006880 | Bacteria | 729 |
| 341 | Ga0075429_101177838 | 3300006880 | Bacteria | 669 |
| 342 | Ga0068865_100027476 | 3300006881 | Bacteria | 3760 |
| 343 | Ga0068865_100503925 | 3300006881 | Bacteria | 1010 |
| 344 | Ga0068865_101130059 | 3300006881 | Bacteria | 691 |
| 345 | Ga0075436_100499175 | 3300006914 | Bacteria | 890 |
| 346 | Ga0075436_100565424 | 3300006914 | Bacteria | 836 |
| 347 | Ga0097620_100000162 | 3300006931 | Bacteria | 65033 |
| 348 | Ga0097620_100000703 | 3300006931 | Bacteria | 33591 |
| 349 | Ga0097620_100001363 | 3300006931 | Bacteria | 24912 |
| 350 | Ga0097620_100002579 | 3300006931 | Bacteria | 18428 |
| 351 | Ga0097620_100116933 | 3300006931 | Bacteria | 2731 |
| 352 | Ga0097620_100662813 | 3300006931 | Bacteria | 1135 |
| 353 | Ga0075435_100261942 | 3300007076 | Bacteria | 1473 |
| 354 | Ga0075435_100379856 | 3300007076 | Bacteria | 1213 |
| 355 | Ga0075435_100710220 | 3300007076 | Bacteria | 874 |
| 356 | Ga0075435_101167389 | 3300007076 | Bacteria | 673 |
| 357 | Ga0099794_10067852 | 3300007265 | Bacteria | 1743 |
| 358 | Ga0099795_10552627 | 3300007788 | Bacteria | 543 |
| 359 | Ga0105250_10007794 | 3300009092 | Bacteria | 4584 |
| 360 | Ga0105240_10006530 | 3300009093 | Bacteria | 17125 |
| 361 | Ga0105240_11153961 | 3300009093 | Bacteria | 822 |
| 362 | Ga0111539_10000022 | 3300009094 | Bacteria | 240838 |
| 363 | Ga0111539_10040340 | 3300009094 | Bacteria | 5621 |
| 364 | Ga0111539_10076709 | 3300009094 | Bacteria | 3935 |
| 365 | Ga0111539_10104137 | 3300009094 | Bacteria | 3330 |
| 366 | Ga0111539_10145119 | 3300009094 | Bacteria | 2779 |
| 367 | Ga0111539_10381999 | 3300009094 | Bacteria | 1640 |
| 368 | Ga0111539_10915989 | 3300009094 | Bacteria | 1019 |
| 369 | Ga0111539_11172000 | 3300009094 | Bacteria | 893 |
| 370 | Ga0111539_11817078 | 3300009094 | Bacteria | 707 |
| 371 | Ga0105245_10000010 | 3300009098 | Bacteria | 278233 |
| 372 | Ga0105245_10000166 | 3300009098 | Bacteria | 62554 |
| 373 | Ga0105245_10038622 | 3300009098 | Bacteria | 4247 |
| 374 | Ga0105245_10351851 | 3300009098 | Bacteria | 1460 |
| 375 | Ga0105245_10392735 | 3300009098 | Bacteria | 1384 |
| 376 | Ga0105247_10000778 | 3300009101 | Bacteria | 24488 |
| 377 | Ga0105247_10005540 | 3300009101 | Bacteria | 7940 |
| 378 | Ga0105247_11763610 | 3300009101 | Bacteria | 514 |
| 379 | Ga0114129_10092785 | 3300009147 | Bacteria | 4183 |
| 380 | Ga0114129_10121065 | 3300009147 | Bacteria | 3602 |
| 381 | Ga0114129_10152522 | 3300009147 | Bacteria | 3161 |
| 382 | Ga0114129_10292313 | 3300009147 | Bacteria | 2174 |
| 383 | Ga0114129_10606618 | 3300009147 | Bacteria | 1417 |
| 384 | Ga0114129_11128009 | 3300009147 | Bacteria | 980 |
| 385 | Ga0114129_11474887 | 3300009147 | Bacteria | 837 |
| 386 | Ga0114129_11640064 | 3300009147 | Bacteria | 786 |
| 387 | Ga0114129_12639473 | 3300009147 | Bacteria | 599 |
| 388 | Ga0105243_10021643 | 3300009148 | Bacteria | 4882 |
| 389 | Ga0105243_10781543 | 3300009148 | Bacteria | 939 |
| 390 | Ga0105241_10000628 | 3300009174 | Bacteria | 26570 |
| 391 | Ga0105242_10009762 | 3300009176 | Bacteria | 7354 |
| 392 | Ga0105242_10425270 | 3300009176 | Bacteria | 1246 |
| 393 | Ga0105242_10661511 | 3300009176 | Bacteria | 1017 |
| 394 | Ga0105242_10794877 | 3300009176 | Bacteria | 936 |
| 395 | Ga0105242_11246583 | 3300009176 | Bacteria | 765 |
| 396 | Ga0105242_12302834 | 3300009176 | Bacteria | 585 |
| 397 | Ga0105248_10001106 | 3300009177 | Bacteria | 29895 |
| 398 | Ga0105248_10034053 | 3300009177 | Bacteria | 5694 |
| 399 | Ga0105248_10098171 | 3300009177 | Bacteria | 3300 |
| 400 | Ga0105248_10199651 | 3300009177 | Bacteria | 2253 |
| 401 | Ga0105248_10446231 | 3300009177 | Bacteria | 1458 |
| 402 | Ga0105248_10851610 | 3300009177 | Bacteria | 1029 |
| 403 | Ga0105248_11028380 | 3300009177 | Bacteria | 931 |
| 404 | Ga0105248_11084329 | 3300009177 | Bacteria | 905 |
| 405 | Ga0105248_11793594 | 3300009177 | Bacteria | 696 |
| 406 | Ga0105248_11865745 | 3300009177 | Bacteria | 682 |
| 407 | Ga0105237_10000740 | 3300009545 | Bacteria | 45064 |
| 408 | Ga0105238_10000002 | 3300009551 | Bacteria | 772711 |
| 409 | Ga0105238_10001986 | 3300009551 | Bacteria | 20595 |
| 410 | Ga0105249_10001061 | 3300009553 | Bacteria | 24372 |
| 411 | Ga0105249_10002192 | 3300009553 | Bacteria | 16910 |
| 412 | Ga0105249_10711388 | 3300009553 | Bacteria | 1065 |
| 413 | Ga0105249_11037129 | 3300009553 | Bacteria | 889 |
| 414 | Ga0105239_10001250 | 3300010375 | Bacteria | 34519 |
| 415 | Ga0105239_10002930 | 3300010375 | Bacteria | 21309 |
| 416 | Ga0105246_10128367 | 3300011119 | Bacteria | 1890 |
| 417 | Ga0105246_10154324 | 3300011119 | Bacteria | 1742 |
| 418 | Ga0105246_10176286 | 3300011119 | Bacteria | 1642 |
| 419 | Ga0157373_10033827 | 3300013100 | Bacteria | 3673 |
| 420 | Ga0157373_10264084 | 3300013100 | Bacteria | 1218 |
| 421 | Ga0157373_10750171 | 3300013100 | Bacteria | 717 |
| 422 | Ga0157371_10031254 | 3300013102 | Bacteria | 3836 |
| 423 | Ga0157371_10594347 | 3300013102 | Bacteria | 823 |
| 424 | Ga0157369_10001943 | 3300013105 | Bacteria | 24887 |
| 425 | Ga0157369_10003299 | 3300013105 | Bacteria | 19204 |
| 426 | Ga0157374_10000005 | 3300013296 | Bacteria | 646767 |
| 427 | Ga0157374_10045770 | 3300013296 | Bacteria | 4050 |
| 428 | Ga0157378_10000167 | 3300013297 | Bacteria | 62921 |
| 429 | Ga0157378_10039360 | 3300013297 | Bacteria | 4193 |
| 430 | Ga0157378_10209845 | 3300013297 | Bacteria | 1846 |
| 431 | Ga0157378_10376225 | 3300013297 | Bacteria | 1394 |
| 432 | Ga0157378_10665271 | 3300013297 | Bacteria | 1058 |
| 433 | Ga0157378_11049199 | 3300013297 | Bacteria | 851 |
| 434 | Ga0163162_10000823 | 3300013306 | Bacteria | 28858 |
| 435 | Ga0163162_10002337 | 3300013306 | Bacteria | 17801 |
| 436 | Ga0163162_10007545 | 3300013306 | Bacteria | 10594 |
| 437 | Ga0163162_10096376 | 3300013306 | Bacteria | 3046 |
| 438 | Ga0163162_10340610 | 3300013306 | Bacteria | 1632 |
| 439 | Ga0163162_10391891 | 3300013306 | Bacteria | 1522 |
| 440 | Ga0157372_10091324 | 3300013307 | Bacteria | 3463 |
| 441 | Ga0157372_10373408 | 3300013307 | Bacteria | 1662 |
| 442 | Ga0157372_11073191 | 3300013307 | Bacteria | 932 |
| 443 | Ga0157375_10000055 | 3300013308 | Bacteria | 126704 |
| 444 | Ga0157375_10001345 | 3300013308 | Bacteria | 21189 |
| 445 | Ga0157375_10001418 | 3300013308 | Bacteria | 20617 |
| 446 | Ga0157375_10082844 | 3300013308 | Bacteria | 3251 |
| 447 | Ga0157375_10158566 | 3300013308 | Bacteria | 2404 |
| 448 | Ga0157375_12000318 | 3300013308 | Bacteria | 689 |
| 449 | Ga0157375_12202148 | 3300013308 | Bacteria | 657 |
| 450 | Ga0163163_10009168 | 3300014325 | Bacteria | 8822 |
| 451 | Ga0163163_10142986 | 3300014325 | Bacteria | 2435 |
| 452 | Ga0163163_10369195 | 3300014325 | Bacteria | 1492 |
| 453 | Ga0163163_10558186 | 3300014325 | Bacteria | 1208 |
| 454 | Ga0163163_10561969 | 3300014325 | Bacteria | 1204 |
| 455 | Ga0163163_12255054 | 3300014325 | Bacteria | 603 |
| 456 | Ga0157380_10118167 | 3300014326 | Bacteria | 2241 |
| 457 | Ga0157380_10148581 | 3300014326 | Bacteria | 2023 |
| 458 | Ga0157380_10295874 | 3300014326 | Bacteria | 1488 |
| 459 | Ga0157380_10366891 | 3300014326 | Bacteria | 1353 |
| 460 | Ga0157380_10551512 | 3300014326 | Bacteria | 1131 |
| 461 | Ga0157380_10701762 | 3300014326 | Bacteria | 1017 |
| 462 | Ga0157380_11076523 | 3300014326 | Bacteria | 842 |
| 463 | Ga0157377_10000026 | 3300014745 | Bacteria | 138648 |
| 464 | Ga0157377_10000296 | 3300014745 | Bacteria | 23341 |
| 465 | Ga0157377_10001264 | 3300014745 | Bacteria | 10813 |
| 466 | Ga0157377_10122387 | 3300014745 | Bacteria | 1578 |
| 467 | Ga0157377_10399171 | 3300014745 | Bacteria | 936 |
| 468 | Ga0157377_11153035 | 3300014745 | Bacteria | 597 |
| 469 | Ga0157379_10000025 | 3300014968 | Bacteria | 90070 |
| 470 | Ga0157379_10000562 | 3300014968 | Bacteria | 29935 |
| 471 | Ga0157379_10043366 | 3300014968 | Bacteria | 4016 |
| 472 | Ga0157379_10324834 | 3300014968 | Bacteria | 1405 |
| 473 | Ga0157379_10693633 | 3300014968 | Bacteria | 955 |
| 474 | Ga0157379_10883384 | 3300014968 | Bacteria | 847 |
| 475 | Ga0157379_11493319 | 3300014968 | Bacteria | 657 |
| 476 | Ga0157379_11836295 | 3300014968 | Bacteria | 596 |
| 477 | Ga0157376_10000003 | 3300014969 | Bacteria | 568634 |
| 478 | Ga0157376_10003404 | 3300014969 | Bacteria | 10945 |
| 479 | Ga0157376_10089508 | 3300014969 | Bacteria | 2661 |
| 480 | Ga0163161_10014953 | 3300017792 | Bacteria | 5406 |
| 481 | Ga0163161_10073389 | 3300017792 | Bacteria | 2507 |
| 482 | Ga0163161_10077880 | 3300017792 | Bacteria | 2436 |
| 483 | Ga0163161_10111267 | 3300017792 | Bacteria | 2047 |
| 484 | Ga0163161_10545687 | 3300017792 | Bacteria | 949 |
| 485 | Ga0163161_10686890 | 3300017792 | Bacteria | 851 |
| 486 | Ga0206355_1166500 | 3300020076 | Bacteria | 1425 |
| 487 | Ga0206352_10354123 | 3300020078 | Bacteria | 1103 |
| 488 | Ga0206353_11044236 | 3300020082 | Bacteria | 656 |
| 489 | Ga0206353_11127814 | 3300020082 | Bacteria | 580 |
| 490 | Ga0213873_10000721 | 3300021358 | Bacteria | 5340 |
| 491 | Ga0213874_10207480 | 3300021377 | Bacteria | 707 |
| 492 | Ga0213876_10000009 | 3300021384 | Bacteria | 496136 |
| 493 | Ga0207673_1010380 | 3300025290 | Bacteria | 1198 |
| 494 | Ga0209257_1063601 | 3300025304 | Bacteria | 995 |
| 495 | Ga0207697_10003661 | 3300025315 | Bacteria | 7528 |
| 496 | Ga0207697_10011132 | 3300025315 | Bacteria | 3813 |
| 497 | Ga0207697_10191667 | 3300025315 | Bacteria | 898 |
| 498 | Ga0207656_10052062 | 3300025321 | Bacteria | 1772 |
| 499 | Ga0207696_1052439 | 3300025711 | Bacteria | 1163 |
| 500 | Ga0207682_10000315 | 3300025893 | Bacteria | 21984 |
| 501 | Ga0207682_10003051 | 3300025893 | Bacteria | 7350 |
| 502 | Ga0207682_10177372 | 3300025893 | Bacteria | 972 |
| 503 | Ga0207642_10004671 | 3300025899 | Bacteria | 4425 |
| 504 | Ga0207642_10571812 | 3300025899 | Bacteria | 700 |
| 505 | Ga0207710_10004541 | 3300025900 | Bacteria | 6032 |
| 506 | Ga0207710_10007497 | 3300025900 | Bacteria | 4621 |
| 507 | Ga0207688_10026904 | 3300025901 | Bacteria | 3164 |
| 508 | Ga0207680_10000156 | 3300025903 | Bacteria | 33323 |
| 509 | Ga0207680_10002207 | 3300025903 | Bacteria | 9093 |
| 510 | Ga0207680_10002463 | 3300025903 | Bacteria | 8640 |
| 511 | Ga0207680_10345296 | 3300025903 | Bacteria | 1045 |
| 512 | Ga0207680_10440388 | 3300025903 | Bacteria | 924 |
| 513 | Ga0207647_10001294 | 3300025904 | Bacteria | 19260 |
| 514 | Ga0207685_10239392 | 3300025905 | Bacteria | 872 |
| 515 | Ga0207645_10000031 | 3300025907 | Bacteria | 93071 |
| 516 | Ga0207645_10072924 | 3300025907 | Bacteria | 2198 |
| 517 | Ga0207643_10000030 | 3300025908 | Bacteria | 97831 |
| 518 | Ga0207643_10027333 | 3300025908 | Bacteria | 3162 |
| 519 | Ga0207643_10062760 | 3300025908 | Bacteria | 2123 |
| 520 | Ga0207643_10434898 | 3300025908 | Bacteria | 833 |
| 521 | Ga0207643_10462185 | 3300025908 | Bacteria | 808 |
| 522 | Ga0207705_10082987 | 3300025909 | Bacteria | 2338 |
| 523 | Ga0207705_10297961 | 3300025909 | Bacteria | 1236 |
| 524 | Ga0207705_10619940 | 3300025909 | Bacteria | 841 |
| 525 | Ga0207684_10006000 | 3300025910 | Bacteria | 11116 |
| 526 | Ga0207684_10155584 | 3300025910 | Bacteria | 1968 |
| 527 | Ga0207684_10551363 | 3300025910 | Bacteria | 986 |
| 528 | Ga0207684_10954250 | 3300025910 | Bacteria | 719 |
| 529 | Ga0207654_10046503 | 3300025911 | Bacteria | 2475 |
| 530 | Ga0207654_10680511 | 3300025911 | Bacteria | 738 |
| 531 | Ga0207707_10073376 | 3300025912 | Bacteria | 2984 |
| 532 | Ga0207707_10217654 | 3300025912 | Bacteria | 1663 |
| 533 | Ga0207695_10249706 | 3300025913 | Bacteria | 1674 |
| 534 | Ga0207671_10015931 | 3300025914 | Bacteria | 5862 |
| 535 | Ga0207671_10144851 | 3300025914 | Bacteria | 1832 |
| 536 | Ga0207663_11037228 | 3300025916 | Bacteria | 658 |
| 537 | Ga0207660_10129345 | 3300025917 | Bacteria | 1920 |
| 538 | Ga0207660_10494141 | 3300025917 | Bacteria | 992 |
| 539 | Ga0207662_10000271 | 3300025918 | Bacteria | 23849 |
| 540 | Ga0207662_10008804 | 3300025918 | Bacteria | 5538 |
| 541 | Ga0207662_10133430 | 3300025918 | Bacteria | 1567 |
| 542 | Ga0207662_10522370 | 3300025918 | Bacteria | 819 |
| 543 | Ga0207657_10000011 | 3300025919 | Bacteria | 186233 |
| 544 | Ga0207657_10049742 | 3300025919 | Bacteria | 3650 |
| 545 | Ga0207649_10008316 | 3300025920 | Bacteria | 5655 |
| 546 | Ga0207649_10212744 | 3300025920 | Bacteria | 1372 |
| 547 | Ga0207652_10009551 | 3300025921 | Bacteria | 7800 |
| 548 | Ga0207652_10078554 | 3300025921 | Bacteria | 2882 |
| 549 | Ga0207652_10147672 | 3300025921 | Bacteria | 2104 |
| 550 | Ga0207652_10685177 | 3300025921 | Bacteria | 915 |
| 551 | Ga0207652_10907633 | 3300025921 | Bacteria | 778 |
| 552 | Ga0207646_10037380 | 3300025922 | Bacteria | 4377 |
| 553 | Ga0207646_10107113 | 3300025922 | Bacteria | 2507 |
| 554 | Ga0207646_10866942 | 3300025922 | Bacteria | 802 |
| 555 | Ga0207646_11028223 | 3300025922 | Bacteria | 727 |
| 556 | Ga0207681_10000030 | 3300025923 | Bacteria | 173766 |
| 557 | Ga0207681_10002254 | 3300025923 | Bacteria | 12259 |
| 558 | Ga0207681_10040426 | 3300025923 | Bacteria | 3103 |
| 559 | Ga0207681_10050455 | 3300025923 | Bacteria | 2816 |
| 560 | Ga0207681_10528867 | 3300025923 | Bacteria | 968 |
| 561 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 562 | Ga0207694_10018119 | 3300025924 | Bacteria | 5324 |
| 563 | Ga0207694_10706353 | 3300025924 | Bacteria | 850 |
| 564 | Ga0207650_10000082 | 3300025925 | Bacteria | 128722 |
| 565 | Ga0207650_10003671 | 3300025925 | Bacteria | 10500 |
| 566 | Ga0207650_10083832 | 3300025925 | Bacteria | 2422 |
| 567 | Ga0207650_10088283 | 3300025925 | Bacteria | 2364 |
| 568 | Ga0207650_10286188 | 3300025925 | Bacteria | 1343 |
| 569 | Ga0207650_10414501 | 3300025925 | Bacteria | 1117 |
| 570 | Ga0207650_11448574 | 3300025925 | Bacteria | 584 |
| 571 | Ga0207659_10000169 | 3300025926 | Bacteria | 39159 |
| 572 | Ga0207659_10000843 | 3300025926 | Bacteria | 18152 |
| 573 | Ga0207659_10003434 | 3300025926 | Bacteria | 9499 |
| 574 | Ga0207659_10008702 | 3300025926 | Bacteria | 6317 |
| 575 | Ga0207659_10014994 | 3300025926 | Bacteria | 5011 |
| 576 | Ga0207659_10655067 | 3300025926 | Bacteria | 898 |
| 577 | Ga0207659_11000666 | 3300025926 | Bacteria | 719 |
| 578 | Ga0207687_10000005 | 3300025927 | Bacteria | 770649 |
| 579 | Ga0207687_10019566 | 3300025927 | Bacteria | 4486 |
| 580 | Ga0207687_10025639 | 3300025927 | Bacteria | 3945 |
| 581 | Ga0207687_10355127 | 3300025927 | Bacteria | 1195 |
| 582 | Ga0207687_10454432 | 3300025927 | Bacteria | 1063 |
| 583 | Ga0207664_11889263 | 3300025929 | Bacteria | 520 |
| 584 | Ga0207644_10000017 | 3300025931 | Bacteria | 177818 |
| 585 | Ga0207644_10001196 | 3300025931 | Bacteria | 16709 |
| 586 | Ga0207644_10010834 | 3300025931 | Bacteria | 6018 |
| 587 | Ga0207644_10015417 | 3300025931 | Bacteria | 5129 |
| 588 | Ga0207644_10278590 | 3300025931 | Bacteria | 1342 |
| 589 | Ga0207644_10396069 | 3300025931 | Bacteria | 1128 |
| 590 | Ga0207644_10785485 | 3300025931 | Bacteria | 796 |
| 591 | Ga0207690_10005181 | 3300025932 | Bacteria | 7689 |
| 592 | Ga0207690_10155537 | 3300025932 | Bacteria | 1699 |
| 593 | Ga0207690_10365538 | 3300025932 | Bacteria | 1144 |
| 594 | Ga0207706_10000034 | 3300025933 | Bacteria | 139105 |
| 595 | Ga0207706_10202278 | 3300025933 | Bacteria | 1742 |
| 596 | Ga0207686_10036644 | 3300025934 | Bacteria | 2954 |
| 597 | Ga0207686_10289976 | 3300025934 | Bacteria | 1211 |
| 598 | Ga0207686_10772179 | 3300025934 | Bacteria | 769 |
| 599 | Ga0207686_10855988 | 3300025934 | Bacteria | 732 |
| 600 | Ga0207709_10035416 | 3300025935 | Bacteria | 2951 |
| 601 | Ga0207709_10349548 | 3300025935 | Bacteria | 1115 |
| 602 | Ga0207670_10001213 | 3300025936 | Bacteria | 13605 |
| 603 | Ga0207670_10014044 | 3300025936 | Bacteria | 4742 |
| 604 | Ga0207670_10055322 | 3300025936 | Bacteria | 2681 |
| 605 | Ga0207670_10465613 | 3300025936 | Bacteria | 1021 |
| 606 | Ga0207669_10003369 | 3300025937 | Bacteria | 6911 |
| 607 | Ga0207669_10029450 | 3300025937 | Bacteria | 3037 |
| 608 | Ga0207669_10468273 | 3300025937 | Bacteria | 1002 |
| 609 | Ga0207669_10878782 | 3300025937 | Bacteria | 748 |
| 610 | Ga0207704_10001582 | 3300025938 | Bacteria | 10219 |
| 611 | Ga0207704_10309810 | 3300025938 | Bacteria | 1213 |
| 612 | Ga0207704_11339769 | 3300025938 | Bacteria | 612 |
| 613 | Ga0207665_10124947 | 3300025939 | Bacteria | 1821 |
| 614 | Ga0207665_10507278 | 3300025939 | Bacteria | 932 |
| 615 | Ga0207691_10002377 | 3300025940 | Bacteria | 18419 |
| 616 | Ga0207691_10019115 | 3300025940 | Bacteria | 6486 |
| 617 | Ga0207691_10028502 | 3300025940 | Bacteria | 5228 |
| 618 | Ga0207691_10065795 | 3300025940 | Bacteria | 3280 |
| 619 | Ga0207691_10130939 | 3300025940 | Bacteria | 2216 |
| 620 | Ga0207691_10146662 | 3300025940 | Bacteria | 2077 |
| 621 | Ga0207691_10535902 | 3300025940 | Bacteria | 993 |
| 622 | Ga0207711_10002481 | 3300025941 | Bacteria | 16454 |
| 623 | Ga0207711_10003920 | 3300025941 | Bacteria | 12809 |
| 624 | Ga0207711_10011639 | 3300025941 | Bacteria | 7310 |
| 625 | Ga0207711_10022799 | 3300025941 | Bacteria | 5239 |
| 626 | Ga0207711_10451419 | 3300025941 | Bacteria | 1197 |
| 627 | Ga0207711_11264963 | 3300025941 | Bacteria | 680 |
| 628 | Ga0207689_10000641 | 3300025942 | Bacteria | 33407 |
| 629 | Ga0207689_10042822 | 3300025942 | Bacteria | 3744 |
| 630 | Ga0207689_10437590 | 3300025942 | Bacteria | 1092 |
| 631 | Ga0207689_10455115 | 3300025942 | Bacteria | 1070 |
| 632 | Ga0207661_10000006 | 3300025944 | Bacteria | 537727 |
| 633 | Ga0207661_10019215 | 3300025944 | Bacteria | 5090 |
| 634 | Ga0207661_11230030 | 3300025944 | Bacteria | 689 |
| 635 | Ga0207679_10000559 | 3300025945 | Bacteria | 25007 |
| 636 | Ga0207679_10007400 | 3300025945 | Bacteria | 6960 |
| 637 | Ga0207679_10025854 | 3300025945 | Bacteria | 4042 |
| 638 | Ga0207679_10496921 | 3300025945 | Bacteria | 1088 |
| 639 | Ga0207679_10506541 | 3300025945 | Bacteria | 1078 |
| 640 | Ga0207667_10044132 | 3300025949 | Bacteria | 4726 |
| 641 | Ga0207667_11068780 | 3300025949 | Bacteria | 791 |
| 642 | Ga0207667_11476237 | 3300025949 | Bacteria | 652 |
| 643 | Ga0207651_10000455 | 3300025960 | Bacteria | 17270 |
| 644 | Ga0207651_10005338 | 3300025960 | Bacteria | 6587 |
| 645 | Ga0207651_10479816 | 3300025960 | Bacteria | 1071 |
| 646 | Ga0207651_11063499 | 3300025960 | Bacteria | 724 |
| 647 | Ga0207712_10004830 | 3300025961 | Bacteria | 8516 |
| 648 | Ga0207712_10307697 | 3300025961 | Bacteria | 1303 |
| 649 | Ga0207712_10426834 | 3300025961 | Bacteria | 1119 |
| 650 | Ga0207712_10846409 | 3300025961 | Bacteria | 806 |
| 651 | Ga0207712_10899409 | 3300025961 | Bacteria | 782 |
| 652 | Ga0207668_10000058 | 3300025972 | Bacteria | 92179 |
| 653 | Ga0207668_10000402 | 3300025972 | Bacteria | 27270 |
| 654 | Ga0207668_10001084 | 3300025972 | Bacteria | 16228 |
| 655 | Ga0207668_10713656 | 3300025972 | Bacteria | 882 |
| 656 | Ga0207668_11790493 | 3300025972 | Bacteria | 554 |
| 657 | Ga0207640_10001483 | 3300025981 | Bacteria | 12652 |
| 658 | Ga0207640_10518093 | 3300025981 | Bacteria | 996 |
| 659 | Ga0207658_10000023 | 3300025986 | Bacteria | 190806 |
| 660 | Ga0207658_10006186 | 3300025986 | Bacteria | 8173 |
| 661 | Ga0207658_10015862 | 3300025986 | Bacteria | 5172 |
| 662 | Ga0207658_10056354 | 3300025986 | Bacteria | 2916 |
| 663 | Ga0207658_10272420 | 3300025986 | Bacteria | 1447 |
| 664 | Ga0207658_10390448 | 3300025986 | Bacteria | 1221 |
| 665 | Ga0207677_10000101 | 3300026023 | Bacteria | 70739 |
| 666 | Ga0207677_10000141 | 3300026023 | Bacteria | 59003 |
| 667 | Ga0207677_10000597 | 3300026023 | Bacteria | 22260 |
| 668 | Ga0207677_10013756 | 3300026023 | Bacteria | 4698 |
| 669 | Ga0207677_11367572 | 3300026023 | Bacteria | 652 |
| 670 | Ga0207703_10000646 | 3300026035 | Bacteria | 34969 |
| 671 | Ga0207703_10003772 | 3300026035 | Bacteria | 12596 |
| 672 | Ga0207703_10011288 | 3300026035 | Bacteria | 6948 |
| 673 | Ga0207703_10025509 | 3300026035 | Bacteria | 4649 |
| 674 | Ga0207703_10036709 | 3300026035 | Bacteria | 3902 |
| 675 | Ga0207703_10152213 | 3300026035 | Bacteria | 2018 |
| 676 | Ga0207703_10297900 | 3300026035 | Bacteria | 1470 |
| 677 | Ga0207703_10637144 | 3300026035 | Bacteria | 1010 |
| 678 | Ga0207639_10012024 | 3300026041 | Bacteria | 6022 |
| 679 | Ga0207639_10212479 | 3300026041 | Bacteria | 1666 |
| 680 | Ga0207678_10000382 | 3300026067 | Bacteria | 40278 |
| 681 | Ga0207678_10473580 | 3300026067 | Bacteria | 1090 |
| 682 | Ga0207708_10019083 | 3300026075 | Bacteria | 5163 |
| 683 | Ga0207708_10107478 | 3300026075 | Bacteria | 2163 |
| 684 | Ga0207708_10454848 | 3300026075 | Bacteria | 1067 |
| 685 | Ga0207702_10000747 | 3300026078 | Bacteria | 34730 |
| 686 | Ga0207702_10003061 | 3300026078 | Bacteria | 15548 |
| 687 | Ga0207702_11129708 | 3300026078 | Bacteria | 778 |
| 688 | Ga0207641_10000119 | 3300026088 | Bacteria | 117312 |
| 689 | Ga0207641_10000293 | 3300026088 | Bacteria | 62674 |
| 690 | Ga0207641_10002454 | 3300026088 | Bacteria | 17139 |
| 691 | Ga0207641_10002919 | 3300026088 | Bacteria | 15481 |
| 692 | Ga0207641_10278913 | 3300026088 | Bacteria | 1571 |
| 693 | Ga0207641_10373131 | 3300026088 | Bacteria | 1364 |
| 694 | Ga0207641_10507609 | 3300026088 | Bacteria | 1172 |
| 695 | Ga0207648_10000117 | 3300026089 | Bacteria | 77423 |
| 696 | Ga0207648_10335963 | 3300026089 | Bacteria | 1360 |
| 697 | Ga0207648_10652183 | 3300026089 | Bacteria | 973 |
| 698 | Ga0207676_10000023 | 3300026095 | Bacteria | 266848 |
| 699 | Ga0207676_10001632 | 3300026095 | Bacteria | 16524 |
| 700 | Ga0207676_10007495 | 3300026095 | Bacteria | 7743 |
| 701 | Ga0207676_10014815 | 3300026095 | Bacteria | 5617 |
| 702 | Ga0207676_10047880 | 3300026095 | Bacteria | 3315 |
| 703 | Ga0207676_10171181 | 3300026095 | Bacteria | 1892 |
| 704 | Ga0207676_10188717 | 3300026095 | Bacteria | 1812 |
| 705 | Ga0207674_10001256 | 3300026116 | Bacteria | 33148 |
| 706 | Ga0207674_10097350 | 3300026116 | Bacteria | 2926 |
| 707 | Ga0207674_10133067 | 3300026116 | Bacteria | 2450 |
| 708 | Ga0207674_10405949 | 3300026116 | Bacteria | 1317 |
| 709 | Ga0207674_10451737 | 3300026116 | Bacteria | 1242 |
| 710 | Ga0207674_11191987 | 3300026116 | Bacteria | 731 |
| 711 | Ga0207675_100000221 | 3300026118 | Bacteria | 53325 |
| 712 | Ga0207675_100000748 | 3300026118 | Bacteria | 32341 |
| 713 | Ga0207675_100379760 | 3300026118 | Bacteria | 1389 |
| 714 | Ga0207675_100539314 | 3300026118 | Bacteria | 1165 |
| 715 | Ga0207683_10000052 | 3300026121 | Bacteria | 86161 |
| 716 | Ga0207683_10001846 | 3300026121 | Bacteria | 18729 |
| 717 | Ga0207683_10157782 | 3300026121 | Bacteria | 2050 |
| 718 | Ga0207683_10386835 | 3300026121 | Bacteria | 1286 |
| 719 | Ga0207683_10821957 | 3300026121 | Bacteria | 862 |
| 720 | Ga0207698_10001612 | 3300026142 | Bacteria | 13137 |
| 721 | Ga0207698_11071165 | 3300026142 | Bacteria | 818 |
| 722 | Ga0209588_1000034 | 3300027671 | Bacteria | 66337 |
| 723 | Ga0209588_1034864 | 3300027671 | Bacteria | 1617 |
| 724 | Ga0209813_10019110 | 3300027866 | Bacteria | 1901 |
| 725 | Ga0207428_10000030 | 3300027907 | Bacteria | 240846 |
| 726 | Ga0207428_10015732 | 3300027907 | Bacteria | 6533 |
| 727 | Ga0207428_10112819 | 3300027907 | Bacteria | 2090 |
| 728 | Ga0207428_10345276 | 3300027907 | Bacteria | 1096 |
| 729 | Ga0268266_10003323 | 3300028379 | Bacteria | 16140 |
| 730 | Ga0268266_10209431 | 3300028379 | Bacteria | 1787 |
| 731 | Ga0268266_10251851 | 3300028379 | Bacteria | 1634 |
| 732 | Ga0268265_10000074 | 3300028380 | Bacteria | 127599 |
| 733 | Ga0268265_10001297 | 3300028380 | Bacteria | 21480 |
| 734 | Ga0268265_10083495 | 3300028380 | Bacteria | 2529 |
| 735 | Ga0268265_10289007 | 3300028380 | Bacteria | 1471 |
| 736 | Ga0268265_10730524 | 3300028380 | Bacteria | 959 |
| 737 | Ga0268264_10000215 | 3300028381 | Bacteria | 113994 |
| 738 | Ga0268264_10001288 | 3300028381 | Bacteria | 23669 |
| 739 | Ga0268264_10001574 | 3300028381 | Bacteria | 21156 |
| 740 | Ga0268264_10005869 | 3300028381 | Bacteria | 10392 |
| 741 | Ga0268264_10028969 | 3300028381 | Bacteria | 4533 |
| 742 | Ga0268264_10042912 | 3300028381 | Bacteria | 3746 |
| 743 | Ga0268264_11113467 | 3300028381 | Bacteria | 798 |
| 744 | Ga0268264_11698265 | 3300028381 | Bacteria | 642 |
| 745 | Ga0265334_10094472 | 3300028573 | Bacteria | 1088 |
| 746 | Ga0265334_10117342 | 3300028573 | Bacteria | 953 |
| 747 | Ga0265318_10001354 | 3300028577 | Bacteria | 14601 |
| 748 | Ga0307515_10456415 | 3300028794 | Bacteria | 893 |
| 749 | Ga0265338_10086311 | 3300028800 | Bacteria | 2612 |
| 750 | Ga0265338_10156521 | 3300028800 | Bacteria | 1764 |
| 751 | Ga0311001_1065531 | 3300029277 | Bacteria | 860 |
| 752 | Ga0310981_1062149 | 3300029285 | Bacteria | 1421 |
| 753 | Ga0307511_10035882 | 3300030521 | Bacteria | 4321 |
| 754 | Ga0265330_10012809 | 3300031235 | Bacteria | 3914 |
| 755 | Ga0265332_10322798 | 3300031238 | Bacteria | 637 |
| 756 | Ga0265328_10079426 | 3300031239 | Bacteria | 1209 |
| 757 | Ga0265320_10035011 | 3300031240 | Bacteria | 2548 |
| 758 | Ga0265325_10021301 | 3300031241 | Bacteria | 3562 |
| 759 | Ga0265325_10060212 | 3300031241 | Bacteria | 1929 |
| 760 | Ga0265340_10024603 | 3300031247 | Bacteria | 3056 |
| 761 | Ga0265340_10068202 | 3300031247 | Bacteria | 1689 |
| 762 | Ga0265339_10006973 | 3300031249 | Bacteria | 7344 |
| 763 | Ga0265339_10028147 | 3300031249 | Bacteria | 3198 |
| 764 | Ga0265316_10020371 | 3300031344 | Bacteria | 5646 |
| 765 | Ga0265316_10131015 | 3300031344 | Bacteria | 1888 |
| 766 | Ga0265316_10331934 | 3300031344 | Bacteria | 1103 |
| 767 | Ga0307408_100475168 | 3300031548 | Bacteria | 1089 |
| 768 | Ga0307408_100637780 | 3300031548 | Bacteria | 951 |
| 769 | Ga0307408_101306425 | 3300031548 | Bacteria | 680 |
| 770 | Ga0265313_10011254 | 3300031595 | Bacteria | 5574 |
| 771 | Ga0265313_10039145 | 3300031595 | Bacteria | 2354 |
| 772 | Ga0307508_10056336 | 3300031616 | Bacteria | 3481 |
| 773 | Ga0316579_10033296 | 3300031691 | Bacteria | 2366 |
| 774 | Ga0265314_10049655 | 3300031711 | Bacteria | 2935 |
| 775 | Ga0265314_10087198 | 3300031711 | Bacteria | 2041 |
| 776 | Ga0265342_10000677 | 3300031712 | Bacteria | 35579 |
| 777 | Ga0265342_10003703 | 3300031712 | Bacteria | 12389 |
| 778 | Ga0307405_11103554 | 3300031731 | Bacteria | 682 |
| 779 | Ga0307405_11583799 | 3300031731 | Bacteria | 578 |
| 780 | Ga0307413_10854422 | 3300031824 | Bacteria | 769 |
| 781 | Ga0307406_11012386 | 3300031901 | Bacteria | 713 |
| 782 | Ga0307412_11478717 | 3300031911 | Bacteria | 617 |
| 783 | Ga0307412_11916637 | 3300031911 | Bacteria | 547 |
| 784 | Ga0307409_100438146 | 3300031995 | Bacteria | 1258 |
| 785 | Ga0316593_10009085 | 3300032168 | Bacteria | 2794 |
| 786 | Ga0307510_10255491 | 3300033180 | Bacteria | 1237 |
| 787 | Ga0373930_0060566 | 3300034816 | Bacteria | 844 |
| 788 | Ga0373934_0127623 | 3300035086 | Bacteria | 1036 |
| 789 | Ga0373951_0130114 | 3300035091 | Bacteria | 692 |
| 790 | Ga0373923_0157419 | 3300035111 | Bacteria | 1035 |
| 791 | Ga0373939_0055304 | 3300035114 | Bacteria | 1246 |
| 792 | Ga0373941_0012714 | 3300035115 | Bacteria | 2207 |
| 793 | Ga0373941_0242102 | 3300035115 | Bacteria | 701 |
| 794 | Ga0373953_0026669 | 3300035117 | Bacteria | 2215 |
| 795 | Ga0373954_0087403 | 3300035118 | Bacteria | 1494 |
| 796 | Ga0373954_0197171 | 3300035118 | Bacteria | 989 |
| 797 | Ga0373956_0323722 | 3300035119 | Bacteria | 735 |
| 798 | Ga0373946_0249273 | 3300035171 | Bacteria | 866 |
| 799 | Ga0373946_0530438 | 3300035171 | Bacteria | 606 |
| 800 | Ga0373946_0609317 | 3300035171 | Bacteria | 567 |
| 801 | Ga0373955_0339445 | 3300035172 | Bacteria | 909 |
| 802 | Ga0373942_0132723 | 3300035207 | Bacteria | 787 |
| 803 | Ga0373961_0006112 | 3300035241 | Bacteria | 2892 |
| 804 | Ga0373961_0081113 | 3300035241 | Bacteria | 1021 |
| 805 | Ga0373962_0117210 | 3300035242 | Bacteria | 846 |
| 806 | Ga0316574_0111493 | 3300035398 | Bacteria | 1754 |
| 807 | Ga0373931_0108446 | 3300035691 | Bacteria | 1572 |
| 808 | Ga0373931_0469816 | 3300035691 | Bacteria | 807 |
| 809 | Ga0373931_0563852 | 3300035691 | Bacteria | 741 |
| 810 | Ga0373935_0324241 | 3300035692 | Bacteria | 1093 |
| 811 | Ga0373933_0266107 | 3300035724 | Bacteria | 1106 |
| 812 | Ga0373947_0175682 | 3300035725 | Bacteria | 1392 |
| 813 | Ga0373947_0204773 | 3300035725 | Bacteria | 1292 |
| 814 | Ga0373937_0078196 | 3300036401 | Bacteria | 3057 |
| 815 | Ga0373937_0123566 | 3300036401 | Bacteria | 2413 |
| 816 | Ga0373937_0875140 | 3300036401 | Bacteria | 847 |
| 817 | Ga0316582_0281182 | 3300036647 | Bacteria | 1142 |
| 818 | Ga0373925_0263373 | 3300037068 | Bacteria | 1385 |
| 819 | Ga0373925_0955722 | 3300037068 | Bacteria | 706 |
| 820 | Ga0395899_0242304 | 3300037312 | Bacteria | 1240 |
| 821 | Ga0395899_0269986 | 3300037312 | Bacteria | 1160 |
| 822 | Ga0395900_0112357 | 3300037418 | Bacteria | 2797 |
| 823 | Ga0395900_0137697 | 3300037418 | Bacteria | 2501 |
| 824 | Ga0395900_0273577 | 3300037418 | Bacteria | 1683 |
| 825 | Ga0395898_0118813 | 3300037466 | Bacteria | 2532 |
| 826 | Ga0395898_0161600 | 3300037466 | Bacteria | 2142 |
| 827 | Ga0395898_0715060 | 3300037466 | Bacteria | 943 |
| 828 | Ga0395898_1201500 | 3300037466 | Bacteria | 689 |
| 829 | Ga0395905_0953119 | 3300037471 | Bacteria | 761 |
| 830 | Ga0436364_0088257 | 3300037853 | Bacteria | 716 |
| 831 | Ga0436364_0947734 | 3300037853 | Bacteria | 1001 |
| 832 | Ga0395901_0077174 | 3300038443 | Bacteria | 3477 |
| 833 | Ga0395901_0093453 | 3300038443 | Bacteria | 3149 |
| 834 | Ga0436365_0179814 | 3300039437 | Bacteria | 665 |
| 835 | Ga0436365_0197039 | 3300039437 | Bacteria | 92371 |
| 836 | Ga0436365_1510825 | 3300039437 | Bacteria | 619 |
| 837 | Ga0436360_1030095 | 3300039438 | Bacteria | 907 |
| 838 | Ga0436363_1487013 | 3300039450 | Bacteria | 968 |
| 839 | Ga0436363_1554023 | 3300039450 | Bacteria | 1509 |
| 840 | Ga0436363_1709560 | 3300039450 | Bacteria | 1403 |
| 841 | Ga0436362_0549823 | 3300039453 | Bacteria | 514 |
| 842 | Ga0436362_0795304 | 3300039453 | Bacteria | 1297 |
| 843 | Ga0436362_1063276 | 3300039453 | Bacteria | 20265 |
| 844 | Ga0451798_0719119 | 3300041458 | Bacteria | 638 |
| 845 | Ga0451855_1960161 | 3300041511 | Bacteria | 782 |
| 846 | Ga0439455_0002430 | 3300042012 | Bacteria | 3384 |
| 847 | Ga0450923_138805 | 3300042125 | Bacteria | 583 |
| 848 | Ga0450902_061543 | 3300042137 | Bacteria | 650 |
| 849 | Ga0439434_0010819 | 3300042435 | Bacteria | 2693 |
| 850 | Ga0439459_0102457 | 3300042438 | Bacteria | 702 |
| 851 | Ga0439464_0103232 | 3300042439 | Bacteria | 868 |
| 852 | Ga0439460_0015566 | 3300042461 | Bacteria | 2015 |
| 853 | Ga0451577_0011021 | 3300042876 | Bacteria | 8587 |
| 854 | Ga0451577_0049881 | 3300042876 | Bacteria | 3736 |
| 855 | Ga0451577_0071974 | 3300042876 | Bacteria | 3083 |
| 856 | Ga0451577_0174276 | 3300042876 | Bacteria | 1938 |
| 857 | Ga0451577_0197157 | 3300042876 | Bacteria | 1817 |
| 858 | Ga0466972_0051802 | 3300044658 | Bacteria | 1980 |
| 859 | Ga0466972_0065614 | 3300044658 | Bacteria | 1736 |
| 860 | Ga0453683_0001246 | 3300044673 | Bacteria | 22711 |
| 861 | Ga0453683_0007125 | 3300044673 | Bacteria | 7617 |
| 862 | Ga0453683_0007146 | 3300044673 | Bacteria | 7609 |
| 863 | Ga0453683_0015865 | 3300044673 | Bacteria | 4870 |
| 864 | Ga0453683_0026252 | 3300044673 | Bacteria | 3699 |
| 865 | Ga0466963_0030514 | 3300044694 | Bacteria | 3479 |
| 866 | Ga0453684_0007935 | 3300044712 | Bacteria | 19255 |
| 867 | Ga0453684_0018536 | 3300044712 | Bacteria | 10671 |
| 868 | Ga0466957_0094687 | 3300044842 | Bacteria | 1875 |
| 869 | Ga0466957_0558926 | 3300044842 | Bacteria | 798 |
| 870 | Ga0466957_0920102 | 3300044842 | Bacteria | 625 |
| 871 | Ga0451576_0000111 | 3300045051 | Bacteria | 209824 |
| 872 | Ga0451576_0004454 | 3300045051 | Bacteria | 18163 |
| 873 | Ga0451576_0046783 | 3300045051 | Bacteria | 4554 |
| 874 | Ga0451576_0175522 | 3300045051 | Bacteria | 2237 |
| 875 | Ga0451576_0544333 | 3300045051 | Bacteria | 1220 |
| 876 | Ga0451576_0745148 | 3300045051 | Bacteria | 1029 |
| 877 | Ga0451576_1144712 | 3300045051 | Bacteria | 813 |
| 878 | Ga0466967_0025273 | 3300045976 | Bacteria | 4895 |
| 879 | Ga0466967_0722947 | 3300045976 | Bacteria | 987 |
| 880 | Ga0466967_0770455 | 3300045976 | Bacteria | 955 |
| 881 | Ga0495592_0036142 | 3300046454 | Bacteria | 3721 |
| 882 | Ga0495592_0118607 | 3300046454 | Bacteria | 1864 |
| 883 | Ga0495629_0072313 | 3300046459 | Bacteria | 2407 |
| 884 | Ga0495651_0191065 | 3300046462 | Bacteria | 1441 |
| 885 | Ga0495651_0650703 | 3300046462 | Bacteria | 661 |
| 886 | Ga0495650_0003288 | 3300046471 | Bacteria | 11949 |
| 887 | Ga0495580_0082266 | 3300046472 | Bacteria | 2244 |
| 888 | Ga0495580_0107955 | 3300046472 | Bacteria | 1933 |
| 889 | Ga0495580_0395404 | 3300046472 | Bacteria | 932 |
| 890 | Ga0495580_0813812 | 3300046472 | Bacteria | 605 |
| 891 | Ga0495605_0058483 | 3300046474 | Bacteria | 1853 |
| 892 | Ga0495662_0066154 | 3300046476 | Bacteria | 1748 |
| 893 | Ga0495664_0035203 | 3300046477 | Bacteria | 2948 |
| 894 | Ga0495608_0010700 | 3300046511 | Bacteria | 6400 |
| 895 | Ga0495608_0403862 | 3300046511 | Bacteria | 835 |
| 896 | Ga0495618_0104683 | 3300046514 | Bacteria | 1812 |
| 897 | Ga0495618_0207056 | 3300046514 | Bacteria | 1240 |
| 898 | Ga0495628_0320942 | 3300046516 | Bacteria | 1143 |
| 899 | Ga0495628_1082799 | 3300046516 | Bacteria | 548 |
| 900 | Ga0495630_0291352 | 3300046517 | Bacteria | 1247 |
| 901 | Ga0495631_0381839 | 3300046518 | Bacteria | 600 |
| 902 | Ga0495642_0226844 | 3300046528 | Bacteria | 816 |
| 903 | Ga0495654_0163918 | 3300046530 | Bacteria | 974 |
| 904 | Ga0495586_0097597 | 3300046535 | Bacteria | 1628 |
| 905 | Ga0495586_0360711 | 3300046535 | Bacteria | 835 |
| 906 | Ga0495587_0272272 | 3300046536 | Bacteria | 950 |
| 907 | Ga0495598_0023404 | 3300046537 | Bacteria | 1663 |
| 908 | Ga0495598_0075735 | 3300046537 | Bacteria | 1069 |
| 909 | Ga0495598_0170017 | 3300046537 | Bacteria | 772 |
| 910 | Ga0495621_0008145 | 3300046539 | Bacteria | 3131 |
| 911 | Ga0495621_0342253 | 3300046539 | Bacteria | 626 |
| 912 | Ga0495622_0056063 | 3300046557 | Bacteria | 1827 |
| 913 | Ga0495667_0019223 | 3300046559 | Bacteria | 4610 |
| 914 | Ga0495667_0275771 | 3300046559 | Bacteria | 1068 |
| 915 | Ga0495656_0032177 | 3300046615 | Bacteria | 2133 |
| 916 | Ga0495656_0129108 | 3300046615 | Bacteria | 1201 |
| 917 | Ga0495656_0262518 | 3300046615 | Bacteria | 875 |
| 918 | Ga0495634_0073151 | 3300046642 | Bacteria | 2254 |
| 919 | Ga0495625_0118368 | 3300046660 | Bacteria | 1805 |
| 920 | Ga0495625_0524427 | 3300046660 | Bacteria | 721 |
| 921 | Ga0495635_0397037 | 3300046663 | Bacteria | 916 |
| 922 | Ga0495588_0169117 | 3300046674 | Bacteria | 1156 |
| 923 | Ga0495657_0003663 | 3300046675 | Bacteria | 12468 |
| 924 | Ga0495599_0066457 | 3300046678 | Bacteria | 2252 |
| 925 | Ga0495599_0436628 | 3300046678 | Bacteria | 776 |
| 926 | Ga0495623_0357100 | 3300046679 | Bacteria | 795 |
| 927 | Ga0495646_0300812 | 3300046680 | Bacteria | 849 |
| 928 | Ga0495647_0052339 | 3300046681 | Bacteria | 1590 |
| 929 | Ga0495658_0007992 | 3300046683 | Bacteria | 5240 |
| 930 | Ga0495658_0078984 | 3300046683 | Bacteria | 1927 |
| 931 | Ga0495658_0170796 | 3300046683 | Bacteria | 1345 |
| 932 | Ga0495658_0213147 | 3300046683 | Bacteria | 1207 |
| 933 | Ga0495613_0077777 | 3300046689 | Bacteria | 2413 |
| 934 | Ga0495613_0191613 | 3300046689 | Bacteria | 1445 |
| 935 | Ga0495671_0216584 | 3300046692 | Bacteria | 927 |
| 936 | Ga0495604_0092906 | 3300047317 | Bacteria | 2234 |
| 937 | Ga0495636_0008939 | 3300047318 | Bacteria | 3946 |
| 938 | Ga0495636_0121635 | 3300047318 | Bacteria | 1155 |
| 939 | Ga0495636_0142961 | 3300047318 | Bacteria | 1069 |
| 940 | Ga0495674_0045230 | 3300047319 | Bacteria | 3909 |
| 941 | Ga0495674_1075686 | 3300047319 | Bacteria | 613 |
| 942 | Ga0495674_1129582 | 3300047319 | Bacteria | 595 |
| 943 | Ga0495672_0048433 | 3300047320 | Bacteria | 2520 |
| 944 | Ga0495680_0485530 | 3300047322 | Bacteria | 841 |
| 945 | Ga0495675_0147189 | 3300047444 | Bacteria | 1457 |
| 946 | Ga0495685_024682 | 3300047447 | Bacteria | 2069 |
| 947 | Ga0495685_145644 | 3300047447 | Bacteria | 770 |
| 948 | Ga0495684_0049455 | 3300047471 | Bacteria | 3212 |
| 949 | Ga0495684_0204759 | 3300047471 | Bacteria | 1453 |
| 950 | Ga0495602_0065592 | 3300048088 | Bacteria | 3133 |
| 951 | Ga0495615_0001222 | 3300048090 | Bacteria | 3741 |
| 952 | Ga0495615_0137478 | 3300048090 | Bacteria | 718 |
| 953 | Ga0496100_0267809 | 3300048903 | Bacteria | 1269 |
| 954 | Ga0496100_0416605 | 3300048903 | Bacteria | 1025 |
| 955 | Ga0496101_0485761 | 3300048904 | Bacteria | 975 |
| 956 | Ga0496102_0026473 | 3300048905 | Bacteria | 5173 |
| 957 | Ga0496103_0070047 | 3300048906 | Bacteria | 2194 |
| 958 | Ga0496104_0064959 | 3300048907 | Bacteria | 3462 |
| 959 | Ga0496104_0449561 | 3300048907 | Bacteria | 1200 |
| 960 | Ga0496104_0811981 | 3300048907 | Bacteria | 841 |
| 961 | Ga0496105_0915270 | 3300048908 | Bacteria | 660 |
| 962 | Ga0496106_0051437 | 3300048909 | Bacteria | 3106 |
| 963 | Ga0496106_0118271 | 3300048909 | Bacteria | 2069 |
| 964 | Ga0496108_0047479 | 3300048911 | Bacteria | 3589 |
| 965 | Ga0496108_0676423 | 3300048911 | Bacteria | 896 |
| 966 | Ga0496109_0048256 | 3300048912 | Bacteria | 3874 |
| 967 | Ga0496109_0570939 | 3300048912 | Bacteria | 1066 |
| 968 | Ga0496112_0001881 | 3300048915 | Bacteria | 16542 |
| 969 | Ga0496112_0046095 | 3300048915 | Bacteria | 4275 |
| 970 | Ga0496112_0449655 | 3300048915 | Bacteria | 1226 |
| 971 | Ga0496112_0465343 | 3300048915 | Bacteria | 1202 |
| 972 | Ga0496112_1500049 | 3300048915 | Bacteria | 588 |
| 973 | Ga0496113_0047258 | 3300048916 | Bacteria | 3198 |
| 974 | Ga0496114_0188257 | 3300048917 | Bacteria | 1805 |
| 975 | Ga0496114_0521036 | 3300048917 | Bacteria | 1051 |
| 976 | Ga0496115_0319671 | 3300048918 | Bacteria | 1270 |
| 977 | Ga0496115_0526063 | 3300048918 | Bacteria | 948 |
| 978 | Ga0496117_0090809 | 3300048920 | Bacteria | 1967 |
| 979 | Ga0496118_0139113 | 3300048921 | Bacteria | 1543 |
| 980 | Ga0496121_0129576 | 3300048924 | Bacteria | 1891 |
| 981 | Ga0496124_0242913 | 3300048927 | Bacteria | 1338 |
| 982 | Ga0496126_0304812 | 3300048929 | Bacteria | 1313 |
| 983 | Ga0501031_0152935 | 3300049568 | Bacteria | 1508 |
| 984 | Ga0501031_0153796 | 3300049568 | Bacteria | 1503 |
| 985 | Ga0501032_0274872 | 3300049569 | Bacteria | 1091 |
| 986 | Ga0501032_0320325 | 3300049569 | Bacteria | 1001 |
| 987 | Ga0501032_0379967 | 3300049569 | Bacteria | 908 |
| 988 | Ga0501033_0016169 | 3300049570 | Bacteria | 5650 |
| 989 | Ga0501033_0305511 | 3300049570 | Bacteria | 1119 |
| 990 | Ga0501034_0609764 | 3300049571 | Bacteria | 996 |
| 991 | Ga0501034_0734737 | 3300049571 | Bacteria | 883 |
| 992 | Ga0501036_0065956 | 3300049572 | Bacteria | 3063 |
| 993 | Ga0501036_1037048 | 3300049572 | Bacteria | 671 |
| 994 | Ga0501037_0412319 | 3300049573 | Bacteria | 925 |
| 995 | Ga0501037_0459168 | 3300049573 | Bacteria | 868 |
| 996 | Ga0501038_0229312 | 3300049574 | Bacteria | 1478 |
| 997 | Ga0501038_0242797 | 3300049574 | Bacteria | 1429 |
| 998 | Ga0501038_0644696 | 3300049574 | Bacteria | 798 |
| 999 | Ga0501039_0217604 | 3300049575 | Bacteria | 1502 |
| 1000 | Ga0501039_0243510 | 3300049575 | Bacteria | 1414 |
| 1001 | Ga0501039_0373946 | 3300049575 | Bacteria | 1119 |
| 1002 | Ga0501040_0137947 | 3300049576 | Bacteria | 1717 |
| 1003 | Ga0501040_0234445 | 3300049576 | Bacteria | 1307 |
| 1004 | Ga0501040_0501718 | 3300049576 | Bacteria | 875 |
| 1005 | Ga0501041_0030975 | 3300049577 | Bacteria | 3229 |
| 1006 | Ga0501041_0614632 | 3300049577 | Bacteria | 694 |
| 1007 | Ga0501042_0114816 | 3300049578 | Bacteria | 1939 |
| 1008 | Ga0501042_0487907 | 3300049578 | Bacteria | 894 |
| 1009 | Ga0501043_0223695 | 3300049579 | Bacteria | 1455 |
| 1010 | Ga0501043_0715987 | 3300049579 | Bacteria | 730 |
| 1011 | Ga0501043_0757533 | 3300049579 | Bacteria | 705 |
| 1012 | Ga0501046_0050901 | 3300049580 | Bacteria | 3271 |
| 1013 | Ga0501046_0806479 | 3300049580 | Bacteria | 658 |
| 1014 | Ga0501047_0003663 | 3300049581 | Bacteria | 14480 |
| 1015 | Ga0501047_0083044 | 3300049581 | Bacteria | 3079 |
| 1016 | Ga0501047_0110366 | 3300049581 | Bacteria | 2633 |
| 1017 | Ga0501047_0220847 | 3300049581 | Bacteria | 1751 |
| 1018 | Ga0501047_0727284 | 3300049581 | Bacteria | 809 |
| 1019 | Ga0501048_0029347 | 3300049582 | Bacteria | 3989 |
| 1020 | Ga0501048_0278568 | 3300049582 | Bacteria | 1189 |
| 1021 | Ga0501067_0142140 | 3300049583 | Bacteria | 1336 |
| 1022 | Ga0501069_0770629 | 3300049585 | Bacteria | 582 |
| 1023 | Ga0501071_0216397 | 3300049587 | Bacteria | 1441 |
| 1024 | Ga0501071_0271111 | 3300049587 | Bacteria | 1283 |
| 1025 | Ga0501071_0473090 | 3300049587 | Bacteria | 960 |
| 1026 | Ga0501072_0072540 | 3300049588 | Bacteria | 2721 |
| 1027 | Ga0501072_0170249 | 3300049588 | Bacteria | 1738 |
| 1028 | Ga0501073_0339821 | 3300049589 | Bacteria | 1036 |
| 1029 | Ga0501073_0483357 | 3300049589 | Bacteria | 856 |
| 1030 | Ga0501073_0564823 | 3300049589 | Bacteria | 786 |
| 1031 | Ga0501073_0783609 | 3300049589 | Bacteria | 657 |
| 1032 | Ga0501074_0165656 | 3300049590 | Bacteria | 1578 |
| 1033 | Ga0501074_0299453 | 3300049590 | Bacteria | 1142 |
| 1034 | Ga0501074_0494273 | 3300049590 | Bacteria | 867 |
| 1035 | Ga0501074_0918862 | 3300049590 | Bacteria | 616 |
| 1036 | Ga0501075_0019376 | 3300049591 | Bacteria | 4935 |
| 1037 | Ga0501075_0807827 | 3300049591 | Bacteria | 714 |
| 1038 | Ga0501076_0034438 | 3300049592 | Bacteria | 3958 |
| 1039 | Ga0501077_0165530 | 3300049593 | Bacteria | 1405 |
| 1040 | Ga0501077_0289589 | 3300049593 | Bacteria | 1043 |
| 1041 | Ga0501077_0403661 | 3300049593 | Bacteria | 874 |
| 1042 | Ga0501077_0442928 | 3300049593 | Bacteria | 832 |
| 1043 | Ga0501077_0552859 | 3300049593 | Bacteria | 739 |
| 1044 | Ga0501238_006454 | 3300049671 | Bacteria | 1512 |
| 1045 | Ga0501079_0206220 | 3300049741 | Bacteria | 1535 |
| 1046 | Ga0501079_0373683 | 3300049741 | Bacteria | 1117 |
| 1047 | Ga0501080_0002922 | 3300049742 | Bacteria | 15012 |
| 1048 | Ga0501080_0005645 | 3300049742 | Bacteria | 11182 |
| 1049 | Ga0501080_0079724 | 3300049742 | Bacteria | 3044 |
| 1050 | Ga0501080_0243872 | 3300049742 | Bacteria | 1639 |
| 1051 | Ga0501080_0821172 | 3300049742 | Bacteria | 814 |
| 1052 | Ga0501081_0188157 | 3300049743 | Bacteria | 1494 |
| 1053 | Ga0501081_0328053 | 3300049743 | Bacteria | 1126 |
| 1054 | Ga0501081_0369036 | 3300049743 | Bacteria | 1059 |
| 1055 | Ga0501081_0733143 | 3300049743 | Bacteria | 742 |
| 1056 | Ga0501081_0817036 | 3300049743 | Bacteria | 702 |
| 1057 | Ga0501083_0004955 | 3300049744 | Bacteria | 9433 |
| 1058 | Ga0501083_0555067 | 3300049744 | Bacteria | 747 |
| 1059 | Ga0501083_0599928 | 3300049744 | Bacteria | 716 |
| 1060 | Ga0501241_047777 | 3300049758 | Bacteria | 840 |
| 1061 | Ga0501269_013888 | 3300049766 | Bacteria | 987 |
| 1062 | Ga0501035_0000846 | 3300049822 | Bacteria | 32725 |
| 1063 | Ga0501035_0005931 | 3300049822 | Bacteria | 11499 |
| 1064 | Ga0501035_0339713 | 3300049822 | Bacteria | 1258 |
| 1065 | Ga0501035_1044297 | 3300049822 | Bacteria | 641 |
| 1066 | Ga0501044_0083371 | 3300049823 | Bacteria | 3233 |
| 1067 | Ga0501045_0064750 | 3300049824 | Bacteria | 2683 |
| 1068 | Ga0501045_0415852 | 3300049824 | Bacteria | 1000 |
| 1069 | Ga0501045_0823222 | 3300049824 | Bacteria | 683 |
| 1070 | nmdc:mga03683_3558_c1 | 3300050489 | Bacteria | 5047 |
| 1071 | nmdc:mga03n38_220507_c1 | 3300050490 | Bacteria | 990 |
| 1072 | nmdc:mga03n38_265177_c1 | 3300050490 | Bacteria | 912 |
| 1073 | nmdc:mga00v17_15446_c1 | 3300050491 | Bacteria | 4286 |
| 1074 | nmdc:mga00v17_75294_c1 | 3300050491 | Bacteria | 2099 |
| 1075 | nmdc:mga0yw44_539059_c1 | 3300050492 | Bacteria | 792 |
| 1076 | nmdc:mga0k408_8408_c1 | 3300050493 | Bacteria | 5539 |
| 1077 | nmdc:mga06z11_336225_c1 | 3300050494 | Bacteria | 902 |
| 1078 | nmdc:mga06z11_42917_c1 | 3300050494 | Bacteria | 2272 |
| 1079 | nmdc:mga06z11_610871_c1 | 3300050494 | Bacteria | 663 |
| 1080 | nmdc:mga04h51_12737_c1 | 3300050495 | Bacteria | 2368 |
| 1081 | nmdc:mga07m45_208382_c1 | 3300050496 | Bacteria | 1137 |
| 1082 | nmdc:mga07m45_412390_c1 | 3300050496 | Bacteria | 784 |
| 1083 | nmdc:mga05p37_1025701_c1 | 3300050507 | Bacteria | 873 |
| 1084 | nmdc:mga05p37_1166400_c1 | 3300050507 | Bacteria | 800 |
| 1085 | nmdc:mga05p37_1310291_c1 | 3300050507 | Bacteria | 737 |
| 1086 | nmdc:mga05p37_133260_c1 | 3300050507 | Bacteria | 3048 |
| 1087 | nmdc:mga05p37_154302_c1 | 3300050507 | Bacteria | 2807 |
| 1088 | nmdc:mga05p37_1690684_c1 | 3300050507 | Bacteria | 618 |
| 1089 | nmdc:mga05p37_449385_c1 | 3300050507 | Bacteria | 1492 |
| 1090 | nmdc:mga05p37_672497_c1 | 3300050507 | Bacteria | 1155 |
| 1091 | nmdc:mga05p37_75430_c1 | 3300050507 | Bacteria | 4151 |
| 1092 | nmdc:mga05p37_829381_c1 | 3300050507 | Bacteria | 1007 |
| 1093 | nmdc:mga09592_40777_c1 | 3300050508 | Bacteria | 3901 |
| 1094 | nmdc:mga09592_458426_c1 | 3300050508 | Bacteria | 1099 |
| 1095 | nmdc:mga09592_494399_c1 | 3300050508 | Bacteria | 1053 |
| 1096 | nmdc:mga09592_602893_c1 | 3300050508 | Bacteria | 941 |
| 1097 | nmdc:mga09592_906705_c1 | 3300050508 | Bacteria | 741 |
| 1098 | nmdc:mga0qj67_133188_c1 | 3300050509 | Bacteria | 2013 |
| 1099 | nmdc:mga06r32_183757_c1 | 3300050510 | Bacteria | 2077 |
| 1100 | nmdc:mga06r32_263611_c1 | 3300050510 | Bacteria | 1711 |
| 1101 | nmdc:mga06r32_36731_c1 | 3300050510 | Bacteria | 4632 |
| 1102 | nmdc:mga06r32_631650_c1 | 3300050510 | Bacteria | 1040 |
| 1103 | nmdc:mga08y16_170026_c1 | 3300050511 | Bacteria | 2264 |
| 1104 | nmdc:mga08y16_220465_c1 | 3300050511 | Bacteria | 1964 |
| 1105 | nmdc:mga08y16_245224_c1 | 3300050511 | Bacteria | 1851 |
| 1106 | nmdc:mga08y16_24_c1 | 3300050511 | Bacteria | 240846 |
| 1107 | nmdc:mga08y16_253285_c1 | 3300050511 | Bacteria | 1819 |
| 1108 | nmdc:mga08y16_51099_c1 | 3300050511 | Bacteria | 4325 |
| 1109 | nmdc:mga08y16_687632_c1 | 3300050511 | Bacteria | 1024 |
| 1110 | nmdc:mga08y16_794313_c1 | 3300050511 | Bacteria | 940 |
| 1111 | nmdc:mga0n895_1195010_c1 | 3300050512 | Bacteria | 735 |
| 1112 | nmdc:mga0n895_187311_c1 | 3300050512 | Bacteria | 2100 |
| 1113 | nmdc:mga0n895_212802_c1 | 3300050512 | Bacteria | 1963 |
| 1114 | nmdc:mga0n895_36271_c1 | 3300050512 | Bacteria | 4761 |
| 1115 | nmdc:mga0n895_4474_c1 | 3300050512 | Bacteria | 11485 |
| 1116 | nmdc:mga0n895_47539_c1 | 3300050512 | Bacteria | 4195 |
| 1117 | nmdc:mga0n895_612349_c1 | 3300050512 | Bacteria | 1090 |
| 1118 | nmdc:mga0n895_76676_c1 | 3300050512 | Bacteria | 3324 |
| 1119 | nmdc:mga0rr50_273683_c1 | 3300050513 | Bacteria | 1408 |
| 1120 | nmdc:mga0rr50_366010_c1 | 3300050513 | Bacteria | 1214 |
| 1121 | nmdc:mga0rr50_48478_c1 | 3300050513 | Bacteria | 3140 |
| 1122 | nmdc:mga0rr50_61265_c1 | 3300050513 | Bacteria | 2834 |
| 1123 | nmdc:mga0rr50_619836_c1 | 3300050513 | Bacteria | 923 |
| 1124 | nmdc:mga08x19_175948_c1 | 3300050514 | Bacteria | 1459 |
| 1125 | nmdc:mga08x19_72375_c1 | 3300050514 | Bacteria | 2248 |
| 1126 | nmdc:mga08x19_76140_c1 | 3300050514 | Bacteria | 2195 |
| 1127 | nmdc:mga0a205_101698_c1 | 3300050515 | Bacteria | 2773 |
| 1128 | nmdc:mga0a205_17718_c1 | 3300050515 | Bacteria | 6683 |
| 1129 | nmdc:mga0a205_711411_c1 | 3300050515 | Bacteria | 854 |
| 1130 | nmdc:mga0a205_953948_c1 | 3300050515 | Bacteria | 704 |
| 1131 | nmdc:mga0sz30_5881_c1 | 3300050516 | Bacteria | 4525 |
| 1132 | Ga0495601_0314594 | 3300053077 | Bacteria | 1020 |
| 1133 | Ga0495595_0251079 | 3300053084 | Bacteria | 886 |
| 1134 | Ga0495595_0365379 | 3300053084 | Bacteria | 729 |
| 1135 | Ga0495595_0488473 | 3300053084 | Bacteria | 627 |
| 1136 | Ga0495619_0162694 | 3300053085 | Bacteria | 1542 |
| 1137 | Ga0500643_009467 | 3300053087 | Bacteria | 3721 |
| 1138 | Ga0500562_004475 | 3300053108 | Bacteria | 3533 |
| 1139 | Ga0500594_0020014 | 3300053118 | Bacteria | 1665 |
| 1140 | Ga0500608_265300 | 3300053122 | Bacteria | 660 |
| 1141 | Ga0500616_0039467 | 3300053153 | Bacteria | 2545 |
| 1142 | Ga0500645_019607 | 3300053730 | Bacteria | 2102 |
| 1143 | Ga0500645_104850 | 3300053730 | Bacteria | 795 |
| 1144 | Ga0501084_0041457 | 3300054114 | Bacteria | 3851 |
| 1145 | Ga0501084_0647331 | 3300054114 | Bacteria | 892 |
| 1146 | Ga0587080_162691 | 3300059503 | Bacteria | 524 |
| 1147 | Ga0587083_0090773 | 3300059505 | Bacteria | 744 |
| 1148 | Ga0587115_008996 | 3300059626 | Bacteria | 1217 |
| 1149 | Ga0587107_013294 | 3300059652 | Bacteria | 1041 |
| 1150 | Ga0501082_0187061 | 3300060353 | Bacteria | 1802 |
| 1151 | Ga0501082_0258583 | 3300060353 | Bacteria | 1514 |
| 1152 | Ga0501082_0716355 | 3300060353 | Bacteria | 876 |
| 1153 | Ga0501082_0723849 | 3300060353 | Bacteria | 871 |
| 1154 | Ga0466962_0279927 | 3300061719 | Bacteria | 823 |
| 1155 | Ga0530510_0071728 | 3300061734 | Bacteria | 2514 |
| 1156 | Ga0530510_0108992 | 3300061734 | Bacteria | 2027 |
| 1157 | Ga0530510_0591101 | 3300061734 | Bacteria | 844 |
| 1158 | Ga0530510_1263601 | 3300061734 | Bacteria | 566 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003320 | rootH2_10110168 | rootH2_101101682 | 147 |
| 2 | 3300053108 | Ga0500562_004475 | Ga0500562_004475_2469_3017 | 148 |
| 3 | iso_pu_bacteria | 2507262055 | 2507509786 | 152 |
| 4 | iso_pu_bacteria | 2508501009 | 2508543802 | 152 |
| 5 | iso_pu_bacteria | 2508501042 | 2508698410 | 152 |
| 6 | iso_pu_bacteria | 2510917021 | 2511127743 | 152 |
| 7 | iso_pu_bacteria | 2511231028 | 2511396986 | 152 |
| 8 | iso_pu_bacteria | 2513237092 | 2513625264 | 152 |
| 9 | iso_pu_bacteria | 2513237094 | 2513644581 | 152 |
| 10 | iso_pu_bacteria | 2513237095 | 2513646148 | 152 |
| 11 | iso_pu_bacteria | 2513237096 | 2513658384 | 152 |
| 12 | iso_pu_bacteria | 2513237098 | 2513678623 | 152 |
| 13 | iso_pu_bacteria | 2513237101 | 2513695945 | 152 |
| 14 | iso_pu_bacteria | 2513237102 | 2513701027 | 152 |
| 15 | iso_pu_bacteria | 2513237104 | 2513715024 | 152 |
| 16 | iso_pu_bacteria | 2513237137 | 2513857540 | 152 |
| 17 | iso_pu_bacteria | 2513237139 | 2513875864 | 152 |
| 18 | iso_pu_bacteria | 2513237141 | 2513894223 | 152 |
| 19 | iso_pu_bacteria | 2513237145 | 2513920124 | 152 |
| 20 | iso_pu_bacteria | 2513237161 | 2514011469 | 152 |
| 21 | iso_pu_bacteria | 2515154112 | 2515630002 | 152 |
| 22 | iso_pu_bacteria | 2517093001 | 2517103514 | 152 |
| 23 | iso_pu_bacteria | 2517572143 | 2517893493 | 152 |
| 24 | iso_pu_bacteria | 2524023205 | 2524441023 | 152 |
| 25 | iso_pu_bacteria | 2524023210 | 2524469965 | 152 |
| 26 | iso_pu_bacteria | 2524023228 | 2524537998 | 152 |
| 27 | iso_pu_bacteria | 2528768022 | 2528856469 | 152 |
| 28 | iso_pu_bacteria | 2602042107 | 2603857120 | 152 |
| 29 | iso_pu_bacteria | 2617270735 | 2617349310 | 152 |
| 30 | iso_pu_bacteria | 2617270741 | 2617378167 | 152 |
| 31 | iso_pu_bacteria | 2643221547 | 2643755775 | 152 |
| 32 | iso_pu_bacteria | 2643221651 | 2644287948 | 152 |
| 33 | iso_pu_bacteria | 2667528175 | 2671118131 | 152 |
| 34 | iso_pu_bacteria | 2721755755 | 2723846177 | 152 |
| 35 | iso_pu_bacteria | 2728368998 | 2728747744 | 152 |
| 36 | iso_pu_bacteria | 2744054633 | 2745082454 | 152 |
| 37 | iso_pu_bacteria | 2791355196 | 2793060240 | 152 |
| 38 | iso_pu_bacteria | 2791355197 | 2793071750 | 152 |
| 39 | iso_pu_bacteria | 2791355199 | 2793076653 | 152 |
| 40 | iso_pu_bacteria | 2802429603 | 2805917606 | 152 |
| 41 | iso_pu_bacteria | 2816332527 | 2818241513 | 152 |
| 42 | iso_pu_bacteria | 2824600985 | 2824602109 | 152 |
| 43 | iso_pu_bacteria | 2824609381 | 2824610097 | 152 |
| 44 | iso_pu_bacteria | 2824617872 | 2824620095 | 152 |
| 45 | iso_pu_bacteria | 2824626560 | 2824627694 | 152 |
| 46 | iso_pu_bacteria | 2824635225 | 2824636737 | 152 |
| 47 | iso_pu_bacteria | 2824644064 | 2824645030 | 152 |
| 48 | iso_pu_bacteria | 2824653114 | 2824654953 | 152 |
| 49 | iso_pu_bacteria | 2824661429 | 2824662351 | 152 |
| 50 | iso_pu_bacteria | 2824671348 | 2824672600 | 152 |
| 51 | iso_pu_bacteria | 2824679649 | 2824680850 | 152 |
| 52 | iso_pu_bacteria | 2824687955 | 2824689067 | 152 |
| 53 | iso_pu_bacteria | 2824696289 | 2824697434 | 152 |
| 54 | iso_pu_bacteria | 2824704595 | 2824706668 | 152 |
| 55 | iso_pu_bacteria | 2824714736 | 2824715408 | 152 |
| 56 | iso_pu_bacteria | 2824723954 | 2824724737 | 152 |
| 57 | iso_pu_bacteria | 2824732956 | 2824733565 | 152 |
| 58 | iso_pu_bacteria | 2824746037 | 2824746940 | 152 |
| 59 | iso_pu_bacteria | 2824753945 | 2824759410 | 152 |
| 60 | iso_pu_bacteria | 2824763712 | 2824769646 | 152 |
| 61 | iso_pu_bacteria | 2824773399 | 2824774043 | 152 |
| 62 | iso_pu_bacteria | 2838122688 | 2838130092 | 152 |
| 63 | iso_pu_bacteria | 2841941048 | 2841941249 | 152 |
| 64 | iso_pu_bacteria | 2841949485 | 2841952724 | 152 |
| 65 | iso_pu_bacteria | 2841957949 | 2841962237 | 152 |
| 66 | iso_pu_bacteria | 2841966195 | 2841967404 | 152 |
| 67 | iso_pu_bacteria | 2841974524 | 2841979198 | 152 |
| 68 | iso_pu_bacteria | 2841983080 | 2841990774 | 152 |
| 69 | iso_pu_bacteria | 2842038055 | 2842038614 | 152 |
| 70 | iso_pu_bacteria | 2842045827 | 2842048441 | 152 |
| 71 | iso_pu_bacteria | 2844315083 | 2844318012 | 152 |
| 72 | iso_pu_bacteria | 2847930680 | 2847934823 | 152 |
| 73 | iso_pu_bacteria | 2847939898 | 2847945388 | 152 |
| 74 | iso_pu_bacteria | 2849076700 | 2849080424 | 152 |
| 75 | iso_pu_bacteria | 2857509624 | 2857510223 | 152 |
| 76 | iso_pu_bacteria | 2857524615 | 2857528523 | 152 |
| 77 | iso_pu_bacteria | 2874590934 | 2874595105 | 152 |
| 78 | iso_pu_bacteria | 2874604998 | 2874610913 | 152 |
| 79 | iso_pu_bacteria | 2874612657 | 2874615662 | 152 |
| 80 | iso_pu_bacteria | 2874620515 | 2874621685 | 152 |
| 81 | iso_pu_bacteria | 2874628541 | 2874632681 | 152 |
| 82 | iso_pu_bacteria | 2874645413 | 2874650966 | 152 |
| 83 | iso_pu_bacteria | 2876761206 | 2876765720 | 152 |
| 84 | iso_pu_bacteria | 2876771140 | 2876775041 | 152 |
| 85 | iso_pu_bacteria | 2876808645 | 2876810426 | 152 |
| 86 | iso_pu_bacteria | 2876818435 | 2876823856 | 152 |
| 87 | iso_pu_bacteria | 2879074833 | 2879080484 | 152 |
| 88 | iso_pu_bacteria | 2879083081 | 2879089270 | 152 |
| 89 | iso_pu_bacteria | 2879099564 | 2879109332 | 152 |
| 90 | iso_pu_bacteria | 2879110137 | 2879110526 | 152 |
| 91 | iso_pu_bacteria | 2879127579 | 2879134910 | 152 |
| 92 | iso_pu_bacteria | 2881364244 | 2881366217 | 152 |
| 93 | iso_pu_bacteria | 2881665667 | 2881671558 | 152 |
| 94 | iso_pu_bacteria | 2885366525 | 2885372810 | 152 |
| 95 | iso_pu_bacteria | 2885374607 | 2885380954 | 152 |
| 96 | iso_pu_bacteria | 2885383462 | 2885384451 | 152 |
| 97 | iso_pu_bacteria | 2885409591 | 2885413067 | 152 |
| 98 | iso_pu_bacteria | 2888388044 | 2888394991 | 152 |
| 99 | iso_pu_bacteria | 2888419890 | 2888423288 | 152 |
| 100 | iso_pu_bacteria | 2889033259 | 2889041126 | 152 |
| 101 | iso_pu_bacteria | 2893066018 | 2893070161 | 152 |
| 102 | iso_pu_bacteria | 2903727486 | 2903729679 | 152 |
| 103 | iso_pu_bacteria | 2903748898 | 2903758271 | 152 |
| 104 | iso_pu_bacteria | 2903768456 | 2903770868 | 152 |
| 105 | iso_pu_bacteria | 2904666416 | 2904668598 | 152 |
| 106 | iso_pu_bacteria | 2904690495 | 2904696887 | 152 |
| 107 | iso_pu_bacteria | 2904699407 | 2904701650 | 152 |
| 108 | iso_pu_bacteria | 2904711408 | 2904716680 | 152 |
| 109 | iso_pu_bacteria | 2906602504 | 2906605827 | 152 |
| 110 | iso_pu_bacteria | 2906610324 | 2906610378 | 152 |
| 111 | iso_pu_bacteria | 2906626472 | 2906628277 | 152 |
| 112 | iso_pu_bacteria | 2906635258 | 2906642793 | 152 |
| 113 | iso_pu_bacteria | 2906643746 | 2906644190 | 152 |
| 114 | iso_pu_bacteria | 2906660503 | 2906665928 | 152 |
| 115 | iso_pu_bacteria | 2908739725 | 2908743899 | 152 |
| 116 | iso_pu_bacteria | 2908756301 | 2908761463 | 152 |
| 117 | iso_pu_bacteria | 2908775508 | 2908778931 | 152 |
| 118 | iso_pu_bacteria | 2909042592 | 2909043592 | 152 |
| 119 | iso_pu_bacteria | 2919073203 | 2919076112 | 152 |
| 120 | iso_pu_bacteria | 2922361189 | 2922361973 | 152 |
| 121 | iso_pu_bacteria | 2922368715 | 2922375231 | 152 |
| 122 | iso_pu_bacteria | 2922386360 | 2922392021 | 152 |
| 123 | iso_pu_bacteria | 2922393267 | 2922395217 | 152 |
| 124 | iso_pu_bacteria | 2922425934 | 2922428983 | 152 |
| 125 | iso_pu_bacteria | 2929615660 | 2929615919 | 152 |
| 126 | iso_pu_bacteria | 2929624759 | 2929630532 | 152 |
| 127 | iso_pu_bacteria | 2932784394 | 2932792443 | 152 |
| 128 | iso_pu_bacteria | 2932794094 | 2932800411 | 152 |
| 129 | iso_pu_bacteria | 2932801729 | 2932804584 | 152 |
| 130 | iso_pu_bacteria | 2932809354 | 2932813942 | 152 |
| 131 | iso_pu_bacteria | 2932818245 | 2932819546 | 152 |
| 132 | iso_pu_bacteria | 2932828146 | 2932833748 | 152 |
| 133 | iso_pu_bacteria | 2933577622 | 2933578795 | 152 |
| 134 | iso_pu_bacteria | 2935608549 | 2935611355 | 152 |
| 135 | iso_pu_bacteria | 2935616580 | 2935618748 | 152 |
| 136 | iso_pu_bacteria | 2935630451 | 2935637754 | 152 |
| 137 | iso_pu_bacteria | 2935638405 | 2935644412 | 152 |
| 138 | iso_pu_bacteria | 2935648319 | 2935648739 | 152 |
| 139 | iso_pu_bacteria | 2935656913 | 2935657178 | 152 |
| 140 | iso_pu_bacteria | 2935665750 | 2935674150 | 152 |
| 141 | iso_pu_bacteria | 2935675223 | 2935678568 | 152 |
| 142 | iso_pu_bacteria | 2935684952 | 2935687935 | 152 |
| 143 | iso_pu_bacteria | 2935694250 | 2935701453 | 152 |
| 144 | iso_pu_bacteria | 2935703347 | 2935708269 | 152 |
| 145 | iso_pu_bacteria | 2935713505 | 2935714955 | 152 |
| 146 | iso_pu_bacteria | 2935722832 | 2935726480 | 152 |
| 147 | iso_pu_bacteria | 2935732158 | 2935733773 | 152 |
| 148 | iso_pu_bacteria | 2935741537 | 2935743152 | 152 |
| 149 | iso_pu_bacteria | 2935750917 | 2935754809 | 152 |
| 150 | iso_pu_bacteria | 2935760218 | 2935765517 | 152 |
| 151 | iso_pu_bacteria | 2935769743 | 2935775270 | 152 |
| 152 | iso_pu_bacteria | 2935777560 | 2935779530 | 152 |
| 153 | iso_pu_bacteria | 2935785616 | 2935791532 | 152 |
| 154 | iso_pu_bacteria | 2935793552 | 2935799844 | 152 |
| 155 | iso_pu_bacteria | 2935801545 | 2935805470 | 152 |
| 156 | iso_pu_bacteria | 2935810662 | 2935816764 | 152 |
| 157 | iso_pu_bacteria | 2935819856 | 2935820832 | 152 |
| 158 | iso_pu_bacteria | 2935827899 | 2935833839 | 152 |
| 159 | iso_pu_bacteria | 2935837841 | 2935839476 | 152 |
| 160 | iso_pu_bacteria | 2935847175 | 2935850908 | 152 |
| 161 | iso_pu_bacteria | 2935855204 | 2935857113 | 152 |
| 162 | iso_pu_bacteria | 2935864058 | 2935864657 | 152 |
| 163 | iso_pu_bacteria | 2935873716 | 2935876435 | 152 |
| 164 | iso_pu_bacteria | 2935883170 | 2935889778 | 152 |
| 165 | iso_pu_bacteria | 2935908558 | 2935913725 | 152 |
| 166 | iso_pu_bacteria | 2935916978 | 2935920285 | 152 |
| 167 | iso_pu_bacteria | 2935926038 | 2935930624 | 152 |
| 168 | iso_pu_bacteria | 2935934488 | 2935939403 | 152 |
| 169 | iso_pu_bacteria | 2935942939 | 2935946352 | 152 |
| 170 | iso_pu_bacteria | 2935951376 | 2935955809 | 152 |
| 171 | iso_pu_bacteria | 2935967501 | 2935972481 | 152 |
| 172 | iso_pu_bacteria | 2935975950 | 2935981688 | 152 |
| 173 | iso_pu_bacteria | 2935984226 | 2935991063 | 152 |
| 174 | iso_pu_bacteria | 2935992306 | 2935997596 | 152 |
| 175 | iso_pu_bacteria | 2936002035 | 2936007114 | 152 |
| 176 | iso_pu_bacteria | 2936011229 | 2936011649 | 152 |
| 177 | iso_pu_bacteria | 2936019824 | 2936020244 | 152 |
| 178 | iso_pu_bacteria | 2936028420 | 2936028939 | 152 |
| 179 | iso_pu_bacteria | 2936037263 | 2936042974 | 152 |
| 180 | iso_pu_bacteria | 2936046547 | 2936046967 | 152 |
| 181 | iso_pu_bacteria | 2936055302 | 2936058153 | 152 |
| 182 | iso_pu_bacteria | 2940556831 | 2940559814 | 152 |
| 183 | iso_pu_bacteria | 2941507105 | 2941514427 | 152 |
| 184 | iso_pu_bacteria | 2941515067 | 2941522323 | 152 |
| 185 | iso_pu_bacteria | 2941523033 | 2941530158 | 152 |
| 186 | iso_pu_bacteria | 2941531003 | 2941536096 | 152 |
| 187 | iso_pu_bacteria | 2941538514 | 2941540165 | 152 |
| 188 | iso_pu_bacteria | 3005474847 | 3005479128 | 152 |
| 189 | iso_pu_bacteria | 3005483717 | 3005488137 | 152 |
| 190 | iso_pu_bacteria | 3005506211 | 3005512715 | 152 |
| 191 | iso_pu_bacteria | 3005587118 | 3005590481 | 152 |
| 192 | iso_pu_bacteria | 3005594810 | 3005598062 | 152 |
| 193 | iso_pu_bacteria | 3005710791 | 3005713741 | 152 |
| 194 | iso_pu_bacteria | 3005718088 | 3005721252 | 152 |
| 195 | iso_pu_bacteria | 8006926726 | 8006930050 | 152 |
| 196 | iso_pu_bacteria | 8006933436 | 8006942220 | 152 |
| 197 | iso_pu_bacteria | 8006964411 | 8006964531 | 152 |
| 198 | iso_pu_bacteria | 8006973647 | 8006981954 | 152 |
| 199 | iso_pu_bacteria | 8006984368 | 8006986850 | 152 |
| 200 | iso_pu_bacteria | 8006994254 | 8006996069 | 152 |
| 201 | iso_pu_bacteria | 8016511872 | 8016514690 | 152 |
| 202 | iso_pu_bacteria | 8016522445 | 8016530788 | 152 |
| 203 | iso_pu_bacteria | 8016530956 | 8016536079 | 152 |
| 204 | iso_pu_bacteria | 8016539877 | 8016540360 | 152 |
| 205 | iso_pu_bacteria | 8016548790 | 8016552873 | 152 |
| 206 | iso_pu_bacteria | 8016557553 | 8016561251 | 152 |
| 207 | iso_pu_bacteria | 8016566248 | 8016574425 | 152 |
| 208 | iso_pu_bacteria | 8016575299 | 8016578524 | 152 |
| 209 | iso_pu_bacteria | 8016583857 | 8016591236 | 152 |
| 210 | iso_pu_bacteria | 8016595262 | 8016599108 | 152 |
| 211 | iso_pu_bacteria | 8016603502 | 8016611940 | 152 |
| 212 | iso_pu_bacteria | 8016613128 | 8016621864 | 152 |
| 213 | iso_pu_bacteria | 8016622563 | 8016627991 | 152 |
| 214 | iso_pu_bacteria | 8016630954 | 8016632313 | 152 |
| 215 | iso_pu_bacteria | 8017057580 | 8017061745 | 152 |
| 216 | iso_pu_bacteria | 8019530166 | 8019535804 | 152 |
| 217 | iso_pu_bacteria | 8019538911 | 8019543673 | 152 |
| 218 | iso_pu_bacteria | 8019547302 | 8019555101 | 152 |
| 219 | iso_pu_bacteria | 8019555841 | 8019557942 | 152 |
| 220 | iso_pu_bacteria | 8019576017 | 8019581243 | 152 |
| 221 | iso_pu_bacteria | 8019586578 | 8019588872 | 152 |
| 222 | iso_pu_bacteria | 8019597564 | 8019602362 | 152 |
| 223 | iso_pu_bacteria | 8019608314 | 8019616199 | 152 |
| 224 | iso_pu_bacteria | 8019629233 | 8019635693 | 152 |
| 225 | iso_pu_bacteria | 8019638758 | 8019643991 | 152 |
| 226 | iso_pu_bacteria | 8019659431 | 8019663491 | 152 |
| 227 | iso_pu_bacteria | 8019668869 | 8019673105 | 152 |
| 228 | iso_pu_bacteria | 8019678201 | 8019683036 | 152 |
| 229 | iso_pu_bacteria | 8019687851 | 8019688734 | 152 |
| 230 | iso_pu_bacteria | 8054302542 | 8054304454 | 152 |
| 231 | iso_pu_bacteria | 8055742211 | 8055747566 | 152 |
| 232 | iso_pu_bacteria | 8056673599 | 8056680459 | 152 |
| 233 | iso_pu_bacteria | 8056681323 | 8056684514 | 152 |
| 234 | iso_pu_bacteria | 8056689827 | 8056691224 | 152 |
| 235 | iso_pu_bacteria | 8056967851 | 8056972358 | 152 |
| 236 | iso_pu_bacteria | 8019619141 | 8019626817 | 153 |
| 237 | 3300005471 | Ga0070698_100786664 | Ga0070698_1007866642 | 155 |
| 238 | 3300005545 | Ga0070695_100098141 | Ga0070695_1000981411 | 155 |
| 239 | 3300005614 | Ga0068856_100000972 | Ga0068856_10000097223 | 155 |
| 240 | 3300006844 | Ga0075428_100179551 | Ga0075428_1001795512 | 155 |
| 241 | 3300006880 | Ga0075429_100187435 | Ga0075429_1001874352 | 155 |
| 242 | 3300009147 | Ga0114129_10152522 | Ga0114129_101525222 | 155 |
| 243 | 3300026078 | Ga0207702_10000747 | Ga0207702_1000074724 | 155 |
| 244 | 3300049570 | Ga0501033_0305511 | Ga0501033_0305511_378_845 | 155 |
| 245 | 3300050507 | nmdc:mga05p37_154302_c1 | nmdc:mga05p37_154302_c1_1000_1467 | 155 |
| 246 | 3300050508 | nmdc:mga09592_40777_c1 | nmdc:mga09592_40777_c1_2869_3336 | 155 |
| 247 | 3300001976 | JGI24752J21851_1001311 | JGI24752J21851_10013114 | 156 |
| 248 | 3300001991 | JGI24743J22301_10160210 | JGI24743J22301_101602101 | 156 |
| 249 | 3300002074 | JGI24748J21848_1024821 | JGI24748J21848_10248211 | 156 |
| 250 | 3300002076 | JGI24749J21850_1001881 | JGI24749J21850_10018812 | 156 |
| 251 | 3300002077 | JGI24744J21845_10041717 | JGI24744J21845_100417172 | 156 |
| 252 | 3300002126 | JGI24035J26624_1020509 | JGI24035J26624_10205091 | 156 |
| 253 | 3300002239 | JGI24034J26672_10002015 | JGI24034J26672_100020152 | 156 |
| 254 | 3300002244 | JGI24742J22300_10034719 | JGI24742J22300_100347191 | 156 |
| 255 | 3300002459 | JGI24751J29686_10015977 | JGI24751J29686_100159772 | 156 |
| 256 | 3300003203 | JGI25406J46586_10118333 | JGI25406J46586_101183332 | 156 |
| 257 | 3300003577 | Ga0007416J51690_1017726 | Ga0007416J51690_10177262 | 156 |
| 258 | 3300003659 | JGI25404J52841_10004339 | JGI25404J52841_100043392 | 156 |
| 259 | 3300003659 | JGI25404J52841_10038933 | JGI25404J52841_100389332 | 156 |
| 260 | 3300003693 | Ga0032354_1061987 | Ga0032354_10619872 | 156 |
| 261 | 3300004798 | Ga0058859_11594462 | Ga0058859_115944622 | 156 |
| 262 | 3300004798 | Ga0058859_11820684 | Ga0058859_118206842 | 156 |
| 263 | 3300004799 | Ga0058863_10056823 | Ga0058863_100568232 | 156 |
| 264 | 3300004799 | Ga0058863_10080931 | Ga0058863_100809311 | 156 |
| 265 | 3300004800 | Ga0058861_10030443 | Ga0058861_100304432 | 156 |
| 266 | 3300004800 | Ga0058861_10175812 | Ga0058861_101758121 | 156 |
| 267 | 3300004800 | Ga0058861_11851124 | Ga0058861_118511241 | 156 |
| 268 | 3300004801 | Ga0058860_11861917 | Ga0058860_118619172 | 156 |
| 269 | 3300004801 | Ga0058860_12158433 | Ga0058860_121584332 | 156 |
| 270 | 3300004803 | Ga0058862_10078448 | Ga0058862_100784482 | 156 |
| 271 | 3300004803 | Ga0058862_10111058 | Ga0058862_101110582 | 156 |
| 272 | 3300004803 | Ga0058862_10160436 | Ga0058862_101604367 | 156 |
| 273 | 3300005289 | Ga0065704_10312968 | Ga0065704_103129681 | 156 |
| 274 | 3300005290 | Ga0065712_10109692 | Ga0065712_101096922 | 156 |
| 275 | 3300005290 | Ga0065712_10175657 | Ga0065712_101756571 | 156 |
| 276 | 3300005293 | Ga0065715_10096781 | Ga0065715_100967812 | 156 |
| 277 | 3300005293 | Ga0065715_10593290 | Ga0065715_105932901 | 156 |
| 278 | 3300005295 | Ga0065707_10105665 | Ga0065707_101056652 | 156 |
| 279 | 3300005295 | Ga0065707_10155043 | Ga0065707_101550433 | 156 |
| 280 | 3300005327 | Ga0070658_10001321 | Ga0070658_100013212 | 156 |
| 281 | 3300005328 | Ga0070676_10000380 | Ga0070676_100003804 | 156 |
| 282 | 3300005328 | Ga0070676_10313408 | Ga0070676_103134082 | 156 |
| 283 | 3300005329 | Ga0070683_100000033 | Ga0070683_100000033103 | 156 |
| 284 | 3300005329 | Ga0070683_100036594 | Ga0070683_1000365944 | 156 |
| 285 | 3300005329 | Ga0070683_100152551 | Ga0070683_1001525513 | 156 |
| 286 | 3300005330 | Ga0070690_100011157 | Ga0070690_1000111572 | 156 |
| 287 | 3300005330 | Ga0070690_100046988 | Ga0070690_1000469882 | 156 |
| 288 | 3300005330 | Ga0070690_100150920 | Ga0070690_1001509203 | 156 |
| 289 | 3300005331 | Ga0070670_100003921 | Ga0070670_1000039213 | 156 |
| 290 | 3300005331 | Ga0070670_100012257 | Ga0070670_10001225710 | 156 |
| 291 | 3300005331 | Ga0070670_100045805 | Ga0070670_1000458053 | 156 |
| 292 | 3300005331 | Ga0070670_100082102 | Ga0070670_1000821022 | 156 |
| 293 | 3300005331 | Ga0070670_100562757 | Ga0070670_1005627572 | 156 |
| 294 | 3300005333 | Ga0070677_10000135 | Ga0070677_1000013515 | 156 |
| 295 | 3300005333 | Ga0070677_10058986 | Ga0070677_100589862 | 156 |
| 296 | 3300005333 | Ga0070677_10155312 | Ga0070677_101553122 | 156 |
| 297 | 3300005333 | Ga0070677_10693157 | Ga0070677_106931571 | 156 |
| 298 | 3300005334 | Ga0068869_100000118 | Ga0068869_10000011835 | 156 |
| 299 | 3300005334 | Ga0068869_100044269 | Ga0068869_1000442693 | 156 |
| 300 | 3300005334 | Ga0068869_100618371 | Ga0068869_1006183711 | 156 |
| 301 | 3300005335 | Ga0070666_10001221 | Ga0070666_100012212 | 156 |
| 302 | 3300005335 | Ga0070666_10002914 | Ga0070666_1000291411 | 156 |
| 303 | 3300005335 | Ga0070666_10010376 | Ga0070666_100103765 | 156 |
| 304 | 3300005336 | Ga0070680_100025773 | Ga0070680_1000257731 | 156 |
| 305 | 3300005336 | Ga0070680_100261308 | Ga0070680_1002613082 | 156 |
| 306 | 3300005336 | Ga0070680_100339940 | Ga0070680_1003399402 | 156 |
| 307 | 3300005336 | Ga0070680_100723710 | Ga0070680_1007237102 | 156 |
| 308 | 3300005336 | Ga0070680_100961876 | Ga0070680_1009618761 | 156 |
| 309 | 3300005337 | Ga0070682_100000036 | Ga0070682_10000003616 | 156 |
| 310 | 3300005337 | Ga0070682_100182381 | Ga0070682_1001823813 | 156 |
| 311 | 3300005337 | Ga0070682_100500128 | Ga0070682_1005001281 | 156 |
| 312 | 3300005338 | Ga0068868_100000723 | Ga0068868_10000072327 | 156 |
| 313 | 3300005338 | Ga0068868_100000912 | Ga0068868_10000091216 | 156 |
| 314 | 3300005338 | Ga0068868_100014237 | Ga0068868_1000142375 | 156 |
| 315 | 3300005338 | Ga0068868_100041603 | Ga0068868_1000416031 | 156 |
| 316 | 3300005338 | Ga0068868_101035301 | Ga0068868_1010353011 | 156 |
| 317 | 3300005339 | Ga0070660_100000631 | Ga0070660_1000006318 | 156 |
| 318 | 3300005339 | Ga0070660_100135988 | Ga0070660_1001359884 | 156 |
| 319 | 3300005340 | Ga0070689_100000443 | Ga0070689_10000044321 | 156 |
| 320 | 3300005340 | Ga0070689_100015182 | Ga0070689_1000151825 | 156 |
| 321 | 3300005340 | Ga0070689_100019995 | Ga0070689_1000199952 | 156 |
| 322 | 3300005340 | Ga0070689_100060765 | Ga0070689_1000607652 | 156 |
| 323 | 3300005340 | Ga0070689_101006720 | Ga0070689_1010067201 | 156 |
| 324 | 3300005341 | Ga0070691_10130801 | Ga0070691_101308012 | 156 |
| 325 | 3300005343 | Ga0070687_100005653 | Ga0070687_1000056536 | 156 |
| 326 | 3300005343 | Ga0070687_100014217 | Ga0070687_1000142174 | 156 |
| 327 | 3300005343 | Ga0070687_100207292 | Ga0070687_1002072922 | 156 |
| 328 | 3300005343 | Ga0070687_100776215 | Ga0070687_1007762152 | 156 |
| 329 | 3300005344 | Ga0070661_100009001 | Ga0070661_1000090014 | 156 |
| 330 | 3300005344 | Ga0070661_100077614 | Ga0070661_1000776142 | 156 |
| 331 | 3300005345 | Ga0070692_10156770 | Ga0070692_101567702 | 156 |
| 332 | 3300005345 | Ga0070692_10704524 | Ga0070692_107045241 | 156 |
| 333 | 3300005347 | Ga0070668_100000076 | Ga0070668_10000007631 | 156 |
| 334 | 3300005347 | Ga0070668_100036317 | Ga0070668_1000363173 | 156 |
| 335 | 3300005347 | Ga0070668_100466288 | Ga0070668_1004662882 | 156 |
| 336 | 3300005347 | Ga0070668_100980307 | Ga0070668_1009803071 | 156 |
| 337 | 3300005347 | Ga0070668_100986416 | Ga0070668_1009864161 | 156 |
| 338 | 3300005353 | Ga0070669_100000096 | Ga0070669_10000009672 | 156 |
| 339 | 3300005353 | Ga0070669_100032654 | Ga0070669_1000326543 | 156 |
| 340 | 3300005353 | Ga0070669_100045874 | Ga0070669_1000458745 | 156 |
| 341 | 3300005353 | Ga0070669_100057829 | Ga0070669_1000578295 | 156 |
| 342 | 3300005353 | Ga0070669_100124436 | Ga0070669_1001244361 | 156 |
| 343 | 3300005354 | Ga0070675_100000559 | Ga0070675_1000005592 | 156 |
| 344 | 3300005354 | Ga0070675_100017111 | Ga0070675_1000171113 | 156 |
| 345 | 3300005354 | Ga0070675_100018869 | Ga0070675_1000188694 | 156 |
| 346 | 3300005354 | Ga0070675_100052834 | Ga0070675_1000528343 | 156 |
| 347 | 3300005354 | Ga0070675_100148076 | Ga0070675_1001480762 | 156 |
| 348 | 3300005354 | Ga0070675_100474509 | Ga0070675_1004745092 | 156 |
| 349 | 3300005354 | Ga0070675_100485534 | Ga0070675_1004855342 | 156 |
| 350 | 3300005355 | Ga0070671_100000045 | Ga0070671_10000004540 | 156 |
| 351 | 3300005355 | Ga0070671_100001952 | Ga0070671_10000195213 | 156 |
| 352 | 3300005355 | Ga0070671_100042395 | Ga0070671_1000423952 | 156 |
| 353 | 3300005355 | Ga0070671_100350254 | Ga0070671_1003502542 | 156 |
| 354 | 3300005355 | Ga0070671_100358067 | Ga0070671_1003580672 | 156 |
| 355 | 3300005355 | Ga0070671_100553913 | Ga0070671_1005539132 | 156 |
| 356 | 3300005356 | Ga0070674_100000922 | Ga0070674_10000092214 | 156 |
| 357 | 3300005356 | Ga0070674_100146244 | Ga0070674_1001462442 | 156 |
| 358 | 3300005356 | Ga0070674_100206191 | Ga0070674_1002061912 | 156 |
| 359 | 3300005356 | Ga0070674_100269913 | Ga0070674_1002699132 | 156 |
| 360 | 3300005356 | Ga0070674_100614464 | Ga0070674_1006144642 | 156 |
| 361 | 3300005364 | Ga0070673_100001307 | Ga0070673_10000130712 | 156 |
| 362 | 3300005364 | Ga0070673_100002114 | Ga0070673_1000021142 | 156 |
| 363 | 3300005364 | Ga0070673_100058949 | Ga0070673_1000589495 | 156 |
| 364 | 3300005364 | Ga0070673_100194356 | Ga0070673_1001943561 | 156 |
| 365 | 3300005364 | Ga0070673_100252144 | Ga0070673_1002521442 | 156 |
| 366 | 3300005364 | Ga0070673_100540477 | Ga0070673_1005404772 | 156 |
| 367 | 3300005365 | Ga0070688_100007941 | Ga0070688_1000079415 | 156 |
| 368 | 3300005365 | Ga0070688_100052606 | Ga0070688_1000526062 | 156 |
| 369 | 3300005365 | Ga0070688_100438694 | Ga0070688_1004386942 | 156 |
| 370 | 3300005366 | Ga0070659_100000088 | Ga0070659_10000008872 | 156 |
| 371 | 3300005366 | Ga0070659_100084712 | Ga0070659_1000847123 | 156 |
| 372 | 3300005367 | Ga0070667_100000025 | Ga0070667_10000002581 | 156 |
| 373 | 3300005367 | Ga0070667_100003534 | Ga0070667_1000035343 | 156 |
| 374 | 3300005367 | Ga0070667_100007729 | Ga0070667_1000077297 | 156 |
| 375 | 3300005367 | Ga0070667_100022068 | Ga0070667_1000220685 | 156 |
| 376 | 3300005367 | Ga0070667_100032953 | Ga0070667_1000329532 | 156 |
| 377 | 3300005367 | Ga0070667_100469753 | Ga0070667_1004697532 | 156 |
| 378 | 3300005436 | Ga0070713_100306206 | Ga0070713_1003062062 | 156 |
| 379 | 3300005437 | Ga0070710_10840348 | Ga0070710_108403481 | 156 |
| 380 | 3300005438 | Ga0070701_10053241 | Ga0070701_100532413 | 156 |
| 381 | 3300005439 | Ga0070711_100582287 | Ga0070711_1005822872 | 156 |
| 382 | 3300005440 | Ga0070705_100000956 | Ga0070705_10000095614 | 156 |
| 383 | 3300005440 | Ga0070705_100368521 | Ga0070705_1003685212 | 156 |
| 384 | 3300005441 | Ga0070700_100102202 | Ga0070700_1001022023 | 156 |
| 385 | 3300005441 | Ga0070700_100144679 | Ga0070700_1001446792 | 156 |
| 386 | 3300005441 | Ga0070700_100573676 | Ga0070700_1005736762 | 156 |
| 387 | 3300005441 | Ga0070700_100623759 | Ga0070700_1006237592 | 156 |
| 388 | 3300005444 | Ga0070694_100575120 | Ga0070694_1005751202 | 156 |
| 389 | 3300005445 | Ga0070708_100004467 | Ga0070708_1000044673 | 156 |
| 390 | 3300005445 | Ga0070708_100497899 | Ga0070708_1004978992 | 156 |
| 391 | 3300005455 | Ga0070663_100015416 | Ga0070663_1000154162 | 156 |
| 392 | 3300005456 | Ga0070678_100000461 | Ga0070678_10000046120 | 156 |
| 393 | 3300005456 | Ga0070678_100194825 | Ga0070678_1001948252 | 156 |
| 394 | 3300005456 | Ga0070678_100354391 | Ga0070678_1003543912 | 156 |
| 395 | 3300005456 | Ga0070678_100642780 | Ga0070678_1006427802 | 156 |
| 396 | 3300005456 | Ga0070678_101249501 | Ga0070678_1012495011 | 156 |
| 397 | 3300005457 | Ga0070662_100000976 | Ga0070662_10000097613 | 156 |
| 398 | 3300005457 | Ga0070662_100027519 | Ga0070662_1000275192 | 156 |
| 399 | 3300005458 | Ga0070681_10077480 | Ga0070681_100774803 | 156 |
| 400 | 3300005458 | Ga0070681_10209829 | Ga0070681_102098291 | 156 |
| 401 | 3300005458 | Ga0070681_10288163 | Ga0070681_102881631 | 156 |
| 402 | 3300005458 | Ga0070681_10304780 | Ga0070681_103047803 | 156 |
| 403 | 3300005458 | Ga0070681_10327027 | Ga0070681_103270272 | 156 |
| 404 | 3300005459 | Ga0068867_100022286 | Ga0068867_1000222863 | 156 |
| 405 | 3300005459 | Ga0068867_100118640 | Ga0068867_1001186402 | 156 |
| 406 | 3300005459 | Ga0068867_100192373 | Ga0068867_1001923732 | 156 |
| 407 | 3300005459 | Ga0068867_100402525 | Ga0068867_1004025251 | 156 |
| 408 | 3300005466 | Ga0070685_10000585 | Ga0070685_100005854 | 156 |
| 409 | 3300005466 | Ga0070685_10060815 | Ga0070685_100608152 | 156 |
| 410 | 3300005466 | Ga0070685_10209483 | Ga0070685_102094832 | 156 |
| 411 | 3300005466 | Ga0070685_10624909 | Ga0070685_106249092 | 156 |
| 412 | 3300005468 | Ga0070707_100021471 | Ga0070707_1000214712 | 156 |
| 413 | 3300005471 | Ga0070698_100194930 | Ga0070698_1001949302 | 156 |
| 414 | 3300005471 | Ga0070698_100519048 | Ga0070698_1005190482 | 156 |
| 415 | 3300005518 | Ga0070699_100128090 | Ga0070699_1001280902 | 156 |
| 416 | 3300005518 | Ga0070699_100662949 | Ga0070699_1006629491 | 156 |
| 417 | 3300005530 | Ga0070679_100030992 | Ga0070679_1000309923 | 156 |
| 418 | 3300005530 | Ga0070679_100100465 | Ga0070679_1001004654 | 156 |
| 419 | 3300005530 | Ga0070679_100149984 | Ga0070679_1001499842 | 156 |
| 420 | 3300005530 | Ga0070679_100211006 | Ga0070679_1002110064 | 156 |
| 421 | 3300005530 | Ga0070679_100420175 | Ga0070679_1004201751 | 156 |
| 422 | 3300005530 | Ga0070679_101057699 | Ga0070679_1010576992 | 156 |
| 423 | 3300005535 | Ga0070684_100010702 | Ga0070684_1000107024 | 156 |
| 424 | 3300005535 | Ga0070684_100054901 | Ga0070684_1000549012 | 156 |
| 425 | 3300005535 | Ga0070684_100109082 | Ga0070684_1001090822 | 156 |
| 426 | 3300005535 | Ga0070684_100192199 | Ga0070684_1001921992 | 156 |
| 427 | 3300005536 | Ga0070697_100004239 | Ga0070697_1000042393 | 156 |
| 428 | 3300005536 | Ga0070697_100238499 | Ga0070697_1002384992 | 156 |
| 429 | 3300005539 | Ga0068853_100000472 | Ga0068853_1000004727 | 156 |
| 430 | 3300005539 | Ga0068853_100170573 | Ga0068853_1001705733 | 156 |
| 431 | 3300005543 | Ga0070672_100000581 | Ga0070672_10000058119 | 156 |
| 432 | 3300005543 | Ga0070672_100005460 | Ga0070672_1000054602 | 156 |
| 433 | 3300005543 | Ga0070672_100048521 | Ga0070672_1000485212 | 156 |
| 434 | 3300005543 | Ga0070672_100076957 | Ga0070672_1000769572 | 156 |
| 435 | 3300005543 | Ga0070672_100576426 | Ga0070672_1005764262 | 156 |
| 436 | 3300005544 | Ga0070686_100000708 | Ga0070686_1000007086 | 156 |
| 437 | 3300005544 | Ga0070686_100059609 | Ga0070686_1000596092 | 156 |
| 438 | 3300005544 | Ga0070686_100210392 | Ga0070686_1002103922 | 156 |
| 439 | 3300005544 | Ga0070686_100219016 | Ga0070686_1002190162 | 156 |
| 440 | 3300005544 | Ga0070686_100796249 | Ga0070686_1007962491 | 156 |
| 441 | 3300005545 | Ga0070695_100181760 | Ga0070695_1001817602 | 156 |
| 442 | 3300005546 | Ga0070696_100078380 | Ga0070696_1000783802 | 156 |
| 443 | 3300005546 | Ga0070696_100225948 | Ga0070696_1002259481 | 156 |
| 444 | 3300005547 | Ga0070693_100034250 | Ga0070693_1000342502 | 156 |
| 445 | 3300005547 | Ga0070693_100392828 | Ga0070693_1003928281 | 156 |
| 446 | 3300005548 | Ga0070665_100061650 | Ga0070665_1000616503 | 156 |
| 447 | 3300005548 | Ga0070665_100103384 | Ga0070665_1001033844 | 156 |
| 448 | 3300005548 | Ga0070665_100571036 | Ga0070665_1005710361 | 156 |
| 449 | 3300005548 | Ga0070665_100838043 | Ga0070665_1008380431 | 156 |
| 450 | 3300005563 | Ga0068855_100002917 | Ga0068855_1000029177 | 156 |
| 451 | 3300005563 | Ga0068855_101258081 | Ga0068855_1012580812 | 156 |
| 452 | 3300005563 | Ga0068855_101617578 | Ga0068855_1016175781 | 156 |
| 453 | 3300005564 | Ga0070664_100000540 | Ga0070664_10000054013 | 156 |
| 454 | 3300005564 | Ga0070664_100001968 | Ga0070664_1000019683 | 156 |
| 455 | 3300005564 | Ga0070664_100017196 | Ga0070664_1000171963 | 156 |
| 456 | 3300005564 | Ga0070664_100023966 | Ga0070664_1000239662 | 156 |
| 457 | 3300005564 | Ga0070664_100513685 | Ga0070664_1005136852 | 156 |
| 458 | 3300005577 | Ga0068857_100004949 | Ga0068857_1000049494 | 156 |
| 459 | 3300005577 | Ga0068857_100740951 | Ga0068857_1007409512 | 156 |
| 460 | 3300005578 | Ga0068854_100008432 | Ga0068854_1000084323 | 156 |
| 461 | 3300005614 | Ga0068856_100008110 | Ga0068856_10000811010 | 156 |
| 462 | 3300005614 | Ga0068856_102086557 | Ga0068856_1020865571 | 156 |
| 463 | 3300005615 | Ga0070702_100174354 | Ga0070702_1001743542 | 156 |
| 464 | 3300005615 | Ga0070702_100268867 | Ga0070702_1002688672 | 156 |
| 465 | 3300005615 | Ga0070702_100322131 | Ga0070702_1003221312 | 156 |
| 466 | 3300005615 | Ga0070702_100520717 | Ga0070702_1005207171 | 156 |
| 467 | 3300005616 | Ga0068852_100000931 | Ga0068852_1000009313 | 156 |
| 468 | 3300005616 | Ga0068852_100998686 | Ga0068852_1009986862 | 156 |
| 469 | 3300005617 | Ga0068859_100000162 | Ga0068859_10000016240 | 156 |
| 470 | 3300005617 | Ga0068859_100000703 | Ga0068859_10000070338 | 156 |
| 471 | 3300005617 | Ga0068859_100001363 | Ga0068859_10000136312 | 156 |
| 472 | 3300005617 | Ga0068859_100002579 | Ga0068859_10000257915 | 156 |
| 473 | 3300005617 | Ga0068859_100116937 | Ga0068859_1001169372 | 156 |
| 474 | 3300005617 | Ga0068859_100662919 | Ga0068859_1006629192 | 156 |
| 475 | 3300005618 | Ga0068864_100000406 | Ga0068864_10000040631 | 156 |
| 476 | 3300005618 | Ga0068864_100000677 | Ga0068864_10000067717 | 156 |
| 477 | 3300005618 | Ga0068864_100001203 | Ga0068864_10000120317 | 156 |
| 478 | 3300005618 | Ga0068864_100018418 | Ga0068864_1000184185 | 156 |
| 479 | 3300005618 | Ga0068864_100077202 | Ga0068864_1000772026 | 156 |
| 480 | 3300005618 | Ga0068864_100081439 | Ga0068864_1000814392 | 156 |
| 481 | 3300005618 | Ga0068864_101501252 | Ga0068864_1015012522 | 156 |
| 482 | 3300005718 | Ga0068866_10002337 | Ga0068866_100023373 | 156 |
| 483 | 3300005718 | Ga0068866_10164411 | Ga0068866_101644112 | 156 |
| 484 | 3300005718 | Ga0068866_10396826 | Ga0068866_103968262 | 156 |
| 485 | 3300005718 | Ga0068866_10674739 | Ga0068866_106747392 | 156 |
| 486 | 3300005719 | Ga0068861_100000205 | Ga0068861_10000020517 | 156 |
| 487 | 3300005719 | Ga0068861_100086895 | Ga0068861_1000868955 | 156 |
| 488 | 3300005719 | Ga0068861_100350673 | Ga0068861_1003506732 | 156 |
| 489 | 3300005834 | Ga0068851_10000663 | Ga0068851_100006632 | 156 |
| 490 | 3300005840 | Ga0068870_10001380 | Ga0068870_100013808 | 156 |
| 491 | 3300005840 | Ga0068870_10061307 | Ga0068870_100613072 | 156 |
| 492 | 3300005840 | Ga0068870_10206190 | Ga0068870_102061902 | 156 |
| 493 | 3300005841 | Ga0068863_100000067 | Ga0068863_10000006781 | 156 |
| 494 | 3300005841 | Ga0068863_100000784 | Ga0068863_10000078427 | 156 |
| 495 | 3300005841 | Ga0068863_100000969 | Ga0068863_1000009693 | 156 |
| 496 | 3300005841 | Ga0068863_100002121 | Ga0068863_1000021216 | 156 |
| 497 | 3300005841 | Ga0068863_100593629 | Ga0068863_1005936292 | 156 |
| 498 | 3300005842 | Ga0068858_100008722 | Ga0068858_10000872214 | 156 |
| 499 | 3300005842 | Ga0068858_100026802 | Ga0068858_1000268023 | 156 |
| 500 | 3300005842 | Ga0068858_100027525 | Ga0068858_1000275253 | 156 |
| 501 | 3300005842 | Ga0068858_100036951 | Ga0068858_1000369513 | 156 |
| 502 | 3300005842 | Ga0068858_100208213 | Ga0068858_1002082132 | 156 |
| 503 | 3300005842 | Ga0068858_100277835 | Ga0068858_1002778352 | 156 |
| 504 | 3300005842 | Ga0068858_100320333 | Ga0068858_1003203332 | 156 |
| 505 | 3300005842 | Ga0068858_100570992 | Ga0068858_1005709922 | 156 |
| 506 | 3300005843 | Ga0068860_100004945 | Ga0068860_1000049452 | 156 |
| 507 | 3300005843 | Ga0068860_100014085 | Ga0068860_1000140855 | 156 |
| 508 | 3300005843 | Ga0068860_100039250 | Ga0068860_1000392503 | 156 |
| 509 | 3300005843 | Ga0068860_100045537 | Ga0068860_1000455375 | 156 |
| 510 | 3300005843 | Ga0068860_100048778 | Ga0068860_1000487782 | 156 |
| 511 | 3300005843 | Ga0068860_100270458 | Ga0068860_1002704583 | 156 |
| 512 | 3300005844 | Ga0068862_100001387 | Ga0068862_1000013872 | 156 |
| 513 | 3300005844 | Ga0068862_100022281 | Ga0068862_1000222815 | 156 |
| 514 | 3300005844 | Ga0068862_100066024 | Ga0068862_1000660242 | 156 |
| 515 | 3300005844 | Ga0068862_100083287 | Ga0068862_1000832873 | 156 |
| 516 | 3300005844 | Ga0068862_100360246 | Ga0068862_1003602462 | 156 |
| 517 | 3300005844 | Ga0068862_100843691 | Ga0068862_1008436912 | 156 |
| 518 | 3300005844 | Ga0068862_101424395 | Ga0068862_1014243951 | 156 |
| 519 | 3300005937 | Ga0081455_10310939 | Ga0081455_103109392 | 156 |
| 520 | 3300005983 | Ga0081540_1000785 | Ga0081540_100078520 | 156 |
| 521 | 3300005983 | Ga0081540_1001166 | Ga0081540_100116625 | 156 |
| 522 | 3300005983 | Ga0081540_1006864 | Ga0081540_10068649 | 156 |
| 523 | 3300005983 | Ga0081540_1062215 | Ga0081540_10622152 | 156 |
| 524 | 3300005983 | Ga0081540_1164081 | Ga0081540_11640812 | 156 |
| 525 | 3300005985 | Ga0081539_10079757 | Ga0081539_100797572 | 156 |
| 526 | 3300006028 | Ga0070717_10171221 | Ga0070717_101712213 | 156 |
| 527 | 3300006028 | Ga0070717_10558537 | Ga0070717_105585372 | 156 |
| 528 | 3300006028 | Ga0070717_11360808 | Ga0070717_113608081 | 156 |
| 529 | 3300006038 | Ga0075365_10000107 | Ga0075365_1000010713 | 156 |
| 530 | 3300006038 | Ga0075365_10105578 | Ga0075365_101055783 | 156 |
| 531 | 3300006038 | Ga0075365_10373490 | Ga0075365_103734902 | 156 |
| 532 | 3300006042 | Ga0075368_10014839 | Ga0075368_100148392 | 156 |
| 533 | 3300006048 | Ga0075363_100118852 | Ga0075363_1001188522 | 156 |
| 534 | 3300006048 | Ga0075363_100125728 | Ga0075363_1001257282 | 156 |
| 535 | 3300006051 | Ga0075364_10003335 | Ga0075364_100033356 | 156 |
| 536 | 3300006051 | Ga0075364_10044569 | Ga0075364_100445692 | 156 |
| 537 | 3300006051 | Ga0075364_10374723 | Ga0075364_103747232 | 156 |
| 538 | 3300006058 | Ga0075432_10315806 | Ga0075432_103158061 | 156 |
| 539 | 3300006175 | Ga0070712_101019032 | Ga0070712_1010190322 | 156 |
| 540 | 3300006177 | Ga0075362_10007455 | Ga0075362_100074553 | 156 |
| 541 | 3300006177 | Ga0075362_10008082 | Ga0075362_100080823 | 156 |
| 542 | 3300006178 | Ga0075367_10009044 | Ga0075367_100090443 | 156 |
| 543 | 3300006178 | Ga0075367_10685474 | Ga0075367_106854742 | 156 |
| 544 | 3300006186 | Ga0075369_10005796 | Ga0075369_100057962 | 156 |
| 545 | 3300006186 | Ga0075369_10031098 | Ga0075369_100310984 | 156 |
| 546 | 3300006195 | Ga0075366_10029169 | Ga0075366_100291693 | 156 |
| 547 | 3300006237 | Ga0097621_100011773 | Ga0097621_1000117732 | 156 |
| 548 | 3300006237 | Ga0097621_100094680 | Ga0097621_1000946805 | 156 |
| 549 | 3300006237 | Ga0097621_100163361 | Ga0097621_1001633612 | 156 |
| 550 | 3300006237 | Ga0097621_100671959 | Ga0097621_1006719592 | 156 |
| 551 | 3300006237 | Ga0097621_100792630 | Ga0097621_1007926302 | 156 |
| 552 | 3300006353 | Ga0075370_10292143 | Ga0075370_102921432 | 156 |
| 553 | 3300006353 | Ga0075370_10498765 | Ga0075370_104987652 | 156 |
| 554 | 3300006358 | Ga0068871_100043089 | Ga0068871_1000430892 | 156 |
| 555 | 3300006358 | Ga0068871_100070590 | Ga0068871_1000705903 | 156 |
| 556 | 3300006358 | Ga0068871_100243130 | Ga0068871_1002431303 | 156 |
| 557 | 3300006358 | Ga0068871_100278956 | Ga0068871_1002789562 | 156 |
| 558 | 3300006844 | Ga0075428_100130169 | Ga0075428_1001301692 | 156 |
| 559 | 3300006844 | Ga0075428_100531359 | Ga0075428_1005313592 | 156 |
| 560 | 3300006844 | Ga0075428_100821334 | Ga0075428_1008213341 | 156 |
| 561 | 3300006844 | Ga0075428_100863332 | Ga0075428_1008633321 | 156 |
| 562 | 3300006844 | Ga0075428_100971034 | Ga0075428_1009710341 | 156 |
| 563 | 3300006844 | Ga0075428_101080949 | Ga0075428_1010809492 | 156 |
| 564 | 3300006844 | Ga0075428_101955078 | Ga0075428_1019550781 | 156 |
| 565 | 3300006847 | Ga0075431_100013381 | Ga0075431_1000133814 | 156 |
| 566 | 3300006847 | Ga0075431_100043853 | Ga0075431_1000438531 | 156 |
| 567 | 3300006847 | Ga0075431_100500274 | Ga0075431_1005002742 | 156 |
| 568 | 3300006847 | Ga0075431_100667935 | Ga0075431_1006679352 | 156 |
| 569 | 3300006852 | Ga0075433_10066503 | Ga0075433_100665032 | 156 |
| 570 | 3300006852 | Ga0075433_10816227 | Ga0075433_108162272 | 156 |
| 571 | 3300006871 | Ga0075434_100087559 | Ga0075434_1000875592 | 156 |
| 572 | 3300006871 | Ga0075434_100151263 | Ga0075434_1001512632 | 156 |
| 573 | 3300006871 | Ga0075434_100242253 | Ga0075434_1002422532 | 156 |
| 574 | 3300006871 | Ga0075434_100519765 | Ga0075434_1005197652 | 156 |
| 575 | 3300006871 | Ga0075434_100770822 | Ga0075434_1007708222 | 156 |
| 576 | 3300006880 | Ga0075429_100088416 | Ga0075429_1000884162 | 156 |
| 577 | 3300006880 | Ga0075429_100677885 | Ga0075429_1006778852 | 156 |
| 578 | 3300006880 | Ga0075429_100705152 | Ga0075429_1007051522 | 156 |
| 579 | 3300006880 | Ga0075429_100833012 | Ga0075429_1008330122 | 156 |
| 580 | 3300006880 | Ga0075429_101006129 | Ga0075429_1010061291 | 156 |
| 581 | 3300006880 | Ga0075429_101177838 | Ga0075429_1011778381 | 156 |
| 582 | 3300006881 | Ga0068865_100027476 | Ga0068865_1000274763 | 156 |
| 583 | 3300006881 | Ga0068865_100503925 | Ga0068865_1005039251 | 156 |
| 584 | 3300006881 | Ga0068865_101130059 | Ga0068865_1011300592 | 156 |
| 585 | 3300006914 | Ga0075436_100499175 | Ga0075436_1004991752 | 156 |
| 586 | 3300006914 | Ga0075436_100565424 | Ga0075436_1005654242 | 156 |
| 587 | 3300006931 | Ga0097620_100000162 | Ga0097620_10000016240 | 156 |
| 588 | 3300006931 | Ga0097620_100000703 | Ga0097620_10000070338 | 156 |
| 589 | 3300006931 | Ga0097620_100001363 | Ga0097620_10000136312 | 156 |
| 590 | 3300006931 | Ga0097620_100002579 | Ga0097620_10000257915 | 156 |
| 591 | 3300006931 | Ga0097620_100116933 | Ga0097620_1001169334 | 156 |
| 592 | 3300006931 | Ga0097620_100662813 | Ga0097620_1006628132 | 156 |
| 593 | 3300007076 | Ga0075435_100261942 | Ga0075435_1002619423 | 156 |
| 594 | 3300007076 | Ga0075435_100379856 | Ga0075435_1003798562 | 156 |
| 595 | 3300007076 | Ga0075435_100710220 | Ga0075435_1007102202 | 156 |
| 596 | 3300007076 | Ga0075435_101167389 | Ga0075435_1011673892 | 156 |
| 597 | 3300007265 | Ga0099794_10067852 | Ga0099794_100678523 | 156 |
| 598 | 3300007788 | Ga0099795_10552627 | Ga0099795_105526271 | 156 |
| 599 | 3300009092 | Ga0105250_10007794 | Ga0105250_100077945 | 156 |
| 600 | 3300009093 | Ga0105240_10006530 | Ga0105240_1000653014 | 156 |
| 601 | 3300009093 | Ga0105240_11153961 | Ga0105240_111539612 | 156 |
| 602 | 3300009094 | Ga0111539_10000022 | Ga0111539_1000002246 | 156 |
| 603 | 3300009094 | Ga0111539_10040340 | Ga0111539_100403402 | 156 |
| 604 | 3300009094 | Ga0111539_10076709 | Ga0111539_100767092 | 156 |
| 605 | 3300009094 | Ga0111539_10104137 | Ga0111539_101041373 | 156 |
| 606 | 3300009094 | Ga0111539_10145119 | Ga0111539_101451194 | 156 |
| 607 | 3300009094 | Ga0111539_10381999 | Ga0111539_103819993 | 156 |
| 608 | 3300009094 | Ga0111539_10915989 | Ga0111539_109159892 | 156 |
| 609 | 3300009094 | Ga0111539_11172000 | Ga0111539_111720001 | 156 |
| 610 | 3300009094 | Ga0111539_11817078 | Ga0111539_118170781 | 156 |
| 611 | 3300009098 | Ga0105245_10000010 | Ga0105245_100000102 | 156 |
| 612 | 3300009098 | Ga0105245_10000166 | Ga0105245_100001662 | 156 |
| 613 | 3300009098 | Ga0105245_10038622 | Ga0105245_100386222 | 156 |
| 614 | 3300009098 | Ga0105245_10351851 | Ga0105245_103518512 | 156 |
| 615 | 3300009098 | Ga0105245_10392735 | Ga0105245_103927353 | 156 |
| 616 | 3300009101 | Ga0105247_10000778 | Ga0105247_1000077817 | 156 |
| 617 | 3300009101 | Ga0105247_10005540 | Ga0105247_100055407 | 156 |
| 618 | 3300009101 | Ga0105247_11763610 | Ga0105247_117636101 | 156 |
| 619 | 3300009147 | Ga0114129_10092785 | Ga0114129_100927852 | 156 |
| 620 | 3300009147 | Ga0114129_10121065 | Ga0114129_101210652 | 156 |
| 621 | 3300009147 | Ga0114129_10292313 | Ga0114129_102923132 | 156 |
| 622 | 3300009147 | Ga0114129_10606618 | Ga0114129_106066182 | 156 |
| 623 | 3300009147 | Ga0114129_11128009 | Ga0114129_111280092 | 156 |
| 624 | 3300009147 | Ga0114129_11474887 | Ga0114129_114748872 | 156 |
| 625 | 3300009147 | Ga0114129_11640064 | Ga0114129_116400642 | 156 |
| 626 | 3300009147 | Ga0114129_12639473 | Ga0114129_126394731 | 156 |
| 627 | 3300009148 | Ga0105243_10021643 | Ga0105243_100216432 | 156 |
| 628 | 3300009148 | Ga0105243_10781543 | Ga0105243_107815432 | 156 |
| 629 | 3300009174 | Ga0105241_10000628 | Ga0105241_1000062816 | 156 |
| 630 | 3300009176 | Ga0105242_10009762 | Ga0105242_100097627 | 156 |
| 631 | 3300009176 | Ga0105242_10425270 | Ga0105242_104252701 | 156 |
| 632 | 3300009176 | Ga0105242_10661511 | Ga0105242_106615112 | 156 |
| 633 | 3300009176 | Ga0105242_10794877 | Ga0105242_107948772 | 156 |
| 634 | 3300009176 | Ga0105242_11246583 | Ga0105242_112465832 | 156 |
| 635 | 3300009176 | Ga0105242_12302834 | Ga0105242_123028341 | 156 |
| 636 | 3300009177 | Ga0105248_10001106 | Ga0105248_100011063 | 156 |
| 637 | 3300009177 | Ga0105248_10034053 | Ga0105248_100340535 | 156 |
| 638 | 3300009177 | Ga0105248_10098171 | Ga0105248_100981712 | 156 |
| 639 | 3300009177 | Ga0105248_10199651 | Ga0105248_101996512 | 156 |
| 640 | 3300009177 | Ga0105248_10446231 | Ga0105248_104462312 | 156 |
| 641 | 3300009177 | Ga0105248_10851610 | Ga0105248_108516102 | 156 |
| 642 | 3300009177 | Ga0105248_11028380 | Ga0105248_110283802 | 156 |
| 643 | 3300009177 | Ga0105248_11084329 | Ga0105248_110843291 | 156 |
| 644 | 3300009177 | Ga0105248_11793594 | Ga0105248_117935941 | 156 |
| 645 | 3300009177 | Ga0105248_11865745 | Ga0105248_118657451 | 156 |
| 646 | 3300009545 | Ga0105237_10000740 | Ga0105237_1000074045 | 156 |
| 647 | 3300009551 | Ga0105238_10000002 | Ga0105238_10000002499 | 156 |
| 648 | 3300009551 | Ga0105238_10001986 | Ga0105238_1000198616 | 156 |
| 649 | 3300009553 | Ga0105249_10001061 | Ga0105249_1000106128 | 156 |
| 650 | 3300009553 | Ga0105249_10002192 | Ga0105249_100021923 | 156 |
| 651 | 3300009553 | Ga0105249_10711388 | Ga0105249_107113881 | 156 |
| 652 | 3300009553 | Ga0105249_11037129 | Ga0105249_110371292 | 156 |
| 653 | 3300010375 | Ga0105239_10001250 | Ga0105239_1000125017 | 156 |
| 654 | 3300010375 | Ga0105239_10002930 | Ga0105239_1000293036 | 156 |
| 655 | 3300011119 | Ga0105246_10128367 | Ga0105246_101283672 | 156 |
| 656 | 3300011119 | Ga0105246_10154324 | Ga0105246_101543241 | 156 |
| 657 | 3300011119 | Ga0105246_10176286 | Ga0105246_101762863 | 156 |
| 658 | 3300013100 | Ga0157373_10033827 | Ga0157373_100338273 | 156 |
| 659 | 3300013100 | Ga0157373_10264084 | Ga0157373_102640842 | 156 |
| 660 | 3300013100 | Ga0157373_10750171 | Ga0157373_107501711 | 156 |
| 661 | 3300013102 | Ga0157371_10031254 | Ga0157371_100312542 | 156 |
| 662 | 3300013102 | Ga0157371_10594347 | Ga0157371_105943472 | 156 |
| 663 | 3300013105 | Ga0157369_10001943 | Ga0157369_100019437 | 156 |
| 664 | 3300013105 | Ga0157369_10003299 | Ga0157369_100032992 | 156 |
| 665 | 3300013296 | Ga0157374_10000005 | Ga0157374_10000005572 | 156 |
| 666 | 3300013296 | Ga0157374_10045770 | Ga0157374_100457705 | 156 |
| 667 | 3300013297 | Ga0157378_10000167 | Ga0157378_100001674 | 156 |
| 668 | 3300013297 | Ga0157378_10039360 | Ga0157378_100393603 | 156 |
| 669 | 3300013297 | Ga0157378_10209845 | Ga0157378_102098451 | 156 |
| 670 | 3300013297 | Ga0157378_10376225 | Ga0157378_103762253 | 156 |
| 671 | 3300013297 | Ga0157378_10665271 | Ga0157378_106652712 | 156 |
| 672 | 3300013297 | Ga0157378_11049199 | Ga0157378_110491992 | 156 |
| 673 | 3300013306 | Ga0163162_10000823 | Ga0163162_1000082334 | 156 |
| 674 | 3300013306 | Ga0163162_10002337 | Ga0163162_1000233714 | 156 |
| 675 | 3300013306 | Ga0163162_10007545 | Ga0163162_100075457 | 156 |
| 676 | 3300013306 | Ga0163162_10096376 | Ga0163162_100963762 | 156 |
| 677 | 3300013306 | Ga0163162_10340610 | Ga0163162_103406102 | 156 |
| 678 | 3300013306 | Ga0163162_10391891 | Ga0163162_103918911 | 156 |
| 679 | 3300013307 | Ga0157372_10091324 | Ga0157372_100913242 | 156 |
| 680 | 3300013307 | Ga0157372_10373408 | Ga0157372_103734082 | 156 |
| 681 | 3300013307 | Ga0157372_11073191 | Ga0157372_110731912 | 156 |
| 682 | 3300013308 | Ga0157375_10000055 | Ga0157375_1000005598 | 156 |
| 683 | 3300013308 | Ga0157375_10001345 | Ga0157375_100013454 | 156 |
| 684 | 3300013308 | Ga0157375_10001418 | Ga0157375_100014185 | 156 |
| 685 | 3300013308 | Ga0157375_10082844 | Ga0157375_100828442 | 156 |
| 686 | 3300013308 | Ga0157375_10158566 | Ga0157375_101585664 | 156 |
| 687 | 3300013308 | Ga0157375_12000318 | Ga0157375_120003182 | 156 |
| 688 | 3300013308 | Ga0157375_12202148 | Ga0157375_122021481 | 156 |
| 689 | 3300014325 | Ga0163163_10009168 | Ga0163163_100091683 | 156 |
| 690 | 3300014325 | Ga0163163_10142986 | Ga0163163_101429864 | 156 |
| 691 | 3300014325 | Ga0163163_10369195 | Ga0163163_103691952 | 156 |
| 692 | 3300014325 | Ga0163163_10558186 | Ga0163163_105581862 | 156 |
| 693 | 3300014325 | Ga0163163_10561969 | Ga0163163_105619692 | 156 |
| 694 | 3300014325 | Ga0163163_12255054 | Ga0163163_122550541 | 156 |
| 695 | 3300014326 | Ga0157380_10118167 | Ga0157380_101181672 | 156 |
| 696 | 3300014326 | Ga0157380_10148581 | Ga0157380_101485812 | 156 |
| 697 | 3300014326 | Ga0157380_10295874 | Ga0157380_102958742 | 156 |
| 698 | 3300014326 | Ga0157380_10366891 | Ga0157380_103668911 | 156 |
| 699 | 3300014326 | Ga0157380_10551512 | Ga0157380_105515122 | 156 |
| 700 | 3300014326 | Ga0157380_10701762 | Ga0157380_107017622 | 156 |
| 701 | 3300014326 | Ga0157380_11076523 | Ga0157380_110765232 | 156 |
| 702 | 3300014745 | Ga0157377_10000026 | Ga0157377_10000026129 | 156 |
| 703 | 3300014745 | Ga0157377_10000296 | Ga0157377_1000029626 | 156 |
| 704 | 3300014745 | Ga0157377_10001264 | Ga0157377_100012649 | 156 |
| 705 | 3300014745 | Ga0157377_10122387 | Ga0157377_101223872 | 156 |
| 706 | 3300014745 | Ga0157377_10399171 | Ga0157377_103991712 | 156 |
| 707 | 3300014745 | Ga0157377_11153035 | Ga0157377_111530351 | 156 |
| 708 | 3300014968 | Ga0157379_10000025 | Ga0157379_1000002515 | 156 |
| 709 | 3300014968 | Ga0157379_10000562 | Ga0157379_100005623 | 156 |
| 710 | 3300014968 | Ga0157379_10043366 | Ga0157379_100433666 | 156 |
| 711 | 3300014968 | Ga0157379_10324834 | Ga0157379_103248342 | 156 |
| 712 | 3300014968 | Ga0157379_10693633 | Ga0157379_106936331 | 156 |
| 713 | 3300014968 | Ga0157379_10883384 | Ga0157379_108833841 | 156 |
| 714 | 3300014968 | Ga0157379_11493319 | Ga0157379_114933191 | 156 |
| 715 | 3300014968 | Ga0157379_11836295 | Ga0157379_118362951 | 156 |
| 716 | 3300014969 | Ga0157376_10000003 | Ga0157376_10000003232 | 156 |
| 717 | 3300014969 | Ga0157376_10003404 | Ga0157376_1000340410 | 156 |
| 718 | 3300014969 | Ga0157376_10089508 | Ga0157376_100895083 | 156 |
| 719 | 3300017792 | Ga0163161_10014953 | Ga0163161_100149535 | 156 |
| 720 | 3300017792 | Ga0163161_10073389 | Ga0163161_100733892 | 156 |
| 721 | 3300017792 | Ga0163161_10077880 | Ga0163161_100778802 | 156 |
| 722 | 3300017792 | Ga0163161_10111267 | Ga0163161_101112673 | 156 |
| 723 | 3300017792 | Ga0163161_10545687 | Ga0163161_105456872 | 156 |
| 724 | 3300017792 | Ga0163161_10686890 | Ga0163161_106868901 | 156 |
| 725 | 3300020076 | Ga0206355_1166500 | Ga0206355_11665002 | 156 |
| 726 | 3300020078 | Ga0206352_10354123 | Ga0206352_103541232 | 156 |
| 727 | 3300020082 | Ga0206353_11044236 | Ga0206353_110442361 | 156 |
| 728 | 3300020082 | Ga0206353_11127814 | Ga0206353_111278141 | 156 |
| 729 | 3300021358 | Ga0213873_10000721 | Ga0213873_100007213 | 156 |
| 730 | 3300021377 | Ga0213874_10207480 | Ga0213874_102074802 | 156 |
| 731 | 3300021384 | Ga0213876_10000009 | Ga0213876_10000009212 | 156 |
| 732 | 3300025290 | Ga0207673_1010380 | Ga0207673_10103802 | 156 |
| 733 | 3300025304 | Ga0209257_1063601 | Ga0209257_10636012 | 156 |
| 734 | 3300025315 | Ga0207697_10003661 | Ga0207697_100036617 | 156 |
| 735 | 3300025315 | Ga0207697_10011132 | Ga0207697_100111322 | 156 |
| 736 | 3300025315 | Ga0207697_10191667 | Ga0207697_101916672 | 156 |
| 737 | 3300025321 | Ga0207656_10052062 | Ga0207656_100520622 | 156 |
| 738 | 3300025711 | Ga0207696_1052439 | Ga0207696_10524392 | 156 |
| 739 | 3300025893 | Ga0207682_10000315 | Ga0207682_1000031513 | 156 |
| 740 | 3300025893 | Ga0207682_10003051 | Ga0207682_100030515 | 156 |
| 741 | 3300025893 | Ga0207682_10177372 | Ga0207682_101773722 | 156 |
| 742 | 3300025899 | Ga0207642_10004671 | Ga0207642_100046713 | 156 |
| 743 | 3300025899 | Ga0207642_10571812 | Ga0207642_105718122 | 156 |
| 744 | 3300025900 | Ga0207710_10004541 | Ga0207710_100045416 | 156 |
| 745 | 3300025900 | Ga0207710_10007497 | Ga0207710_100074973 | 156 |
| 746 | 3300025901 | Ga0207688_10026904 | Ga0207688_100269042 | 156 |
| 747 | 3300025903 | Ga0207680_10000156 | Ga0207680_1000015621 | 156 |
| 748 | 3300025903 | Ga0207680_10002207 | Ga0207680_100022072 | 156 |
| 749 | 3300025903 | Ga0207680_10002463 | Ga0207680_100024632 | 156 |
| 750 | 3300025903 | Ga0207680_10345296 | Ga0207680_103452962 | 156 |
| 751 | 3300025903 | Ga0207680_10440388 | Ga0207680_104403882 | 156 |
| 752 | 3300025904 | Ga0207647_10001294 | Ga0207647_100012946 | 156 |
| 753 | 3300025905 | Ga0207685_10239392 | Ga0207685_102393922 | 156 |
| 754 | 3300025907 | Ga0207645_10000031 | Ga0207645_1000003174 | 156 |
| 755 | 3300025907 | Ga0207645_10072924 | Ga0207645_100729242 | 156 |
| 756 | 3300025908 | Ga0207643_10000030 | Ga0207643_1000003047 | 156 |
| 757 | 3300025908 | Ga0207643_10027333 | Ga0207643_100273332 | 156 |
| 758 | 3300025908 | Ga0207643_10062760 | Ga0207643_100627602 | 156 |
| 759 | 3300025908 | Ga0207643_10434898 | Ga0207643_104348982 | 156 |
| 760 | 3300025908 | Ga0207643_10462185 | Ga0207643_104621852 | 156 |
| 761 | 3300025909 | Ga0207705_10082987 | Ga0207705_100829872 | 156 |
| 762 | 3300025909 | Ga0207705_10297961 | Ga0207705_102979612 | 156 |
| 763 | 3300025909 | Ga0207705_10619940 | Ga0207705_106199401 | 156 |
| 764 | 3300025910 | Ga0207684_10006000 | Ga0207684_100060008 | 156 |
| 765 | 3300025910 | Ga0207684_10155584 | Ga0207684_101555842 | 156 |
| 766 | 3300025910 | Ga0207684_10551363 | Ga0207684_105513632 | 156 |
| 767 | 3300025910 | Ga0207684_10954250 | Ga0207684_109542501 | 156 |
| 768 | 3300025911 | Ga0207654_10046503 | Ga0207654_100465032 | 156 |
| 769 | 3300025911 | Ga0207654_10680511 | Ga0207654_106805111 | 156 |
| 770 | 3300025912 | Ga0207707_10073376 | Ga0207707_100733763 | 156 |
| 771 | 3300025912 | Ga0207707_10217654 | Ga0207707_102176542 | 156 |
| 772 | 3300025913 | Ga0207695_10249706 | Ga0207695_102497062 | 156 |
| 773 | 3300025914 | Ga0207671_10015931 | Ga0207671_100159313 | 156 |
| 774 | 3300025914 | Ga0207671_10144851 | Ga0207671_101448512 | 156 |
| 775 | 3300025916 | Ga0207663_11037228 | Ga0207663_110372282 | 156 |
| 776 | 3300025917 | Ga0207660_10129345 | Ga0207660_101293452 | 156 |
| 777 | 3300025917 | Ga0207660_10494141 | Ga0207660_104941412 | 156 |
| 778 | 3300025918 | Ga0207662_10000271 | Ga0207662_100002719 | 156 |
| 779 | 3300025918 | Ga0207662_10008804 | Ga0207662_100088044 | 156 |
| 780 | 3300025918 | Ga0207662_10133430 | Ga0207662_101334302 | 156 |
| 781 | 3300025918 | Ga0207662_10522370 | Ga0207662_105223702 | 156 |
| 782 | 3300025919 | Ga0207657_10000011 | Ga0207657_1000001173 | 156 |
| 783 | 3300025919 | Ga0207657_10049742 | Ga0207657_100497422 | 156 |
| 784 | 3300025920 | Ga0207649_10008316 | Ga0207649_100083164 | 156 |
| 785 | 3300025920 | Ga0207649_10212744 | Ga0207649_102127442 | 156 |
| 786 | 3300025921 | Ga0207652_10009551 | Ga0207652_100095515 | 156 |
| 787 | 3300025921 | Ga0207652_10078554 | Ga0207652_100785542 | 156 |
| 788 | 3300025921 | Ga0207652_10147672 | Ga0207652_101476724 | 156 |
| 789 | 3300025921 | Ga0207652_10685177 | Ga0207652_106851771 | 156 |
| 790 | 3300025921 | Ga0207652_10907633 | Ga0207652_109076332 | 156 |
| 791 | 3300025922 | Ga0207646_10037380 | Ga0207646_100373806 | 156 |
| 792 | 3300025922 | Ga0207646_10107113 | Ga0207646_101071132 | 156 |
| 793 | 3300025922 | Ga0207646_10866942 | Ga0207646_108669422 | 156 |
| 794 | 3300025922 | Ga0207646_11028223 | Ga0207646_110282231 | 156 |
| 795 | 3300025923 | Ga0207681_10000030 | Ga0207681_10000030129 | 156 |
| 796 | 3300025923 | Ga0207681_10002254 | Ga0207681_100022546 | 156 |
| 797 | 3300025923 | Ga0207681_10040426 | Ga0207681_100404262 | 156 |
| 798 | 3300025923 | Ga0207681_10050455 | Ga0207681_100504552 | 156 |
| 799 | 3300025923 | Ga0207681_10528867 | Ga0207681_105288672 | 156 |
| 800 | 3300025924 | Ga0207694_10000001 | Ga0207694_10000001497 | 156 |
| 801 | 3300025924 | Ga0207694_10018119 | Ga0207694_100181194 | 156 |
| 802 | 3300025924 | Ga0207694_10706353 | Ga0207694_107063532 | 156 |
| 803 | 3300025925 | Ga0207650_10000082 | Ga0207650_1000008217 | 156 |
| 804 | 3300025925 | Ga0207650_10003671 | Ga0207650_100036714 | 156 |
| 805 | 3300025925 | Ga0207650_10083832 | Ga0207650_100838323 | 156 |
| 806 | 3300025925 | Ga0207650_10088283 | Ga0207650_100882833 | 156 |
| 807 | 3300025925 | Ga0207650_10286188 | Ga0207650_102861882 | 156 |
| 808 | 3300025925 | Ga0207650_10414501 | Ga0207650_104145012 | 156 |
| 809 | 3300025925 | Ga0207650_11448574 | Ga0207650_114485741 | 156 |
| 810 | 3300025926 | Ga0207659_10000169 | Ga0207659_1000016925 | 156 |
| 811 | 3300025926 | Ga0207659_10000843 | Ga0207659_100008436 | 156 |
| 812 | 3300025926 | Ga0207659_10003434 | Ga0207659_100034347 | 156 |
| 813 | 3300025926 | Ga0207659_10008702 | Ga0207659_100087022 | 156 |
| 814 | 3300025926 | Ga0207659_10014994 | Ga0207659_100149944 | 156 |
| 815 | 3300025926 | Ga0207659_10655067 | Ga0207659_106550672 | 156 |
| 816 | 3300025926 | Ga0207659_11000666 | Ga0207659_110006662 | 156 |
| 817 | 3300025927 | Ga0207687_10000005 | Ga0207687_10000005438 | 156 |
| 818 | 3300025927 | Ga0207687_10019566 | Ga0207687_100195664 | 156 |
| 819 | 3300025927 | Ga0207687_10025639 | Ga0207687_100256394 | 156 |
| 820 | 3300025927 | Ga0207687_10355127 | Ga0207687_103551272 | 156 |
| 821 | 3300025927 | Ga0207687_10454432 | Ga0207687_104544322 | 156 |
| 822 | 3300025929 | Ga0207664_11889263 | Ga0207664_118892631 | 156 |
| 823 | 3300025931 | Ga0207644_10000017 | Ga0207644_10000017131 | 156 |
| 824 | 3300025931 | Ga0207644_10001196 | Ga0207644_1000119614 | 156 |
| 825 | 3300025931 | Ga0207644_10010834 | Ga0207644_100108342 | 156 |
| 826 | 3300025931 | Ga0207644_10015417 | Ga0207644_100154175 | 156 |
| 827 | 3300025931 | Ga0207644_10278590 | Ga0207644_102785902 | 156 |
| 828 | 3300025931 | Ga0207644_10396069 | Ga0207644_103960692 | 156 |
| 829 | 3300025931 | Ga0207644_10785485 | Ga0207644_107854851 | 156 |
| 830 | 3300025932 | Ga0207690_10005181 | Ga0207690_100051816 | 156 |
| 831 | 3300025932 | Ga0207690_10155537 | Ga0207690_101555372 | 156 |
| 832 | 3300025932 | Ga0207690_10365538 | Ga0207690_103655382 | 156 |
| 833 | 3300025933 | Ga0207706_10000034 | Ga0207706_1000003417 | 156 |
| 834 | 3300025933 | Ga0207706_10202278 | Ga0207706_102022782 | 156 |
| 835 | 3300025934 | Ga0207686_10036644 | Ga0207686_100366442 | 156 |
| 836 | 3300025934 | Ga0207686_10289976 | Ga0207686_102899762 | 156 |
| 837 | 3300025934 | Ga0207686_10772179 | Ga0207686_107721792 | 156 |
| 838 | 3300025934 | Ga0207686_10855988 | Ga0207686_108559882 | 156 |
| 839 | 3300025935 | Ga0207709_10035416 | Ga0207709_100354162 | 156 |
| 840 | 3300025935 | Ga0207709_10349548 | Ga0207709_103495482 | 156 |
| 841 | 3300025936 | Ga0207670_10001213 | Ga0207670_1000121313 | 156 |
| 842 | 3300025936 | Ga0207670_10014044 | Ga0207670_100140444 | 156 |
| 843 | 3300025936 | Ga0207670_10055322 | Ga0207670_100553222 | 156 |
| 844 | 3300025936 | Ga0207670_10465613 | Ga0207670_104656132 | 156 |
| 845 | 3300025937 | Ga0207669_10003369 | Ga0207669_100033694 | 156 |
| 846 | 3300025937 | Ga0207669_10029450 | Ga0207669_100294502 | 156 |
| 847 | 3300025937 | Ga0207669_10468273 | Ga0207669_104682732 | 156 |
| 848 | 3300025937 | Ga0207669_10878782 | Ga0207669_108787822 | 156 |
| 849 | 3300025938 | Ga0207704_10001582 | Ga0207704_100015827 | 156 |
| 850 | 3300025938 | Ga0207704_10309810 | Ga0207704_103098102 | 156 |
| 851 | 3300025938 | Ga0207704_11339769 | Ga0207704_113397692 | 156 |
| 852 | 3300025939 | Ga0207665_10124947 | Ga0207665_101249472 | 156 |
| 853 | 3300025939 | Ga0207665_10507278 | Ga0207665_105072782 | 156 |
| 854 | 3300025940 | Ga0207691_10002377 | Ga0207691_1000237716 | 156 |
| 855 | 3300025940 | Ga0207691_10019115 | Ga0207691_100191152 | 156 |
| 856 | 3300025940 | Ga0207691_10028502 | Ga0207691_100285027 | 156 |
| 857 | 3300025940 | Ga0207691_10065795 | Ga0207691_100657952 | 156 |
| 858 | 3300025940 | Ga0207691_10130939 | Ga0207691_101309394 | 156 |
| 859 | 3300025940 | Ga0207691_10146662 | Ga0207691_101466623 | 156 |
| 860 | 3300025940 | Ga0207691_10535902 | Ga0207691_105359022 | 156 |
| 861 | 3300025941 | Ga0207711_10002481 | Ga0207711_1000248112 | 156 |
| 862 | 3300025941 | Ga0207711_10003920 | Ga0207711_100039203 | 156 |
| 863 | 3300025941 | Ga0207711_10011639 | Ga0207711_100116392 | 156 |
| 864 | 3300025941 | Ga0207711_10022799 | Ga0207711_100227994 | 156 |
| 865 | 3300025941 | Ga0207711_10451419 | Ga0207711_104514192 | 156 |
| 866 | 3300025941 | Ga0207711_11264963 | Ga0207711_112649632 | 156 |
| 867 | 3300025942 | Ga0207689_10000641 | Ga0207689_1000064117 | 156 |
| 868 | 3300025942 | Ga0207689_10042822 | Ga0207689_100428222 | 156 |
| 869 | 3300025942 | Ga0207689_10437590 | Ga0207689_104375902 | 156 |
| 870 | 3300025942 | Ga0207689_10455115 | Ga0207689_104551152 | 156 |
| 871 | 3300025944 | Ga0207661_10000006 | Ga0207661_10000006470 | 156 |
| 872 | 3300025944 | Ga0207661_10019215 | Ga0207661_100192155 | 156 |
| 873 | 3300025944 | Ga0207661_11230030 | Ga0207661_112300301 | 156 |
| 874 | 3300025945 | Ga0207679_10000559 | Ga0207679_1000055913 | 156 |
| 875 | 3300025945 | Ga0207679_10007400 | Ga0207679_100074004 | 156 |
| 876 | 3300025945 | Ga0207679_10025854 | Ga0207679_100258543 | 156 |
| 877 | 3300025945 | Ga0207679_10496921 | Ga0207679_104969212 | 156 |
| 878 | 3300025945 | Ga0207679_10506541 | Ga0207679_105065412 | 156 |
| 879 | 3300025949 | Ga0207667_10044132 | Ga0207667_100441324 | 156 |
| 880 | 3300025949 | Ga0207667_11068780 | Ga0207667_110687801 | 156 |
| 881 | 3300025949 | Ga0207667_11476237 | Ga0207667_114762371 | 156 |
| 882 | 3300025960 | Ga0207651_10000455 | Ga0207651_100004555 | 156 |
| 883 | 3300025960 | Ga0207651_10005338 | Ga0207651_100053382 | 156 |
| 884 | 3300025960 | Ga0207651_10479816 | Ga0207651_104798161 | 156 |
| 885 | 3300025960 | Ga0207651_11063499 | Ga0207651_110634991 | 156 |
| 886 | 3300025961 | Ga0207712_10004830 | Ga0207712_100048303 | 156 |
| 887 | 3300025961 | Ga0207712_10307697 | Ga0207712_103076973 | 156 |
| 888 | 3300025961 | Ga0207712_10426834 | Ga0207712_104268341 | 156 |
| 889 | 3300025961 | Ga0207712_10846409 | Ga0207712_108464092 | 156 |
| 890 | 3300025961 | Ga0207712_10899409 | Ga0207712_108994091 | 156 |
| 891 | 3300025972 | Ga0207668_10000058 | Ga0207668_1000005813 | 156 |
| 892 | 3300025972 | Ga0207668_10000402 | Ga0207668_1000040233 | 156 |
| 893 | 3300025972 | Ga0207668_10001084 | Ga0207668_100010845 | 156 |
| 894 | 3300025972 | Ga0207668_10713656 | Ga0207668_107136562 | 156 |
| 895 | 3300025972 | Ga0207668_11790493 | Ga0207668_117904931 | 156 |
| 896 | 3300025981 | Ga0207640_10001483 | Ga0207640_100014832 | 156 |
| 897 | 3300025981 | Ga0207640_10518093 | Ga0207640_105180932 | 156 |
| 898 | 3300025986 | Ga0207658_10000023 | Ga0207658_1000002380 | 156 |
| 899 | 3300025986 | Ga0207658_10006186 | Ga0207658_100061866 | 156 |
| 900 | 3300025986 | Ga0207658_10015862 | Ga0207658_100158625 | 156 |
| 901 | 3300025986 | Ga0207658_10056354 | Ga0207658_100563543 | 156 |
| 902 | 3300025986 | Ga0207658_10272420 | Ga0207658_102724202 | 156 |
| 903 | 3300025986 | Ga0207658_10390448 | Ga0207658_103904482 | 156 |
| 904 | 3300026023 | Ga0207677_10000101 | Ga0207677_1000010178 | 156 |
| 905 | 3300026023 | Ga0207677_10000141 | Ga0207677_1000014160 | 156 |
| 906 | 3300026023 | Ga0207677_10000597 | Ga0207677_1000059710 | 156 |
| 907 | 3300026023 | Ga0207677_10013756 | Ga0207677_100137563 | 156 |
| 908 | 3300026023 | Ga0207677_11367572 | Ga0207677_113675722 | 156 |
| 909 | 3300026035 | Ga0207703_10000646 | Ga0207703_1000064614 | 156 |
| 910 | 3300026035 | Ga0207703_10003772 | Ga0207703_100037728 | 156 |
| 911 | 3300026035 | Ga0207703_10011288 | Ga0207703_100112884 | 156 |
| 912 | 3300026035 | Ga0207703_10025509 | Ga0207703_100255093 | 156 |
| 913 | 3300026035 | Ga0207703_10036709 | Ga0207703_100367092 | 156 |
| 914 | 3300026035 | Ga0207703_10152213 | Ga0207703_101522132 | 156 |
| 915 | 3300026035 | Ga0207703_10297900 | Ga0207703_102979002 | 156 |
| 916 | 3300026035 | Ga0207703_10637144 | Ga0207703_106371442 | 156 |
| 917 | 3300026041 | Ga0207639_10012024 | Ga0207639_100120245 | 156 |
| 918 | 3300026041 | Ga0207639_10212479 | Ga0207639_102124792 | 156 |
| 919 | 3300026067 | Ga0207678_10000382 | Ga0207678_1000038231 | 156 |
| 920 | 3300026067 | Ga0207678_10473580 | Ga0207678_104735802 | 156 |
| 921 | 3300026075 | Ga0207708_10019083 | Ga0207708_100190835 | 156 |
| 922 | 3300026075 | Ga0207708_10107478 | Ga0207708_101074782 | 156 |
| 923 | 3300026075 | Ga0207708_10454848 | Ga0207708_104548482 | 156 |
| 924 | 3300026078 | Ga0207702_10003061 | Ga0207702_1000306112 | 156 |
| 925 | 3300026078 | Ga0207702_11129708 | Ga0207702_111297081 | 156 |
| 926 | 3300026088 | Ga0207641_10000119 | Ga0207641_1000011938 | 156 |
| 927 | 3300026088 | Ga0207641_10000293 | Ga0207641_1000029321 | 156 |
| 928 | 3300026088 | Ga0207641_10002454 | Ga0207641_100024542 | 156 |
| 929 | 3300026088 | Ga0207641_10002919 | Ga0207641_100029199 | 156 |
| 930 | 3300026088 | Ga0207641_10278913 | Ga0207641_102789131 | 156 |
| 931 | 3300026088 | Ga0207641_10373131 | Ga0207641_103731312 | 156 |
| 932 | 3300026088 | Ga0207641_10507609 | Ga0207641_105076093 | 156 |
| 933 | 3300026089 | Ga0207648_10000117 | Ga0207648_1000011774 | 156 |
| 934 | 3300026089 | Ga0207648_10335963 | Ga0207648_103359632 | 156 |
| 935 | 3300026089 | Ga0207648_10652183 | Ga0207648_106521832 | 156 |
| 936 | 3300026095 | Ga0207676_10000023 | Ga0207676_10000023185 | 156 |
| 937 | 3300026095 | Ga0207676_10001632 | Ga0207676_100016324 | 156 |
| 938 | 3300026095 | Ga0207676_10007495 | Ga0207676_100074953 | 156 |
| 939 | 3300026095 | Ga0207676_10014815 | Ga0207676_100148153 | 156 |
| 940 | 3300026095 | Ga0207676_10047880 | Ga0207676_100478805 | 156 |
| 941 | 3300026095 | Ga0207676_10171181 | Ga0207676_101711812 | 156 |
| 942 | 3300026095 | Ga0207676_10188717 | Ga0207676_101887173 | 156 |
| 943 | 3300026116 | Ga0207674_10001256 | Ga0207674_1000125615 | 156 |
| 944 | 3300026116 | Ga0207674_10097350 | Ga0207674_100973503 | 156 |
| 945 | 3300026116 | Ga0207674_10133067 | Ga0207674_101330672 | 156 |
| 946 | 3300026116 | Ga0207674_10405949 | Ga0207674_104059492 | 156 |
| 947 | 3300026116 | Ga0207674_10451737 | Ga0207674_104517371 | 156 |
| 948 | 3300026116 | Ga0207674_11191987 | Ga0207674_111919871 | 156 |
| 949 | 3300026118 | Ga0207675_100000221 | Ga0207675_10000022140 | 156 |
| 950 | 3300026118 | Ga0207675_100000748 | Ga0207675_10000074814 | 156 |
| 951 | 3300026118 | Ga0207675_100379760 | Ga0207675_1003797602 | 156 |
| 952 | 3300026118 | Ga0207675_100539314 | Ga0207675_1005393142 | 156 |
| 953 | 3300026121 | Ga0207683_10000052 | Ga0207683_1000005270 | 156 |
| 954 | 3300026121 | Ga0207683_10001846 | Ga0207683_1000184628 | 156 |
| 955 | 3300026121 | Ga0207683_10157782 | Ga0207683_101577822 | 156 |
| 956 | 3300026121 | Ga0207683_10386835 | Ga0207683_103868352 | 156 |
| 957 | 3300026121 | Ga0207683_10821957 | Ga0207683_108219572 | 156 |
| 958 | 3300026142 | Ga0207698_10001612 | Ga0207698_100016127 | 156 |
| 959 | 3300026142 | Ga0207698_11071165 | Ga0207698_110711651 | 156 |
| 960 | 3300027671 | Ga0209588_1000034 | Ga0209588_100003457 | 156 |
| 961 | 3300027671 | Ga0209588_1034864 | Ga0209588_10348643 | 156 |
| 962 | 3300027866 | Ga0209813_10019110 | Ga0209813_100191102 | 156 |
| 963 | 3300027907 | Ga0207428_10000030 | Ga0207428_1000003046 | 156 |
| 964 | 3300027907 | Ga0207428_10015732 | Ga0207428_100157326 | 156 |
| 965 | 3300027907 | Ga0207428_10112819 | Ga0207428_101128192 | 156 |
| 966 | 3300027907 | Ga0207428_10345276 | Ga0207428_103452762 | 156 |
| 967 | 3300028379 | Ga0268266_10003323 | Ga0268266_100033232 | 156 |
| 968 | 3300028379 | Ga0268266_10209431 | Ga0268266_102094311 | 156 |
| 969 | 3300028379 | Ga0268266_10251851 | Ga0268266_102518512 | 156 |
| 970 | 3300028380 | Ga0268265_10000074 | Ga0268265_1000007446 | 156 |
| 971 | 3300028380 | Ga0268265_10001297 | Ga0268265_1000129714 | 156 |
| 972 | 3300028380 | Ga0268265_10083495 | Ga0268265_100834951 | 156 |
| 973 | 3300028380 | Ga0268265_10289007 | Ga0268265_102890071 | 156 |
| 974 | 3300028380 | Ga0268265_10730524 | Ga0268265_107305241 | 156 |
| 975 | 3300028381 | Ga0268264_10000215 | Ga0268264_1000021566 | 156 |
| 976 | 3300028381 | Ga0268264_10001288 | Ga0268264_100012883 | 156 |
| 977 | 3300028381 | Ga0268264_10001574 | Ga0268264_100015747 | 156 |
| 978 | 3300028381 | Ga0268264_10005869 | Ga0268264_100058698 | 156 |
| 979 | 3300028381 | Ga0268264_10028969 | Ga0268264_100289695 | 156 |
| 980 | 3300028381 | Ga0268264_10042912 | Ga0268264_100429124 | 156 |
| 981 | 3300028381 | Ga0268264_11113467 | Ga0268264_111134671 | 156 |
| 982 | 3300028381 | Ga0268264_11698265 | Ga0268264_116982651 | 156 |
| 983 | 3300028573 | Ga0265334_10094472 | Ga0265334_100944721 | 156 |
| 984 | 3300028573 | Ga0265334_10117342 | Ga0265334_101173421 | 156 |
| 985 | 3300028577 | Ga0265318_10001354 | Ga0265318_1000135426 | 156 |
| 986 | 3300028794 | Ga0307515_10456415 | Ga0307515_104564152 | 156 |
| 987 | 3300028800 | Ga0265338_10086311 | Ga0265338_100863112 | 156 |
| 988 | 3300028800 | Ga0265338_10156521 | Ga0265338_101565212 | 156 |
| 989 | 3300029277 | Ga0311001_1065531 | Ga0311001_10655312 | 156 |
| 990 | 3300029285 | Ga0310981_1062149 | Ga0310981_10621492 | 156 |
| 991 | 3300030521 | Ga0307511_10035882 | Ga0307511_100358824 | 156 |
| 992 | 3300031235 | Ga0265330_10012809 | Ga0265330_100128092 | 156 |
| 993 | 3300031238 | Ga0265332_10322798 | Ga0265332_103227982 | 156 |
| 994 | 3300031239 | Ga0265328_10079426 | Ga0265328_100794262 | 156 |
| 995 | 3300031240 | Ga0265320_10035011 | Ga0265320_100350113 | 156 |
| 996 | 3300031241 | Ga0265325_10021301 | Ga0265325_100213013 | 156 |
| 997 | 3300031241 | Ga0265325_10060212 | Ga0265325_100602123 | 156 |
| 998 | 3300031247 | Ga0265340_10024603 | Ga0265340_100246032 | 156 |
| 999 | 3300031247 | Ga0265340_10068202 | Ga0265340_100682023 | 156 |
| 1000 | 3300031249 | Ga0265339_10006973 | Ga0265339_100069736 | 156 |
| 1001 | 3300031249 | Ga0265339_10028147 | Ga0265339_100281472 | 156 |
| 1002 | 3300031344 | Ga0265316_10020371 | Ga0265316_100203717 | 156 |
| 1003 | 3300031344 | Ga0265316_10131015 | Ga0265316_101310152 | 156 |
| 1004 | 3300031344 | Ga0265316_10331934 | Ga0265316_103319341 | 156 |
| 1005 | 3300031548 | Ga0307408_100475168 | Ga0307408_1004751682 | 156 |
| 1006 | 3300031548 | Ga0307408_100637780 | Ga0307408_1006377802 | 156 |
| 1007 | 3300031548 | Ga0307408_101306425 | Ga0307408_1013064252 | 156 |
| 1008 | 3300031595 | Ga0265313_10011254 | Ga0265313_100112542 | 156 |
| 1009 | 3300031595 | Ga0265313_10039145 | Ga0265313_100391453 | 156 |
| 1010 | 3300031616 | Ga0307508_10056336 | Ga0307508_100563363 | 156 |
| 1011 | 3300031691 | Ga0316579_10033296 | Ga0316579_100332962 | 156 |
| 1012 | 3300031711 | Ga0265314_10049655 | Ga0265314_100496553 | 156 |
| 1013 | 3300031711 | Ga0265314_10087198 | Ga0265314_100871982 | 156 |
| 1014 | 3300031712 | Ga0265342_10000677 | Ga0265342_1000067745 | 156 |
| 1015 | 3300031712 | Ga0265342_10003703 | Ga0265342_100037035 | 156 |
| 1016 | 3300031731 | Ga0307405_11103554 | Ga0307405_111035542 | 156 |
| 1017 | 3300031731 | Ga0307405_11583799 | Ga0307405_115837992 | 156 |
| 1018 | 3300031824 | Ga0307413_10854422 | Ga0307413_108544221 | 156 |
| 1019 | 3300031901 | Ga0307406_11012386 | Ga0307406_110123861 | 156 |
| 1020 | 3300031911 | Ga0307412_11478717 | Ga0307412_114787171 | 156 |
| 1021 | 3300031911 | Ga0307412_11916637 | Ga0307412_119166371 | 156 |
| 1022 | 3300031995 | Ga0307409_100438146 | Ga0307409_1004381462 | 156 |
| 1023 | 3300032168 | Ga0316593_10009085 | Ga0316593_100090852 | 156 |
| 1024 | 3300033180 | Ga0307510_10255491 | Ga0307510_102554912 | 156 |
| 1025 | 3300034816 | Ga0373930_0060566 | Ga0373930_0060566_308_778 | 156 |
| 1026 | 3300035086 | Ga0373934_0127623 | Ga0373934_0127623_236_706 | 156 |
| 1027 | 3300035091 | Ga0373951_0130114 | Ga0373951_0130114_118_588 | 156 |
| 1028 | 3300035111 | Ga0373923_0157419 | Ga0373923_0157419_48_518 | 156 |
| 1029 | 3300035114 | Ga0373939_0055304 | Ga0373939_0055304_355_825 | 156 |
| 1030 | 3300035115 | Ga0373941_0012714 | Ga0373941_0012714_373_843 | 156 |
| 1031 | 3300035115 | Ga0373941_0242102 | Ga0373941_0242102_132_602 | 156 |
| 1032 | 3300035117 | Ga0373953_0026669 | Ga0373953_0026669_921_1391 | 156 |
| 1033 | 3300035118 | Ga0373954_0087403 | Ga0373954_0087403_675_1145 | 156 |
| 1034 | 3300035118 | Ga0373954_0197171 | Ga0373954_0197171_123_593 | 156 |
| 1035 | 3300035119 | Ga0373956_0323722 | Ga0373956_0323722_127_615 | 156 |
| 1036 | 3300035171 | Ga0373946_0249273 | Ga0373946_0249273_22_492 | 156 |
| 1037 | 3300035171 | Ga0373946_0530438 | Ga0373946_0530438_90_560 | 156 |
| 1038 | 3300035171 | Ga0373946_0609317 | Ga0373946_0609317_30_500 | 156 |
| 1039 | 3300035172 | Ga0373955_0339445 | Ga0373955_0339445_52_522 | 156 |
| 1040 | 3300035207 | Ga0373942_0132723 | Ga0373942_0132723_143_613 | 156 |
| 1041 | 3300035241 | Ga0373961_0006112 | Ga0373961_0006112_1075_1545 | 156 |
| 1042 | 3300035241 | Ga0373961_0081113 | Ga0373961_0081113_396_866 | 156 |
| 1043 | 3300035242 | Ga0373962_0117210 | Ga0373962_0117210_147_617 | 156 |
| 1044 | 3300035398 | Ga0316574_0111493 | Ga0316574_0111493_667_1137 | 156 |
| 1045 | 3300035691 | Ga0373931_0108446 | Ga0373931_0108446_59_529 | 156 |
| 1046 | 3300035691 | Ga0373931_0469816 | Ga0373931_0469816_77_547 | 156 |
| 1047 | 3300035691 | Ga0373931_0563852 | Ga0373931_0563852_100_570 | 156 |
| 1048 | 3300035692 | Ga0373935_0324241 | Ga0373935_0324241_608_1078 | 156 |
| 1049 | 3300035724 | Ga0373933_0266107 | Ga0373933_0266107_85_555 | 156 |
| 1050 | 3300035725 | Ga0373947_0175682 | Ga0373947_0175682_143_613 | 156 |
| 1051 | 3300035725 | Ga0373947_0204773 | Ga0373947_0204773_645_1115 | 156 |
| 1052 | 3300036401 | Ga0373937_0078196 | Ga0373937_0078196_1530_2000 | 156 |
| 1053 | 3300036401 | Ga0373937_0123566 | Ga0373937_0123566_1772_2242 | 156 |
| 1054 | 3300036401 | Ga0373937_0875140 | Ga0373937_0875140_85_555 | 156 |
| 1055 | 3300036647 | Ga0316582_0281182 | Ga0316582_0281182_233_703 | 156 |
| 1056 | 3300037068 | Ga0373925_0263373 | Ga0373925_0263373_825_1295 | 156 |
| 1057 | 3300037068 | Ga0373925_0955722 | Ga0373925_0955722_167_637 | 156 |
| 1058 | 3300037312 | Ga0395899_0242304 | Ga0395899_0242304_620_1090 | 156 |
| 1059 | 3300037312 | Ga0395899_0269986 | Ga0395899_0269986_135_605 | 156 |
| 1060 | 3300037418 | Ga0395900_0112357 | Ga0395900_0112357_2192_2662 | 156 |
| 1061 | 3300037418 | Ga0395900_0137697 | Ga0395900_0137697_136_606 | 156 |
| 1062 | 3300037418 | Ga0395900_0273577 | Ga0395900_0273577_870_1340 | 156 |
| 1063 | 3300037466 | Ga0395898_0118813 | Ga0395898_0118813_1555_2025 | 156 |
| 1064 | 3300037466 | Ga0395898_0161600 | Ga0395898_0161600_1107_1577 | 156 |
| 1065 | 3300037466 | Ga0395898_0715060 | Ga0395898_0715060_69_539 | 156 |
| 1066 | 3300037466 | Ga0395898_1201500 | Ga0395898_1201500_176_646 | 156 |
| 1067 | 3300037471 | Ga0395905_0953119 | Ga0395905_0953119_198_668 | 156 |
| 1068 | 3300037853 | Ga0436364_0088257 | Ga0436364_0088257_52_522 | 156 |
| 1069 | 3300037853 | Ga0436364_0947734 | Ga0436364_0947734_141_611 | 156 |
| 1070 | 3300038443 | Ga0395901_0077174 | Ga0395901_0077174_1482_1952 | 156 |
| 1071 | 3300038443 | Ga0395901_0093453 | Ga0395901_0093453_1107_1577 | 156 |
| 1072 | 3300039437 | Ga0436365_0179814 | Ga0436365_0179814_68_538 | 156 |
| 1073 | 3300039437 | Ga0436365_0197039 | Ga0436365_0197039_4070_4540 | 156 |
| 1074 | 3300039437 | Ga0436365_1510825 | Ga0436365_1510825_45_515 | 156 |
| 1075 | 3300039438 | Ga0436360_1030095 | Ga0436360_1030095_410_880 | 156 |
| 1076 | 3300039450 | Ga0436363_1487013 | Ga0436363_1487013_457_927 | 156 |
| 1077 | 3300039450 | Ga0436363_1554023 | Ga0436363_1554023_689_1159 | 156 |
| 1078 | 3300039450 | Ga0436363_1709560 | Ga0436363_1709560_465_953 | 156 |
| 1079 | 3300039453 | Ga0436362_0549823 | Ga0436362_0549823_29_499 | 156 |
| 1080 | 3300039453 | Ga0436362_0795304 | Ga0436362_0795304_546_1016 | 156 |
| 1081 | 3300039453 | Ga0436362_1063276 | Ga0436362_1063276_2362_2832 | 156 |
| 1082 | 3300041458 | Ga0451798_0719119 | Ga0451798_0719119_153_623 | 156 |
| 1083 | 3300041511 | Ga0451855_1960161 | Ga0451855_1960161_295_765 | 156 |
| 1084 | 3300042012 | Ga0439455_0002430 | Ga0439455_0002430_1750_2220 | 156 |
| 1085 | 3300042125 | Ga0450923_138805 | Ga0450923_138805_59_529 | 156 |
| 1086 | 3300042137 | Ga0450902_061543 | Ga0450902_061543_68_538 | 156 |
| 1087 | 3300042435 | Ga0439434_0010819 | Ga0439434_0010819_1166_1636 | 156 |
| 1088 | 3300042438 | Ga0439459_0102457 | Ga0439459_0102457_210_680 | 156 |
| 1089 | 3300042439 | Ga0439464_0103232 | Ga0439464_0103232_204_674 | 156 |
| 1090 | 3300042461 | Ga0439460_0015566 | Ga0439460_0015566_90_560 | 156 |
| 1091 | 3300042876 | Ga0451577_0011021 | Ga0451577_0011021_344_814 | 156 |
| 1092 | 3300042876 | Ga0451577_0049881 | Ga0451577_0049881_1938_2408 | 156 |
| 1093 | 3300042876 | Ga0451577_0071974 | Ga0451577_0071974_902_1372 | 156 |
| 1094 | 3300042876 | Ga0451577_0174276 | Ga0451577_0174276_431_901 | 156 |
| 1095 | 3300042876 | Ga0451577_0197157 | Ga0451577_0197157_85_555 | 156 |
| 1096 | 3300044658 | Ga0466972_0051802 | Ga0466972_0051802_1404_1892 | 156 |
| 1097 | 3300044658 | Ga0466972_0065614 | Ga0466972_0065614_28_498 | 156 |
| 1098 | 3300044673 | Ga0453683_0001246 | Ga0453683_0001246_2746_3216 | 156 |
| 1099 | 3300044673 | Ga0453683_0007125 | Ga0453683_0007125_522_992 | 156 |
| 1100 | 3300044673 | Ga0453683_0007146 | Ga0453683_0007146_6619_7089 | 156 |
| 1101 | 3300044673 | Ga0453683_0015865 | Ga0453683_0015865_1948_2418 | 156 |
| 1102 | 3300044673 | Ga0453683_0026252 | Ga0453683_0026252_506_976 | 156 |
| 1103 | 3300044694 | Ga0466963_0030514 | Ga0466963_0030514_864_1334 | 156 |
| 1104 | 3300044712 | Ga0453684_0007935 | Ga0453684_0007935_10961_11431 | 156 |
| 1105 | 3300044712 | Ga0453684_0018536 | Ga0453684_0018536_7749_8219 | 156 |
| 1106 | 3300044842 | Ga0466957_0094687 | Ga0466957_0094687_1111_1581 | 156 |
| 1107 | 3300044842 | Ga0466957_0558926 | Ga0466957_0558926_52_522 | 156 |
| 1108 | 3300044842 | Ga0466957_0920102 | Ga0466957_0920102_104_574 | 156 |
| 1109 | 3300045051 | Ga0451576_0000111 | Ga0451576_0000111_206919_207389 | 156 |
| 1110 | 3300045051 | Ga0451576_0004454 | Ga0451576_0004454_506_976 | 156 |
| 1111 | 3300045051 | Ga0451576_0046783 | Ga0451576_0046783_1434_1904 | 156 |
| 1112 | 3300045051 | Ga0451576_0175522 | Ga0451576_0175522_1237_1707 | 156 |
| 1113 | 3300045051 | Ga0451576_0544333 | Ga0451576_0544333_298_768 | 156 |
| 1114 | 3300045051 | Ga0451576_0745148 | Ga0451576_0745148_172_642 | 156 |
| 1115 | 3300045051 | Ga0451576_1144712 | Ga0451576_1144712_148_621 | 156 |
| 1116 | 3300045976 | Ga0466967_0025273 | Ga0466967_0025273_862_1332 | 156 |
| 1117 | 3300045976 | Ga0466967_0722947 | Ga0466967_0722947_193_681 | 156 |
| 1118 | 3300045976 | Ga0466967_0770455 | Ga0466967_0770455_365_835 | 156 |
| 1119 | 3300046454 | Ga0495592_0036142 | Ga0495592_0036142_1954_2424 | 156 |
| 1120 | 3300046454 | Ga0495592_0118607 | Ga0495592_0118607_366_854 | 156 |
| 1121 | 3300046459 | Ga0495629_0072313 | Ga0495629_0072313_162_632 | 156 |
| 1122 | 3300046462 | Ga0495651_0191065 | Ga0495651_0191065_329_817 | 156 |
| 1123 | 3300046462 | Ga0495651_0650703 | Ga0495651_0650703_59_529 | 156 |
| 1124 | 3300046471 | Ga0495650_0003288 | Ga0495650_0003288_1965_2435 | 156 |
| 1125 | 3300046472 | Ga0495580_0082266 | Ga0495580_0082266_1681_2151 | 156 |
| 1126 | 3300046472 | Ga0495580_0107955 | Ga0495580_0107955_347_817 | 156 |
| 1127 | 3300046472 | Ga0495580_0395404 | Ga0495580_0395404_211_681 | 156 |
| 1128 | 3300046472 | Ga0495580_0813812 | Ga0495580_0813812_82_552 | 156 |
| 1129 | 3300046474 | Ga0495605_0058483 | Ga0495605_0058483_165_635 | 156 |
| 1130 | 3300046476 | Ga0495662_0066154 | Ga0495662_0066154_787_1257 | 156 |
| 1131 | 3300046477 | Ga0495664_0035203 | Ga0495664_0035203_1525_1995 | 156 |
| 1132 | 3300046511 | Ga0495608_0010700 | Ga0495608_0010700_862_1332 | 156 |
| 1133 | 3300046511 | Ga0495608_0403862 | Ga0495608_0403862_34_522 | 156 |
| 1134 | 3300046514 | Ga0495618_0104683 | Ga0495618_0104683_1269_1739 | 156 |
| 1135 | 3300046514 | Ga0495618_0207056 | Ga0495618_0207056_688_1158 | 156 |
| 1136 | 3300046516 | Ga0495628_0320942 | Ga0495628_0320942_99_587 | 156 |
| 1137 | 3300046516 | Ga0495628_1082799 | Ga0495628_1082799_16_504 | 156 |
| 1138 | 3300046517 | Ga0495630_0291352 | Ga0495630_0291352_512_982 | 156 |
| 1139 | 3300046518 | Ga0495631_0381839 | Ga0495631_0381839_117_587 | 156 |
| 1140 | 3300046528 | Ga0495642_0226844 | Ga0495642_0226844_247_717 | 156 |
| 1141 | 3300046530 | Ga0495654_0163918 | Ga0495654_0163918_156_626 | 156 |
| 1142 | 3300046535 | Ga0495586_0097597 | Ga0495586_0097597_1040_1510 | 156 |
| 1143 | 3300046535 | Ga0495586_0360711 | Ga0495586_0360711_273_743 | 156 |
| 1144 | 3300046536 | Ga0495587_0272272 | Ga0495587_0272272_358_846 | 156 |
| 1145 | 3300046537 | Ga0495598_0023404 | Ga0495598_0023404_351_821 | 156 |
| 1146 | 3300046537 | Ga0495598_0075735 | Ga0495598_0075735_531_1001 | 156 |
| 1147 | 3300046537 | Ga0495598_0170017 | Ga0495598_0170017_204_674 | 156 |
| 1148 | 3300046539 | Ga0495621_0008145 | Ga0495621_0008145_1277_1747 | 156 |
| 1149 | 3300046539 | Ga0495621_0342253 | Ga0495621_0342253_117_587 | 156 |
| 1150 | 3300046557 | Ga0495622_0056063 | Ga0495622_0056063_1310_1780 | 156 |
| 1151 | 3300046559 | Ga0495667_0019223 | Ga0495667_0019223_2412_2882 | 156 |
| 1152 | 3300046559 | Ga0495667_0275771 | Ga0495667_0275771_186_674 | 156 |
| 1153 | 3300046615 | Ga0495656_0032177 | Ga0495656_0032177_1369_1839 | 156 |
| 1154 | 3300046615 | Ga0495656_0129108 | Ga0495656_0129108_467_937 | 156 |
| 1155 | 3300046615 | Ga0495656_0262518 | Ga0495656_0262518_343_813 | 156 |
| 1156 | 3300046642 | Ga0495634_0073151 | Ga0495634_0073151_998_1468 | 156 |
| 1157 | 3300046660 | Ga0495625_0118368 | Ga0495625_0118368_1095_1565 | 156 |
| 1158 | 3300046660 | Ga0495625_0524427 | Ga0495625_0524427_114_584 | 156 |
| 1159 | 3300046663 | Ga0495635_0397037 | Ga0495635_0397037_267_755 | 156 |
| 1160 | 3300046674 | Ga0495588_0169117 | Ga0495588_0169117_238_708 | 156 |
| 1161 | 3300046675 | Ga0495657_0003663 | Ga0495657_0003663_9433_9903 | 156 |
| 1162 | 3300046678 | Ga0495599_0066457 | Ga0495599_0066457_1182_1652 | 156 |
| 1163 | 3300046678 | Ga0495599_0436628 | Ga0495599_0436628_266_736 | 156 |
| 1164 | 3300046679 | Ga0495623_0357100 | Ga0495623_0357100_11_499 | 156 |
| 1165 | 3300046680 | Ga0495646_0300812 | Ga0495646_0300812_337_807 | 156 |
| 1166 | 3300046681 | Ga0495647_0052339 | Ga0495647_0052339_1100_1570 | 156 |
| 1167 | 3300046683 | Ga0495658_0007992 | Ga0495658_0007992_4262_4732 | 156 |
| 1168 | 3300046683 | Ga0495658_0078984 | Ga0495658_0078984_78_548 | 156 |
| 1169 | 3300046683 | Ga0495658_0170796 | Ga0495658_0170796_745_1215 | 156 |
| 1170 | 3300046683 | Ga0495658_0213147 | Ga0495658_0213147_83_553 | 156 |
| 1171 | 3300046689 | Ga0495613_0077777 | Ga0495613_0077777_1792_2262 | 156 |
| 1172 | 3300046689 | Ga0495613_0191613 | Ga0495613_0191613_785_1273 | 156 |
| 1173 | 3300046692 | Ga0495671_0216584 | Ga0495671_0216584_295_765 | 156 |
| 1174 | 3300047317 | Ga0495604_0092906 | Ga0495604_0092906_1550_2038 | 156 |
| 1175 | 3300047318 | Ga0495636_0008939 | Ga0495636_0008939_1722_2192 | 156 |
| 1176 | 3300047318 | Ga0495636_0121635 | Ga0495636_0121635_46_516 | 156 |
| 1177 | 3300047318 | Ga0495636_0142961 | Ga0495636_0142961_376_846 | 156 |
| 1178 | 3300047319 | Ga0495674_0045230 | Ga0495674_0045230_1196_1666 | 156 |
| 1179 | 3300047319 | Ga0495674_1075686 | Ga0495674_1075686_24_494 | 156 |
| 1180 | 3300047319 | Ga0495674_1129582 | Ga0495674_1129582_88_558 | 156 |
| 1181 | 3300047320 | Ga0495672_0048433 | Ga0495672_0048433_1610_2080 | 156 |
| 1182 | 3300047322 | Ga0495680_0485530 | Ga0495680_0485530_57_527 | 156 |
| 1183 | 3300047444 | Ga0495675_0147189 | Ga0495675_0147189_478_966 | 156 |
| 1184 | 3300047447 | Ga0495685_024682 | Ga0495685_024682_1016_1486 | 156 |
| 1185 | 3300047447 | Ga0495685_145644 | Ga0495685_145644_172_642 | 156 |
| 1186 | 3300047471 | Ga0495684_0049455 | Ga0495684_0049455_1189_1659 | 156 |
| 1187 | 3300047471 | Ga0495684_0204759 | Ga0495684_0204759_906_1376 | 156 |
| 1188 | 3300048088 | Ga0495602_0065592 | Ga0495602_0065592_2593_3081 | 156 |
| 1189 | 3300048090 | Ga0495615_0001222 | Ga0495615_0001222_2209_2679 | 156 |
| 1190 | 3300048090 | Ga0495615_0137478 | Ga0495615_0137478_217_687 | 156 |
| 1191 | 3300048903 | Ga0496100_0267809 | Ga0496100_0267809_539_1009 | 156 |
| 1192 | 3300048903 | Ga0496100_0416605 | Ga0496100_0416605_382_852 | 156 |
| 1193 | 3300048904 | Ga0496101_0485761 | Ga0496101_0485761_349_819 | 156 |
| 1194 | 3300048905 | Ga0496102_0026473 | Ga0496102_0026473_2193_2663 | 156 |
| 1195 | 3300048906 | Ga0496103_0070047 | Ga0496103_0070047_899_1369 | 156 |
| 1196 | 3300048907 | Ga0496104_0064959 | Ga0496104_0064959_444_914 | 156 |
| 1197 | 3300048907 | Ga0496104_0449561 | Ga0496104_0449561_716_1186 | 156 |
| 1198 | 3300048907 | Ga0496104_0811981 | Ga0496104_0811981_350_820 | 156 |
| 1199 | 3300048908 | Ga0496105_0915270 | Ga0496105_0915270_176_646 | 156 |
| 1200 | 3300048909 | Ga0496106_0051437 | Ga0496106_0051437_2359_2829 | 156 |
| 1201 | 3300048909 | Ga0496106_0118271 | Ga0496106_0118271_952_1422 | 156 |
| 1202 | 3300048911 | Ga0496108_0047479 | Ga0496108_0047479_754_1224 | 156 |
| 1203 | 3300048911 | Ga0496108_0676423 | Ga0496108_0676423_374_844 | 156 |
| 1204 | 3300048912 | Ga0496109_0048256 | Ga0496109_0048256_2341_2811 | 156 |
| 1205 | 3300048912 | Ga0496109_0570939 | Ga0496109_0570939_478_948 | 156 |
| 1206 | 3300048915 | Ga0496112_0001881 | Ga0496112_0001881_12066_12536 | 156 |
| 1207 | 3300048915 | Ga0496112_0046095 | Ga0496112_0046095_2128_2616 | 156 |
| 1208 | 3300048915 | Ga0496112_0449655 | Ga0496112_0449655_109_579 | 156 |
| 1209 | 3300048915 | Ga0496112_0465343 | Ga0496112_0465343_171_659 | 156 |
| 1210 | 3300048915 | Ga0496112_1500049 | Ga0496112_1500049_91_561 | 156 |
| 1211 | 3300048916 | Ga0496113_0047258 | Ga0496113_0047258_417_887 | 156 |
| 1212 | 3300048917 | Ga0496114_0188257 | Ga0496114_0188257_558_1028 | 156 |
| 1213 | 3300048917 | Ga0496114_0521036 | Ga0496114_0521036_184_654 | 156 |
| 1214 | 3300048918 | Ga0496115_0319671 | Ga0496115_0319671_440_910 | 156 |
| 1215 | 3300048918 | Ga0496115_0526063 | Ga0496115_0526063_287_757 | 156 |
| 1216 | 3300048920 | Ga0496117_0090809 | Ga0496117_0090809_1244_1714 | 156 |
| 1217 | 3300048921 | Ga0496118_0139113 | Ga0496118_0139113_368_838 | 156 |
| 1218 | 3300048924 | Ga0496121_0129576 | Ga0496121_0129576_1385_1855 | 156 |
| 1219 | 3300048927 | Ga0496124_0242913 | Ga0496124_0242913_412_882 | 156 |
| 1220 | 3300048929 | Ga0496126_0304812 | Ga0496126_0304812_164_634 | 156 |
| 1221 | 3300049568 | Ga0501031_0152935 | Ga0501031_0152935_188_658 | 156 |
| 1222 | 3300049568 | Ga0501031_0153796 | Ga0501031_0153796_416_886 | 156 |
| 1223 | 3300049569 | Ga0501032_0274872 | Ga0501032_0274872_109_579 | 156 |
| 1224 | 3300049569 | Ga0501032_0320325 | Ga0501032_0320325_357_827 | 156 |
| 1225 | 3300049569 | Ga0501032_0379967 | Ga0501032_0379967_169_639 | 156 |
| 1226 | 3300049570 | Ga0501033_0016169 | Ga0501033_0016169_575_1045 | 156 |
| 1227 | 3300049571 | Ga0501034_0609764 | Ga0501034_0609764_249_719 | 156 |
| 1228 | 3300049571 | Ga0501034_0734737 | Ga0501034_0734737_183_653 | 156 |
| 1229 | 3300049572 | Ga0501036_0065956 | Ga0501036_0065956_2556_3026 | 156 |
| 1230 | 3300049572 | Ga0501036_1037048 | Ga0501036_1037048_30_500 | 156 |
| 1231 | 3300049573 | Ga0501037_0412319 | Ga0501037_0412319_41_511 | 156 |
| 1232 | 3300049573 | Ga0501037_0459168 | Ga0501037_0459168_151_621 | 156 |
| 1233 | 3300049574 | Ga0501038_0229312 | Ga0501038_0229312_10_480 | 156 |
| 1234 | 3300049574 | Ga0501038_0242797 | Ga0501038_0242797_451_921 | 156 |
| 1235 | 3300049574 | Ga0501038_0644696 | Ga0501038_0644696_99_569 | 156 |
| 1236 | 3300049575 | Ga0501039_0217604 | Ga0501039_0217604_813_1283 | 156 |
| 1237 | 3300049575 | Ga0501039_0243510 | Ga0501039_0243510_930_1400 | 156 |
| 1238 | 3300049575 | Ga0501039_0373946 | Ga0501039_0373946_407_877 | 156 |
| 1239 | 3300049576 | Ga0501040_0137947 | Ga0501040_0137947_520_990 | 156 |
| 1240 | 3300049576 | Ga0501040_0234445 | Ga0501040_0234445_562_1032 | 156 |
| 1241 | 3300049576 | Ga0501040_0501718 | Ga0501040_0501718_302_772 | 156 |
| 1242 | 3300049577 | Ga0501041_0030975 | Ga0501041_0030975_627_1097 | 156 |
| 1243 | 3300049577 | Ga0501041_0614632 | Ga0501041_0614632_206_676 | 156 |
| 1244 | 3300049578 | Ga0501042_0114816 | Ga0501042_0114816_1051_1521 | 156 |
| 1245 | 3300049578 | Ga0501042_0487907 | Ga0501042_0487907_307_777 | 156 |
| 1246 | 3300049579 | Ga0501043_0223695 | Ga0501043_0223695_479_949 | 156 |
| 1247 | 3300049579 | Ga0501043_0715987 | Ga0501043_0715987_91_561 | 156 |
| 1248 | 3300049579 | Ga0501043_0757533 | Ga0501043_0757533_192_662 | 156 |
| 1249 | 3300049580 | Ga0501046_0050901 | Ga0501046_0050901_301_771 | 156 |
| 1250 | 3300049580 | Ga0501046_0806479 | Ga0501046_0806479_101_571 | 156 |
| 1251 | 3300049581 | Ga0501047_0003663 | Ga0501047_0003663_2243_2713 | 156 |
| 1252 | 3300049581 | Ga0501047_0083044 | Ga0501047_0083044_61_531 | 156 |
| 1253 | 3300049581 | Ga0501047_0110366 | Ga0501047_0110366_2150_2620 | 156 |
| 1254 | 3300049581 | Ga0501047_0220847 | Ga0501047_0220847_208_678 | 156 |
| 1255 | 3300049581 | Ga0501047_0727284 | Ga0501047_0727284_167_637 | 156 |
| 1256 | 3300049582 | Ga0501048_0029347 | Ga0501048_0029347_643_1113 | 156 |
| 1257 | 3300049582 | Ga0501048_0278568 | Ga0501048_0278568_161_631 | 156 |
| 1258 | 3300049583 | Ga0501067_0142140 | Ga0501067_0142140_209_679 | 156 |
| 1259 | 3300049585 | Ga0501069_0770629 | Ga0501069_0770629_35_505 | 156 |
| 1260 | 3300049587 | Ga0501071_0216397 | Ga0501071_0216397_479_949 | 156 |
| 1261 | 3300049587 | Ga0501071_0271111 | Ga0501071_0271111_113_583 | 156 |
| 1262 | 3300049587 | Ga0501071_0473090 | Ga0501071_0473090_233_703 | 156 |
| 1263 | 3300049588 | Ga0501072_0072540 | Ga0501072_0072540_491_961 | 156 |
| 1264 | 3300049588 | Ga0501072_0170249 | Ga0501072_0170249_1099_1569 | 156 |
| 1265 | 3300049589 | Ga0501073_0339821 | Ga0501073_0339821_510_980 | 156 |
| 1266 | 3300049589 | Ga0501073_0483357 | Ga0501073_0483357_198_668 | 156 |
| 1267 | 3300049589 | Ga0501073_0564823 | Ga0501073_0564823_156_626 | 156 |
| 1268 | 3300049589 | Ga0501073_0783609 | Ga0501073_0783609_64_534 | 156 |
| 1269 | 3300049590 | Ga0501074_0165656 | Ga0501074_0165656_1054_1524 | 156 |
| 1270 | 3300049590 | Ga0501074_0299453 | Ga0501074_0299453_79_549 | 156 |
| 1271 | 3300049590 | Ga0501074_0494273 | Ga0501074_0494273_134_604 | 156 |
| 1272 | 3300049590 | Ga0501074_0918862 | Ga0501074_0918862_133_603 | 156 |
| 1273 | 3300049591 | Ga0501075_0019376 | Ga0501075_0019376_3260_3730 | 156 |
| 1274 | 3300049591 | Ga0501075_0807827 | Ga0501075_0807827_233_703 | 156 |
| 1275 | 3300049592 | Ga0501076_0034438 | Ga0501076_0034438_1062_1532 | 156 |
| 1276 | 3300049593 | Ga0501077_0165530 | Ga0501077_0165530_221_691 | 156 |
| 1277 | 3300049593 | Ga0501077_0289589 | Ga0501077_0289589_538_1008 | 156 |
| 1278 | 3300049593 | Ga0501077_0403661 | Ga0501077_0403661_228_698 | 156 |
| 1279 | 3300049593 | Ga0501077_0442928 | Ga0501077_0442928_224_694 | 156 |
| 1280 | 3300049593 | Ga0501077_0552859 | Ga0501077_0552859_152_622 | 156 |
| 1281 | 3300049671 | Ga0501238_006454 | Ga0501238_006454_435_905 | 156 |
| 1282 | 3300049741 | Ga0501079_0206220 | Ga0501079_0206220_876_1346 | 156 |
| 1283 | 3300049741 | Ga0501079_0373683 | Ga0501079_0373683_232_702 | 156 |
| 1284 | 3300049742 | Ga0501080_0002922 | Ga0501080_0002922_5373_5843 | 156 |
| 1285 | 3300049742 | Ga0501080_0005645 | Ga0501080_0005645_469_939 | 156 |
| 1286 | 3300049742 | Ga0501080_0079724 | Ga0501080_0079724_2205_2675 | 156 |
| 1287 | 3300049742 | Ga0501080_0243872 | Ga0501080_0243872_290_760 | 156 |
| 1288 | 3300049742 | Ga0501080_0821172 | Ga0501080_0821172_176_646 | 156 |
| 1289 | 3300049743 | Ga0501081_0188157 | Ga0501081_0188157_371_841 | 156 |
| 1290 | 3300049743 | Ga0501081_0328053 | Ga0501081_0328053_47_517 | 156 |
| 1291 | 3300049743 | Ga0501081_0369036 | Ga0501081_0369036_199_669 | 156 |
| 1292 | 3300049743 | Ga0501081_0733143 | Ga0501081_0733143_156_626 | 156 |
| 1293 | 3300049743 | Ga0501081_0817036 | Ga0501081_0817036_188_658 | 156 |
| 1294 | 3300049744 | Ga0501083_0004955 | Ga0501083_0004955_4443_4913 | 156 |
| 1295 | 3300049744 | Ga0501083_0555067 | Ga0501083_0555067_180_650 | 156 |
| 1296 | 3300049744 | Ga0501083_0599928 | Ga0501083_0599928_117_587 | 156 |
| 1297 | 3300049758 | Ga0501241_047777 | Ga0501241_047777_269_739 | 156 |
| 1298 | 3300049766 | Ga0501269_013888 | Ga0501269_013888_111_581 | 156 |
| 1299 | 3300049822 | Ga0501035_0000846 | Ga0501035_0000846_2460_2930 | 156 |
| 1300 | 3300049822 | Ga0501035_0005931 | Ga0501035_0005931_8696_9166 | 156 |
| 1301 | 3300049822 | Ga0501035_0339713 | Ga0501035_0339713_256_726 | 156 |
| 1302 | 3300049822 | Ga0501035_1044297 | Ga0501035_1044297_81_551 | 156 |
| 1303 | 3300049823 | Ga0501044_0083371 | Ga0501044_0083371_1434_1904 | 156 |
| 1304 | 3300049824 | Ga0501045_0064750 | Ga0501045_0064750_654_1124 | 156 |
| 1305 | 3300049824 | Ga0501045_0415852 | Ga0501045_0415852_218_688 | 156 |
| 1306 | 3300049824 | Ga0501045_0823222 | Ga0501045_0823222_159_629 | 156 |
| 1307 | 3300050489 | nmdc:mga03683_3558_c1 | nmdc:mga03683_3558_c1_3081_3551 | 156 |
| 1308 | 3300050490 | nmdc:mga03n38_220507_c1 | nmdc:mga03n38_220507_c1_359_829 | 156 |
| 1309 | 3300050490 | nmdc:mga03n38_265177_c1 | nmdc:mga03n38_265177_c1_156_626 | 156 |
| 1310 | 3300050491 | nmdc:mga00v17_15446_c1 | nmdc:mga00v17_15446_c1_140_610 | 156 |
| 1311 | 3300050491 | nmdc:mga00v17_75294_c1 | nmdc:mga00v17_75294_c1_1483_1953 | 156 |
| 1312 | 3300050492 | nmdc:mga0yw44_539059_c1 | nmdc:mga0yw44_539059_c1_257_727 | 156 |
| 1313 | 3300050493 | nmdc:mga0k408_8408_c1 | nmdc:mga0k408_8408_c1_2224_2694 | 156 |
| 1314 | 3300050494 | nmdc:mga06z11_336225_c1 | nmdc:mga06z11_336225_c1_153_623 | 156 |
| 1315 | 3300050494 | nmdc:mga06z11_42917_c1 | nmdc:mga06z11_42917_c1_1529_1999 | 156 |
| 1316 | 3300050494 | nmdc:mga06z11_610871_c1 | nmdc:mga06z11_610871_c1_150_620 | 156 |
| 1317 | 3300050495 | nmdc:mga04h51_12737_c1 | nmdc:mga04h51_12737_c1_412_882 | 156 |
| 1318 | 3300050496 | nmdc:mga07m45_208382_c1 | nmdc:mga07m45_208382_c1_301_771 | 156 |
| 1319 | 3300050496 | nmdc:mga07m45_412390_c1 | nmdc:mga07m45_412390_c1_230_700 | 156 |
| 1320 | 3300050507 | nmdc:mga05p37_1025701_c1 | nmdc:mga05p37_1025701_c1_135_605 | 156 |
| 1321 | 3300050507 | nmdc:mga05p37_1166400_c1 | nmdc:mga05p37_1166400_c1_300_770 | 156 |
| 1322 | 3300050507 | nmdc:mga05p37_1310291_c1 | nmdc:mga05p37_1310291_c1_79_549 | 156 |
| 1323 | 3300050507 | nmdc:mga05p37_133260_c1 | nmdc:mga05p37_133260_c1_2319_2789 | 156 |
| 1324 | 3300050507 | nmdc:mga05p37_1690684_c1 | nmdc:mga05p37_1690684_c1_87_557 | 156 |
| 1325 | 3300050507 | nmdc:mga05p37_449385_c1 | nmdc:mga05p37_449385_c1_486_956 | 156 |
| 1326 | 3300050507 | nmdc:mga05p37_672497_c1 | nmdc:mga05p37_672497_c1_472_942 | 156 |
| 1327 | 3300050507 | nmdc:mga05p37_75430_c1 | nmdc:mga05p37_75430_c1_1455_1925 | 156 |
| 1328 | 3300050507 | nmdc:mga05p37_829381_c1 | nmdc:mga05p37_829381_c1_27_497 | 156 |
| 1329 | 3300050508 | nmdc:mga09592_458426_c1 | nmdc:mga09592_458426_c1_175_645 | 156 |
| 1330 | 3300050508 | nmdc:mga09592_494399_c1 | nmdc:mga09592_494399_c1_377_847 | 156 |
| 1331 | 3300050508 | nmdc:mga09592_602893_c1 | nmdc:mga09592_602893_c1_98_568 | 156 |
| 1332 | 3300050508 | nmdc:mga09592_906705_c1 | nmdc:mga09592_906705_c1_217_687 | 156 |
| 1333 | 3300050509 | nmdc:mga0qj67_133188_c1 | nmdc:mga0qj67_133188_c1_609_1079 | 156 |
| 1334 | 3300050510 | nmdc:mga06r32_183757_c1 | nmdc:mga06r32_183757_c1_324_794 | 156 |
| 1335 | 3300050510 | nmdc:mga06r32_263611_c1 | nmdc:mga06r32_263611_c1_302_772 | 156 |
| 1336 | 3300050510 | nmdc:mga06r32_36731_c1 | nmdc:mga06r32_36731_c1_102_572 | 156 |
| 1337 | 3300050510 | nmdc:mga06r32_631650_c1 | nmdc:mga06r32_631650_c1_329_799 | 156 |
| 1338 | 3300050511 | nmdc:mga08y16_170026_c1 | nmdc:mga08y16_170026_c1_307_777 | 156 |
| 1339 | 3300050511 | nmdc:mga08y16_220465_c1 | nmdc:mga08y16_220465_c1_868_1338 | 156 |
| 1340 | 3300050511 | nmdc:mga08y16_245224_c1 | nmdc:mga08y16_245224_c1_1065_1535 | 156 |
| 1341 | 3300050511 | nmdc:mga08y16_24_c1 | nmdc:mga08y16_24_c1_50373_50843 | 156 |
| 1342 | 3300050511 | nmdc:mga08y16_253285_c1 | nmdc:mga08y16_253285_c1_269_739 | 156 |
| 1343 | 3300050511 | nmdc:mga08y16_51099_c1 | nmdc:mga08y16_51099_c1_1602_2072 | 156 |
| 1344 | 3300050511 | nmdc:mga08y16_687632_c1 | nmdc:mga08y16_687632_c1_209_781 | 156 |
| 1345 | 3300050511 | nmdc:mga08y16_794313_c1 | nmdc:mga08y16_794313_c1_443_913 | 156 |
| 1346 | 3300050512 | nmdc:mga0n895_1195010_c1 | nmdc:mga0n895_1195010_c1_150_620 | 156 |
| 1347 | 3300050512 | nmdc:mga0n895_187311_c1 | nmdc:mga0n895_187311_c1_1212_1682 | 156 |
| 1348 | 3300050512 | nmdc:mga0n895_212802_c1 | nmdc:mga0n895_212802_c1_488_958 | 156 |
| 1349 | 3300050512 | nmdc:mga0n895_36271_c1 | nmdc:mga0n895_36271_c1_2233_2703 | 156 |
| 1350 | 3300050512 | nmdc:mga0n895_4474_c1 | nmdc:mga0n895_4474_c1_3592_4062 | 156 |
| 1351 | 3300050512 | nmdc:mga0n895_47539_c1 | nmdc:mga0n895_47539_c1_744_1214 | 156 |
| 1352 | 3300050512 | nmdc:mga0n895_612349_c1 | nmdc:mga0n895_612349_c1_113_583 | 156 |
| 1353 | 3300050512 | nmdc:mga0n895_76676_c1 | nmdc:mga0n895_76676_c1_1029_1499 | 156 |
| 1354 | 3300050513 | nmdc:mga0rr50_273683_c1 | nmdc:mga0rr50_273683_c1_541_1011 | 156 |
| 1355 | 3300050513 | nmdc:mga0rr50_366010_c1 | nmdc:mga0rr50_366010_c1_226_696 | 156 |
| 1356 | 3300050513 | nmdc:mga0rr50_48478_c1 | nmdc:mga0rr50_48478_c1_588_1058 | 156 |
| 1357 | 3300050513 | nmdc:mga0rr50_61265_c1 | nmdc:mga0rr50_61265_c1_1422_1892 | 156 |
| 1358 | 3300050513 | nmdc:mga0rr50_619836_c1 | nmdc:mga0rr50_619836_c1_242_712 | 156 |
| 1359 | 3300050514 | nmdc:mga08x19_175948_c1 | nmdc:mga08x19_175948_c1_696_1166 | 156 |
| 1360 | 3300050514 | nmdc:mga08x19_72375_c1 | nmdc:mga08x19_72375_c1_1700_2170 | 156 |
| 1361 | 3300050514 | nmdc:mga08x19_76140_c1 | nmdc:mga08x19_76140_c1_47_517 | 156 |
| 1362 | 3300050515 | nmdc:mga0a205_101698_c1 | nmdc:mga0a205_101698_c1_1669_2139 | 156 |
| 1363 | 3300050515 | nmdc:mga0a205_17718_c1 | nmdc:mga0a205_17718_c1_3063_3533 | 156 |
| 1364 | 3300050515 | nmdc:mga0a205_711411_c1 | nmdc:mga0a205_711411_c1_209_679 | 156 |
| 1365 | 3300050515 | nmdc:mga0a205_953948_c1 | nmdc:mga0a205_953948_c1_48_518 | 156 |
| 1366 | 3300050516 | nmdc:mga0sz30_5881_c1 | nmdc:mga0sz30_5881_c1_500_970 | 156 |
| 1367 | 3300053077 | Ga0495601_0314594 | Ga0495601_0314594_445_915 | 156 |
| 1368 | 3300053084 | Ga0495595_0251079 | Ga0495595_0251079_347_835 | 156 |
| 1369 | 3300053084 | Ga0495595_0365379 | Ga0495595_0365379_45_515 | 156 |
| 1370 | 3300053084 | Ga0495595_0488473 | Ga0495595_0488473_117_587 | 156 |
| 1371 | 3300053085 | Ga0495619_0162694 | Ga0495619_0162694_818_1306 | 156 |
| 1372 | 3300053087 | Ga0500643_009467 | Ga0500643_009467_1892_2362 | 156 |
| 1373 | 3300053118 | Ga0500594_0020014 | Ga0500594_0020014_978_1448 | 156 |
| 1374 | 3300053122 | Ga0500608_265300 | Ga0500608_265300_25_495 | 156 |
| 1375 | 3300053153 | Ga0500616_0039467 | Ga0500616_0039467_1411_1881 | 156 |
| 1376 | 3300053730 | Ga0500645_019607 | Ga0500645_019607_1297_1767 | 156 |
| 1377 | 3300053730 | Ga0500645_104850 | Ga0500645_104850_113_661 | 156 |
| 1378 | 3300054114 | Ga0501084_0041457 | Ga0501084_0041457_2246_2716 | 156 |
| 1379 | 3300054114 | Ga0501084_0647331 | Ga0501084_0647331_64_534 | 156 |
| 1380 | 3300059503 | Ga0587080_162691 | Ga0587080_162691_17_487 | 156 |
| 1381 | 3300059505 | Ga0587083_0090773 | Ga0587083_0090773_79_549 | 156 |
| 1382 | 3300059626 | Ga0587115_008996 | Ga0587115_008996_119_589 | 156 |
| 1383 | 3300059652 | Ga0587107_013294 | Ga0587107_013294_537_1007 | 156 |
| 1384 | 3300060353 | Ga0501082_0187061 | Ga0501082_0187061_199_669 | 156 |
| 1385 | 3300060353 | Ga0501082_0258583 | Ga0501082_0258583_380_850 | 156 |
| 1386 | 3300060353 | Ga0501082_0716355 | Ga0501082_0716355_39_509 | 156 |
| 1387 | 3300060353 | Ga0501082_0723849 | Ga0501082_0723849_31_501 | 156 |
| 1388 | 3300061719 | Ga0466962_0279927 | Ga0466962_0279927_161_631 | 156 |
| 1389 | 3300061734 | Ga0530510_0071728 | Ga0530510_0071728_365_835 | 156 |
| 1390 | 3300061734 | Ga0530510_0108992 | Ga0530510_0108992_1292_1762 | 156 |
| 1391 | 3300061734 | Ga0530510_0591101 | Ga0530510_0591101_295_765 | 156 |
| 1392 | 3300061734 | Ga0530510_1263601 | Ga0530510_1263601_44_514 | 156 |
| 1393 | iso_pu_bacteria | 2508501128 | 2509149638 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cdv-assembly1.cif.gz_H | rnase r bound to a 30s degradation intermediate (state ii) | 0.9827 | 18 | 127 |
| 7p7u-assembly1.cif.gz_h | e. faecalis 70s ribosome with p-trna, state iv | 0.9792 | 8 | 154 |
| 7nhn-assembly1.cif.gz_h | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.977 | 12 | 151 |
| 7nhl-assembly1.cif.gz_h | vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus | 0.9764 | 12 | 151 |
| 7nhm-assembly1.cif.gz_h | 70s ribosome from staphylococcus aureus | 0.9724 | 8 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P48940_2_156_1.10.455.10 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9697 | 3 | 156 | 1.10.455.10 |
| 5x8rg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9673 | 8 | 151 | 1.10.455.10 |
| 1husA00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9662 | 10 | 148 | 1.10.455.10 |
| 1husA00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9592 | 10 | 148 | 1.10.455.10 |
| 5mmjg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.958 | 2 | 155 | 1.10.455.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1UAE0-F1-model_v4 | 30S ribosomal protein S7 | 0.9975 | 34 | 156 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A7Y2PLF6-F1-model_v4 | Ribosomal protein S7 | 0.993 | 12 | 149 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A838VDW6-F1-model_v4 | 30S ribosomal protein S7 | 0.99 | 51 | 156 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A3S1UAE0-F1-model_v4 | 30S ribosomal protein S7 | 0.9895 | 34 | 156 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A2V2RP19-F1-model_v4 | 30S ribosomal protein S7 | 0.9869 | 53 | 156 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar