F493595

General Info

Members Datasets Scaffolds Average Seq Length
1391 825 1029 443

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0017887|Ga0495625_0017887_1654_3144
Length 496
Sequence MKTGAAKVSLPRSVGRLAIADPRCQKPPVIFSTSPSLADSGAASNRTNFDMAHDAQKMVFEPGGPLRGTVTVPGDKSISHRSLMLSALAVGESHVSGLLEGEDVLATAAAMRALGAQIERDADGTWRIYGVGVGSLVQPTTALDMGNSGTSTRLLMGLLASHALTATFVGDASLSKRPMGRVTDPLGLMGATFTASPGGRLPLTMRGIVPAVPIEYRLPVASAQVKSAVLLAGLNTPGITRIIEPVPTRDHSERMLRGFGADLTVEVDDDGTRHIAIRGEAELKPQTLVVPGDPSSAAFPVVAALITPGSEVRVNNVGMNPTRTGVFKMLQAMGADLTFTNERDVGGEPVADLVARYSRLTGIDVPSDIAPSMIDEFPIFFVAASFAKGRTTTSGLDELRVKESDRLALMAKNLARIGARVEEQDDGLLIDGTDGEPLDGGNKAPTIGAELDHRIAMSFAVAGQATKGGLAIDDMSPVATSFPGFVGLLRTLKGEA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
8 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
9 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
10 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
11 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
12 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
13 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
14 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
17 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
18 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
19 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
20 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
21 2516143018 Ensifer sp. BR816 Isolate Nodule
22 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
23 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
24 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
25 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
26 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
27 2534681786 Brucella suis 92/29 Isolate Unclassified
28 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
29 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
30 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
31 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
32 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
33 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
34 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
35 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
36 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
37 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
38 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
39 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
40 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
41 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
42 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
43 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
44 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
45 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
46 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
47 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
48 2643221557 Ensifer sp. Root558 Isolate Unclassified
49 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
50 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
51 2643221610 Ensifer sp. Root74 Isolate Unclassified
52 2643221618 Ensifer sp. Root231 Isolate Unclassified
53 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
54 2643221626 Ensifer sp. Root31 Isolate Unclassified
55 2643221655 Ensifer sp. Root1252 Isolate Unclassified
56 2643221659 Ensifer sp. Root127 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
59 2643221675 Ensifer sp. Root1298 Isolate Unclassified
60 2643221680 Ensifer sp. Root1312 Isolate Unclassified
61 2643221698 Ensifer sp. Root142 Isolate Unclassified
62 2643221712 Ensifer sp. Root258 Isolate Unclassified
63 2643221723 Ensifer sp. Root278 Isolate Unclassified
64 2643221726 Ensifer sp. Root954 Isolate Unclassified
65 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
66 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
67 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
68 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
69 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
70 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
71 2751185800 Brucella pituitosa AA2 Isolate Unclassified
72 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
73 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
74 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
75 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
76 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
77 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
78 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
79 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
80 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
81 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
82 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
83 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
84 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
85 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
86 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
87 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
88 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
89 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
90 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
91 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
92 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
93 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
94 2802429633 Rhizobium anhuiense J3 Isolate Nodule
95 2802429634 Rhizobium anhuiense S10 Isolate Nodule
96 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
97 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
98 2802429637 Rhizobium anhuiense C15 Isolate Nodule
99 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
100 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
101 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
102 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
103 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
104 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
105 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
106 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
107 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
108 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
109 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
110 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
111 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
112 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
113 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
114 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
115 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
116 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
117 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
118 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
119 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
120 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
121 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
122 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
123 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
124 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
125 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
126 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
127 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
128 2844163670 Ensifer sp. 1H6 Isolate Unclassified
129 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
130 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
131 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
132 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
133 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
134 2854911287 Brucella lupini LUP21 Isolate Unclassified
135 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
136 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
137 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
138 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
139 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
140 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
141 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
142 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
143 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
144 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
145 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
146 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
147 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
148 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
149 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
150 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
151 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
152 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
153 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
154 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
155 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
156 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
157 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
158 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
159 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
160 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
161 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
162 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
163 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
164 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
165 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
166 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
167 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
168 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
169 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
170 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
171 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
172 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
173 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
174 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
175 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
176 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
177 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
178 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
179 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
180 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
181 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
182 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
183 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
184 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
185 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
186 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
187 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
188 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
189 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
190 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
191 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
192 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
193 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
194 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
195 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
196 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
197 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
198 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
199 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
200 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
201 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
202 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
203 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
204 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
205 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
206 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
207 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
208 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
209 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
210 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
211 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
212 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
213 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
214 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
215 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
216 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
217 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
218 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
219 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
220 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
221 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
222 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
223 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
224 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
225 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
226 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
227 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
228 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
229 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
230 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
231 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
232 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
233 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
234 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
235 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
236 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
237 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
238 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
239 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
240 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
241 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
242 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
243 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
244 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
245 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
246 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
247 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
248 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
249 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
250 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
251 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
252 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
253 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
254 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
255 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
256 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
257 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
258 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
259 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
260 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
261 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
262 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
263 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
264 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
265 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
266 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
267 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
268 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
269 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
270 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
271 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
272 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
273 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
274 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
275 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
276 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
277 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
278 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
279 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
280 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
281 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
282 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
283 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
284 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
285 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
286 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
287 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
288 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
289 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
290 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
291 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
292 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
293 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
294 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
295 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
296 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
297 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
298 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
299 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
300 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
301 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
302 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
303 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
304 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
305 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
306 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
307 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
308 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
309 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
310 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
311 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
312 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
313 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
314 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
315 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
316 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
317 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
318 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
319 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
320 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
321 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
322 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
323 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
324 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
325 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
326 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
327 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
328 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
329 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
330 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
331 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
332 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
333 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
334 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
335 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
336 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
337 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
338 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
339 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
340 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
341 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
342 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
343 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
344 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
345 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
346 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
347 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
348 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
349 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
350 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
351 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
352 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
353 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
354 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
355 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
356 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
357 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
358 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
359 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
360 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
361 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
362 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
363 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
364 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
365 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
366 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
367 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
368 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
369 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
370 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
371 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
372 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
373 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
374 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
375 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
379 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
380 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
381 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
382 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
383 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
384 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
385 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
386 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
387 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
388 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
389 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
390 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
391 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
392 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
393 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
394 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
395 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
396 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
397 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
398 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
399 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
400 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
401 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
402 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
403 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
404 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
405 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
406 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
407 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
408 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
409 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
410 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
411 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
412 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
413 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
414 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
415 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
416 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
417 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
418 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
419 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
420 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
421 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
422 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
423 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
424 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
425 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
426 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
427 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
428 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
429 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
430 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
431 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
432 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
433 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
434 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
435 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
436 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
437 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
438 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
439 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
440 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
441 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
442 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
443 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
444 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
445 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
446 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
447 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
448 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
449 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
450 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
451 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
452 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
453 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
454 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
455 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
456 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
457 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
458 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
459 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
460 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
461 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
462 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
463 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
464 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
465 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
466 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
467 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
468 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
469 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
470 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
471 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
472 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
473 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
474 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
475 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
476 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
477 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
478 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
479 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
480 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
481 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
482 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
483 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
484 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
486 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
487 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
488 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
489 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
490 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
491 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
492 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
493 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
494 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
495 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
496 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
497 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
498 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
499 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
500 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
501 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
502 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
503 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
504 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
505 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
506 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
507 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
527 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
528 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
530 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
531 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
532 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
533 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
534 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
542 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
543 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
545 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
546 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
547 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
548 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
549 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
550 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
551 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
552 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
553 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
554 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
556 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
557 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
558 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
559 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
560 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
561 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
563 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
564 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
565 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
566 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
567 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
568 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
569 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
570 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
571 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
572 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
573 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
574 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
575 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
576 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
577 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
578 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
579 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
580 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
581 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
582 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
583 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
584 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
585 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
586 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
587 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
588 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
589 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
590 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
591 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
592 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
593 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
594 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
595 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
596 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
597 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
598 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
599 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
600 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
601 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
602 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
603 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
604 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
605 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
606 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
607 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
608 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
609 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
610 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
611 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
612 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
613 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
614 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
615 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
616 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
617 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
618 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
619 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
620 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
621 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
622 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
623 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
624 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
625 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
626 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
627 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
628 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
629 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
630 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
631 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
632 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
633 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
634 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
635 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
636 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
637 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
638 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
639 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
640 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
641 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
642 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
643 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
644 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
645 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
646 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
647 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
648 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
649 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
650 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
651 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
652 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
653 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
654 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
655 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
656 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
657 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
658 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
659 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
660 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
661 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
662 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
663 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
664 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
665 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
666 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
667 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
668 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
669 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
670 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
671 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
672 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
673 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
674 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
675 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
676 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
677 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
678 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
679 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
680 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
681 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
682 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
683 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
684 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
685 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
686 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
687 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
688 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
689 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
690 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
691 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
692 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
693 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
694 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
695 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
696 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
697 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
698 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
699 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
700 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
701 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
702 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
703 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
704 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
705 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
706 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
707 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
708 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
709 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
710 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
711 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
712 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
713 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
714 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
715 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
716 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
717 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
718 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
719 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
720 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
721 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
722 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
723 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
724 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
725 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
726 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
727 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
728 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
729 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
730 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
731 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
732 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
733 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
734 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
735 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
736 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
737 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
738 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
739 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
740 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
741 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
742 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
743 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
744 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
745 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
746 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
747 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
748 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
749 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
750 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
751 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
752 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
753 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
754 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
755 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
756 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
757 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
758 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
759 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
760 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
761 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
762 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
763 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
764 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
765 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
766 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
767 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
768 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
769 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
770 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
771 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
772 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
773 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
774 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
775 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
776 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
777 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
778 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
779 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
780 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
781 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
782 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
783 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
784 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
785 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
786 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
787 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
788 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
789 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
790 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
791 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
792 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
793 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
794 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
795 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
796 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
797 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
798 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
799 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
800 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
801 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
802 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
803 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
804 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
805 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
806 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
807 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
808 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
809 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
810 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
811 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
812 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
813 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
814 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
815 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
816 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
817 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
818 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
819 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
820 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
821 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
822 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
823 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
824 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
825 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.47
Metatranscriptomes 0.5
Isolates 26.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 11.79
Nodule 19.48
Rhizoplane 2.95
Rhizosphere 54.35
Stem 0
Stem Tuber 0
Unclassified 11.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000185 3300001904 Bacteria 11068
2 JGI24736J21556_1001548 3300001904 Bacteria 4184
3 JGI24741J21665_1000045 3300001915 Bacteria 30044
4 JGI24739J22299_10000095 3300001989 Bacteria 25993
5 JGI24739J22299_10003612 3300001989 Bacteria 5909
6 JGI24739J22299_10011937 3300001989 Bacteria 3195
7 JGI24737J22298_10014256 3300001990 Bacteria 2582
8 JGI24735J21928_10004127 3300002067 Bacteria 4906
9 JGI24735J21928_10008073 3300002067 Bacteria 3416
10 JGI24735J21928_10014478 3300002067 Bacteria 2469
11 JGI24735J21928_10023493 3300002067 Bacteria 1869
12 JGI24750J21931_1000436 3300002070 Bacteria 6775
13 JGI24748J21848_1000063 3300002074 Bacteria 40664
14 JGI24738J21930_10000967 3300002075 Bacteria 8242
15 JGI24749J21850_1000018 3300002076 Bacteria 32428
16 JGI24034J26672_10000007 3300002239 Bacteria 224370
17 JGI24751J29686_10000115 3300002459 Bacteria 42174
18 JGI24751J29686_10000235 3300002459 Bacteria 22528
19 JGI24751J29686_10004035 3300002459 Bacteria 2970
20 JGI25155J39150_1000069 3300002704 Bacteria 64645
21 JGI25156J39149_1000095 3300002705 Bacteria 64645
22 JGI25154J39366_1000866 3300002738 Bacteria 13083
23 JGI25157J39369_1000732 3300002741 Bacteria 17479
24 JGI25150J39212_1000126 3300002774 Bacteria 42982
25 JGI25159J45721_1003717 3300002987 Bacteria 5291
26 JGI25159J45721_1006593 3300002987 Bacteria 3456
27 JGI25151J46595_10003658 3300003187 Bacteria 8381
28 JGI25151J46595_10007368 3300003187 Bacteria 5402
29 JGI25165J46597_1000041 3300003214 Bacteria 272566
30 JGI25165J46597_1000043 3300003214 Bacteria 264515
31 JGI25153J46596_10000115 3300003215 Bacteria 91366
32 JGI25153J46596_10000305 3300003215 Bacteria 36679
33 JGI25153J46596_10009756 3300003215 Bacteria 4416
34 JGI25153J46596_10019462 3300003215 Bacteria 2600
35 JGI25153J46596_10021828 3300003215 Bacteria 2378
36 rootL2_10134394 3300003322 Bacteria 7000
37 JGI25160J50197_1000003 3300003354 Bacteria 482719
38 JGI25160J50197_1000287 3300003354 Bacteria 36528
39 JGI25160J50197_1005283 3300003354 Bacteria 5402
40 JGI25161J50226_1000176 3300003374 Bacteria 42677
41 JGI25161J50226_1000299 3300003374 Bacteria 27879
42 JGI25161J50226_1003479 3300003374 Bacteria 3584
43 Ga0055525_1000104 3300003759 Bacteria 134560
44 Ga0055542_1000025 3300003762 Bacteria 263538
45 Ga0055529_1000014 3300003763 Bacteria 367283
46 Ga0055526_1004618 3300003771 Bacteria 8205
47 Ga0055526_1007718 3300003771 Bacteria 5523
48 Ga0055526_1007837 3300003771 Bacteria 5462
49 Ga0055524_1000056 3300003775 Bacteria 141764
50 Ga0055524_1006032 3300003775 Bacteria 5317
51 Ga0055524_1006689 3300003775 Bacteria 4979
52 Ga0055536_1001996 3300003781 Bacteria 11706
53 Ga0055528_1018190 3300003790 Bacteria 2393
54 Ga0055530_10000027 3300003791 Bacteria 129838
55 Ga0055530_10000931 3300003791 Bacteria 23980
56 Ga0055530_10011442 3300003791 Bacteria 3186
57 Ga0055530_10013499 3300003791 Bacteria 2785
58 Ga0055540_1001336 3300003792 Bacteria 14852
59 Ga0055531_10000013 3300003794 Bacteria 187583
60 Ga0055531_10014149 3300003794 Bacteria 3616
61 Ga0055531_10027395 3300003794 Bacteria 2001
62 Ga0055543_1000034 3300004625 Bacteria 128668
63 Ga0055543_1000114 3300004625 Bacteria 69144
64 Ga0055543_1001135 3300004625 Bacteria 11409
65 Ga0058863_11910898 3300004799 Bacteria 1853
66 Ga0058861_12061624 3300004800 Bacteria 1765
67 Ga0058862_12737959 3300004803 Bacteria 1855
68 Ga0065165_1000047 3300005262 Bacteria 197811
69 Ga0065165_1003833 3300005262 Bacteria 10014
70 Ga0065165_1004051 3300005262 Bacteria 9518
71 Ga0065165_1012721 3300005262 Bacteria 3403
72 Ga0065165_1013057 3300005262 Bacteria 3328
73 Ga0065704_10002519 3300005289 Bacteria 5081
74 Ga0065704_10070744 3300005289 Bacteria 16791
75 Ga0065707_10084641 3300005295 Bacteria 6937
76 Ga0065707_10149171 3300005295 Bacteria 1677
77 Ga0070658_10000033 3300005327 Bacteria 147380
78 Ga0070658_10014420 3300005327 Bacteria 6342
79 Ga0070658_10107179 3300005327 Bacteria 2312
80 Ga0070676_10003672 3300005328 Bacteria 8035
81 Ga0070690_100000024 3300005330 Bacteria 69563
82 Ga0070690_100000483 3300005330 Bacteria 20028
83 Ga0070690_100014932 3300005330 Bacteria 4620
84 Ga0070690_100043813 3300005330 Bacteria 2839
85 Ga0070670_100000074 3300005331 Bacteria 97530
86 Ga0070670_100000409 3300005331 Bacteria 35372
87 Ga0070670_100004278 3300005331 Bacteria 11948
88 Ga0070670_100044213 3300005331 Bacteria 3830
89 Ga0070670_100221670 3300005331 Bacteria 1645
90 Ga0070666_10000017 3300005335 Bacteria 190526
91 Ga0070666_10000160 3300005335 Bacteria 46166
92 Ga0070666_10001625 3300005335 Bacteria 13672
93 Ga0070666_10026239 3300005335 Bacteria 3804
94 Ga0070666_10026566 3300005335 Bacteria 3784
95 Ga0070680_100169761 3300005336 Bacteria 1835
96 Ga0068868_100002423 3300005338 Bacteria 12922
97 Ga0070660_100000225 3300005339 Bacteria 37405
98 Ga0070660_100006402 3300005339 Bacteria 8160
99 Ga0070660_100022696 3300005339 Bacteria 4645
100 Ga0070660_100043168 3300005339 Bacteria 3444
101 Ga0070660_100108019 3300005339 Bacteria 2211
102 Ga0070689_100043036 3300005340 Bacteria 3469
103 Ga0070689_100095475 3300005340 Bacteria 2348
104 Ga0070661_100224086 3300005344 Bacteria 1443
105 Ga0070692_10005729 3300005345 Bacteria 5334
106 Ga0070668_100000197 3300005347 Bacteria 39485
107 Ga0070668_100031066 3300005347 Bacteria 4063
108 Ga0070668_100080044 3300005347 Bacteria 2559
109 Ga0070668_100103426 3300005347 Bacteria 2259
110 Ga0070668_100174904 3300005347 Bacteria 1750
111 Ga0070668_100197028 3300005347 Bacteria 1652
112 Ga0070669_100000013 3300005353 Bacteria 210577
113 Ga0070669_100000058 3300005353 Bacteria 110162
114 Ga0070669_100003312 3300005353 Bacteria 11582
115 Ga0070669_100013530 3300005353 Bacteria 5800
116 Ga0070669_100045809 3300005353 Bacteria 3188
117 Ga0070675_100007844 3300005354 Bacteria 8273
118 Ga0070671_100000009 3300005355 Bacteria 206508
119 Ga0070671_100000482 3300005355 Bacteria 27745
120 Ga0070671_100004829 3300005355 Bacteria 10718
121 Ga0070671_100013940 3300005355 Bacteria 6487
122 Ga0070671_100015118 3300005355 Bacteria 6233
123 Ga0070671_100016699 3300005355 Bacteria 5935
124 Ga0070671_100032053 3300005355 Unclassified 4345
125 Ga0070674_100010775 3300005356 Bacteria 5543
126 Ga0070674_100020424 3300005356 Bacteria 4232
127 Ga0070673_100000138 3300005364 Bacteria 34274
128 Ga0070673_100010149 3300005364 Bacteria 6360
129 Ga0070659_100023655 3300005366 Bacteria 4704
130 Ga0070659_100038689 3300005366 Bacteria 3721
131 Ga0070659_100041111 3300005366 Bacteria 3613
132 Ga0070659_100062954 3300005366 Bacteria 2934
133 Ga0070659_100097236 3300005366 Bacteria 2366
134 Ga0070659_100119598 3300005366 Bacteria 2132
135 Ga0070667_100000017 3300005367 Bacteria 230531
136 Ga0070667_100000024 3300005367 Bacteria 191216
137 Ga0070667_100003990 3300005367 Bacteria 12503
138 Ga0070667_100008843 3300005367 Bacteria 8338
139 Ga0070667_100012637 3300005367 Bacteria 6982
140 Ga0070667_100063753 3300005367 Bacteria 3124
141 Ga0070667_100122428 3300005367 Bacteria 2264
142 Ga0070709_10000892 3300005434 Bacteria 16688
143 Ga0070714_100015160 3300005435 Bacteria 6198
144 Ga0070714_100078232 3300005435 Bacteria 2874
145 Ga0070713_100000003 3300005436 Bacteria 245840
146 Ga0070710_10045250 3300005437 Bacteria 2446
147 Ga0070711_100033038 3300005439 Bacteria 3444
148 Ga0070663_100015679 3300005455 Bacteria 4900
149 Ga0070678_100000057 3300005456 Bacteria 40248
150 Ga0070678_100001464 3300005456 Bacteria 12579
151 Ga0070662_100048101 3300005457 Bacteria 3071
152 Ga0070662_100096720 3300005457 Bacteria 2227
153 Ga0070685_10000389 3300005466 Bacteria 26431
154 Ga0070679_100143648 3300005530 Bacteria 2365
155 Ga0070679_100199771 3300005530 Bacteria 1966
156 Ga0070697_100097945 3300005536 Bacteria 2434
157 Ga0068853_100013242 3300005539 Bacteria 6731
158 Ga0068853_100017003 3300005539 Bacteria 5997
159 Ga0068853_100036747 3300005539 Bacteria 4166
160 Ga0070672_100005400 3300005543 Bacteria 8462
161 Ga0070686_100010480 3300005544 Bacteria 5229
162 Ga0070695_100079773 3300005545 Bacteria 2162
163 Ga0070665_100000042 3300005548 Bacteria 292582
164 Ga0070665_100000319 3300005548 Bacteria 74295
165 Ga0070665_100007081 3300005548 Bacteria 11395
166 Ga0070665_100010626 3300005548 Bacteria 9318
167 Ga0070665_100049096 3300005548 Bacteria 4235
168 Ga0070665_100074881 3300005548 Bacteria 3391
169 Ga0070665_100144530 3300005548 Bacteria 2382
170 Ga0070665_100241459 3300005548 Bacteria 1807
171 Ga0068855_100000608 3300005563 Bacteria 43919
172 Ga0068855_100155318 3300005563 Bacteria 2600
173 Ga0070664_100021787 3300005564 Bacteria 5284
174 Ga0068857_100005280 3300005577 Bacteria 11000
175 Ga0068857_100049639 3300005577 Bacteria 3723
176 Ga0068857_100066411 3300005577 Bacteria 3209
177 Ga0068857_100100978 3300005577 Bacteria 2588
178 Ga0068857_100144066 3300005577 Bacteria 2155
179 Ga0068854_100134981 3300005578 Bacteria 1888
180 Ga0068856_100000719 3300005614 Bacteria 36011
181 Ga0068856_100003762 3300005614 Bacteria 15216
182 Ga0068856_100009436 3300005614 Bacteria 9475
183 Ga0068856_100171757 3300005614 Bacteria 2180
184 Ga0068856_100179211 3300005614 Bacteria 2132
185 Ga0068852_100000753 3300005616 Bacteria 21299
186 Ga0068852_100165021 3300005616 Unclassified 2072
187 Ga0068859_100001232 3300005617 Bacteria 26157
188 Ga0068859_100003906 3300005617 Bacteria 15207
189 Ga0068859_100006922 3300005617 Bacteria 11512
190 Ga0068859_100023002 3300005617 Bacteria 6251
191 Ga0068859_100103822 3300005617 Bacteria 2901
192 Ga0068859_100141475 3300005617 Bacteria 2480
193 Ga0068864_100000260 3300005618 Bacteria 47076
194 Ga0068864_100003187 3300005618 Bacteria 13568
195 Ga0068864_100017327 3300005618 Bacteria 6004
196 Ga0068864_100030494 3300005618 Bacteria 4571
197 Ga0068861_100000074 3300005719 Bacteria 48480
198 Ga0068861_100001071 3300005719 Bacteria 16866
199 Ga0068861_100004608 3300005719 Bacteria 9251
200 Ga0068861_100010221 3300005719 Bacteria 6515
201 Ga0068861_100011989 3300005719 Bacteria 6037
202 Ga0068863_100000082 3300005841 Bacteria 105688
203 Ga0068863_100000280 3300005841 Bacteria 52729
204 Ga0068863_100007010 3300005841 Bacteria 11048
205 Ga0068863_100027387 3300005841 Bacteria 5436
206 Ga0068863_100055600 3300005841 Bacteria 3747
207 Ga0068863_100173781 3300005841 Bacteria 2067
208 Ga0068858_100000303 3300005842 Bacteria 52646
209 Ga0068858_100000591 3300005842 Bacteria 37967
210 Ga0068858_100001032 3300005842 Bacteria 28756
211 Ga0068858_100003432 3300005842 Bacteria 15745
212 Ga0068858_100013493 3300005842 Bacteria 7709
213 Ga0068858_100014160 3300005842 Bacteria 7520
214 Ga0068858_100162541 3300005842 Bacteria 2103
215 Ga0068860_100000056 3300005843 Bacteria 202751
216 Ga0068860_100000062 3300005843 Bacteria 190526
217 Ga0068860_100000944 3300005843 Bacteria 32201
218 Ga0068860_100018956 3300005843 Bacteria 6684
219 Ga0068860_100047514 3300005843 Bacteria 4091
220 Ga0068862_100000081 3300005844 Bacteria 113133
221 Ga0068862_100000280 3300005844 Bacteria 56780
222 Ga0068862_100000308 3300005844 Bacteria 53687
223 Ga0068862_100004544 3300005844 Bacteria 11698
224 Ga0068862_100017500 3300005844 Bacteria 5970
225 Ga0068862_100019008 3300005844 Bacteria 5729
226 Ga0081455_10000255 3300005937 Bacteria 69927
227 Ga0081540_1009297 3300005983 Bacteria 6781
228 Ga0081539_10006765 3300005985 Bacteria 10759
229 Ga0070717_10193808 3300006028 Bacteria 1777
230 Ga0070717_10220193 3300006028 Bacteria 1668
231 Ga0075365_10013351 3300006038 Bacteria 4908
232 Ga0075365_10074003 3300006038 Bacteria 2297
233 Ga0070712_100000169 3300006175 Bacteria 35660
234 Ga0075362_10004292 3300006177 Bacteria 5098
235 Ga0075367_10012269 3300006178 Bacteria 4563
236 Ga0075369_10005723 3300006186 Bacteria 4663
237 Ga0097621_100013780 3300006237 Bacteria 6037
238 Ga0075370_10010246 3300006353 Bacteria 4893
239 Ga0068871_100008468 3300006358 Bacteria 7400
240 Ga0068871_100024042 3300006358 Unclassified 4721
241 Ga0075430_100151222 3300006846 Bacteria 1933
242 Ga0075431_100004735 3300006847 Bacteria 13375
243 Ga0075431_100014844 3300006847 Bacteria 7886
244 Ga0075433_10031628 3300006852 Bacteria 4525
245 Ga0075434_100129812 3300006871 Bacteria 2539
246 Ga0075436_100000038 3300006914 Bacteria 82918
247 Ga0075436_100045939 3300006914 Bacteria 3013
248 Ga0097620_100001232 3300006931 Bacteria 26157
249 Ga0097620_100003906 3300006931 Bacteria 15207
250 Ga0097620_100006922 3300006931 Bacteria 11512
251 Ga0097620_100022995 3300006931 Bacteria 6251
252 Ga0097620_100103821 3300006931 Bacteria 2901
253 Ga0097620_100141468 3300006931 Bacteria 2480
254 Ga0079104_1000125 3300006946 Bacteria 110104
255 Ga0079104_1004867 3300006946 Bacteria 5564
256 Ga0079104_1006152 3300006946 Bacteria 4617
257 Ga0105240_10008524 3300009093 Bacteria 14649
258 Ga0105240_10098810 3300009093 Bacteria 3553
259 Ga0105240_10361753 3300009093 Bacteria 1643
260 Ga0111539_10000890 3300009094 Bacteria 39032
261 Ga0114129_10001654 3300009147 Bacteria 30326
262 Ga0114129_10026011 3300009147 Bacteria 8288
263 Ga0114129_10034137 3300009147 Bacteria 7185
264 Ga0114129_10443639 3300009147 Bacteria 1703
265 Ga0114129_10524881 3300009147 Bacteria 1543
266 Ga0105243_10000033 3300009148 Bacteria 180464
267 Ga0105241_10013534 3300009174 Bacteria 5979
268 Ga0105241_10017676 3300009174 Bacteria 5243
269 Ga0105241_10030093 3300009174 Bacteria 4055
270 Ga0105248_10001187 3300009177 Bacteria 29143
271 Ga0105248_10008690 3300009177 Bacteria 11160
272 Ga0105248_10016997 3300009177 Bacteria 8013
273 Ga0105248_10017774 3300009177 Bacteria 7846
274 Ga0105248_10025390 3300009177 Bacteria 6588
275 Ga0105248_10152523 3300009177 Bacteria 2607
276 Ga0105248_10315041 3300009177 Bacteria 1762
277 Ga0105237_10002470 3300009545 Bacteria 22937
278 Ga0105238_10003588 3300009551 Bacteria 15470
279 Ga0105238_10113471 3300009551 Bacteria 2690
280 Ga0105249_10000012 3300009553 Bacteria 292640
281 Ga0105249_10000103 3300009553 Bacteria 118397
282 Ga0105249_10020498 3300009553 Bacteria 5909
283 Ga0105246_10116683 3300011119 Bacteria 1971
284 Ga0157326_1000338 3300012513 Bacteria 5509
285 Ga0157371_10000059 3300013102 Bacteria 170541
286 Ga0157371_10025477 3300013102 Bacteria 4310
287 Ga0157370_10000069 3300013104 Bacteria 112889
288 Ga0157370_10049403 3300013104 Bacteria 4026
289 Ga0157369_10004747 3300013105 Bacteria 15970
290 Ga0157369_10030829 3300013105 Bacteria 5911
291 Ga0157369_10038626 3300013105 Bacteria 5219
292 Ga0157369_10097133 3300013105 Bacteria 3142
293 Ga0171463_1001 3300013249 Bacteria 1406070
294 Ga0157378_10002131 3300013297 Bacteria 17601
295 Ga0157378_10137652 3300013297 Bacteria 2265
296 Ga0163162_10001741 3300013306 Bacteria 20418
297 Ga0163162_10005593 3300013306 Bacteria 12158
298 Ga0163162_10013689 3300013306 Bacteria 7926
299 Ga0163162_10046965 3300013306 Bacteria 4328
300 Ga0163162_10066770 3300013306 Bacteria 3646
301 Ga0163162_10102190 3300013306 Bacteria 2960
302 Ga0157372_10232582 3300013307 Bacteria 2137
303 Ga0157375_10002592 3300013308 Bacteria 15698
304 Ga0157375_10006186 3300013308 Bacteria 10435
305 Ga0157375_10065252 3300013308 Bacteria 3629
306 Ga0163163_10022274 3300014325 Bacteria 5996
307 Ga0157380_10000151 3300014326 Bacteria 39765
308 Ga0157380_10001425 3300014326 Bacteria 15655
309 Ga0157379_10036388 3300014968 Bacteria 4390
310 Ga0157379_10137507 3300014968 Bacteria 2202
311 Ga0157376_10000903 3300014969 Bacteria 19363
312 Ga0183363_1004 3300015690 Bacteria 416766
313 Ga0183363_1053 3300015690 Bacteria 36839
314 Ga0163161_10000025 3300017792 Bacteria 201127
315 Ga0163161_10038310 3300017792 Bacteria 3438
316 Ga0206356_11309587 3300020070 Bacteria 1807
317 Ga0206350_11038354 3300020080 Eukaryota 1789
318 Ga0206354_10710180 3300020081 Bacteria 1848
319 Ga0214544_1000434 3300021320 Bacteria 75507
320 Ga0214542_1000146 3300021321 Bacteria 103035
321 Ga0214542_1027236 3300021321 Bacteria 2648
322 Ga0214543_1000049 3300021327 Bacteria 149506
323 Ga0214543_1000054 3300021327 Bacteria 140288
324 Ga0213876_10000310 3300021384 Bacteria 42816
325 Ga0224712_10035483 3300022467 Bacteria 1841
326 Ga0228711_1000006 3300022739 Bacteria 202437
327 Ga0228710_1000004 3300022740 Bacteria 250560
328 Ga0209435_100049 3300025206 Bacteria 92067
329 Ga0207672_1000205 3300025223 Bacteria 8314
330 Ga0209563_100116 3300025230 Bacteria 134661
331 Ga0207425_1000041 3300025245 Bacteria 210441
332 Ga0207425_1004457 3300025245 Bacteria 4194
333 Ga0209646_1000159 3300025246 Bacteria 92067
334 Ga0209026_1000183 3300025250 Bacteria 92067
335 Ga0209026_1000650 3300025250 Bacteria 21317
336 Ga0209148_1000011 3300025254 Bacteria 1196503
337 Ga0209148_1000238 3300025254 Bacteria 87836
338 Ga0209148_1003278 3300025254 Bacteria 4582
339 Ga0209759_1000206 3300025256 Bacteria 92067
340 Ga0209129_1000359 3300025258 Bacteria 37937
341 Ga0209129_1006060 3300025258 Bacteria 4043
342 Ga0209233_1000079 3300025261 Bacteria 346944
343 Ga0209233_1000104 3300025261 Bacteria 272675
344 Ga0209565_1000008 3300025263 Bacteria 774179
345 Ga0209565_1000134 3300025263 Bacteria 104013
346 Ga0209455_1000006 3300025272 Bacteria 1196503
347 Ga0209673_1000584 3300025273 Bacteria 57616
348 Ga0209673_1003724 3300025273 Bacteria 8722
349 Ga0209673_1004104 3300025273 Bacteria 8005
350 Ga0209130_1000005 3300025284 Bacteria 599620
351 Ga0209130_1000642 3300025284 Bacteria 32652
352 Ga0209675_1003991 3300025291 Bacteria 6740
353 Ga0209676_1001593 3300025292 Bacteria 20182
354 Ga0209025_1000037 3300025294 Bacteria 383429
355 Ga0209025_1000068 3300025294 Bacteria 294129
356 Ga0209025_1000814 3300025294 Bacteria 50030
357 Ga0209025_1011026 3300025294 Bacteria 6026
358 Ga0209564_1000113 3300025295 Bacteria 211564
359 Ga0209564_1001020 3300025295 Bacteria 34568
360 Ga0209564_1006879 3300025295 Bacteria 5996
361 Ga0209758_1000001 3300025297 Bacteria 1981790
362 Ga0209758_1000004 3300025297 Bacteria 1375322
363 Ga0209758_1001197 3300025297 Bacteria 32795
364 Ga0209758_1004151 3300025297 Bacteria 12343
365 Ga0209758_1008214 3300025297 Bacteria 6837
366 Ga0209050_1000001 3300025298 Bacteria 3563507
367 Ga0209050_1000014 3300025298 Bacteria 774327
368 Ga0209050_1002150 3300025298 Bacteria 17933
369 Ga0209050_1009997 3300025298 Bacteria 4747
370 Ga0209256_1000009 3300025299 Bacteria 922071
371 Ga0209256_1000010 3300025299 Bacteria 912110
372 Ga0209256_1000819 3300025299 Bacteria 39621
373 Ga0209256_1002787 3300025299 Bacteria 13398
374 Ga0209256_1007106 3300025299 Bacteria 5646
375 Ga0207426_1000015 3300025302 Bacteria 599316
376 Ga0207426_1000330 3300025302 Bacteria 89992
377 Ga0207426_1000812 3300025302 Bacteria 33529
378 Ga0207426_1028357 3300025302 Bacteria 1857
379 Ga0209051_1000232 3300025303 Bacteria 93680
380 Ga0209051_1009681 3300025303 Bacteria 4943
381 Ga0209257_1000019 3300025304 Bacteria 774261
382 Ga0209257_1003713 3300025304 Bacteria 12689
383 Ga0209257_1005528 3300025304 Bacteria 8809
384 Ga0209257_1018206 3300025304 Bacteria 2718
385 Ga0207656_10043107 3300025321 Bacteria 1923
386 Ga0207713_1004595 3300025735 Bacteria 8919
387 Ga0207682_10011989 3300025893 Bacteria 3383
388 Ga0207680_10000012 3300025903 Bacteria 293810
389 Ga0207680_10001210 3300025903 Bacteria 12223
390 Ga0207680_10005315 3300025903 Bacteria 6148
391 Ga0207680_10025252 3300025903 Bacteria 3275
392 Ga0207647_10000497 3300025904 Bacteria 31453
393 Ga0207647_10001733 3300025904 Bacteria 16727
394 Ga0207647_10025680 3300025904 Bacteria 3865
395 Ga0207647_10043369 3300025904 Bacteria 2816
396 Ga0207699_10000676 3300025906 Bacteria 16381
397 Ga0207645_10002209 3300025907 Bacteria 15534
398 Ga0207705_10000002 3300025909 Bacteria 2046852
399 Ga0207705_10000197 3300025909 Bacteria 61058
400 Ga0207705_10016169 3300025909 Bacteria 5353
401 Ga0207705_10179745 3300025909 Bacteria 1596
402 Ga0207654_10000222 3300025911 Bacteria 34847
403 Ga0207654_10000293 3300025911 Bacteria 30167
404 Ga0207707_10160961 3300025912 Bacteria 1963
405 Ga0207695_10000641 3300025913 Bacteria 69705
406 Ga0207695_10033073 3300025913 Bacteria 5648
407 Ga0207695_10069418 3300025913 Bacteria 3605
408 Ga0207695_10080915 3300025913 Bacteria 3289
409 Ga0207671_10002072 3300025914 Bacteria 21940
410 Ga0207671_10003353 3300025914 Bacteria 16074
411 Ga0207657_10041918 3300025919 Bacteria 4043
412 Ga0207657_10087798 3300025919 Bacteria 2601
413 Ga0207657_10105879 3300025919 Bacteria 2328
414 Ga0207657_10119347 3300025919 Bacteria 2170
415 Ga0207657_10134006 3300025919 Bacteria 2028
416 Ga0207649_10000319 3300025920 Bacteria 36478
417 Ga0207649_10055003 3300025920 Bacteria 2479
418 Ga0207652_10056019 3300025921 Bacteria 3393
419 Ga0207646_10046513 3300025922 Unclassified 3893
420 Ga0207681_10000003 3300025923 Bacteria 713245
421 Ga0207681_10000008 3300025923 Bacteria 414329
422 Ga0207681_10000221 3300025923 Bacteria 45206
423 Ga0207681_10000259 3300025923 Bacteria 40452
424 Ga0207681_10000667 3300025923 Bacteria 22714
425 Ga0207681_10044582 3300025923 Bacteria 2973
426 Ga0207694_10003805 3300025924 Bacteria 11940
427 Ga0207694_10055561 3300025924 Bacteria 3073
428 Ga0207650_10000038 3300025925 Bacteria 206081
429 Ga0207650_10001576 3300025925 Bacteria 16287
430 Ga0207650_10002138 3300025925 Bacteria 13823
431 Ga0207650_10007425 3300025925 Bacteria 7470
432 Ga0207650_10027164 3300025925 Bacteria 4094
433 Ga0207650_10100427 3300025925 Bacteria 2226
434 Ga0207659_10002827 3300025926 Bacteria 10358
435 Ga0207659_10118854 3300025926 Bacteria 2022
436 Ga0207687_10039346 3300025927 Bacteria 3237
437 Ga0207700_10000083 3300025928 Bacteria 58710
438 Ga0207700_10034972 3300025928 Bacteria 3613
439 Ga0207664_10011315 3300025929 Bacteria 6331
440 Ga0207644_10000006 3300025931 Bacteria 408793
441 Ga0207644_10000060 3300025931 Bacteria 79209
442 Ga0207644_10000385 3300025931 Bacteria 28685
443 Ga0207644_10000927 3300025931 Bacteria 18628
444 Ga0207644_10002506 3300025931 Bacteria 11823
445 Ga0207644_10017065 3300025931 Bacteria 4896
446 Ga0207644_10017956 3300025931 Unclassified 4783
447 Ga0207644_10037322 3300025931 Bacteria 3417
448 Ga0207690_10010226 3300025932 Bacteria 5570
449 Ga0207690_10010856 3300025932 Bacteria 5428
450 Ga0207690_10013890 3300025932 Bacteria 4851
451 Ga0207690_10087993 3300025932 Bacteria 2187
452 Ga0207690_10142117 3300025932 Bacteria 1770
453 Ga0207690_10148204 3300025932 Unclassified 1737
454 Ga0207706_10003677 3300025933 Bacteria 14643
455 Ga0207706_10009415 3300025933 Bacteria 8967
456 Ga0207706_10141341 3300025933 Bacteria 2118
457 Ga0207709_10000059 3300025935 Bacteria 211914
458 Ga0207669_10005970 3300025937 Bacteria 5520
459 Ga0207691_10000019 3300025940 Bacteria 133680
460 Ga0207711_10002994 3300025941 Bacteria 14761
461 Ga0207711_10011653 3300025941 Bacteria 7305
462 Ga0207711_10014565 3300025941 Bacteria 6536
463 Ga0207711_10029281 3300025941 Bacteria 4643
464 Ga0207711_10224428 3300025941 Bacteria 1719
465 Ga0207711_10268308 3300025941 Bacteria 1570
466 Ga0207679_10017290 3300025945 Unclassified 4807
467 Ga0207679_10067410 3300025945 Bacteria 2685
468 Ga0207667_10000002 3300025949 Bacteria 895662
469 Ga0207667_10000916 3300025949 Bacteria 37599
470 Ga0207667_10005514 3300025949 Bacteria 15433
471 Ga0207667_10020324 3300025949 Bacteria 7390
472 Ga0207667_10044809 3300025949 Bacteria 4686
473 Ga0207667_10086736 3300025949 Bacteria 3239
474 Ga0207651_10001213 3300025960 Bacteria 11549
475 Ga0207651_10059026 3300025960 Bacteria 2654
476 Ga0207712_10000021 3300025961 Bacteria 292649
477 Ga0207712_10000069 3300025961 Bacteria 127318
478 Ga0207712_10020513 3300025961 Bacteria 4328
479 Ga0207668_10000178 3300025972 Bacteria 43552
480 Ga0207668_10000647 3300025972 Bacteria 21409
481 Ga0207668_10001332 3300025972 Bacteria 14663
482 Ga0207668_10022777 3300025972 Bacteria 4015
483 Ga0207668_10109414 3300025972 Bacteria 2070
484 Ga0207640_10117499 3300025981 Bacteria 1898
485 Ga0207658_10000011 3300025986 Bacteria 239620
486 Ga0207658_10000022 3300025986 Bacteria 191235
487 Ga0207658_10005443 3300025986 Bacteria 8730
488 Ga0207658_10014406 3300025986 Bacteria 5414
489 Ga0207658_10045858 3300025986 Bacteria 3189
490 Ga0207658_10064739 3300025986 Bacteria 2743
491 Ga0207658_10079952 3300025986 Bacteria 2502
492 Ga0207677_10002920 3300026023 Bacteria 9029
493 Ga0207703_10000205 3300026035 Bacteria 69078
494 Ga0207703_10000639 3300026035 Bacteria 35173
495 Ga0207703_10000714 3300026035 Bacteria 32756
496 Ga0207703_10014160 3300026035 Bacteria 6219
497 Ga0207639_10000691 3300026041 Bacteria 23195
498 Ga0207639_10003585 3300026041 Bacteria 10426
499 Ga0207678_10000218 3300026067 Bacteria 51096
500 Ga0207678_10025364 3300026067 Bacteria 5175
501 Ga0207702_10000045 3300026078 Bacteria 144714
502 Ga0207702_10002451 3300026078 Bacteria 17572
503 Ga0207702_10002929 3300026078 Bacteria 15968
504 Ga0207702_10028110 3300026078 Bacteria 4672
505 Ga0207702_10032499 3300026078 Bacteria 4354
506 Ga0207702_10104638 3300026078 Bacteria 2505
507 Ga0207641_10000115 3300026088 Bacteria 118497
508 Ga0207641_10000139 3300026088 Bacteria 105740
509 Ga0207641_10000414 3300026088 Bacteria 49835
510 Ga0207641_10002917 3300026088 Bacteria 15486
511 Ga0207641_10008887 3300026088 Bacteria 8296
512 Ga0207641_10033804 3300026088 Bacteria 4249
513 Ga0207641_10236824 3300026088 Bacteria 1699
514 Ga0207641_10321469 3300026088 Bacteria 1467
515 Ga0207648_10096920 3300026089 Bacteria 2581
516 Ga0207676_10000034 3300026095 Bacteria 206058
517 Ga0207676_10000613 3300026095 Bacteria 29202
518 Ga0207676_10001417 3300026095 Bacteria 17820
519 Ga0207676_10005994 3300026095 Bacteria 8574
520 Ga0207676_10035291 3300026095 Bacteria 3794
521 Ga0207674_10000026 3300026116 Bacteria 151359
522 Ga0207674_10027999 3300026116 Bacteria 5955
523 Ga0207674_10037284 3300026116 Bacteria 5058
524 Ga0207674_10041996 3300026116 Bacteria 4726
525 Ga0207674_10050697 3300026116 Bacteria 4239
526 Ga0207674_10057730 3300026116 Bacteria 3934
527 Ga0207674_10086805 3300026116 Bacteria 3123
528 Ga0207674_10164988 3300026116 Bacteria 2169
529 Ga0207675_100000244 3300026118 Bacteria 51844
530 Ga0207675_100000360 3300026118 Bacteria 43597
531 Ga0207675_100000533 3300026118 Bacteria 37022
532 Ga0207675_100006658 3300026118 Bacteria 10932
533 Ga0207675_100028656 3300026118 Bacteria 5187
534 Ga0207683_10002984 3300026121 Bacteria 14769
535 Ga0207683_10020489 3300026121 Bacteria 5656
536 Ga0207683_10020696 3300026121 Bacteria 5628
537 Ga0207698_10000130 3300026142 Bacteria 47043
538 Ga0207698_10274655 3300026142 Unclassified 1555
539 Ga0209281_1000102 3300027111 Bacteria 221665
540 Ga0209281_1000242 3300027111 Bacteria 110116
541 Ga0209281_1000695 3300027111 Bacteria 34292
542 Ga0209282_1000013 3300027666 Bacteria 215053
543 Ga0209813_10000111 3300027866 Bacteria 29673
544 Ga0209974_10004804 3300027876 Bacteria 4792
545 Ga0207428_10047662 3300027907 Bacteria 3440
546 Ga0268266_10000002 3300028379 Bacteria 3059047
547 Ga0268266_10000054 3300028379 Bacteria 292717
548 Ga0268266_10000212 3300028379 Bacteria 101029
549 Ga0268266_10012740 3300028379 Bacteria 7267
550 Ga0268266_10031160 3300028379 Bacteria 4528
551 Ga0268266_10056372 3300028379 Bacteria 3381
552 Ga0268266_10115169 3300028379 Bacteria 2386
553 Ga0268265_10000030 3300028380 Bacteria 228157
554 Ga0268265_10000292 3300028380 Bacteria 56426
555 Ga0268265_10000601 3300028380 Bacteria 36169
556 Ga0268265_10000739 3300028380 Bacteria 31842
557 Ga0268265_10006464 3300028380 Bacteria 7943
558 Ga0268264_10000074 3300028381 Bacteria 259555
559 Ga0268264_10000089 3300028381 Bacteria 234760
560 Ga0268264_10000310 3300028381 Bacteria 78142
561 Ga0268264_10002308 3300028381 Bacteria 16874
562 Ga0268264_10018414 3300028381 Bacteria 5711
563 Ga0268264_10046657 3300028381 Bacteria 3599
564 Ga0307517_10015953 3300028786 Bacteria 9920
565 Ga0307517_10028410 3300028786 Bacteria 6666
566 Ga0307517_10094042 3300028786 Bacteria 2424
567 Ga0268256_1004680 3300030500 Bacteria 5590
568 Ga0307513_10054454 3300031456 Bacteria 4289
569 Ga0307513_10109370 3300031456 Bacteria 2762
570 Ga0307408_100002167 3300031548 Bacteria 14050
571 Ga0307408_100134083 3300031548 Bacteria 1935
572 Ga0307508_10000398 3300031616 Bacteria 52452
573 Ga0307516_10137322 3300031730 Bacteria 2218
574 Ga0307405_10029241 3300031731 Bacteria 3219
575 Ga0307405_10047559 3300031731 Bacteria 2642
576 Ga0307405_10049815 3300031731 Bacteria 2591
577 Ga0307405_10086253 3300031731 Bacteria 2066
578 Ga0307405_10098046 3300031731 Bacteria 1958
579 Ga0307413_10053302 3300031824 Bacteria 2448
580 Ga0307406_10039675 3300031901 Bacteria 2923
581 Ga0307406_10176625 3300031901 Bacteria 1551
582 Ga0307407_10019922 3300031903 Bacteria 3424
583 Ga0307412_10019148 3300031911 Bacteria 4137
584 Ga0307412_10023819 3300031911 Bacteria 3772
585 Ga0315914_1000004 3300031967 Bacteria 288534
586 Ga0307409_100106263 3300031995 Bacteria 2342
587 Ga0307414_10016847 3300032004 Bacteria 4456
588 Ga0307414_10083941 3300032004 Bacteria 2341
589 Ga0307414_10224461 3300032004 Bacteria 1544
590 Ga0307415_100159691 3300032126 Bacteria 1746
591 Ga0307510_10008962 3300033180 Bacteria 11914
592 Ga0307510_10052621 3300033180 Bacteria 4289
593 Ga0315913_1000011 3300033430 Bacteria 140532
594 Ga0315915_1000003 3300033464 Bacteria 407996
595 Ga0373926_0012290 3300035083 Bacteria 2893
596 Ga0373936_0042425 3300035113 Bacteria 1826
597 Ga0373954_0006557 3300035118 Bacteria 5074
598 Ga0373954_0101270 3300035118 Bacteria 1390
599 Ga0373957_0005881 3300035120 Bacteria 3832
600 Ga0373943_0004815 3300035170 Bacteria 6097
601 Ga0373943_0036081 3300035170 Bacteria 2367
602 Ga0373943_0046767 3300035170 Bacteria 2113
603 Ga0373943_0081973 3300035170 Bacteria 1656
604 Ga0373955_0051397 3300035172 Bacteria 2245
605 Ga0373935_0004136 3300035692 Bacteria 8491
606 Ga0373935_0025842 3300035692 Bacteria 3619
607 Ga0373927_0013012 3300035695 Bacteria 5534
608 Ga0373927_0156870 3300035695 Bacteria 1491
609 Ga0373933_0014844 3300035724 Bacteria 4335
610 Ga0373933_0045726 3300035724 Bacteria 2597
611 Ga0373947_0016497 3300035725 Bacteria 4244
612 Ga0373947_0086858 3300035725 Bacteria 1945
613 Ga0373937_0004279 3300036401 Bacteria 12093
614 Ga0373937_0016703 3300036401 Bacteria 6522
615 Ga0373937_0027529 3300036401 Bacteria 5140
616 Ga0373937_0110922 3300036401 Bacteria 2551
617 Ga0373937_0144920 3300036401 Bacteria 2223
618 Ga0373925_0002642 3300037068 Bacteria 14220
619 Ga0373925_0038558 3300037068 Bacteria 3533
620 Ga0373925_0054265 3300037068 Bacteria 2997
621 Ga0373925_0131705 3300037068 Bacteria 1950
622 Ga0395899_0001521 3300037312 Bacteria 19608
623 Ga0395905_0109712 3300037471 Bacteria 2591
624 Ga0436364_0910692 3300037853 Bacteria 15334
625 Ga0436364_1027058 3300037853 Bacteria 7297
626 Ga0395901_0091535 3300038443 Bacteria 3184
627 Ga0237819_00949 3300038705 Bacteria 8836
628 Ga0237816_00649 3300039145 Bacteria 2933
629 Ga0436365_1654841 3300039437 Bacteria 47529
630 Ga0436360_0036174 3300039438 Bacteria 2882
631 Ga0436360_1255809 3300039438 Bacteria 2632
632 Ga0436362_1291891 3300039453 Bacteria 4496
633 Ga0439461_0000133 3300041410 Bacteria 9890
634 Ga0439461_0003201 3300041410 Bacteria 2680
635 Ga0439465_0002515 3300041413 Bacteria 5984
636 Ga0439465_0007006 3300041413 Bacteria 3582
637 Ga0439465_0010080 3300041413 Bacteria 2972
638 Ga0451793_0729188 3300041452 Bacteria 1990
639 Ga0451806_691803 3300041462 Bacteria 2065
640 Ga0451835_0937263 3300041492 Bacteria 6890
641 Ga0451849_0603856 3300041505 Bacteria 2074
642 Ga0439431_0000794 3300041997 Bacteria 6831
643 Ga0439431_0007345 3300041997 Bacteria 2456
644 Ga0439432_010870 3300042006 Bacteria 3144
645 Ga0439449_0002709 3300042007 Bacteria 6901
646 Ga0439462_0002763 3300042015 Bacteria 4122
647 Ga0439446_0003437 3300042156 Bacteria 3935
648 Ga0466972_0012842 3300044658 Bacteria 4206
649 Ga0466966_0060715 3300044684 Bacteria 2386
650 Ga0466968_0007104 3300044735 Bacteria 4248
651 Ga0466968_0014787 3300044735 Bacteria 3087
652 Ga0466970_0042451 3300044765 Bacteria 2419
653 Ga0466960_0058600 3300044901 Bacteria 1881
654 Ga0466959_0019769 3300045049 Bacteria 4955
655 Ga0451576_0000023 3300045051 Bacteria 477965
656 Ga0451576_0032757 3300045051 Bacteria 5527
657 Ga0495627_000157 3300046453 Bacteria 78082
658 Ga0495627_000318 3300046453 Bacteria 47190
659 Ga0495592_0087492 3300046454 Bacteria 2241
660 Ga0495592_0096045 3300046454 Bacteria 2119
661 Ga0495638_0000018 3300046460 Bacteria 389696
662 Ga0495638_0000214 3300046460 Bacteria 81426
663 Ga0495638_0003200 3300046460 Bacteria 12944
664 Ga0495638_0009219 3300046460 Bacteria 6938
665 Ga0495638_0013831 3300046460 Bacteria 5477
666 Ga0495651_0071686 3300046462 Bacteria 2633
667 Ga0495650_0000174 3300046471 Bacteria 142519
668 Ga0495650_0006704 3300046471 Bacteria 7130
669 Ga0495580_0017783 3300046472 Bacteria 5303
670 Ga0495582_0042330 3300046473 Bacteria 2508
671 Ga0495605_0002064 3300046474 Bacteria 12659
672 Ga0495639_0000789 3300046475 Bacteria 14448
673 Ga0495664_0007587 3300046477 Bacteria 6031
674 Ga0495584_0018885 3300046491 Bacteria 3503
675 Ga0495585_0016115 3300046492 Bacteria 4332
676 Ga0495585_0017595 3300046492 Bacteria 4128
677 Ga0495594_0015378 3300046499 Bacteria 4020
678 Ga0495596_0006273 3300046500 Bacteria 5499
679 Ga0495607_0037983 3300046501 Bacteria 2888
680 Ga0495583_0000038 3300046506 Bacteria 243395
681 Ga0495583_0002170 3300046506 Bacteria 17516
682 Ga0495583_0006072 3300046506 Bacteria 7988
683 Ga0495583_0017689 3300046506 Bacteria 3778
684 Ga0495583_0028306 3300046506 Bacteria 2756
685 Ga0495583_0035876 3300046506 Bacteria 2362
686 Ga0495606_0003780 3300046507 Bacteria 15734
687 Ga0495606_0017420 3300046507 Bacteria 5433
688 Ga0495606_0080258 3300046507 Bacteria 2030
689 Ga0495610_0000389 3300046512 Bacteria 45473
690 Ga0495610_0053919 3300046512 Bacteria 1945
691 Ga0495616_0000880 3300046513 Bacteria 21796
692 Ga0495616_0030509 3300046513 Bacteria 2833
693 Ga0495620_0013645 3300046515 Bacteria 4154
694 Ga0495630_0012981 3300046517 Bacteria 6052
695 Ga0495631_0001695 3300046518 Bacteria 13089
696 Ga0495632_0000042 3300046519 Bacteria 145186
697 Ga0495632_0001274 3300046519 Bacteria 21337
698 Ga0495632_0011422 3300046519 Bacteria 5182
699 Ga0495637_0001047 3300046520 Bacteria 17342
700 Ga0495637_0007051 3300046520 Bacteria 5597
701 Ga0495643_0000005 3300046522 Bacteria 443135
702 Ga0495643_0005203 3300046522 Bacteria 8863
703 Ga0495643_0020654 3300046522 Bacteria 3793
704 Ga0495643_0031010 3300046522 Bacteria 2979
705 Ga0495643_0065559 3300046522 Bacteria 1917
706 Ga0495648_0000144 3300046524 Bacteria 85412
707 Ga0495648_0000147 3300046524 Bacteria 84418
708 Ga0495648_0033238 3300046524 Bacteria 3372
709 Ga0495648_0034396 3300046524 Bacteria 3298
710 Ga0495663_0000015 3300046525 Bacteria 145185
711 Ga0495663_0005738 3300046525 Bacteria 3438
712 Ga0495663_0010363 3300046525 Bacteria 2592
713 Ga0495663_0017105 3300046525 Bacteria 2055
714 Ga0495652_0163682 3300046529 Bacteria 1724
715 Ga0495654_0000236 3300046530 Bacteria 51913
716 Ga0495654_0010002 3300046530 Bacteria 5180
717 Ga0495654_0015312 3300046530 Bacteria 4074
718 Ga0495665_0001769 3300046531 Bacteria 11640
719 Ga0495645_0003119 3300046543 Bacteria 11232
720 Ga0495633_0000197 3300046558 Bacteria 76903
721 Ga0495633_0000262 3300046558 Bacteria 62524
722 Ga0495633_0033295 3300046558 Bacteria 2485
723 Ga0495633_0073505 3300046558 Bacteria 1593
724 Ga0495667_0008176 3300046559 Bacteria 7100
725 Ga0495667_0025775 3300046559 Bacteria 3961
726 Ga0495656_0026297 3300046615 Bacteria 2316
727 Ga0495668_0000072 3300046616 Bacteria 167170
728 Ga0495668_0006134 3300046616 Bacteria 7956
729 Ga0495668_0028551 3300046616 Bacteria 3155
730 Ga0495668_0028910 3300046616 Bacteria 3133
731 Ga0495611_0007195 3300046648 Bacteria 4730
732 Ga0495625_0001386 3300046660 Bacteria 29753
733 Ga0495625_0002794 3300046660 Bacteria 18407
734 Ga0495625_0008722 3300046660 Bacteria 8594
735 Ga0495625_0017887 3300046660 Bacteria 5541
736 Ga0495625_0109602 3300046660 Bacteria 1888
737 Ga0495625_0125954 3300046660 Bacteria 1739
738 Ga0495661_0070079 3300046665 Bacteria 2053
739 Ga0495661_0088828 3300046665 Bacteria 1763
740 Ga0495588_0005144 3300046674 Bacteria 5810
741 Ga0495599_0093830 3300046678 Bacteria 1872
742 Ga0495658_0002931 3300046683 Bacteria 8560
743 Ga0495669_0000258 3300046684 Bacteria 30670
744 Ga0495613_0025023 3300046689 Bacteria 4449
745 Ga0495670_0018659 3300046691 Bacteria 3417
746 Ga0495670_0028758 3300046691 Bacteria 2756
747 Ga0495671_0000007 3300046692 Bacteria 443069
748 Ga0495671_0000060 3300046692 Bacteria 107734
749 Ga0495589_0011649 3300046794 Bacteria 4565
750 Ga0495660_0006209 3300046810 Bacteria 7090
751 Ga0495581_0007959 3300047315 Bacteria 6140
752 Ga0495604_0048025 3300047317 Bacteria 3321
753 Ga0495674_0033062 3300047319 Bacteria 4688
754 Ga0495672_0007359 3300047320 Bacteria 8292
755 Ga0495672_0009409 3300047320 Bacteria 7084
756 Ga0495680_0129972 3300047322 Bacteria 1852
757 Ga0495683_0024537 3300047323 Bacteria 3094
758 Ga0495687_000045 3300047443 Bacteria 211968
759 Ga0495687_000240 3300047443 Bacteria 75621
760 Ga0495675_0034447 3300047444 Bacteria 3233
761 Ga0495673_0000088 3300047469 Bacteria 189812
762 Ga0495673_0016447 3300047469 Bacteria 3781
763 Ga0495673_0041921 3300047469 Bacteria 2058
764 Ga0495681_0000006 3300047470 Bacteria 221565
765 Ga0495681_0004911 3300047470 Bacteria 9033
766 Ga0495681_0016802 3300047470 Bacteria 4084
767 Ga0495686_0000197 3300047472 Bacteria 112818
768 Ga0495686_0000544 3300047472 Bacteria 53939
769 Ga0495686_0000588 3300047472 Bacteria 51272
770 Ga0495686_0004312 3300047472 Bacteria 11764
771 Ga0495686_0010969 3300047472 Bacteria 6416
772 Ga0495686_0021400 3300047472 Bacteria 4295
773 Ga0495686_0054433 3300047472 Bacteria 2505
774 Ga0495686_0125900 3300047472 Bacteria 1523
775 Ga0495593_0002299 3300047673 Bacteria 11458
776 Ga0495602_0003534 3300048088 Bacteria 16152
777 Ga0495614_0002616 3300048089 Bacteria 8001
778 Ga0495626_0045817 3300048091 Bacteria 2040
779 Ga0496101_0004194 3300048904 Bacteria 9032
780 Ga0496102_0000043 3300048905 Bacteria 189201
781 Ga0496102_0000106 3300048905 Bacteria 118841
782 Ga0496102_0011122 3300048905 Bacteria 7750
783 Ga0496103_0000069 3300048906 Bacteria 121542
784 Ga0496103_0000095 3300048906 Bacteria 98260
785 Ga0496103_0000133 3300048906 Bacteria 78740
786 Ga0496103_0002980 3300048906 Bacteria 10483
787 Ga0496104_0000060 3300048907 Bacteria 117966
788 Ga0496104_0067340 3300048907 Bacteria 3401
789 Ga0496104_0077771 3300048907 Bacteria 3161
790 Ga0496104_0109404 3300048907 Bacteria 2649
791 Ga0496105_0000274 3300048908 Bacteria 34048
792 Ga0496105_0041343 3300048908 Bacteria 3799
793 Ga0496105_0062920 3300048908 Bacteria 3062
794 Ga0496105_0079109 3300048908 Bacteria 2715
795 Ga0496106_0000338 3300048909 Bacteria 32910
796 Ga0496106_0001196 3300048909 Bacteria 19346
797 Ga0496107_0002397 3300048910 Bacteria 12134
798 Ga0496108_0001297 3300048911 Bacteria 19637
799 Ga0496108_0045490 3300048911 Bacteria 3666
800 Ga0496109_0056144 3300048912 Bacteria 3593
801 Ga0496110_0038618 3300048913 Bacteria 4155
802 Ga0496111_0000685 3300048914 Bacteria 17853
803 Ga0496111_0034979 3300048914 Bacteria 3588
804 Ga0496112_0175508 3300048915 Bacteria 2108
805 Ga0496113_0001855 3300048916 Bacteria 12041
806 Ga0496113_0002586 3300048916 Bacteria 10570
807 Ga0496113_0023903 3300048916 Bacteria 4338
808 Ga0496114_0003386 3300048917 Bacteria 12242
809 Ga0496115_0000009 3300048918 Bacteria 234372
810 Ga0496115_0001130 3300048918 Bacteria 19264
811 Ga0496116_0007300 3300048919 Bacteria 9843
812 Ga0496116_0014376 3300048919 Bacteria 6327
813 Ga0496116_0041259 3300048919 Bacteria 3168
814 Ga0496117_0000104 3300048920 Bacteria 189201
815 Ga0496117_0000185 3300048920 Bacteria 127413
816 Ga0496117_0000366 3300048920 Bacteria 78816
817 Ga0496117_0002165 3300048920 Bacteria 25611
818 Ga0496117_0013629 3300048920 Bacteria 7080
819 Ga0496117_0015041 3300048920 Bacteria 6628
820 Ga0496118_0000077 3300048921 Bacteria 192298
821 Ga0496118_0000080 3300048921 Bacteria 189201
822 Ga0496118_0003332 3300048921 Bacteria 20326
823 Ga0496118_0013982 3300048921 Bacteria 7539
824 Ga0496118_0031034 3300048921 Bacteria 4443
825 Ga0496118_0041709 3300048921 Bacteria 3629
826 Ga0496119_0001213 3300048922 Bacteria 32201
827 Ga0496119_0008938 3300048922 Bacteria 8700
828 Ga0496119_0052767 3300048922 Bacteria 2488
829 Ga0496120_0001109 3300048923 Bacteria 35064
830 Ga0496121_0001230 3300048924 Bacteria 44601
831 Ga0496121_0001994 3300048924 Bacteria 32423
832 Ga0496121_0002144 3300048924 Bacteria 30983
833 Ga0496121_0002478 3300048924 Bacteria 28115
834 Ga0496121_0003590 3300048924 Bacteria 21898
835 Ga0496121_0006338 3300048924 Bacteria 14748
836 Ga0496121_0089230 3300048924 Bacteria 2415
837 Ga0496122_0000018 3300048925 Bacteria 426350
838 Ga0496122_0000147 3300048925 Bacteria 165589
839 Ga0496122_0002719 3300048925 Bacteria 24543
840 Ga0496122_0002984 3300048925 Bacteria 23033
841 Ga0496122_0004287 3300048925 Bacteria 17866
842 Ga0496122_0011451 3300048925 Bacteria 8977
843 Ga0496122_0011913 3300048925 Bacteria 8732
844 Ga0496122_0017578 3300048925 Bacteria 6674
845 Ga0496122_0088083 3300048925 Bacteria 2130
846 Ga0496122_0096638 3300048925 Bacteria 1991
847 Ga0496123_0000015 3300048926 Bacteria 426088
848 Ga0496123_0000158 3300048926 Bacteria 136078
849 Ga0496123_0002233 3300048926 Bacteria 24544
850 Ga0496123_0009579 3300048926 Bacteria 8700
851 Ga0496123_0020668 3300048926 Bacteria 5144
852 Ga0496123_0020817 3300048926 Bacteria 5117
853 Ga0496123_0060977 3300048926 Bacteria 2428
854 Ga0496123_0074867 3300048926 Bacteria 2093
855 Ga0496124_0000050 3300048927 Bacteria 258041
856 Ga0496124_0000093 3300048927 Bacteria 189201
857 Ga0496124_0000703 3300048927 Bacteria 54743
858 Ga0496124_0001819 3300048927 Bacteria 29505
859 Ga0496124_0046920 3300048927 Bacteria 3698
860 Ga0496124_0053549 3300048927 Bacteria 3419
861 Ga0496124_0109096 3300048927 Bacteria 2231
862 Ga0496125_0000114 3300048928 Bacteria 182012
863 Ga0496125_0002943 3300048928 Bacteria 21430
864 Ga0496125_0051834 3300048928 Bacteria 3380
865 Ga0496126_0000113 3300048929 Bacteria 192212
866 Ga0496126_0000195 3300048929 Bacteria 135582
867 Ga0496126_0000294 3300048929 Bacteria 106327
868 Ga0496126_0014568 3300048929 Bacteria 7942
869 Ga0496126_0018207 3300048929 Bacteria 6970
870 Ga0496126_0055342 3300048929 Bacteria 3590
871 Ga0496126_0055898 3300048929 Bacteria 3569
872 Ga0496126_0093366 3300048929 Bacteria 2642
873 Ga0496126_0122718 3300048929 Bacteria 2251
874 Ga0495682_0010402 3300049460 Bacteria 3605
875 Ga0501292_000117 3300049515 Bacteria 14110
876 Ga0501294_000670 3300049517 Bacteria 3854
877 Ga0501032_0003709 3300049569 Bacteria 11594
878 Ga0501033_0011114 3300049570 Bacteria 6897
879 Ga0501033_0110784 3300049570 Bacteria 1998
880 Ga0501033_0133467 3300049570 Bacteria 1797
881 Ga0501034_0002130 3300049571 Bacteria 24593
882 Ga0501034_0035340 3300049571 Bacteria 5066
883 Ga0501034_0236801 3300049571 Bacteria 1773
884 Ga0501036_0052198 3300049572 Bacteria 3462
885 Ga0501037_0010333 3300049573 Bacteria 6848
886 Ga0501037_0017394 3300049573 Bacteria 5295
887 Ga0501038_0000423 3300049574 Bacteria 36823
888 Ga0501038_0059572 3300049574 Bacteria 3270
889 Ga0501038_0280500 3300049574 Bacteria 1312
890 Ga0501039_0000228 3300049575 Bacteria 40749
891 Ga0501040_0000401 3300049576 Bacteria 25582
892 Ga0501041_0000068 3300049577 Bacteria 39067
893 Ga0501042_0000225 3300049578 Bacteria 27025
894 Ga0501042_0004646 3300049578 Bacteria 8764
895 Ga0501043_0006877 3300049579 Bacteria 9077
896 Ga0501043_0026913 3300049579 Bacteria 4513
897 Ga0501043_0058007 3300049579 Bacteria 3039
898 Ga0501043_0058400 3300049579 Unclassified 3028
899 Ga0501046_0047770 3300049580 Bacteria 3392
900 Ga0501046_0064267 3300049580 Bacteria 2865
901 Ga0501047_0015644 3300049581 Bacteria 7228
902 Ga0501048_0033352 3300049582 Bacteria 3719
903 Ga0501068_0006265 3300049584 Bacteria 6547
904 Ga0501068_0057140 3300049584 Bacteria 2365
905 Ga0501068_0090858 3300049584 Bacteria 1884
906 Ga0501071_0000943 3300049587 Bacteria 15815
907 Ga0501071_0041124 3300049587 Unclassified 3310
908 Ga0501072_0000133 3300049588 Bacteria 55596
909 Ga0501073_0008046 3300049589 Bacteria 7827
910 Ga0501074_0040848 3300049590 Unclassified 3358
911 Ga0501075_0000065 3300049591 Bacteria 46049
912 Ga0501075_0003810 3300049591 Bacteria 10148
913 Ga0501075_0006150 3300049591 Bacteria 8252
914 Ga0501075_0029149 3300049591 Bacteria 4080
915 Ga0501076_0000120 3300049592 Bacteria 43155
916 Ga0501076_0010487 3300049592 Bacteria 6878
917 Ga0501076_0073841 3300049592 Unclassified 2731
918 Ga0501077_0000108 3300049593 Bacteria 43917
919 Ga0501222_001581 3300049662 Bacteria 3166
920 Ga0501223_000025 3300049663 Bacteria 58092
921 Ga0501223_000367 3300049663 Bacteria 11110
922 Ga0501224_000028 3300049664 Bacteria 53596
923 Ga0501233_000183 3300049668 Bacteria 9154
924 Ga0501249_001102 3300049679 Bacteria 5711
925 Ga0501257_002893 3300049686 Bacteria 3640
926 Ga0501261_000498 3300049690 Bacteria 5028
927 Ga0501225_0000842 3300049705 Bacteria 9554
928 Ga0501225_0001033 3300049705 Bacteria 8731
929 Ga0501079_0003036 3300049741 Bacteria 12287
930 Ga0501079_0007424 3300049741 Bacteria 8295
931 Ga0501080_0003323 3300049742 Bacteria 14193
932 Ga0501081_0000705 3300049743 Bacteria 19322
933 Ga0501081_0031876 3300049743 Unclassified 3573
934 Ga0501083_0009775 3300049744 Bacteria 6772
935 Ga0501241_001834 3300049758 Bacteria 4185
936 Ga0501279_000004 3300049775 Bacteria 175612
937 Ga0501280_000014 3300049776 Bacteria 57720
938 Ga0501281_00189 3300049777 Bacteria 7123
939 Ga0501035_0044401 3300049822 Bacteria 4002
940 Ga0501035_0075331 3300049822 Unclassified 2985
941 Ga0501035_0118966 3300049822 Bacteria 2311
942 Ga0501035_0140319 3300049822 Bacteria 2101
943 Ga0501044_0026843 3300049823 Bacteria 6095
944 Ga0501044_0040197 3300049823 Bacteria 4875
945 Ga0501044_0102020 3300049823 Bacteria 2886
946 Ga0501045_0000389 3300049824 Bacteria 26607
947 Ga0501226_000191 3300049853 Bacteria 9822
948 nmdc:mga03683_6454_c1 3300050489 Bacteria 4017
949 nmdc:mga0yw44_12216_c1 3300050492 Bacteria 4467
950 nmdc:mga0k408_16763_c1 3300050493 Bacteria 4071
951 nmdc:mga06z11_195_c1 3300050494 Bacteria 24343
952 nmdc:mga04h51_420_c1 3300050495 Bacteria 10192
953 nmdc:mga07m45_6743_c1 3300050496 Bacteria 5827
954 nmdc:mga05p37_21251_c1 3300050507 Bacteria 7857
955 nmdc:mga05p37_32544_c1 3300050507 Bacteria 6378
956 nmdc:mga05p37_446694_c1 3300050507 Bacteria 1498
957 nmdc:mga08y16_11558_c1 3300050511 Bacteria 9280
958 nmdc:mga08y16_1414_c1 3300050511 Bacteria 24082
959 nmdc:mga0n895_45942_c1 3300050512 Bacteria 4264
960 nmdc:mga0rr50_50701_c1 3300050513 Bacteria 3076
961 nmdc:mga08x19_95_c1 3300050514 Bacteria 78182
962 nmdc:mga0a205_18078_c1 3300050515 Bacteria 6623
963 nmdc:mga0a205_276294_c1 3300050515 Bacteria 1556
964 nmdc:mga0a205_41220_c1 3300050515 Bacteria 4446
965 nmdc:mga0sz30_40997_c1 3300050516 Bacteria 1946
966 Ga0495612_0000632 3300053078 Bacteria 14129
967 Ga0500610_0000364 3300053079 Bacteria 13658
968 Ga0500610_0025760 3300053079 Bacteria 2937
969 Ga0495619_0015018 3300053085 Bacteria 4894
970 Ga0500643_000093 3300053087 Bacteria 93451
971 Ga0500643_000135 3300053087 Bacteria 74911
972 Ga0500643_000606 3300053087 Bacteria 24434
973 Ga0500643_001944 3300053087 Bacteria 11194
974 Ga0500643_003937 3300053087 Bacteria 6884
975 Ga0500643_025214 3300053087 Bacteria 1878
976 Ga0500566_0000696 3300053094 Bacteria 18967
977 Ga0500555_003899 3300053103 Bacteria 4243
978 Ga0500556_0000197 3300053104 Bacteria 49633
979 Ga0500557_000292 3300053105 Bacteria 6735
980 Ga0500562_011252 3300053108 Bacteria 2271
981 Ga0500569_014218 3300053109 Bacteria 1965
982 Ga0500592_000056 3300053116 Bacteria 31914
983 Ga0500592_001060 3300053116 Bacteria 4499
984 Ga0500595_002230 3300053119 Bacteria 9841
985 Ga0500595_002716 3300053119 Bacteria 8574
986 Ga0500597_023742 3300053120 Bacteria 2454
987 Ga0500607_003805 3300053121 Bacteria 10780
988 Ga0500618_002112 3300053125 Bacteria 7866
989 Ga0500642_0000011 3300053130 Bacteria 215963
990 Ga0500642_0013377 3300053130 Bacteria 3013
991 Ga0500658_0001519 3300053134 Bacteria 9303
992 Ga0500658_0005819 3300053134 Bacteria 4592
993 Ga0500658_0010069 3300053134 Bacteria 3489
994 Ga0500559_0007673 3300053136 Bacteria 4764
995 Ga0500559_0017644 3300053136 Bacteria 3015
996 Ga0500559_0044993 3300053136 Bacteria 1931
997 Ga0500564_006756 3300053138 Bacteria 4810
998 Ga0500568_0001075 3300053139 Bacteria 18488
999 Ga0500568_0048447 3300053139 Bacteria 1680
1000 Ga0500590_002666 3300053148 Bacteria 8015
1001 Ga0500616_0009045 3300053153 Bacteria 6098
1002 Ga0500616_0017475 3300053153 Bacteria 4068
1003 Ga0500616_0041719 3300053153 Bacteria 2460
1004 Ga0500616_0072211 3300053153 Bacteria 1755
1005 Ga0500622_0061457 3300053156 Bacteria 1915
1006 Ga0500622_0105632 3300053156 Bacteria 1381
1007 Ga0500624_000024 3300053157 Bacteria 114404
1008 Ga0500624_000062 3300053157 Bacteria 66317
1009 Ga0500624_000105 3300053157 Bacteria 40162
1010 Ga0500627_0000844 3300053158 Bacteria 8195
1011 Ga0500627_0000889 3300053158 Bacteria 8007
1012 Ga0500627_0011244 3300053158 Bacteria 3296
1013 Ga0500636_0003773 3300053177 Bacteria 8558
1014 Ga0500636_0034004 3300053177 Bacteria 3016
1015 Ga0500637_0000692 3300053178 Bacteria 13419
1016 Ga0500567_009748 3300053723 Bacteria 4580
1017 Ga0500611_004434 3300053727 Bacteria 1894
1018 Ga0500625_000039 3300053729 Bacteria 43868
1019 Ga0500645_000134 3300053730 Bacteria 58275
1020 Ga0500645_000767 3300053730 Bacteria 19511
1021 Ga0500596_005462 3300053735 Bacteria 2233
1022 Ga0501084_0003536 3300054114 Bacteria 12682
1023 Ga0590071_004250 3300059421 Bacteria 3486
1024 Ga0590075_001519 3300059424 Bacteria 5778
1025 Ga0501082_0001005 3300060353 Bacteria 24909
1026 Ga0501082_0060529 3300060353 Bacteria 3260
1027 Ga0501082_0199736 3300060353 Bacteria 1740
1028 Ga0530510_0000050 3300061734 Bacteria 55919
1029 Ga0530510_0122252 3300061734 Bacteria 1911

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0280500 Ga0501038_0280500_218_1291 354
2 3300035118 Ga0373954_0101270 Ga0373954_0101270_240_1352 365
3 3300035170 Ga0373943_0081973 Ga0373943_0081973_478_1590 366
4 3300035695 Ga0373927_0156870 Ga0373927_0156870_85_1197 366
5 iso_pu_bacteria 2967671571 2967673812 375
6 iso_pu_bacteria 2970019648 2970021648 375
7 3300003762 Ga0055542_1000025 Ga0055542_1000025199 377
8 3300003763 Ga0055529_1000014 Ga0055529_100001454 377
9 3300025254 Ga0209148_1000011 Ga0209148_100001155 377
10 3300025272 Ga0209455_1000006 Ga0209455_10000061139 377
11 3300025986 Ga0207658_10045858 Ga0207658_100458584 379
12 3300049822 Ga0501035_0140319 Ga0501035_0140319_47_1210 383
13 3300009148 Ga0105243_10000033 Ga0105243_1000003340 385
14 3300025935 Ga0207709_10000059 Ga0207709_10000059212 385
15 3300048925 Ga0496122_0011913 Ga0496122_0011913_6042_7373 389
16 3300048926 Ga0496123_0020817 Ga0496123_0020817_1550_2881 389
17 3300048928 Ga0496125_0000114 Ga0496125_0000114_6369_7700 389
18 3300005339 Ga0070660_100108019 Ga0070660_1001080192 390
19 3300005366 Ga0070659_100041111 Ga0070659_1000411113 390
20 3300005435 Ga0070714_100078232 Ga0070714_1000782323 390
21 3300025919 Ga0207657_10105879 Ga0207657_101058792 390
22 3300025932 Ga0207690_10010856 Ga0207690_100108563 390
23 3300025949 Ga0207667_10020324 Ga0207667_100203246 390
24 3300035083 Ga0373926_0012290 Ga0373926_0012290_1089_2288 390
25 3300035113 Ga0373936_0042425 Ga0373936_0042425_192_1391 390
26 3300035170 Ga0373943_0004815 Ga0373943_0004815_1763_2962 390
27 3300035692 Ga0373935_0004136 Ga0373935_0004136_3619_4818 390
28 3300035695 Ga0373927_0013012 Ga0373927_0013012_2596_3795 390
29 3300037068 Ga0373925_0002642 Ga0373925_0002642_5842_7041 390
30 3300046472 Ga0495580_0017783 Ga0495580_0017783_3650_4849 390
31 3300046473 Ga0495582_0042330 Ga0495582_0042330_855_2054 390
32 3300046475 Ga0495639_0000789 Ga0495639_0000789_9136_10335 390
33 3300046517 Ga0495630_0012981 Ga0495630_0012981_2076_3275 390
34 3300046524 Ga0495648_0000147 Ga0495648_0000147_77128_78459 390
35 3300046531 Ga0495665_0001769 Ga0495665_0001769_7668_8867 390
36 3300046674 Ga0495588_0005144 Ga0495588_0005144_4266_5465 390
37 3300046683 Ga0495658_0002931 Ga0495658_0002931_3682_4881 390
38 3300046689 Ga0495613_0025023 Ga0495613_0025023_2619_3818 390
39 3300047315 Ga0495581_0007959 Ga0495581_0007959_3819_5018 390
40 3300047673 Ga0495593_0002299 Ga0495593_0002299_2731_3930 390
41 3300048089 Ga0495614_0002616 Ga0495614_0002616_4078_5277 390
42 3300047443 Ga0495687_000045 Ga0495687_000045_208424_209755 394
43 3300039438 Ga0436360_1255809 Ga0436360_1255809_623_1858 395
44 3300013308 Ga0157375_10065252 Ga0157375_100652523 400
45 3300053735 Ga0500596_005462 Ga0500596_005462_99_1430 400
46 3300004800 Ga0058861_12061624 Ga0058861_120616241 402
47 3300005327 Ga0070658_10014420 Ga0070658_100144206 402
48 3300005366 Ga0070659_100119598 Ga0070659_1001195982 402
49 3300025909 Ga0207705_10016169 Ga0207705_100161694 402
50 3300025932 Ga0207690_10087993 Ga0207690_100879932 402
51 3300036401 Ga0373937_0110922 Ga0373937_0110922_490_1779 402
52 3300046454 Ga0495592_0096045 Ga0495592_0096045_746_2035 402
53 3300046678 Ga0495599_0093830 Ga0495599_0093830_160_1449 402
54 3300046558 Ga0495633_0073505 Ga0495633_0073505_359_1579 404
55 3300006038 Ga0075365_10074003 Ga0075365_100740032 405
56 3300005331 Ga0070670_100044213 Ga0070670_1000442132 406
57 3300005367 Ga0070667_100122428 Ga0070667_1001224283 406
58 3300048911 Ga0496108_0045490 Ga0496108_0045490_1426_2745 406
59 3300048912 Ga0496109_0056144 Ga0496109_0056144_745_2064 406
60 3300048913 Ga0496110_0038618 Ga0496110_0038618_1930_3249 406
61 3300048915 Ga0496112_0175508 Ga0496112_0175508_526_1845 406
62 3300048916 Ga0496113_0023903 Ga0496113_0023903_1792_3111 406
63 3300048928 Ga0496125_0051834 Ga0496125_0051834_688_2007 406
64 3300005842 Ga0068858_100014160 Ga0068858_1000141605 408
65 3300025972 Ga0207668_10109414 Ga0207668_101094142 408
66 3300036401 Ga0373937_0144920 Ga0373937_0144920_24_1259 408
67 3300005347 Ga0070668_100000197 Ga0070668_10000019737 409
68 3300005355 Ga0070671_100000482 Ga0070671_10000048227 409
69 3300005548 Ga0070665_100241459 Ga0070665_1002414592 409
70 3300005719 Ga0068861_100010221 Ga0068861_1000102213 409
71 3300005841 Ga0068863_100027387 Ga0068863_1000273874 409
72 3300005844 Ga0068862_100017500 Ga0068862_1000175003 409
73 3300013104 Ga0157370_10049403 Ga0157370_100494032 409
74 3300025941 Ga0207711_10268308 Ga0207711_102683081 409
75 3300026088 Ga0207641_10000115 Ga0207641_1000011580 409
76 3300026088 Ga0207641_10008887 Ga0207641_1000888711 409
77 3300026095 Ga0207676_10005994 Ga0207676_100059946 409
78 3300026118 Ga0207675_100028656 Ga0207675_1000286564 409
79 3300002459 JGI24751J29686_10000235 JGI24751J29686_1000023511 410
80 3300032126 Ga0307415_100159691 Ga0307415_1001596913 410
81 3300045049 Ga0466959_0019769 Ga0466959_0019769_2475_3710 410
82 3300046499 Ga0495594_0015378 Ga0495594_0015378_1188_2453 410
83 3300046506 Ga0495583_0000038 Ga0495583_0000038_186167_187405 410
84 3300046665 Ga0495661_0070079 Ga0495661_0070079_610_1848 410
85 3300047320 Ga0495672_0007359 Ga0495672_0007359_4821_6080 410
86 3300053103 Ga0500555_003899 Ga0500555_003899_461_1699 410
87 3300053108 Ga0500562_011252 Ga0500562_011252_323_1570 410
88 3300009147 Ga0114129_10524881 Ga0114129_105248812 412
89 3300025304 Ga0209257_1018206 Ga0209257_10182063 412
90 3300005330 Ga0070690_100000483 Ga0070690_1000004835 414
91 3300005331 Ga0070670_100004278 Ga0070670_1000042782 414
92 3300005338 Ga0068868_100002423 Ga0068868_1000024238 414
93 3300005355 Ga0070671_100032053 Ga0070671_1000320532 414
94 3300005364 Ga0070673_100010149 Ga0070673_1000101493 414
95 3300005367 Ga0070667_100012637 Ga0070667_1000126374 414
96 3300005618 Ga0068864_100003187 Ga0068864_1000031873 414
97 3300005841 Ga0068863_100055600 Ga0068863_1000556003 414
98 3300006358 Ga0068871_100024042 Ga0068871_1000240425 414
99 3300009177 Ga0105248_10008690 Ga0105248_1000869013 414
100 3300011119 Ga0105246_10116683 Ga0105246_101166832 414
101 3300013306 Ga0163162_10013689 Ga0163162_100136897 414
102 3300013308 Ga0157375_10006186 Ga0157375_100061862 414
103 3300014325 Ga0163163_10022274 Ga0163163_100222746 414
104 3300025925 Ga0207650_10002138 Ga0207650_100021388 414
105 3300025931 Ga0207644_10017956 Ga0207644_100179566 414
106 3300025941 Ga0207711_10011653 Ga0207711_100116536 414
107 3300025945 Ga0207679_10017290 Ga0207679_100172904 414
108 3300025960 Ga0207651_10059026 Ga0207651_100590264 414
109 3300026023 Ga0207677_10002920 Ga0207677_100029204 414
110 3300026088 Ga0207641_10033804 Ga0207641_100338043 414
111 3300033180 Ga0307510_10052621 Ga0307510_100526214 415
112 3300041413 Ga0439465_0010080 Ga0439465_0010080_1005_2378 415
113 3300005336 Ga0070680_100169761 Ga0070680_1001697612 416
114 3300025912 Ga0207707_10160961 Ga0207707_101609612 416
115 3300053085 Ga0495619_0015018 Ga0495619_0015018_1982_3316 416
116 3300059421 Ga0590071_004250 Ga0590071_004250_1095_2378 416
117 3300059424 Ga0590075_001519 Ga0590075_001519_2172_3455 416
118 3300005295 Ga0065707_10084641 Ga0065707_100846412 417
119 3300006846 Ga0075430_100151222 Ga0075430_1001512222 417
120 3300006847 Ga0075431_100004735 Ga0075431_1000047355 417
121 3300006847 Ga0075431_100014844 Ga0075431_1000148445 417
122 3300006852 Ga0075433_10031628 Ga0075433_100316284 417
123 3300009147 Ga0114129_10001654 Ga0114129_100016548 417
124 3300009147 Ga0114129_10026011 Ga0114129_100260115 417
125 3300009147 Ga0114129_10034137 Ga0114129_100341374 417
126 3300009147 Ga0114129_10443639 Ga0114129_104436392 417
127 3300013306 Ga0163162_10005593 Ga0163162_100055932 417
128 3300025922 Ga0207646_10046513 Ga0207646_100465131 417
129 3300025933 Ga0207706_10141341 Ga0207706_101413412 417
130 3300026121 Ga0207683_10020489 Ga0207683_100204893 417
131 3300027876 Ga0209974_10004804 Ga0209974_100048042 417
132 3300031456 Ga0307513_10109370 Ga0307513_101093702 417
133 3300031901 Ga0307406_10176625 Ga0307406_101766251 417
134 3300035725 Ga0373947_0016497 Ga0373947_0016497_1562_2848 417
135 3300037068 Ga0373925_0131705 Ga0373925_0131705_348_1634 417
136 3300045051 Ga0451576_0032757 Ga0451576_0032757_3872_5158 417
137 3300049569 Ga0501032_0003709 Ga0501032_0003709_3049_4335 417
138 3300049570 Ga0501033_0011114 Ga0501033_0011114_4550_5836 417
139 3300049572 Ga0501036_0052198 Ga0501036_0052198_168_1454 417
140 3300049573 Ga0501037_0010333 Ga0501037_0010333_1482_2768 417
141 3300049573 Ga0501037_0017394 Ga0501037_0017394_1982_3268 417
142 3300049574 Ga0501038_0000423 Ga0501038_0000423_25517_26803 417
143 3300049574 Ga0501038_0059572 Ga0501038_0059572_519_1805 417
144 3300049575 Ga0501039_0000228 Ga0501039_0000228_8842_10128 417
145 3300049576 Ga0501040_0000401 Ga0501040_0000401_13550_14836 417
146 3300049577 Ga0501041_0000068 Ga0501041_0000068_30310_31596 417
147 3300049578 Ga0501042_0000225 Ga0501042_0000225_2229_3515 417
148 3300049578 Ga0501042_0004646 Ga0501042_0004646_2960_4246 417
149 3300049579 Ga0501043_0006877 Ga0501043_0006877_6900_8186 417
150 3300049579 Ga0501043_0058400 Ga0501043_0058400_1642_2928 417
151 3300049580 Ga0501046_0047770 Ga0501046_0047770_893_2179 417
152 3300049582 Ga0501048_0033352 Ga0501048_0033352_391_1677 417
153 3300049584 Ga0501068_0006265 Ga0501068_0006265_2351_3637 417
154 3300049584 Ga0501068_0057140 Ga0501068_0057140_796_2082 417
155 3300049584 Ga0501068_0090858 Ga0501068_0090858_136_1431 417
156 3300049587 Ga0501071_0000943 Ga0501071_0000943_2081_3367 417
157 3300049587 Ga0501071_0041124 Ga0501071_0041124_146_1468 417
158 3300049588 Ga0501072_0000133 Ga0501072_0000133_10240_11526 417
159 3300049589 Ga0501073_0008046 Ga0501073_0008046_5110_6396 417
160 3300049590 Ga0501074_0040848 Ga0501074_0040848_2003_3289 417
161 3300049591 Ga0501075_0000065 Ga0501075_0000065_30649_31935 417
162 3300049591 Ga0501075_0003810 Ga0501075_0003810_5398_6693 417
163 3300049591 Ga0501075_0006150 Ga0501075_0006150_3021_4343 417
164 3300049591 Ga0501075_0029149 Ga0501075_0029149_2075_3361 417
165 3300049592 Ga0501076_0000120 Ga0501076_0000120_8828_10114 417
166 3300049592 Ga0501076_0010487 Ga0501076_0010487_608_1903 417
167 3300049592 Ga0501076_0073841 Ga0501076_0073841_959_2281 417
168 3300049593 Ga0501077_0000108 Ga0501077_0000108_13396_14682 417
169 3300049741 Ga0501079_0003036 Ga0501079_0003036_7472_8758 417
170 3300049741 Ga0501079_0007424 Ga0501079_0007424_3650_4945 417
171 3300049742 Ga0501080_0003323 Ga0501080_0003323_10420_11706 417
172 3300049743 Ga0501081_0000705 Ga0501081_0000705_8842_10128 417
173 3300049743 Ga0501081_0031876 Ga0501081_0031876_1345_2667 417
174 3300049744 Ga0501083_0009775 Ga0501083_0009775_1514_2800 417
175 3300049822 Ga0501035_0044401 Ga0501035_0044401_2009_3295 417
176 3300049822 Ga0501035_0075331 Ga0501035_0075331_1191_2477 417
177 3300049823 Ga0501044_0026843 Ga0501044_0026843_2458_3744 417
178 3300049824 Ga0501045_0000389 Ga0501045_0000389_5492_6778 417
179 3300050507 nmdc:mga05p37_21251_c1 nmdc:mga05p37_21251_c1_2408_3694 417
180 3300050507 nmdc:mga05p37_32544_c1 nmdc:mga05p37_32544_c1_4644_5930 417
181 3300050507 nmdc:mga05p37_446694_c1 nmdc:mga05p37_446694_c1_105_1391 417
182 3300050511 nmdc:mga08y16_11558_c1 nmdc:mga08y16_11558_c1_3650_4939 417
183 3300050515 nmdc:mga0a205_18078_c1 nmdc:mga0a205_18078_c1_485_1771 417
184 3300050515 nmdc:mga0a205_276294_c1 nmdc:mga0a205_276294_c1_231_1517 417
185 3300050515 nmdc:mga0a205_41220_c1 nmdc:mga0a205_41220_c1_1195_2481 417
186 3300054114 Ga0501084_0003536 Ga0501084_0003536_9195_10481 417
187 3300060353 Ga0501082_0001005 Ga0501082_0001005_20295_21581 417
188 3300060353 Ga0501082_0060529 Ga0501082_0060529_879_2174 417
189 3300060353 Ga0501082_0199736 Ga0501082_0199736_65_1387 417
190 3300061734 Ga0530510_0000050 Ga0530510_0000050_44394_45680 417
191 3300061734 Ga0530510_0122252 Ga0530510_0122252_519_1805 417
192 3300005328 Ga0070676_10003672 Ga0070676_100036723 418
193 3300005330 Ga0070690_100014932 Ga0070690_1000149324 418
194 3300005335 Ga0070666_10001625 Ga0070666_100016258 418
195 3300005340 Ga0070689_100043036 Ga0070689_1000430364 418
196 3300005340 Ga0070689_100095475 Ga0070689_1000954752 418
197 3300005354 Ga0070675_100007844 Ga0070675_1000078444 418
198 3300005356 Ga0070674_100010775 Ga0070674_1000107752 418
199 3300005364 Ga0070673_100000138 Ga0070673_1000001389 418
200 3300005366 Ga0070659_100097236 Ga0070659_1000972362 418
201 3300005456 Ga0070678_100001464 Ga0070678_1000014645 418
202 3300005536 Ga0070697_100097945 Ga0070697_1000979453 418
203 3300005543 Ga0070672_100005400 Ga0070672_1000054003 418
204 3300005564 Ga0070664_100021787 Ga0070664_1000217874 418
205 3300005616 Ga0068852_100165021 Ga0068852_1001650212 418
206 3300005983 Ga0081540_1009297 Ga0081540_10092977 418
207 3300006237 Ga0097621_100013780 Ga0097621_1000137803 418
208 3300006358 Ga0068871_100008468 Ga0068871_1000084682 418
209 3300009094 Ga0111539_10000890 Ga0111539_100008909 418
210 3300013308 Ga0157375_10002592 Ga0157375_100025929 418
211 3300014969 Ga0157376_10000903 Ga0157376_1000090314 418
212 3300025893 Ga0207682_10011989 Ga0207682_100119891 418
213 3300025903 Ga0207680_10025252 Ga0207680_100252523 418
214 3300025907 Ga0207645_10002209 Ga0207645_100022097 418
215 3300025925 Ga0207650_10027164 Ga0207650_100271644 418
216 3300025926 Ga0207659_10002827 Ga0207659_100028279 418
217 3300025932 Ga0207690_10148204 Ga0207690_101482042 418
218 3300025933 Ga0207706_10009415 Ga0207706_100094154 418
219 3300025940 Ga0207691_10000019 Ga0207691_100000199 418
220 3300025945 Ga0207679_10067410 Ga0207679_100674103 418
221 3300025960 Ga0207651_10001213 Ga0207651_100012132 418
222 3300026116 Ga0207674_10086805 Ga0207674_100868054 418
223 3300026121 Ga0207683_10002984 Ga0207683_100029847 418
224 3300026142 Ga0207698_10274655 Ga0207698_102746551 418
225 3300027907 Ga0207428_10047662 Ga0207428_100476621 418
226 3300031548 Ga0307408_100134083 Ga0307408_1001340833 418
227 3300031903 Ga0307407_10019922 Ga0307407_100199222 418
228 3300031995 Ga0307409_100106263 Ga0307409_1001062633 418
229 3300048907 Ga0496104_0109404 Ga0496104_0109404_380_1699 418
230 3300048908 Ga0496105_0079109 Ga0496105_0079109_283_1602 418
231 3300048917 Ga0496114_0003386 Ga0496114_0003386_6794_8113 418
232 3300050511 nmdc:mga08y16_1414_c1 nmdc:mga08y16_1414_c1_13097_14416 418
233 3300046525 Ga0495663_0010363 Ga0495663_0010363_1031_2365 420
234 3300053116 Ga0500592_001060 Ga0500592_001060_1174_2508 420
235 3300053139 Ga0500568_0048447 Ga0500568_0048447_213_1547 420
236 3300053727 Ga0500611_004434 Ga0500611_004434_439_1773 420
237 3300009553 Ga0105249_10000103 Ga0105249_1000010352 422
238 3300013297 Ga0157378_10137652 Ga0157378_101376521 422
239 3300046530 Ga0495654_0010002 Ga0495654_0010002_2652_3923 422
240 3300046616 Ga0495668_0028910 Ga0495668_0028910_680_1951 422
241 3300046794 Ga0495589_0011649 Ga0495589_0011649_1298_2569 422
242 3300048905 Ga0496102_0000043 Ga0496102_0000043_184714_185985 422
243 3300048906 Ga0496103_0000133 Ga0496103_0000133_3217_4488 422
244 3300048919 Ga0496116_0014376 Ga0496116_0014376_3205_4476 422
245 3300048920 Ga0496117_0000104 Ga0496117_0000104_184714_185985 422
246 3300048921 Ga0496118_0000080 Ga0496118_0000080_3217_4488 422
247 3300048927 Ga0496124_0000093 Ga0496124_0000093_3217_4488 422
248 3300053087 Ga0500643_001944 Ga0500643_001944_1796_3064 422
249 3300053136 Ga0500559_0007673 Ga0500559_0007673_1689_2957 422
250 3300053158 Ga0500627_0000889 Ga0500627_0000889_5293_6564 422
251 3300053094 Ga0500566_0000696 Ga0500566_0000696_1533_2810 425
252 3300039438 Ga0436360_0036174 Ga0436360_0036174_1302_2591 426
253 3300005327 Ga0070658_10000033 Ga0070658_1000003366 427
254 3300005339 Ga0070660_100000225 Ga0070660_1000002254 427
255 3300005345 Ga0070692_10005729 Ga0070692_100057292 427
256 3300005366 Ga0070659_100023655 Ga0070659_1000236556 427
257 3300005439 Ga0070711_100033038 Ga0070711_1000330382 427
258 3300005614 Ga0068856_100171757 Ga0068856_1001717571 427
259 3300006028 Ga0070717_10193808 Ga0070717_101938082 427
260 3300013105 Ga0157369_10030829 Ga0157369_100308295 427
261 3300021384 Ga0213876_10000310 Ga0213876_1000031039 427
262 3300025909 Ga0207705_10000002 Ga0207705_100000021950 427
263 3300025928 Ga0207700_10034972 Ga0207700_100349723 427
264 3300025932 Ga0207690_10013890 Ga0207690_100138906 427
265 3300025932 Ga0207690_10142117 Ga0207690_101421172 427
266 3300035118 Ga0373954_0006557 Ga0373954_0006557_3016_4350 427
267 3300035120 Ga0373957_0005881 Ga0373957_0005881_939_2273 427
268 3300035170 Ga0373943_0046767 Ga0373943_0046767_725_2059 427
269 3300035692 Ga0373935_0025842 Ga0373935_0025842_235_1569 427
270 3300035724 Ga0373933_0014844 Ga0373933_0014844_1551_2885 427
271 3300035725 Ga0373947_0086858 Ga0373947_0086858_429_1763 427
272 3300036401 Ga0373937_0004279 Ga0373937_0004279_6118_7452 427
273 3300036401 Ga0373937_0027529 Ga0373937_0027529_2890_4224 427
274 3300037068 Ga0373925_0038558 Ga0373925_0038558_899_2233 427
275 3300039437 Ga0436365_1654841 Ga0436365_1654841_8341_9651 427
276 3300046477 Ga0495664_0007587 Ga0495664_0007587_2522_3856 427
277 3300046543 Ga0495645_0003119 Ga0495645_0003119_2165_3499 427
278 3300046559 Ga0495667_0008176 Ga0495667_0008176_3266_4579 427
279 3300046559 Ga0495667_0025775 Ga0495667_0025775_2606_3940 427
280 3300046691 Ga0495670_0028758 Ga0495670_0028758_336_1634 427
281 3300047317 Ga0495604_0048025 Ga0495604_0048025_259_1593 427
282 3300047444 Ga0495675_0034447 Ga0495675_0034447_835_2169 427
283 3300048088 Ga0495602_0003534 Ga0495602_0003534_9134_10468 427
284 3300053078 Ga0495612_0000632 Ga0495612_0000632_4619_5953 427
285 3300005841 Ga0068863_100173781 Ga0068863_1001737812 428
286 3300048929 Ga0496126_0122718 Ga0496126_0122718_853_2148 428
287 3300005985 Ga0081539_10006765 Ga0081539_100067653 430
288 3300017792 Ga0163161_10038310 Ga0163161_100383104 430
289 3300046522 Ga0495643_0031010 Ga0495643_0031010_1021_2388 430
290 3300047469 Ga0495673_0041921 Ga0495673_0041921_616_1947 430
291 3300048926 Ga0496123_0060977 Ga0496123_0060977_395_1747 430
292 3300048927 Ga0496124_0053549 Ga0496124_0053549_1402_2754 430
293 3300053130 Ga0500642_0013377 Ga0500642_0013377_1085_2416 430
294 3300031824 Ga0307413_10053302 Ga0307413_100533023 431
295 3300053153 Ga0500616_0041719 Ga0500616_0041719_422_1750 431
296 iso_pu_bacteria 2643221618 2644103793 431
297 iso_pu_bacteria 2643221626 2644144674 431
298 iso_pu_bacteria 2643221655 2644306723 431
299 iso_pu_bacteria 2643221659 2644330914 431
300 iso_pu_bacteria 2643221698 2644541133 431
301 iso_pu_bacteria 2643221712 2644612334 431
302 iso_pu_bacteria 2671180139 2671693757 431
303 iso_pu_bacteria 2844163670 2844164740 431
304 3300002704 JGI25155J39150_1000069 JGI25155J39150_10000695 432
305 3300002705 JGI25156J39149_1000095 JGI25156J39149_10000955 432
306 3300002738 JGI25154J39366_1000866 JGI25154J39366_100086612 432
307 3300002741 JGI25157J39369_1000732 JGI25157J39369_100073215 432
308 3300002987 JGI25159J45721_1003717 JGI25159J45721_10037174 432
309 3300002987 JGI25159J45721_1006593 JGI25159J45721_10065931 432
310 3300003187 JGI25151J46595_10003658 JGI25151J46595_100036583 432
311 3300003187 JGI25151J46595_10007368 JGI25151J46595_100073687 432
312 3300003215 JGI25153J46596_10019462 JGI25153J46596_100194622 432
313 3300003215 JGI25153J46596_10021828 JGI25153J46596_100218281 432
314 3300003354 JGI25160J50197_1000003 JGI25160J50197_100000327 432
315 3300003354 JGI25160J50197_1000287 JGI25160J50197_100028740 432
316 3300003354 JGI25160J50197_1005283 JGI25160J50197_10052837 432
317 3300003374 JGI25161J50226_1000176 JGI25161J50226_10001764 432
318 3300003374 JGI25161J50226_1000299 JGI25161J50226_10002995 432
319 3300003374 JGI25161J50226_1003479 JGI25161J50226_10034793 432
320 3300003771 Ga0055526_1004618 Ga0055526_10046185 432
321 3300003771 Ga0055526_1007837 Ga0055526_10078373 432
322 3300003775 Ga0055524_1006032 Ga0055524_10060328 432
323 3300003775 Ga0055524_1006689 Ga0055524_10066893 432
324 3300003781 Ga0055536_1001996 Ga0055536_10019964 432
325 3300003790 Ga0055528_1018190 Ga0055528_10181902 432
326 3300003791 Ga0055530_10011442 Ga0055530_100114422 432
327 3300003794 Ga0055531_10027395 Ga0055531_100273951 432
328 3300004625 Ga0055543_1000034 Ga0055543_1000034127 432
329 3300004625 Ga0055543_1000114 Ga0055543_100011475 432
330 3300004625 Ga0055543_1001135 Ga0055543_10011358 432
331 3300004799 Ga0058863_11910898 Ga0058863_119108981 432
332 3300004803 Ga0058862_12737959 Ga0058862_127379591 432
333 3300005262 Ga0065165_1000047 Ga0065165_1000047147 432
334 3300005262 Ga0065165_1004051 Ga0065165_10040514 432
335 3300005548 Ga0070665_100049096 Ga0070665_1000490966 432
336 3300005548 Ga0070665_100074881 Ga0070665_1000748813 432
337 3300006038 Ga0075365_10013351 Ga0075365_100133513 432
338 3300006177 Ga0075362_10004292 Ga0075362_100042925 432
339 3300006178 Ga0075367_10012269 Ga0075367_100122692 432
340 3300006186 Ga0075369_10005723 Ga0075369_100057237 432
341 3300006353 Ga0075370_10010246 Ga0075370_100102463 432
342 3300006946 Ga0079104_1000125 Ga0079104_100012589 432
343 3300006946 Ga0079104_1004867 Ga0079104_10048672 432
344 3300006946 Ga0079104_1006152 Ga0079104_10061523 432
345 3300013105 Ga0157369_10097133 Ga0157369_100971334 432
346 3300013249 Ga0171463_1001 Ga0171463_10011255 432
347 3300015690 Ga0183363_1053 Ga0183363_105318 432
348 3300020070 Ga0206356_11309587 Ga0206356_113095871 432
349 3300020080 Ga0206350_11038354 Ga0206350_110383542 432
350 3300020081 Ga0206354_10710180 Ga0206354_107101802 432
351 3300021320 Ga0214544_1000434 Ga0214544_100043437 432
352 3300021321 Ga0214542_1000146 Ga0214542_10001463 432
353 3300021321 Ga0214542_1027236 Ga0214542_10272364 432
354 3300021327 Ga0214543_1000049 Ga0214543_100004934 432
355 3300021327 Ga0214543_1000054 Ga0214543_100005493 432
356 3300022467 Ga0224712_10035483 Ga0224712_100354831 432
357 3300022739 Ga0228711_1000006 Ga0228711_100000644 432
358 3300022740 Ga0228710_1000004 Ga0228710_100000492 432
359 3300025206 Ga0209435_100049 Ga0209435_10004963 432
360 3300025245 Ga0207425_1004457 Ga0207425_10044574 432
361 3300025246 Ga0209646_1000159 Ga0209646_100015963 432
362 3300025250 Ga0209026_1000183 Ga0209026_100018363 432
363 3300025256 Ga0209759_1000206 Ga0209759_100020663 432
364 3300025258 Ga0209129_1006060 Ga0209129_10060604 432
365 3300025273 Ga0209673_1000584 Ga0209673_100058413 432
366 3300025273 Ga0209673_1003724 Ga0209673_10037243 432
367 3300025284 Ga0209130_1000005 Ga0209130_1000005453 432
368 3300025284 Ga0209130_1000642 Ga0209130_100064219 432
369 3300025292 Ga0209676_1001593 Ga0209676_100159310 432
370 3300025294 Ga0209025_1000037 Ga0209025_1000037334 432
371 3300025294 Ga0209025_1000814 Ga0209025_100081438 432
372 3300025294 Ga0209025_1011026 Ga0209025_10110267 432
373 3300025295 Ga0209564_1000113 Ga0209564_1000113143 432
374 3300025295 Ga0209564_1006879 Ga0209564_10068793 432
375 3300025297 Ga0209758_1001197 Ga0209758_10011977 432
376 3300025297 Ga0209758_1004151 Ga0209758_10041513 432
377 3300025298 Ga0209050_1002150 Ga0209050_100215013 432
378 3300025299 Ga0209256_1000819 Ga0209256_100081926 432
379 3300025299 Ga0209256_1002787 Ga0209256_10027873 432
380 3300025299 Ga0209256_1007106 Ga0209256_10071067 432
381 3300025302 Ga0207426_1000015 Ga0207426_1000015146 432
382 3300025302 Ga0207426_1000330 Ga0207426_100033023 432
383 3300025302 Ga0207426_1000812 Ga0207426_10008127 432
384 3300025303 Ga0209051_1009681 Ga0209051_10096813 432
385 3300025304 Ga0209257_1003713 Ga0209257_100371314 432
386 3300027111 Ga0209281_1000102 Ga0209281_100010227 432
387 3300027111 Ga0209281_1000242 Ga0209281_100024286 432
388 3300027111 Ga0209281_1000695 Ga0209281_100069522 432
389 3300027666 Ga0209282_1000013 Ga0209282_100001362 432
390 3300028379 Ga0268266_10056372 Ga0268266_100563723 432
391 3300030500 Ga0268256_1004680 Ga0268256_10046807 432
392 3300031456 Ga0307513_10054454 Ga0307513_100544543 432
393 3300031730 Ga0307516_10137322 Ga0307516_101373222 432
394 3300031731 Ga0307405_10049815 Ga0307405_100498153 432
395 3300031901 Ga0307406_10039675 Ga0307406_100396752 432
396 3300031967 Ga0315914_1000004 Ga0315914_100000497 432
397 3300032004 Ga0307414_10083941 Ga0307414_100839412 432
398 3300033430 Ga0315913_1000011 Ga0315913_100001193 432
399 3300033464 Ga0315915_1000003 Ga0315915_1000003204 432
400 3300041410 Ga0439461_0000133 Ga0439461_0000133_6848_8182 432
401 3300041413 Ga0439465_0002515 Ga0439465_0002515_161_1495 432
402 3300041492 Ga0451835_0937263 Ga0451835_0937263_5274_6632 432
403 3300041505 Ga0451849_0603856 Ga0451849_0603856_444_1802 432
404 3300041997 Ga0439431_0000794 Ga0439431_0000794_1012_2346 432
405 3300042007 Ga0439449_0002709 Ga0439449_0002709_2901_4268 432
406 3300042015 Ga0439462_0002763 Ga0439462_0002763_1712_3046 432
407 3300044735 Ga0466968_0007104 Ga0466968_0007104_770_2137 432
408 3300044765 Ga0466970_0042451 Ga0466970_0042451_1002_2369 432
409 3300046460 Ga0495638_0003200 Ga0495638_0003200_2398_3807 432
410 3300046460 Ga0495638_0009219 Ga0495638_0009219_2822_4168 432
411 3300046474 Ga0495605_0002064 Ga0495605_0002064_9210_10598 432
412 3300046492 Ga0495585_0016115 Ga0495585_0016115_849_2237 432
413 3300046501 Ga0495607_0037983 Ga0495607_0037983_646_2001 432
414 3300046506 Ga0495583_0017689 Ga0495583_0017689_761_2149 432
415 3300046507 Ga0495606_0017420 Ga0495606_0017420_1490_2848 432
416 3300046512 Ga0495610_0053919 Ga0495610_0053919_199_1554 432
417 3300046513 Ga0495616_0030509 Ga0495616_0030509_156_1544 432
418 3300046515 Ga0495620_0013645 Ga0495620_0013645_2455_3813 432
419 3300046518 Ga0495631_0001695 Ga0495631_0001695_9541_10929 432
420 3300046519 Ga0495632_0011422 Ga0495632_0011422_2920_4308 432
421 3300046522 Ga0495643_0065559 Ga0495643_0065559_287_1645 432
422 3300046524 Ga0495648_0034396 Ga0495648_0034396_1813_3201 432
423 3300046530 Ga0495654_0000236 Ga0495654_0000236_39524_40891 432
424 3300046615 Ga0495656_0026297 Ga0495656_0026297_26_1384 432
425 3300046616 Ga0495668_0006134 Ga0495668_0006134_1150_2538 432
426 3300046660 Ga0495625_0008722 Ga0495625_0008722_5046_6434 432
427 3300046660 Ga0495625_0109602 Ga0495625_0109602_259_1617 432
428 3300046810 Ga0495660_0006209 Ga0495660_0006209_3604_4992 432
429 3300047320 Ga0495672_0009409 Ga0495672_0009409_2763_4172 432
430 3300048091 Ga0495626_0045817 Ga0495626_0045817_649_2001 432
431 3300048909 Ga0496106_0001196 Ga0496106_0001196_15066_16418 432
432 3300048914 Ga0496111_0000685 Ga0496111_0000685_3841_5205 432
433 3300048920 Ga0496117_0002165 Ga0496117_0002165_12908_14275 432
434 3300048922 Ga0496119_0008938 Ga0496119_0008938_3694_5046 432
435 3300048925 Ga0496122_0000018 Ga0496122_0000018_366541_367908 432
436 3300048925 Ga0496122_0000147 Ga0496122_0000147_88233_89600 432
437 3300048925 Ga0496122_0011451 Ga0496122_0011451_3066_4430 432
438 3300048926 Ga0496123_0000015 Ga0496123_0000015_366541_367908 432
439 3300048926 Ga0496123_0000158 Ga0496123_0000158_124204_125571 432
440 3300048926 Ga0496123_0020668 Ga0496123_0020668_2601_3965 432
441 3300048927 Ga0496124_0046920 Ga0496124_0046920_1449_2816 432
442 3300048928 Ga0496125_0002943 Ga0496125_0002943_10587_11954 432
443 3300048929 Ga0496126_0000195 Ga0496126_0000195_10107_11474 432
444 3300048929 Ga0496126_0055342 Ga0496126_0055342_859_2211 432
445 3300048929 Ga0496126_0093366 Ga0496126_0093366_119_1486 432
446 3300049460 Ga0495682_0010402 Ga0495682_0010402_1968_3356 432
447 3300049570 Ga0501033_0133467 Ga0501033_0133467_399_1766 432
448 3300049571 Ga0501034_0035340 Ga0501034_0035340_2863_4230 432
449 3300049571 Ga0501034_0236801 Ga0501034_0236801_138_1448 432
450 3300050489 nmdc:mga03683_6454_c1 nmdc:mga03683_6454_c1_2011_3369 432
451 3300050492 nmdc:mga0yw44_12216_c1 nmdc:mga0yw44_12216_c1_187_1545 432
452 3300050493 nmdc:mga0k408_16763_c1 nmdc:mga0k408_16763_c1_1706_3064 432
453 3300050496 nmdc:mga07m45_6743_c1 nmdc:mga07m45_6743_c1_3364_4722 432
454 3300050516 nmdc:mga0sz30_40997_c1 nmdc:mga0sz30_40997_c1_179_1537 432
455 3300053079 Ga0500610_0025760 Ga0500610_0025760_298_1686 432
456 3300053087 Ga0500643_025214 Ga0500643_025214_134_1474 432
457 3300053105 Ga0500557_000292 Ga0500557_000292_3646_5034 432
458 3300053109 Ga0500569_014218 Ga0500569_014218_349_1737 432
459 3300053125 Ga0500618_002112 Ga0500618_002112_1230_2597 432
460 3300053134 Ga0500658_0010069 Ga0500658_0010069_534_1892 432
461 3300053136 Ga0500559_0017644 Ga0500559_0017644_589_1935 432
462 3300053139 Ga0500568_0001075 Ga0500568_0001075_5471_6880 432
463 3300053153 Ga0500616_0017475 Ga0500616_0017475_1652_3010 432
464 3300053156 Ga0500622_0061457 Ga0500622_0061457_38_1396 432
465 iso_pu_bacteria 2508501122 2509111528 432
466 iso_pu_bacteria 2509276019 2509375475 432
467 iso_pu_bacteria 2510065057 2510307088 432
468 iso_pu_bacteria 2510917022 2511132166 432
469 iso_pu_bacteria 2511231027 2511392031 432
470 iso_pu_bacteria 2511231052 2511498857 432
471 iso_pu_bacteria 2512047086 2512534993 432
472 iso_pu_bacteria 2512875026 2512973187 432
473 iso_pu_bacteria 2513237084 2513570728 432
474 iso_pu_bacteria 2513237085 2513575053 432
475 iso_pu_bacteria 2513237086 2513588295 432
476 iso_pu_bacteria 2513237089 2513603547 432
477 iso_pu_bacteria 2513237091 2513619082 432
478 iso_pu_bacteria 2513237140 2513882570 432
479 iso_pu_bacteria 2513237143 2513904554 432
480 iso_pu_bacteria 2513237156 2513983251 432
481 iso_pu_bacteria 2513237160 2514005787 432
482 iso_pu_bacteria 2515154107 2515607283 432
483 iso_pu_bacteria 2515154134 2515741279 432
484 iso_pu_bacteria 2516143018 2516204823 432
485 iso_pu_bacteria 2516653046 2516895134 432
486 iso_pu_bacteria 2516653085 2517078629 432
487 iso_pu_bacteria 2517487022 2517571810 432
488 iso_pu_bacteria 2524023207 2524452462 432
489 iso_pu_bacteria 2524023209 2524462170 432
490 iso_pu_bacteria 2534681786 2535485645 432
491 iso_pu_bacteria 2551306084 2551678399 432
492 iso_pu_bacteria 2551306085 2551688990 432
493 iso_pu_bacteria 2551306086 2551696385 432
494 iso_pu_bacteria 2551306087 2551699360 432
495 iso_pu_bacteria 2551306089 2551711590 432
496 iso_pu_bacteria 2551306090 2551719850 432
497 iso_pu_bacteria 2558860100 2558866573 432
498 iso_pu_bacteria 2582581307 2585276344 432
499 iso_pu_bacteria 2585427526 2585524056 432
500 iso_pu_bacteria 2585427531 2585564144 432
501 iso_pu_bacteria 2585427608 2585897277 432
502 iso_pu_bacteria 2585427609 2585903009 432
503 iso_pu_bacteria 2585428125 2587978416 432
504 iso_pu_bacteria 2599185236 2599718554 432
505 iso_pu_bacteria 2599185352 2600195273 432
506 iso_pu_bacteria 2600254933 2600376829 432
507 iso_pu_bacteria 2615840698 2616551734 432
508 iso_pu_bacteria 2643221557 2643805786 432
509 iso_pu_bacteria 2643221610 2644065962 432
510 iso_pu_bacteria 2643221668 2644380266 432
511 iso_pu_bacteria 2643221675 2644417293 432
512 iso_pu_bacteria 2643221680 2644450689 432
513 iso_pu_bacteria 2643221723 2644671467 432
514 iso_pu_bacteria 2643221726 2644692886 432
515 iso_pu_bacteria 2657244999 2657682796 432
516 iso_pu_bacteria 2690316117 2692320617 432
517 iso_pu_bacteria 2724679232 2725947204 432
518 iso_pu_bacteria 2751185800 2753358372 432
519 iso_pu_bacteria 2751185821 2753459947 432
520 iso_pu_bacteria 2757320392 2757570152 432
521 iso_pu_bacteria 2758568016 2758640596 432
522 iso_pu_bacteria 2765235802 2765465918 432
523 iso_pu_bacteria 2765235942 2766067306 432
524 iso_pu_bacteria 2767802442 2770196511 432
525 iso_pu_bacteria 2775506902 2776269364 432
526 iso_pu_bacteria 2775506904 2776283497 432
527 iso_pu_bacteria 2775507049 2776915866 432
528 iso_pu_bacteria 2791355082 2792583400 432
529 iso_pu_bacteria 2791355091 2792620998 432
530 iso_pu_bacteria 2791355092 2792625213 432
531 iso_pu_bacteria 2791355094 2792637623 432
532 iso_pu_bacteria 2802428858 2802720828 432
533 iso_pu_bacteria 2802428859 2802724434 432
534 iso_pu_bacteria 2802428860 2802729901 432
535 iso_pu_bacteria 2802428861 2802737245 432
536 iso_pu_bacteria 2802428862 2802746375 432
537 iso_pu_bacteria 2802428863 2802751864 432
538 iso_pu_bacteria 2802429268 2804754016 432
539 iso_pu_bacteria 2802429633 2806049213 432
540 iso_pu_bacteria 2802429634 2806056130 432
541 iso_pu_bacteria 2802429635 2806063138 432
542 iso_pu_bacteria 2802429636 2806070736 432
543 iso_pu_bacteria 2802429637 2806077597 432
544 iso_pu_bacteria 2818991448 2819613225 432
545 iso_pu_bacteria 2818991461 2819685715 432
546 iso_pu_bacteria 2821123053 2821123110 432
547 iso_pu_bacteria 2837651117 2837651543 432
548 iso_pu_bacteria 2838074704 2838074885 432
549 iso_pu_bacteria 2838686498 2838689941 432
550 iso_pu_bacteria 2838729681 2838731330 432
551 iso_pu_bacteria 2838736955 2838739866 432
552 iso_pu_bacteria 2838742623 2838744271 432
553 iso_pu_bacteria 2839993093 2839993560 432
554 iso_pu_bacteria 2840764183 2840766535 432
555 iso_pu_bacteria 2841840854 2841844010 432
556 iso_pu_bacteria 2841851746 2841852844 432
557 iso_pu_bacteria 2842110456 2842112855 432
558 iso_pu_bacteria 2842140634 2842143731 432
559 iso_pu_bacteria 2842156927 2842160171 432
560 iso_pu_bacteria 2842163707 2842165850 432
561 iso_pu_bacteria 2842180545 2842184163 432
562 iso_pu_bacteria 2842229732 2842231745 432
563 iso_pu_bacteria 2842243621 2842245753 432
564 iso_pu_bacteria 2842257432 2842260131 432
565 iso_pu_bacteria 2842271015 2842273575 432
566 iso_pu_bacteria 2842298080 2842303528 432
567 iso_pu_bacteria 2842304105 2842308573 432
568 iso_pu_bacteria 2842357229 2842362799 432
569 iso_pu_bacteria 2842509118 2842515351 432
570 iso_pu_bacteria 2842871566 2842875008 432
571 iso_pu_bacteria 2844454524 2844456689 432
572 iso_pu_bacteria 2847417321 2847421277 432
573 iso_pu_bacteria 2848992105 2848996065 432
574 iso_pu_bacteria 2850079185 2850079458 432
575 iso_pu_bacteria 2852387548 2852387646 432
576 iso_pu_bacteria 2854911287 2854913880 432
577 iso_pu_bacteria 2855825444 2855827778 432
578 iso_pu_bacteria 2855839649 2855843142 432
579 iso_pu_bacteria 2855872281 2855877773 432
580 iso_pu_bacteria 2857516855 2857520990 432
581 iso_pu_bacteria 2857531043 2857533937 432
582 iso_pu_bacteria 2858800743 2858802874 432
583 iso_pu_bacteria 2891373044 2891375031 432
584 iso_pu_bacteria 2894652903 2894653513 432
585 iso_pu_bacteria 2896384573 2896388640 432
586 iso_pu_bacteria 2904578770 2904579777 432
587 iso_pu_bacteria 2913295892 2913298392 432
588 iso_pu_bacteria 2915650412 2915650754 432
589 iso_pu_bacteria 2915980308 2915982683 432
590 iso_pu_bacteria 2915986958 2915989870 432
591 iso_pu_bacteria 2915993759 2915999734 432
592 iso_pu_bacteria 2916000859 2916002244 432
593 iso_pu_bacteria 2916007675 2916008911 432
594 iso_pu_bacteria 2916014648 2916016259 432
595 iso_pu_bacteria 2916021584 2916022365 432
596 iso_pu_bacteria 2916028427 2916033415 432
597 iso_pu_bacteria 2916035215 2916037098 432
598 iso_pu_bacteria 2916041962 2916046969 432
599 iso_pu_bacteria 2916048683 2916054916 432
600 iso_pu_bacteria 2916055098 2916056745 432
601 iso_pu_bacteria 2916061851 2916063931 432
602 iso_pu_bacteria 2916076590 2916078739 432
603 iso_pu_bacteria 2919119836 2919120555 432
604 iso_pu_bacteria 2920760137 2920763869 432
605 iso_pu_bacteria 2920822456 2920822829 432
606 iso_pu_bacteria 2921201388 2921202015 432
607 iso_pu_bacteria 2921208531 2921209714 432
608 iso_pu_bacteria 2921237296 2921237990 432
609 iso_pu_bacteria 2921244191 2921244358 432
610 iso_pu_bacteria 2921250672 2921256342 432
611 iso_pu_bacteria 2921257292 2921261469 432
612 iso_pu_bacteria 2921263974 2921265815 432
613 iso_pu_bacteria 2921282425 2921283901 432
614 iso_pu_bacteria 2921289301 2921291484 432
615 iso_pu_bacteria 2921296804 2921303048 432
616 iso_pu_bacteria 2924144063 2924145304 432
617 iso_pu_bacteria 2924150972 2924155172 432
618 iso_pu_bacteria 2924158325 2924162530 432
619 iso_pu_bacteria 2924165586 2924167329 432
620 iso_pu_bacteria 2924172951 2924173449 432
621 iso_pu_bacteria 2924179722 2924182797 432
622 iso_pu_bacteria 2924186466 2924187065 432
623 iso_pu_bacteria 2924193448 2924197280 432
624 iso_pu_bacteria 2924200457 2924202157 432
625 iso_pu_bacteria 2924207177 2924210979 432
626 iso_pu_bacteria 2924214083 2924215374 432
627 iso_pu_bacteria 2924221636 2924225211 432
628 iso_pu_bacteria 2924228884 2924230383 432
629 iso_pu_bacteria 2928521798 2928522580 432
630 iso_pu_bacteria 2933570622 2933575021 432
631 iso_pu_bacteria 2933586486 2933588255 432
632 iso_pu_bacteria 2935901341 2935902224 432
633 iso_pu_bacteria 2936375103 2936380379 432
634 iso_pu_bacteria 2936996657 2936998728 432
635 iso_pu_bacteria 2937002841 2937003451 432
636 iso_pu_bacteria 2937009748 2937010525 432
637 iso_pu_bacteria 2937016420 2937017296 432
638 iso_pu_bacteria 2937023124 2937025656 432
639 iso_pu_bacteria 2937029754 2937030569 432
640 iso_pu_bacteria 2937036028 2937039037 432
641 iso_pu_bacteria 2937042894 2937045701 432
642 iso_pu_bacteria 2937049772 2937054873 432
643 iso_pu_bacteria 2937056579 2937057692 432
644 iso_pu_bacteria 2937063883 2937070862 432
645 iso_pu_bacteria 2937071275 2937076146 432
646 iso_pu_bacteria 2937078374 2937083910 432
647 iso_pu_bacteria 2937084907 2937088557 432
648 iso_pu_bacteria 2937091812 2937096653 432
649 iso_pu_bacteria 2937098957 2937100679 432
650 iso_pu_bacteria 2937106411 2937111675 432
651 iso_pu_bacteria 2937113482 2937115897 432
652 iso_pu_bacteria 2937119839 2937125705 432
653 iso_pu_bacteria 2937126314 2937130831 432
654 iso_pu_bacteria 2941499720 2941504023 432
655 iso_pu_bacteria 2954011201 2954014039 432
656 iso_pu_bacteria 2957375807 2957378003 432
657 iso_pu_bacteria 2957382221 2957383288 432
658 iso_pu_bacteria 2957388812 2957390585 432
659 iso_pu_bacteria 2957395598 2957401430 432
660 iso_pu_bacteria 2957402308 2957407386 432
661 iso_pu_bacteria 2957408893 2957409947 432
662 iso_pu_bacteria 2957415311 2957416529 432
663 iso_pu_bacteria 2957422303 2957422608 432
664 iso_pu_bacteria 2957430029 2957435166 432
665 iso_pu_bacteria 2957437181 2957441457 432
666 iso_pu_bacteria 2957443900 2957447808 432
667 iso_pu_bacteria 2957450854 2957451840 432
668 iso_pu_bacteria 2957457609 2957460712 432
669 iso_pu_bacteria 2957464669 2957468040 432
670 iso_pu_bacteria 2957471148 2957475928 432
671 iso_pu_bacteria 2957478035 2957484641 432
672 iso_pu_bacteria 2957484790 2957485502 432
673 iso_pu_bacteria 2957491536 2957492052 432
674 iso_pu_bacteria 2957498199 2957502969 432
675 iso_pu_bacteria 2957505466 2957506899 432
676 iso_pu_bacteria 2960584000 2960585956 432
677 iso_pu_bacteria 2960591022 2960593183 432
678 iso_pu_bacteria 2960597568 2960600932 432
679 iso_pu_bacteria 2960603979 2960607754 432
680 iso_pu_bacteria 2960610863 2960615663 432
681 iso_pu_bacteria 2960617483 2960620949 432
682 iso_pu_bacteria 2960624210 2960626196 432
683 iso_pu_bacteria 2960631154 2960635358 432
684 iso_pu_bacteria 2960637947 2960640416 432
685 iso_pu_bacteria 2960645483 2960646993 432
686 iso_pu_bacteria 2960652885 2960656376 432
687 iso_pu_bacteria 2960660292 2960664265 432
688 iso_pu_bacteria 2960667422 2960670913 432
689 iso_pu_bacteria 2960674078 2960677434 432
690 iso_pu_bacteria 2960680706 2960682643 432
691 iso_pu_bacteria 2960687367 2960692762 432
692 iso_pu_bacteria 2960693952 2960697788 432
693 iso_pu_bacteria 2964607997 2964609969 432
694 iso_pu_bacteria 2964615318 2964618223 432
695 iso_pu_bacteria 2964621998 2964627397 432
696 iso_pu_bacteria 2964628898 2964631552 432
697 iso_pu_bacteria 2964636051 2964641332 432
698 iso_pu_bacteria 2964643177 2964645445 432
699 iso_pu_bacteria 2964649959 2964651396 432
700 iso_pu_bacteria 2964656573 2964662965 432
701 iso_pu_bacteria 2964663802 2964668677 432
702 iso_pu_bacteria 2964670856 2964672328 432
703 iso_pu_bacteria 2964678106 2964682247 432
704 iso_pu_bacteria 2964685014 2964690663 432
705 iso_pu_bacteria 2964691889 2964695189 432
706 iso_pu_bacteria 2964698721 2964700000 432
707 iso_pu_bacteria 2964705432 2964710026 432
708 iso_pu_bacteria 2964712639 2964716072 432
709 iso_pu_bacteria 2964719344 2964725860 432
710 iso_pu_bacteria 2967664464 2967669276 432
711 iso_pu_bacteria 2967678726 2967683504 432
712 iso_pu_bacteria 2967686174 2967688467 432
713 iso_pu_bacteria 2967693043 2967694595 432
714 iso_pu_bacteria 2967699805 2967705465 432
715 iso_pu_bacteria 2967706974 2967714015 432
716 iso_pu_bacteria 2967714385 2967716255 432
717 iso_pu_bacteria 2967721400 2967725899 432
718 iso_pu_bacteria 2967728569 2967733798 432
719 iso_pu_bacteria 2967735183 2967740902 432
720 iso_pu_bacteria 2967742019 2967742823 432
721 iso_pu_bacteria 2967748971 2967751544 432
722 iso_pu_bacteria 2967755722 2967758480 432
723 iso_pu_bacteria 2967762386 2967766394 432
724 iso_pu_bacteria 2967769361 2967775532 432
725 iso_pu_bacteria 2967775926 2967776969 432
726 iso_pu_bacteria 2970026789 2970031947 432
727 iso_pu_bacteria 2970033650 2970038033 432
728 iso_pu_bacteria 2970040964 2970046758 432
729 iso_pu_bacteria 2970047711 2970054404 432
730 iso_pu_bacteria 2970054988 2970056023 432
731 iso_pu_bacteria 2970061556 2970064585 432
732 iso_pu_bacteria 2970068827 2970073417 432
733 iso_pu_bacteria 2970076120 2970077175 432
734 iso_pu_bacteria 2970082768 2970085092 432
735 iso_pu_bacteria 2970088815 2970095719 432
736 iso_pu_bacteria 2970095765 2970099319 432
737 iso_pu_bacteria 2970102677 2970106235 432
738 iso_pu_bacteria 2970109326 2970112622 432
739 iso_pu_bacteria 2970116247 2970118867 432
740 iso_pu_bacteria 2970122695 2970122764 432
741 iso_pu_bacteria 2970129317 2970130896 432
742 iso_pu_bacteria 2970136068 2970139340 432
743 iso_pu_bacteria 2970143518 2970145287 432
744 iso_pu_bacteria 2970149975 2970153331 432
745 iso_pu_bacteria 2970156795 2970160483 432
746 iso_pu_bacteria 2970164137 2970165615 432
747 iso_pu_bacteria 2970170962 2970177794 432
748 iso_pu_bacteria 2970177841 2970182080 432
749 iso_pu_bacteria 2970184632 2970186924 432
750 iso_pu_bacteria 2970191845 2970193263 432
751 iso_pu_bacteria 2977516862 2977522187 432
752 iso_pu_bacteria 2977523885 2977525544 432
753 iso_pu_bacteria 2977530762 2977530916 432
754 iso_pu_bacteria 2977537788 2977538807 432
755 iso_pu_bacteria 2977544691 2977546942 432
756 iso_pu_bacteria 2977551784 2977556311 432
757 iso_pu_bacteria 2977558990 2977561846 432
758 iso_pu_bacteria 2977565890 2977572402 432
759 iso_pu_bacteria 2977572785 2977576267 432
760 iso_pu_bacteria 2977579622 2977581071 432
761 iso_pu_bacteria 2989349275 2989351518 432
762 iso_pu_bacteria 2989771324 2989774462 432
763 iso_pu_bacteria 3002141150 3002141873 432
764 iso_pu_bacteria 3003930520 3003931433 432
765 iso_pu_bacteria 3005409236 3005410531 432
766 iso_pu_bacteria 3005416602 3005419321 432
767 iso_pu_bacteria 643692032 643827767 432
768 iso_pu_bacteria 648276728 648738288 432
769 iso_pu_bacteria 8003992118 8003995728 432
770 iso_pu_bacteria 8003999396 8004003482 432
771 iso_pu_bacteria 8005307578 8005310154 432
772 iso_pu_bacteria 8005314921 8005317524 432
773 iso_pu_bacteria 8005376324 8005378198 432
774 iso_pu_bacteria 8005484373 8005489263 432
775 iso_pu_bacteria 8005556819 8005559868 432
776 iso_pu_bacteria 8005563573 8005564634 432
777 iso_pu_bacteria 8005570704 8005570998 432
778 iso_pu_bacteria 8005645114 8005645398 432
779 iso_pu_bacteria 8005682033 8005687757 432
780 iso_pu_bacteria 8018163183 8018167709 432
781 iso_pu_bacteria 8023680758 8023681370 432
782 iso_pu_bacteria 8024479707 8024481797 432
783 iso_pu_bacteria 8046767195 8046774115 432
784 iso_pu_bacteria 8049293176 8049296633 432
785 iso_pu_bacteria 8054558443 8054562443 432
786 iso_pu_bacteria 8056875544 8056878565 432
787 iso_pu_bacteria 8057575449 8057577935 432
788 3300002774 JGI25150J39212_1000126 JGI25150J39212_100012614 433
789 3300003214 JGI25165J46597_1000041 JGI25165J46597_1000041184 433
790 3300003215 JGI25153J46596_10000305 JGI25153J46596_100003054 433
791 3300003215 JGI25153J46596_10009756 JGI25153J46596_100097563 433
792 3300003771 Ga0055526_1007718 Ga0055526_10077182 433
793 3300003775 Ga0055524_1000056 Ga0055524_100005630 433
794 3300003791 Ga0055530_10000027 Ga0055530_100000274 433
795 3300003791 Ga0055530_10000931 Ga0055530_100009317 433
796 3300003791 Ga0055530_10013499 Ga0055530_100134994 433
797 3300003792 Ga0055540_1001336 Ga0055540_10013362 433
798 3300003794 Ga0055531_10000013 Ga0055531_10000013159 433
799 3300003794 Ga0055531_10014149 Ga0055531_100141493 433
800 3300005262 Ga0065165_1003833 Ga0065165_100383311 433
801 3300005262 Ga0065165_1012721 Ga0065165_10127213 433
802 3300005262 Ga0065165_1013057 Ga0065165_10130572 433
803 3300005353 Ga0070669_100013530 Ga0070669_1000135304 433
804 3300005355 Ga0070671_100004829 Ga0070671_1000048293 433
805 3300005530 Ga0070679_100143648 Ga0070679_1001436482 433
806 3300005539 Ga0068853_100036747 Ga0068853_1000367474 433
807 3300005548 Ga0070665_100000319 Ga0070665_10000031967 433
808 3300005618 Ga0068864_100030494 Ga0068864_1000304943 433
809 3300005842 Ga0068858_100000591 Ga0068858_10000059125 433
810 3300005842 Ga0068858_100013493 Ga0068858_1000134939 433
811 3300009177 Ga0105248_10016997 Ga0105248_100169979 433
812 3300009177 Ga0105248_10025390 Ga0105248_100253902 433
813 3300009551 Ga0105238_10113471 Ga0105238_101134711 433
814 3300013306 Ga0163162_10102190 Ga0163162_101021903 433
815 3300025245 Ga0207425_1000041 Ga0207425_100004182 433
816 3300025258 Ga0209129_1000359 Ga0209129_10003599 433
817 3300025261 Ga0209233_1000104 Ga0209233_1000104187 433
818 3300025263 Ga0209565_1000008 Ga0209565_1000008608 433
819 3300025263 Ga0209565_1000134 Ga0209565_100013474 433
820 3300025273 Ga0209673_1004104 Ga0209673_100410410 433
821 3300025291 Ga0209675_1003991 Ga0209675_10039913 433
822 3300025294 Ga0209025_1000068 Ga0209025_1000068251 433
823 3300025295 Ga0209564_1001020 Ga0209564_100102012 433
824 3300025297 Ga0209758_1000004 Ga0209758_1000004150 433
825 3300025297 Ga0209758_1008214 Ga0209758_10082147 433
826 3300025298 Ga0209050_1000001 Ga0209050_10000012099 433
827 3300025298 Ga0209050_1000014 Ga0209050_10000144 433
828 3300025298 Ga0209050_1009997 Ga0209050_10099973 433
829 3300025299 Ga0209256_1000009 Ga0209256_1000009261 433
830 3300025299 Ga0209256_1000010 Ga0209256_1000010185 433
831 3300025302 Ga0207426_1028357 Ga0207426_10283572 433
832 3300025303 Ga0209051_1000232 Ga0209051_100023232 433
833 3300025304 Ga0209257_1000019 Ga0209257_1000019688 433
834 3300025304 Ga0209257_1005528 Ga0209257_10055283 433
835 3300025921 Ga0207652_10056019 Ga0207652_100560193 433
836 3300025923 Ga0207681_10000667 Ga0207681_1000066723 433
837 3300025927 Ga0207687_10039346 Ga0207687_100393464 433
838 3300025931 Ga0207644_10037322 Ga0207644_100373224 433
839 3300025941 Ga0207711_10014565 Ga0207711_100145652 433
840 3300025941 Ga0207711_10029281 Ga0207711_100292814 433
841 3300026035 Ga0207703_10000205 Ga0207703_1000020546 433
842 3300026035 Ga0207703_10000639 Ga0207703_1000063912 433
843 3300026095 Ga0207676_10001417 Ga0207676_100014173 433
844 3300028379 Ga0268266_10000212 Ga0268266_1000021249 433
845 3300028381 Ga0268264_10018414 Ga0268264_100184145 433
846 3300031616 Ga0307508_10000398 Ga0307508_100003987 433
847 3300033180 Ga0307510_10008962 Ga0307510_100089625 433
848 3300041410 Ga0439461_0003201 Ga0439461_0003201_615_1952 433
849 3300041413 Ga0439465_0007006 Ga0439465_0007006_56_1393 433
850 3300041997 Ga0439431_0007345 Ga0439431_0007345_116_1453 433
851 3300042006 Ga0439432_010870 Ga0439432_010870_115_1452 433
852 3300042156 Ga0439446_0003437 Ga0439446_0003437_1106_2443 433
853 3300045051 Ga0451576_0000023 Ga0451576_0000023_202526_203950 433
854 3300046660 Ga0495625_0001386 Ga0495625_0001386_26918_28243 433
855 3300048918 Ga0496115_0001130 Ga0496115_0001130_12609_13934 433
856 3300048924 Ga0496121_0003590 Ga0496121_0003590_18001_19326 433
857 3300048924 Ga0496121_0006338 Ga0496121_0006338_2634_3953 433
858 3300048924 Ga0496121_0089230 Ga0496121_0089230_1020_2345 433
859 3300048925 Ga0496122_0002719 Ga0496122_0002719_2016_3350 433
860 3300048926 Ga0496123_0002233 Ga0496123_0002233_2007_3341 433
861 3300048929 Ga0496126_0018207 Ga0496126_0018207_153_1472 433
862 3300049822 Ga0501035_0118966 Ga0501035_0118966_435_1736 433
863 3300049823 Ga0501044_0040197 Ga0501044_0040197_2686_4053 433
864 3300053087 Ga0500643_003937 Ga0500643_003937_4185_5510 433
865 3300053119 Ga0500595_002230 Ga0500595_002230_7420_8757 433
866 3300053120 Ga0500597_023742 Ga0500597_023742_672_2060 433
867 3300053134 Ga0500658_0001519 Ga0500658_0001519_1805_3130 433
868 3300053136 Ga0500559_0044993 Ga0500559_0044993_36_1361 433
869 3300053148 Ga0500590_002666 Ga0500590_002666_2663_4021 433
870 3300053156 Ga0500622_0105632 Ga0500622_0105632_10_1344 433
871 3300053157 Ga0500624_000062 Ga0500624_000062_28218_29606 433
872 3300053178 Ga0500637_0000692 Ga0500637_0000692_10537_11925 433
873 iso_pu_bacteria 2643221622 2644126070 433
874 iso_pu_bacteria 2879163058 2879165962 433
875 iso_pu_bacteria 2896253425 2896255487 433
876 3300005289 Ga0065704_10070744 Ga0065704_1007074410 434
877 3300005330 Ga0070690_100043813 Ga0070690_1000438133 434
878 3300005335 Ga0070666_10026566 Ga0070666_100265664 434
879 3300005347 Ga0070668_100174904 Ga0070668_1001749042 434
880 3300005355 Ga0070671_100015118 Ga0070671_1000151189 434
881 3300005367 Ga0070667_100008843 Ga0070667_1000088439 434
882 3300005548 Ga0070665_100007081 Ga0070665_1000070818 434
883 3300005548 Ga0070665_100010626 Ga0070665_10001062612 434
884 3300005577 Ga0068857_100144066 Ga0068857_1001440662 434
885 3300005614 Ga0068856_100179211 Ga0068856_1001792113 434
886 3300005617 Ga0068859_100103822 Ga0068859_1001038224 434
887 3300005841 Ga0068863_100007010 Ga0068863_1000070104 434
888 3300005842 Ga0068858_100162541 Ga0068858_1001625411 434
889 3300005843 Ga0068860_100000944 Ga0068860_10000094425 434
890 3300005843 Ga0068860_100047514 Ga0068860_1000475145 434
891 3300005844 Ga0068862_100000280 Ga0068862_10000028026 434
892 3300005844 Ga0068862_100019008 Ga0068862_10001900810 434
893 3300006028 Ga0070717_10220193 Ga0070717_102201931 434
894 3300006931 Ga0097620_100103821 Ga0097620_1001038214 434
895 3300009093 Ga0105240_10361753 Ga0105240_103617531 434
896 3300009177 Ga0105248_10152523 Ga0105248_101525232 434
897 3300009545 Ga0105237_10002470 Ga0105237_1000247021 434
898 3300009553 Ga0105249_10020498 Ga0105249_100204987 434
899 3300013297 Ga0157378_10002131 Ga0157378_1000213119 434
900 3300013306 Ga0163162_10066770 Ga0163162_100667705 434
901 3300025735 Ga0207713_1004595 Ga0207713_100459512 434
902 3300025914 Ga0207671_10002072 Ga0207671_100020729 434
903 3300025923 Ga0207681_10000259 Ga0207681_1000025918 434
904 3300025931 Ga0207644_10000060 Ga0207644_1000006050 434
905 3300025931 Ga0207644_10002506 Ga0207644_1000250611 434
906 3300025941 Ga0207711_10224428 Ga0207711_102244282 434
907 3300025961 Ga0207712_10000069 Ga0207712_1000006954 434
908 3300025961 Ga0207712_10020513 Ga0207712_100205135 434
909 3300025986 Ga0207658_10005443 Ga0207658_100054436 434
910 3300025986 Ga0207658_10064739 Ga0207658_100647394 434
911 3300026088 Ga0207641_10002917 Ga0207641_100029175 434
912 3300026088 Ga0207641_10236824 Ga0207641_102368242 434
913 3300026116 Ga0207674_10164988 Ga0207674_101649882 434
914 3300028379 Ga0268266_10012740 Ga0268266_100127404 434
915 3300028380 Ga0268265_10000739 Ga0268265_1000073924 434
916 3300028380 Ga0268265_10006464 Ga0268265_100064649 434
917 3300028381 Ga0268264_10002308 Ga0268264_100023083 434
918 3300028381 Ga0268264_10046657 Ga0268264_100466574 434
919 3300035170 Ga0373943_0036081 Ga0373943_0036081_309_1646 434
920 3300035724 Ga0373933_0045726 Ga0373933_0045726_1138_2475 434
921 3300037068 Ga0373925_0054265 Ga0373925_0054265_398_1735 434
922 3300037853 Ga0436364_1027058 Ga0436364_1027058_704_2047 434
923 3300039453 Ga0436362_1291891 Ga0436362_1291891_498_1841 434
924 3300046454 Ga0495592_0087492 Ga0495592_0087492_366_1700 434
925 3300046462 Ga0495651_0071686 Ga0495651_0071686_635_1969 434
926 3300046529 Ga0495652_0163682 Ga0495652_0163682_73_1407 434
927 3300047319 Ga0495674_0033062 Ga0495674_0033062_1095_2483 434
928 3300047322 Ga0495680_0129972 Ga0495680_0129972_410_1798 434
929 3300048904 Ga0496101_0004194 Ga0496101_0004194_4807_6288 434
930 3300048905 Ga0496102_0000106 Ga0496102_0000106_71784_73265 434
931 3300048906 Ga0496103_0000095 Ga0496103_0000095_30764_32245 434
932 3300048907 Ga0496104_0000060 Ga0496104_0000060_15668_17149 434
933 3300048907 Ga0496104_0077771 Ga0496104_0077771_1358_2704 434
934 3300048908 Ga0496105_0000274 Ga0496105_0000274_9873_11354 434
935 3300048909 Ga0496106_0000338 Ga0496106_0000338_28981_30327 434
936 3300048910 Ga0496107_0002397 Ga0496107_0002397_6381_7727 434
937 3300048916 Ga0496113_0001855 Ga0496113_0001855_2698_4044 434
938 3300048916 Ga0496113_0002586 Ga0496113_0002586_197_1678 434
939 3300048920 Ga0496117_0000366 Ga0496117_0000366_47709_49190 434
940 3300048921 Ga0496118_0003332 Ga0496118_0003332_6885_8366 434
941 3300048921 Ga0496118_0041709 Ga0496118_0041709_1843_3183 434
942 3300048922 Ga0496119_0001213 Ga0496119_0001213_19229_20710 434
943 3300048922 Ga0496119_0052767 Ga0496119_0052767_717_2057 434
944 3300048923 Ga0496120_0001109 Ga0496120_0001109_10889_12370 434
945 3300048924 Ga0496121_0001994 Ga0496121_0001994_28730_30211 434
946 3300048924 Ga0496121_0002478 Ga0496121_0002478_18832_20172 434
947 3300048925 Ga0496122_0004287 Ga0496122_0004287_6475_7956 434
948 3300048925 Ga0496122_0096638 Ga0496122_0096638_62_1390 434
949 3300048927 Ga0496124_0000703 Ga0496124_0000703_52078_53406 434
950 3300048927 Ga0496124_0001819 Ga0496124_0001819_15209_16690 434
951 3300048927 Ga0496124_0109096 Ga0496124_0109096_148_1476 434
952 3300048929 Ga0496126_0000294 Ga0496126_0000294_60228_61709 434
953 3300048929 Ga0496126_0055898 Ga0496126_0055898_829_2157 434
954 3300049758 Ga0501241_001834 Ga0501241_001834_354_1682 434
955 iso_pu_bacteria 2599185359 2600225479 434
956 iso_pu_bacteria 2818991466 2819713914 434
957 iso_pu_bacteria 2919138771 2919141165 434
958 iso_pu_bacteria 2928526807 2928528472 434
959 iso_pu_bacteria 2928968154 2928970019 434
960 3300001904 JGI24736J21556_1001548 JGI24736J21556_10015484 435
961 3300001989 JGI24739J22299_10003612 JGI24739J22299_100036125 435
962 3300002067 JGI24735J21928_10008073 JGI24735J21928_100080733 435
963 3300002070 JGI24750J21931_1000436 JGI24750J21931_10004369 435
964 3300002074 JGI24748J21848_1000063 JGI24748J21848_100006315 435
965 3300002076 JGI24749J21850_1000018 JGI24749J21850_100001816 435
966 3300002239 JGI24034J26672_10000007 JGI24034J26672_1000000738 435
967 3300002459 JGI24751J29686_10000115 JGI24751J29686_1000011529 435
968 3300002459 JGI24751J29686_10004035 JGI24751J29686_100040353 435
969 3300003215 JGI25153J46596_10000115 JGI25153J46596_1000011511 435
970 3300003759 Ga0055525_1000104 Ga0055525_1000104120 435
971 3300005295 Ga0065707_10149171 Ga0065707_101491711 435
972 3300005330 Ga0070690_100000024 Ga0070690_1000000243 435
973 3300005331 Ga0070670_100000074 Ga0070670_10000007417 435
974 3300005331 Ga0070670_100000409 Ga0070670_10000040959 435
975 3300005335 Ga0070666_10000017 Ga0070666_10000017181 435
976 3300005339 Ga0070660_100022696 Ga0070660_1000226964 435
977 3300005347 Ga0070668_100080044 Ga0070668_1000800441 435
978 3300005353 Ga0070669_100000058 Ga0070669_10000005818 435
979 3300005353 Ga0070669_100003312 Ga0070669_1000033122 435
980 3300005355 Ga0070671_100013940 Ga0070671_1000139405 435
981 3300005356 Ga0070674_100020424 Ga0070674_1000204244 435
982 3300005366 Ga0070659_100038689 Ga0070659_1000386893 435
983 3300005366 Ga0070659_100062954 Ga0070659_1000629542 435
984 3300005367 Ga0070667_100000017 Ga0070667_10000001726 435
985 3300005367 Ga0070667_100003990 Ga0070667_1000039909 435
986 3300005367 Ga0070667_100063753 Ga0070667_1000637531 435
987 3300005434 Ga0070709_10000892 Ga0070709_1000089212 435
988 3300005435 Ga0070714_100015160 Ga0070714_1000151603 435
989 3300005436 Ga0070713_100000003 Ga0070713_10000000330 435
990 3300005437 Ga0070710_10045250 Ga0070710_100452502 435
991 3300005456 Ga0070678_100000057 Ga0070678_10000005714 435
992 3300005466 Ga0070685_10000389 Ga0070685_1000038924 435
993 3300005530 Ga0070679_100199771 Ga0070679_1001997712 435
994 3300005539 Ga0068853_100017003 Ga0068853_1000170034 435
995 3300005544 Ga0070686_100010480 Ga0070686_1000104804 435
996 3300005545 Ga0070695_100079773 Ga0070695_1000797732 435
997 3300005548 Ga0070665_100000042 Ga0070665_100000042182 435
998 3300005563 Ga0068855_100000608 Ga0068855_10000060816 435
999 3300005577 Ga0068857_100100978 Ga0068857_1001009784 435
1000 3300005578 Ga0068854_100134981 Ga0068854_1001349812 435
1001 3300005614 Ga0068856_100000719 Ga0068856_10000071924 435
1002 3300005614 Ga0068856_100003762 Ga0068856_1000037625 435
1003 3300005617 Ga0068859_100001232 Ga0068859_1000012324 435
1004 3300005617 Ga0068859_100003906 Ga0068859_1000039063 435
1005 3300005617 Ga0068859_100023002 Ga0068859_1000230025 435
1006 3300005617 Ga0068859_100141475 Ga0068859_1001414754 435
1007 3300005618 Ga0068864_100000260 Ga0068864_10000026016 435
1008 3300005618 Ga0068864_100017327 Ga0068864_1000173274 435
1009 3300005719 Ga0068861_100000074 Ga0068861_10000007447 435
1010 3300005719 Ga0068861_100001071 Ga0068861_1000010715 435
1011 3300005719 Ga0068861_100011989 Ga0068861_1000119893 435
1012 3300005841 Ga0068863_100000280 Ga0068863_10000028037 435
1013 3300005842 Ga0068858_100000303 Ga0068858_10000030354 435
1014 3300005842 Ga0068858_100001032 Ga0068858_10000103212 435
1015 3300005843 Ga0068860_100000056 Ga0068860_100000056219 435
1016 3300005843 Ga0068860_100000062 Ga0068860_1000000623 435
1017 3300005844 Ga0068862_100000081 Ga0068862_10000008126 435
1018 3300005844 Ga0068862_100000308 Ga0068862_10000030846 435
1019 3300005937 Ga0081455_10000255 Ga0081455_1000025569 435
1020 3300006175 Ga0070712_100000169 Ga0070712_1000001695 435
1021 3300006871 Ga0075434_100129812 Ga0075434_1001298122 435
1022 3300006914 Ga0075436_100000038 Ga0075436_10000003886 435
1023 3300006914 Ga0075436_100045939 Ga0075436_1000459394 435
1024 3300006931 Ga0097620_100001232 Ga0097620_1000012324 435
1025 3300006931 Ga0097620_100003906 Ga0097620_10000390615 435
1026 3300006931 Ga0097620_100022995 Ga0097620_1000229955 435
1027 3300006931 Ga0097620_100141468 Ga0097620_1001414684 435
1028 3300009093 Ga0105240_10008524 Ga0105240_100085248 435
1029 3300009174 Ga0105241_10017676 Ga0105241_100176763 435
1030 3300009174 Ga0105241_10030093 Ga0105241_100300935 435
1031 3300009177 Ga0105248_10001187 Ga0105248_100011875 435
1032 3300009177 Ga0105248_10017774 Ga0105248_100177749 435
1033 3300009551 Ga0105238_10003588 Ga0105238_100035888 435
1034 3300009553 Ga0105249_10000012 Ga0105249_10000012106 435
1035 3300013102 Ga0157371_10000059 Ga0157371_10000059143 435
1036 3300013102 Ga0157371_10025477 Ga0157371_100254772 435
1037 3300013105 Ga0157369_10004747 Ga0157369_1000474715 435
1038 3300013306 Ga0163162_10046965 Ga0163162_100469654 435
1039 3300013307 Ga0157372_10232582 Ga0157372_102325821 435
1040 3300014326 Ga0157380_10000151 Ga0157380_100001516 435
1041 3300014326 Ga0157380_10001425 Ga0157380_1000142517 435
1042 3300014968 Ga0157379_10036388 Ga0157379_100363884 435
1043 3300014968 Ga0157379_10137507 Ga0157379_101375074 435
1044 3300015690 Ga0183363_1004 Ga0183363_1004259 435
1045 3300017792 Ga0163161_10000025 Ga0163161_10000025181 435
1046 3300025223 Ga0207672_1000205 Ga0207672_10002056 435
1047 3300025230 Ga0209563_100116 Ga0209563_10011618 435
1048 3300025297 Ga0209758_1000001 Ga0209758_1000001781 435
1049 3300025321 Ga0207656_10043107 Ga0207656_100431072 435
1050 3300025903 Ga0207680_10000012 Ga0207680_10000012180 435
1051 3300025904 Ga0207647_10001733 Ga0207647_1000173318 435
1052 3300025904 Ga0207647_10025680 Ga0207647_100256804 435
1053 3300025906 Ga0207699_10000676 Ga0207699_1000067611 435
1054 3300025909 Ga0207705_10000197 Ga0207705_1000019753 435
1055 3300025911 Ga0207654_10000222 Ga0207654_1000022223 435
1056 3300025911 Ga0207654_10000293 Ga0207654_1000029322 435
1057 3300025913 Ga0207695_10000641 Ga0207695_1000064138 435
1058 3300025913 Ga0207695_10069418 Ga0207695_100694183 435
1059 3300025913 Ga0207695_10080915 Ga0207695_100809153 435
1060 3300025914 Ga0207671_10003353 Ga0207671_100033535 435
1061 3300025919 Ga0207657_10087798 Ga0207657_100877983 435
1062 3300025920 Ga0207649_10000319 Ga0207649_100003194 435
1063 3300025920 Ga0207649_10055003 Ga0207649_100550033 435
1064 3300025923 Ga0207681_10000003 Ga0207681_10000003535 435
1065 3300025923 Ga0207681_10000221 Ga0207681_1000022142 435
1066 3300025924 Ga0207694_10003805 Ga0207694_100038055 435
1067 3300025925 Ga0207650_10000038 Ga0207650_10000038166 435
1068 3300025925 Ga0207650_10007425 Ga0207650_1000742513 435
1069 3300025925 Ga0207650_10100427 Ga0207650_101004271 435
1070 3300025926 Ga0207659_10118854 Ga0207659_101188542 435
1071 3300025928 Ga0207700_10000083 Ga0207700_1000008330 435
1072 3300025929 Ga0207664_10011315 Ga0207664_100113156 435
1073 3300025931 Ga0207644_10000385 Ga0207644_100003853 435
1074 3300025931 Ga0207644_10000927 Ga0207644_100009278 435
1075 3300025932 Ga0207690_10010226 Ga0207690_100102264 435
1076 3300025933 Ga0207706_10003677 Ga0207706_1000367717 435
1077 3300025937 Ga0207669_10005970 Ga0207669_100059703 435
1078 3300025941 Ga0207711_10002994 Ga0207711_100029948 435
1079 3300025949 Ga0207667_10000002 Ga0207667_1000000212 435
1080 3300025949 Ga0207667_10000916 Ga0207667_1000091616 435
1081 3300025949 Ga0207667_10005514 Ga0207667_1000551411 435
1082 3300025949 Ga0207667_10044809 Ga0207667_100448093 435
1083 3300025961 Ga0207712_10000021 Ga0207712_10000021180 435
1084 3300025972 Ga0207668_10000178 Ga0207668_1000017832 435
1085 3300025972 Ga0207668_10022777 Ga0207668_100227772 435
1086 3300025981 Ga0207640_10117499 Ga0207640_101174992 435
1087 3300025986 Ga0207658_10000011 Ga0207658_10000011214 435
1088 3300025986 Ga0207658_10014406 Ga0207658_100144065 435
1089 3300025986 Ga0207658_10079952 Ga0207658_100799522 435
1090 3300026035 Ga0207703_10000714 Ga0207703_1000071433 435
1091 3300026035 Ga0207703_10014160 Ga0207703_100141603 435
1092 3300026041 Ga0207639_10003585 Ga0207639_100035856 435
1093 3300026067 Ga0207678_10025364 Ga0207678_100253642 435
1094 3300026078 Ga0207702_10000045 Ga0207702_10000045129 435
1095 3300026078 Ga0207702_10002929 Ga0207702_1000292910 435
1096 3300026078 Ga0207702_10032499 Ga0207702_100324993 435
1097 3300026078 Ga0207702_10104638 Ga0207702_101046383 435
1098 3300026088 Ga0207641_10000414 Ga0207641_1000041434 435
1099 3300026089 Ga0207648_10096920 Ga0207648_100969202 435
1100 3300026095 Ga0207676_10000034 Ga0207676_1000003417 435
1101 3300026095 Ga0207676_10035291 Ga0207676_100352913 435
1102 3300026116 Ga0207674_10000026 Ga0207674_1000002679 435
1103 3300026116 Ga0207674_10027999 Ga0207674_100279996 435
1104 3300026116 Ga0207674_10041996 Ga0207674_100419965 435
1105 3300026118 Ga0207675_100000244 Ga0207675_1000002443 435
1106 3300026118 Ga0207675_100000360 Ga0207675_10000036017 435
1107 3300026118 Ga0207675_100006658 Ga0207675_10000665810 435
1108 3300026121 Ga0207683_10020696 Ga0207683_100206964 435
1109 3300028379 Ga0268266_10000002 Ga0268266_100000022939 435
1110 3300028379 Ga0268266_10000054 Ga0268266_10000054179 435
1111 3300028379 Ga0268266_10031160 Ga0268266_100311602 435
1112 3300028380 Ga0268265_10000030 Ga0268265_1000003073 435
1113 3300028380 Ga0268265_10000292 Ga0268265_1000029224 435
1114 3300028381 Ga0268264_10000074 Ga0268264_10000074180 435
1115 3300028381 Ga0268264_10000089 Ga0268264_1000008933 435
1116 3300028786 Ga0307517_10015953 Ga0307517_100159536 435
1117 3300028786 Ga0307517_10028410 Ga0307517_100284106 435
1118 3300028786 Ga0307517_10094042 Ga0307517_100940422 435
1119 3300031731 Ga0307405_10086253 Ga0307405_100862532 435
1120 3300031911 Ga0307412_10019148 Ga0307412_100191482 435
1121 3300032004 Ga0307414_10016847 Ga0307414_100168474 435
1122 3300035172 Ga0373955_0051397 Ga0373955_0051397_133_1479 435
1123 3300036401 Ga0373937_0016703 Ga0373937_0016703_3751_5097 435
1124 3300038443 Ga0395901_0091535 Ga0395901_0091535_1578_2909 435
1125 3300046460 Ga0495638_0000214 Ga0495638_0000214_1280_2626 435
1126 3300046471 Ga0495650_0000174 Ga0495650_0000174_6842_8173 435
1127 3300046492 Ga0495585_0017595 Ga0495585_0017595_2426_3757 435
1128 3300046500 Ga0495596_0006273 Ga0495596_0006273_922_2253 435
1129 3300046506 Ga0495583_0006072 Ga0495583_0006072_5989_7320 435
1130 3300046506 Ga0495583_0028306 Ga0495583_0028306_1091_2422 435
1131 3300046506 Ga0495583_0035876 Ga0495583_0035876_998_2329 435
1132 3300046522 Ga0495643_0005203 Ga0495643_0005203_6476_7843 435
1133 3300046522 Ga0495643_0020654 Ga0495643_0020654_295_1626 435
1134 3300046525 Ga0495663_0005738 Ga0495663_0005738_990_2336 435
1135 3300046525 Ga0495663_0017105 Ga0495663_0017105_653_1984 435
1136 3300046558 Ga0495633_0033295 Ga0495633_0033295_198_1529 435
1137 3300046616 Ga0495668_0000072 Ga0495668_0000072_69455_70786 435
1138 3300046616 Ga0495668_0028551 Ga0495668_0028551_1387_2721 435
1139 3300046648 Ga0495611_0007195 Ga0495611_0007195_1888_3219 435
1140 3300046660 Ga0495625_0002794 Ga0495625_0002794_1447_2793 435
1141 3300046660 Ga0495625_0017887 Ga0495625_0017887_1654_3144 435
1142 3300046660 Ga0495625_0125954 Ga0495625_0125954_116_1462 435
1143 3300046684 Ga0495669_0000258 Ga0495669_0000258_5392_6723 435
1144 3300046691 Ga0495670_0018659 Ga0495670_0018659_364_1713 435
1145 3300047323 Ga0495683_0024537 Ga0495683_0024537_74_1405 435
1146 3300047443 Ga0495687_000240 Ga0495687_000240_72089_73420 435
1147 3300047470 Ga0495681_0004911 Ga0495681_0004911_5874_7205 435
1148 3300047472 Ga0495686_0000544 Ga0495686_0000544_50021_51352 435
1149 3300047472 Ga0495686_0010969 Ga0495686_0010969_1094_2422 435
1150 3300047472 Ga0495686_0021400 Ga0495686_0021400_1313_2659 435
1151 3300048905 Ga0496102_0011122 Ga0496102_0011122_6379_7710 435
1152 3300048906 Ga0496103_0000069 Ga0496103_0000069_114046_115377 435
1153 3300048906 Ga0496103_0002980 Ga0496103_0002980_3275_4609 435
1154 3300048907 Ga0496104_0067340 Ga0496104_0067340_1330_2661 435
1155 3300048908 Ga0496105_0041343 Ga0496105_0041343_1113_2444 435
1156 3300048908 Ga0496105_0062920 Ga0496105_0062920_1171_2505 435
1157 3300048914 Ga0496111_0034979 Ga0496111_0034979_918_2249 435
1158 3300048918 Ga0496115_0000009 Ga0496115_0000009_227019_228350 435
1159 3300048919 Ga0496116_0007300 Ga0496116_0007300_2325_3656 435
1160 3300048920 Ga0496117_0000185 Ga0496117_0000185_6167_7498 435
1161 3300048920 Ga0496117_0015041 Ga0496117_0015041_2070_3404 435
1162 3300048921 Ga0496118_0000077 Ga0496118_0000077_184662_185993 435
1163 3300048921 Ga0496118_0013982 Ga0496118_0013982_428_1762 435
1164 3300048924 Ga0496121_0001230 Ga0496121_0001230_6250_7581 435
1165 3300048927 Ga0496124_0000050 Ga0496124_0000050_250453_251784 435
1166 3300048929 Ga0496126_0000113 Ga0496126_0000113_184704_186035 435
1167 3300049571 Ga0501034_0002130 Ga0501034_0002130_21693_23021 435
1168 3300049663 Ga0501223_000367 Ga0501223_000367_1767_3095 435
1169 3300049664 Ga0501224_000028 Ga0501224_000028_6733_8061 435
1170 3300049668 Ga0501233_000183 Ga0501233_000183_6229_7557 435
1171 3300049705 Ga0501225_0001033 Ga0501225_0001033_6687_8015 435
1172 3300049853 Ga0501226_000191 Ga0501226_000191_1767_3095 435
1173 3300050512 nmdc:mga0n895_45942_c1 nmdc:mga0n895_45942_c1_2452_3798 435
1174 3300050513 nmdc:mga0rr50_50701_c1 nmdc:mga0rr50_50701_c1_694_2040 435
1175 3300050514 nmdc:mga08x19_95_c1 nmdc:mga08x19_95_c1_6711_8063 435
1176 3300053079 Ga0500610_0000364 Ga0500610_0000364_6811_8142 435
1177 3300053087 Ga0500643_000135 Ga0500643_000135_35816_37150 435
1178 3300053087 Ga0500643_000606 Ga0500643_000606_1562_2902 435
1179 3300053104 Ga0500556_0000197 Ga0500556_0000197_46388_47878 435
1180 3300053119 Ga0500595_002716 Ga0500595_002716_5551_6882 435
1181 3300053121 Ga0500607_003805 Ga0500607_003805_2780_4138 435
1182 3300053130 Ga0500642_0000011 Ga0500642_0000011_153667_155157 435
1183 3300053134 Ga0500658_0005819 Ga0500658_0005819_3096_4442 435
1184 3300053138 Ga0500564_006756 Ga0500564_006756_436_1794 435
1185 3300053153 Ga0500616_0009045 Ga0500616_0009045_3409_4755 435
1186 3300053177 Ga0500636_0003773 Ga0500636_0003773_5383_6750 435
1187 3300053723 Ga0500567_009748 Ga0500567_009748_2956_4314 435
1188 3300053729 Ga0500625_000039 Ga0500625_000039_24309_25667 435
1189 3300053730 Ga0500645_000134 Ga0500645_000134_5405_6736 435
1190 3300053730 Ga0500645_000767 Ga0500645_000767_1533_3023 435
1191 iso_pu_bacteria 2599185354 2600200336 435
1192 iso_pu_bacteria 2739367664 2739649478 435
1193 iso_pu_bacteria 2739367865 2740027951 435
1194 iso_pu_bacteria 2751185897 2753763883 435
1195 iso_pu_bacteria 2830075706 2830076954 435
1196 iso_pu_bacteria 2885429604 2885430331 435
1197 iso_pu_bacteria 2928027323 2928030281 435
1198 iso_pu_bacteria 2946787523 2946787723 435
1199 iso_pu_bacteria 2984555340 2984558858 435
1200 iso_pu_bacteria 2984564862 2984566628 435
1201 iso_pu_bacteria 2990265787 2990266543 435
1202 iso_pu_bacteria 2993356040 2993357824 435
1203 iso_pu_bacteria 2993693658 2993695659 435
1204 iso_pu_bacteria 8057101203 8057103754 435
1205 3300001904 JGI24736J21556_1000185 JGI24736J21556_10001859 436
1206 3300001915 JGI24741J21665_1000045 JGI24741J21665_100004524 436
1207 3300001989 JGI24739J22299_10000095 JGI24739J22299_100000958 436
1208 3300001989 JGI24739J22299_10011937 JGI24739J22299_100119372 436
1209 3300001990 JGI24737J22298_10014256 JGI24737J22298_100142561 436
1210 3300002067 JGI24735J21928_10004127 JGI24735J21928_100041271 436
1211 3300002067 JGI24735J21928_10014478 JGI24735J21928_100144784 436
1212 3300002067 JGI24735J21928_10023493 JGI24735J21928_100234932 436
1213 3300002075 JGI24738J21930_10000967 JGI24738J21930_100009678 436
1214 3300003214 JGI25165J46597_1000043 JGI25165J46597_1000043148 436
1215 3300003322 rootL2_10134394 rootL2_101343949 436
1216 3300005289 Ga0065704_10002519 Ga0065704_100025193 436
1217 3300005327 Ga0070658_10107179 Ga0070658_101071792 436
1218 3300005331 Ga0070670_100221670 Ga0070670_1002216701 436
1219 3300005335 Ga0070666_10000160 Ga0070666_100001605 436
1220 3300005335 Ga0070666_10026239 Ga0070666_100262393 436
1221 3300005339 Ga0070660_100006402 Ga0070660_1000064026 436
1222 3300005339 Ga0070660_100043168 Ga0070660_1000431684 436
1223 3300005344 Ga0070661_100224086 Ga0070661_1002240861 436
1224 3300005347 Ga0070668_100031066 Ga0070668_1000310662 436
1225 3300005347 Ga0070668_100103426 Ga0070668_1001034261 436
1226 3300005347 Ga0070668_100197028 Ga0070668_1001970282 436
1227 3300005353 Ga0070669_100000013 Ga0070669_100000013146 436
1228 3300005353 Ga0070669_100045809 Ga0070669_1000458093 436
1229 3300005355 Ga0070671_100000009 Ga0070671_10000000977 436
1230 3300005355 Ga0070671_100016699 Ga0070671_1000166994 436
1231 3300005367 Ga0070667_100000024 Ga0070667_10000002498 436
1232 3300005455 Ga0070663_100015679 Ga0070663_1000156794 436
1233 3300005457 Ga0070662_100048101 Ga0070662_1000481013 436
1234 3300005457 Ga0070662_100096720 Ga0070662_1000967202 436
1235 3300005539 Ga0068853_100013242 Ga0068853_1000132428 436
1236 3300005548 Ga0070665_100144530 Ga0070665_1001445302 436
1237 3300005563 Ga0068855_100155318 Ga0068855_1001553182 436
1238 3300005577 Ga0068857_100005280 Ga0068857_1000052804 436
1239 3300005577 Ga0068857_100049639 Ga0068857_1000496392 436
1240 3300005577 Ga0068857_100066411 Ga0068857_1000664114 436
1241 3300005614 Ga0068856_100009436 Ga0068856_1000094367 436
1242 3300005616 Ga0068852_100000753 Ga0068852_1000007537 436
1243 3300005617 Ga0068859_100006922 Ga0068859_1000069223 436
1244 3300005719 Ga0068861_100004608 Ga0068861_1000046083 436
1245 3300005841 Ga0068863_100000082 Ga0068863_10000008222 436
1246 3300005842 Ga0068858_100003432 Ga0068858_10000343210 436
1247 3300005843 Ga0068860_100018956 Ga0068860_1000189562 436
1248 3300005844 Ga0068862_100004544 Ga0068862_1000045449 436
1249 3300006931 Ga0097620_100006922 Ga0097620_1000069223 436
1250 3300009093 Ga0105240_10098810 Ga0105240_100988101 436
1251 3300009174 Ga0105241_10013534 Ga0105241_100135348 436
1252 3300009177 Ga0105248_10315041 Ga0105248_103150412 436
1253 3300012513 Ga0157326_1000338 Ga0157326_10003387 436
1254 3300013104 Ga0157370_10000069 Ga0157370_1000006935 436
1255 3300013105 Ga0157369_10038626 Ga0157369_100386262 436
1256 3300013306 Ga0163162_10001741 Ga0163162_100017418 436
1257 3300025250 Ga0209026_1000650 Ga0209026_10006508 436
1258 3300025254 Ga0209148_1000238 Ga0209148_100023832 436
1259 3300025254 Ga0209148_1003278 Ga0209148_10032784 436
1260 3300025261 Ga0209233_1000079 Ga0209233_1000079122 436
1261 3300025903 Ga0207680_10001210 Ga0207680_100012106 436
1262 3300025903 Ga0207680_10005315 Ga0207680_100053153 436
1263 3300025904 Ga0207647_10000497 Ga0207647_1000049721 436
1264 3300025904 Ga0207647_10043369 Ga0207647_100433694 436
1265 3300025909 Ga0207705_10179745 Ga0207705_101797452 436
1266 3300025913 Ga0207695_10033073 Ga0207695_100330737 436
1267 3300025919 Ga0207657_10041918 Ga0207657_100419183 436
1268 3300025919 Ga0207657_10119347 Ga0207657_101193472 436
1269 3300025919 Ga0207657_10134006 Ga0207657_101340063 436
1270 3300025923 Ga0207681_10000008 Ga0207681_1000000886 436
1271 3300025923 Ga0207681_10044582 Ga0207681_100445824 436
1272 3300025924 Ga0207694_10055561 Ga0207694_100555613 436
1273 3300025925 Ga0207650_10001576 Ga0207650_100015763 436
1274 3300025931 Ga0207644_10000006 Ga0207644_1000000676 436
1275 3300025931 Ga0207644_10017065 Ga0207644_100170653 436
1276 3300025949 Ga0207667_10086736 Ga0207667_100867364 436
1277 3300025972 Ga0207668_10000647 Ga0207668_1000064721 436
1278 3300025972 Ga0207668_10001332 Ga0207668_1000133210 436
1279 3300025986 Ga0207658_10000022 Ga0207658_1000002282 436
1280 3300026041 Ga0207639_10000691 Ga0207639_1000069111 436
1281 3300026067 Ga0207678_10000218 Ga0207678_1000021834 436
1282 3300026078 Ga0207702_10002451 Ga0207702_1000245110 436
1283 3300026078 Ga0207702_10028110 Ga0207702_100281103 436
1284 3300026088 Ga0207641_10000139 Ga0207641_1000013982 436
1285 3300026088 Ga0207641_10321469 Ga0207641_103214691 436
1286 3300026095 Ga0207676_10000613 Ga0207676_1000061329 436
1287 3300026116 Ga0207674_10037284 Ga0207674_100372844 436
1288 3300026116 Ga0207674_10050697 Ga0207674_100506973 436
1289 3300026116 Ga0207674_10057730 Ga0207674_100577303 436
1290 3300026118 Ga0207675_100000533 Ga0207675_10000053338 436
1291 3300026142 Ga0207698_10000130 Ga0207698_1000013051 436
1292 3300027866 Ga0209813_10000111 Ga0209813_1000011120 436
1293 3300028379 Ga0268266_10115169 Ga0268266_101151692 436
1294 3300028380 Ga0268265_10000601 Ga0268265_1000060128 436
1295 3300028381 Ga0268264_10000310 Ga0268264_100003108 436
1296 3300031548 Ga0307408_100002167 Ga0307408_1000021678 436
1297 3300031731 Ga0307405_10029241 Ga0307405_100292411 436
1298 3300031731 Ga0307405_10047559 Ga0307405_100475593 436
1299 3300031731 Ga0307405_10098046 Ga0307405_100980463 436
1300 3300031911 Ga0307412_10023819 Ga0307412_100238193 436
1301 3300032004 Ga0307414_10224461 Ga0307414_102244611 436
1302 3300037312 Ga0395899_0001521 Ga0395899_0001521_330_1667 436
1303 3300037471 Ga0395905_0109712 Ga0395905_0109712_703_2040 436
1304 3300037853 Ga0436364_0910692 Ga0436364_0910692_1138_2478 436
1305 3300038705 Ga0237819_00949 Ga0237819_00949_3411_4748 436
1306 3300039145 Ga0237816_00649 Ga0237816_00649_1575_2912 436
1307 3300041452 Ga0451793_0729188 Ga0451793_0729188_176_1513 436
1308 3300041462 Ga0451806_691803 Ga0451806_691803_346_1683 436
1309 3300044658 Ga0466972_0012842 Ga0466972_0012842_1943_3280 436
1310 3300044684 Ga0466966_0060715 Ga0466966_0060715_248_1585 436
1311 3300044735 Ga0466968_0014787 Ga0466968_0014787_737_2095 436
1312 3300044901 Ga0466960_0058600 Ga0466960_0058600_165_1502 436
1313 3300046453 Ga0495627_000157 Ga0495627_000157_18875_20185 436
1314 3300046453 Ga0495627_000318 Ga0495627_000318_24361_25701 436
1315 3300046460 Ga0495638_0000018 Ga0495638_0000018_366430_367800 436
1316 3300046460 Ga0495638_0013831 Ga0495638_0013831_1519_2871 436
1317 3300046471 Ga0495650_0006704 Ga0495650_0006704_1479_2819 436
1318 3300046491 Ga0495584_0018885 Ga0495584_0018885_792_2132 436
1319 3300046506 Ga0495583_0002170 Ga0495583_0002170_14777_16147 436
1320 3300046507 Ga0495606_0003780 Ga0495606_0003780_2881_4221 436
1321 3300046507 Ga0495606_0080258 Ga0495606_0080258_480_1820 436
1322 3300046512 Ga0495610_0000389 Ga0495610_0000389_29413_30723 436
1323 3300046513 Ga0495616_0000880 Ga0495616_0000880_18758_20068 436
1324 3300046519 Ga0495632_0000042 Ga0495632_0000042_25873_27213 436
1325 3300046519 Ga0495632_0001274 Ga0495632_0001274_16099_17469 436
1326 3300046520 Ga0495637_0001047 Ga0495637_0001047_15715_17055 436
1327 3300046520 Ga0495637_0007051 Ga0495637_0007051_2769_4079 436
1328 3300046522 Ga0495643_0000005 Ga0495643_0000005_415920_417260 436
1329 3300046524 Ga0495648_0000144 Ga0495648_0000144_63278_64648 436
1330 3300046524 Ga0495648_0033238 Ga0495648_0033238_1115_2455 436
1331 3300046525 Ga0495663_0000015 Ga0495663_0000015_117973_119313 436
1332 3300046530 Ga0495654_0015312 Ga0495654_0015312_2307_3644 436
1333 3300046558 Ga0495633_0000197 Ga0495633_0000197_46004_47344 436
1334 3300046558 Ga0495633_0000262 Ga0495633_0000262_25873_27213 436
1335 3300046665 Ga0495661_0088828 Ga0495661_0088828_75_1385 436
1336 3300046692 Ga0495671_0000007 Ga0495671_0000007_415854_417194 436
1337 3300046692 Ga0495671_0000060 Ga0495671_0000060_104924_106294 436
1338 3300047469 Ga0495673_0000088 Ga0495673_0000088_104924_106294 436
1339 3300047469 Ga0495673_0016447 Ga0495673_0016447_1660_3000 436
1340 3300047470 Ga0495681_0000006 Ga0495681_0000006_181247_182557 436
1341 3300047470 Ga0495681_0016802 Ga0495681_0016802_1459_2799 436
1342 3300047472 Ga0495686_0000197 Ga0495686_0000197_2112_3467 436
1343 3300047472 Ga0495686_0000588 Ga0495686_0000588_2895_4235 436
1344 3300047472 Ga0495686_0004312 Ga0495686_0004312_9930_11270 436
1345 3300047472 Ga0495686_0054433 Ga0495686_0054433_1127_2437 436
1346 3300047472 Ga0495686_0125900 Ga0495686_0125900_86_1396 436
1347 3300048911 Ga0496108_0001297 Ga0496108_0001297_1522_2832 436
1348 3300048919 Ga0496116_0041259 Ga0496116_0041259_753_2063 436
1349 3300048920 Ga0496117_0013629 Ga0496117_0013629_5137_6447 436
1350 3300048921 Ga0496118_0031034 Ga0496118_0031034_2805_4142 436
1351 3300048924 Ga0496121_0002144 Ga0496121_0002144_1317_2627 436
1352 3300048925 Ga0496122_0002984 Ga0496122_0002984_10179_11516 436
1353 3300048925 Ga0496122_0017578 Ga0496122_0017578_1768_3105 436
1354 3300048925 Ga0496122_0088083 Ga0496122_0088083_397_1749 436
1355 3300048926 Ga0496123_0009579 Ga0496123_0009579_6361_7698 436
1356 3300048926 Ga0496123_0074867 Ga0496123_0074867_240_1577 436
1357 3300048929 Ga0496126_0014568 Ga0496126_0014568_1327_2637 436
1358 3300049515 Ga0501292_000117 Ga0501292_000117_2548_3861 436
1359 3300049517 Ga0501294_000670 Ga0501294_000670_2397_3716 436
1360 3300049570 Ga0501033_0110784 Ga0501033_0110784_445_1800 436
1361 3300049579 Ga0501043_0026913 Ga0501043_0026913_206_1561 436
1362 3300049579 Ga0501043_0058007 Ga0501043_0058007_405_1751 436
1363 3300049580 Ga0501046_0064267 Ga0501046_0064267_1286_2635 436
1364 3300049581 Ga0501047_0015644 Ga0501047_0015644_4600_5946 436
1365 3300049662 Ga0501222_001581 Ga0501222_001581_1718_3055 436
1366 3300049663 Ga0501223_000025 Ga0501223_000025_1640_2950 436
1367 3300049679 Ga0501249_001102 Ga0501249_001102_1259_2605 436
1368 3300049686 Ga0501257_002893 Ga0501257_002893_1616_2953 436
1369 3300049690 Ga0501261_000498 Ga0501261_000498_3597_4910 436
1370 3300049705 Ga0501225_0000842 Ga0501225_0000842_6482_7792 436
1371 3300049775 Ga0501279_000004 Ga0501279_000004_171840_173153 436
1372 3300049776 Ga0501280_000014 Ga0501280_000014_53855_55168 436
1373 3300049777 Ga0501281_00189 Ga0501281_00189_51_1364 436
1374 3300049823 Ga0501044_0102020 Ga0501044_0102020_1210_2556 436
1375 3300050494 nmdc:mga06z11_195_c1 nmdc:mga06z11_195_c1_2721_4031 436
1376 3300050495 nmdc:mga04h51_420_c1 nmdc:mga04h51_420_c1_8052_9362 436
1377 3300053087 Ga0500643_000093 Ga0500643_000093_90351_91664 436
1378 3300053116 Ga0500592_000056 Ga0500592_000056_30079_31416 436
1379 3300053153 Ga0500616_0072211 Ga0500616_0072211_241_1581 436
1380 3300053157 Ga0500624_000024 Ga0500624_000024_69399_70715 436
1381 3300053157 Ga0500624_000105 Ga0500624_000105_32784_34142 436
1382 3300053158 Ga0500627_0000844 Ga0500627_0000844_2452_3789 436
1383 3300053158 Ga0500627_0011244 Ga0500627_0011244_18_1328 436
1384 3300053177 Ga0500636_0034004 Ga0500636_0034004_1439_2797 436
1385 iso_pu_bacteria 2512564014 2512643021 436
1386 iso_pu_bacteria 2643221541 2643729421 436
1387 iso_pu_bacteria 2643221605 2644039139 436
1388 iso_pu_bacteria 2643221606 2644045897 436
1389 iso_pu_bacteria 2643221671 2644393474 436
1390 iso_pu_bacteria 2775507255 2778124311 436
1391 iso_pu_bacteria 2919709256 2919709946 436

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

60

489

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pqc-assembly1.cif.gz_A cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog 0.9835 2 435
2pqd-assembly1.cif.gz_A a100g cp4 epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog 0.9834 2 435
3tr1-assembly1.cif.gz_A structure of a 3-phosphoshikimate 1-carboxyvinyltransferase (aroa) from coxiella burnetii 0.9776 2 433
3slh-assembly3.cif.gz_C 1.70 angstrom resolution structure of 3-phosphoshikimate 1-carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate 0.9774 2 433
2pqc-assembly1.cif.gz_A cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog 0.9768 2 435
ID Description Score Start End Superfamily
2gg6A02 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9895 19 233 3.65.10.10
2gg6A02 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9849 19 233 3.65.10.10
2ggaA01 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9728 234 435 3.65.10.10
5bufA01 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9693 234 434 3.65.10.10
af_Q05615_22_211_3.65.10.10 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.957 18 209 3.65.10.10
ID Description Score Start End GO Terms
AF-A0A0E9MP87-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) 0.9955 1 432 GO:0003866
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-A0A7U4LE28-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) 0.9953 1 432 GO:0003866
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-A0A529LR22-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase 0.9945 196 342 GO:0003866
GO:0009423
AF-A0A1G7SGL2-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) 0.9929 2 434 GO:0003866
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-A0A523G0H3-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) 0.9927 2 435 GO:0003866
GO:0005737
GO:0008652
GO:0009073
GO:0009423

Feature Viewer

pLDDT pTM Quality
95.15 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map