F493595
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1391 | 825 | 1029 | 443 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0017887|Ga0495625_0017887_1654_3144 |
| Length | 496 |
| Sequence | MKTGAAKVSLPRSVGRLAIADPRCQKPPVIFSTSPSLADSGAASNRTNFDMAHDAQKMVFEPGGPLRGTVTVPGDKSISHRSLMLSALAVGESHVSGLLEGEDVLATAAAMRALGAQIERDADGTWRIYGVGVGSLVQPTTALDMGNSGTSTRLLMGLLASHALTATFVGDASLSKRPMGRVTDPLGLMGATFTASPGGRLPLTMRGIVPAVPIEYRLPVASAQVKSAVLLAGLNTPGITRIIEPVPTRDHSERMLRGFGADLTVEVDDDGTRHIAIRGEAELKPQTLVVPGDPSSAAFPVVAALITPGSEVRVNNVGMNPTRTGVFKMLQAMGADLTFTNERDVGGEPVADLVARYSRLTGIDVPSDIAPSMIDEFPIFFVAASFAKGRTTTSGLDELRVKESDRLALMAKNLARIGARVEEQDDGLLIDGTDGEPLDGGNKAPTIGAELDHRIAMSFAVAGQATKGGLAIDDMSPVATSFPGFVGLLRTLKGEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 4 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 5 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 6 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 7 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 8 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 9 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 10 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 11 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 12 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 13 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 14 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 15 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 16 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 17 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 18 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 19 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 20 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 21 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 22 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 23 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 24 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 25 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 26 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 27 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 28 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 29 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 30 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 31 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 32 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 33 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 34 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 35 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 36 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 37 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 38 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 39 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 40 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 41 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 42 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 43 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 44 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 45 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 46 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 47 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 48 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 49 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 50 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 51 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 52 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 53 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 54 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 55 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 56 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 57 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 58 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 59 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 60 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 61 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 62 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 63 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 64 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 65 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 66 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 67 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 68 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 69 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 70 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 71 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 72 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 73 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 74 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 75 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 76 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 77 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 78 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 79 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 80 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 81 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 82 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 83 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 84 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 85 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 86 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 87 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 88 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 89 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 90 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 91 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 92 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 93 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 94 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 95 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 96 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 97 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 98 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 99 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 100 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 101 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 102 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 103 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 104 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 105 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 106 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 107 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 108 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 109 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 110 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 111 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 112 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 113 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 114 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 115 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 116 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 117 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 118 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 119 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 120 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 121 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 122 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 123 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 124 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 125 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 126 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 127 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 128 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 129 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 130 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 131 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 132 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 133 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 134 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 135 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 136 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 137 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 138 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 139 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 140 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 141 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 142 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 143 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 144 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 145 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 146 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 147 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 148 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 149 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 150 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 151 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 152 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 153 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 154 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 155 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 156 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 157 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 158 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 159 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 160 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 161 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 162 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 163 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 164 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 165 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 166 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 167 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 168 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 169 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 170 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 171 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 172 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 173 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 174 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 175 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 176 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 177 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 178 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 179 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 180 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 181 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 182 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 183 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 184 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 185 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 186 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 187 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 188 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 189 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 190 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 191 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 192 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 193 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 194 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 195 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 196 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 197 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 198 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 199 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 200 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 201 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 202 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 203 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 204 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 205 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 206 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 207 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 208 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 209 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 210 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 211 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 212 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 213 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 214 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 215 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 216 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 217 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 218 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 219 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 220 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 221 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 222 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 223 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 224 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 225 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 226 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 227 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 228 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 229 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 230 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 231 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 232 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 233 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 234 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 235 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 236 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 237 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 238 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 239 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 240 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 241 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 242 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 243 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 244 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 245 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 246 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 247 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 248 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 249 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 250 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 251 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 252 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 253 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 254 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 255 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 256 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 257 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 258 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 259 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 260 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 261 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 262 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 263 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 264 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 265 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 266 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 267 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 268 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 269 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 270 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 271 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 272 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 273 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 274 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 275 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 276 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 277 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 278 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 279 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 280 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 281 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 282 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 283 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 284 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 285 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 286 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 287 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 288 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 289 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 290 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 291 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 292 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 293 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 294 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 295 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 296 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 297 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 298 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 299 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 300 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 301 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 302 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 303 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 304 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 305 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 306 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 307 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 308 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 309 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 310 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 311 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 312 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 313 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 314 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 315 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 316 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 317 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 318 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 319 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 320 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 321 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 322 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 323 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 324 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 325 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 326 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 327 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 328 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 329 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 330 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 331 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 332 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 333 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 334 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 335 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 336 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 337 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 338 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 339 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 340 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 341 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 342 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 343 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 344 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 345 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 346 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 347 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 348 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 349 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 350 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 351 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 352 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 353 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 354 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 355 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 356 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 357 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 358 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 359 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 360 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 361 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 362 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 363 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 364 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 365 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 366 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 367 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 368 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 369 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 370 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 371 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 372 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 373 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 374 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 375 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 379 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 380 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 381 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 382 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 383 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 384 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 385 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 386 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 387 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 388 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 389 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 390 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 391 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 392 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 393 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 394 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 395 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 396 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 397 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 398 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 399 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 400 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 401 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 402 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 403 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 404 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 405 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 406 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 407 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 408 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 409 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 410 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 411 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 412 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 413 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 414 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 415 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 416 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 417 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 418 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 419 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 420 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 421 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 422 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 423 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 424 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 425 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 426 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 427 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 428 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 429 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 430 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 431 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 432 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 433 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 434 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 435 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 436 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 437 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 438 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 440 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 441 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 442 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 443 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 444 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 445 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 446 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 448 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 449 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 452 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 453 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 454 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 455 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 456 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 457 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 458 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 459 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 460 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 461 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 462 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 463 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 464 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 465 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 466 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 467 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 468 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 469 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 470 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 471 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 472 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 473 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 474 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 475 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 476 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 477 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 478 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 479 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 480 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 481 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 482 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 483 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 484 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 486 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 487 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 488 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 489 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 490 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 491 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 492 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 493 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 494 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 495 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 496 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 497 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 498 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 499 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 500 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 501 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 502 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 503 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 504 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 505 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 506 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 507 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 518 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 527 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 529 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 530 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 531 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 532 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 533 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 534 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 535 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 537 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 544 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 545 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 546 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 547 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 548 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 549 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 550 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 551 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 552 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 553 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 557 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 558 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 559 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 561 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 565 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 566 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 567 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 568 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 569 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 570 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 571 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 572 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 573 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 574 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 575 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 576 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 577 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 578 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 579 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 580 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 581 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 582 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 583 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 584 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 585 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 586 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 587 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 588 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 589 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 590 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 591 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 592 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 593 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 594 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 595 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 596 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 597 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 598 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 599 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 600 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 601 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 602 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 603 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 604 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 605 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 606 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 607 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 608 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 609 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 610 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 611 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 612 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 613 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 614 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 615 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 616 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 617 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 618 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 619 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 620 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 621 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 684 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 685 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 686 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 687 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 688 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 689 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 690 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 691 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 692 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 693 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 694 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 695 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 696 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 697 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 698 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 699 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 700 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 701 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 702 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 703 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 704 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 705 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 706 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 707 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 708 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 709 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 711 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 712 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 713 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 714 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 715 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 716 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 717 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 718 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 719 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 720 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 721 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 722 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 723 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 724 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 725 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 726 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 727 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 728 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 729 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 730 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 731 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 732 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 733 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 734 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 735 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 736 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 737 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 738 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 739 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 740 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 741 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 742 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 743 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 744 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 745 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 746 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 747 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 748 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 749 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 750 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 751 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 752 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 753 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 754 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 755 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 756 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 757 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 758 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 759 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 760 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 761 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 762 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 763 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 764 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 765 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 766 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 767 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 769 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 771 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 772 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 773 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 774 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 775 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 776 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 777 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 778 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 779 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 780 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 781 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 782 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 783 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 784 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 785 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 786 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 787 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 788 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 789 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 790 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 791 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 792 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 793 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 794 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 795 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 796 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 797 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 798 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 799 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 800 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 801 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 802 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 803 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 804 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 805 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 806 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 807 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 808 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 809 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 810 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 811 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 812 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 813 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 814 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 815 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 816 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 817 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 818 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 819 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 820 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 821 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 822 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 823 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 824 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
| 825 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.47 |
| Metatranscriptomes | 0.5 |
| Isolates | 26.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 11.79 |
| Nodule | 19.48 |
| Rhizoplane | 2.95 |
| Rhizosphere | 54.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000185 | 3300001904 | Bacteria | 11068 |
| 2 | JGI24736J21556_1001548 | 3300001904 | Bacteria | 4184 |
| 3 | JGI24741J21665_1000045 | 3300001915 | Bacteria | 30044 |
| 4 | JGI24739J22299_10000095 | 3300001989 | Bacteria | 25993 |
| 5 | JGI24739J22299_10003612 | 3300001989 | Bacteria | 5909 |
| 6 | JGI24739J22299_10011937 | 3300001989 | Bacteria | 3195 |
| 7 | JGI24737J22298_10014256 | 3300001990 | Bacteria | 2582 |
| 8 | JGI24735J21928_10004127 | 3300002067 | Bacteria | 4906 |
| 9 | JGI24735J21928_10008073 | 3300002067 | Bacteria | 3416 |
| 10 | JGI24735J21928_10014478 | 3300002067 | Bacteria | 2469 |
| 11 | JGI24735J21928_10023493 | 3300002067 | Bacteria | 1869 |
| 12 | JGI24750J21931_1000436 | 3300002070 | Bacteria | 6775 |
| 13 | JGI24748J21848_1000063 | 3300002074 | Bacteria | 40664 |
| 14 | JGI24738J21930_10000967 | 3300002075 | Bacteria | 8242 |
| 15 | JGI24749J21850_1000018 | 3300002076 | Bacteria | 32428 |
| 16 | JGI24034J26672_10000007 | 3300002239 | Bacteria | 224370 |
| 17 | JGI24751J29686_10000115 | 3300002459 | Bacteria | 42174 |
| 18 | JGI24751J29686_10000235 | 3300002459 | Bacteria | 22528 |
| 19 | JGI24751J29686_10004035 | 3300002459 | Bacteria | 2970 |
| 20 | JGI25155J39150_1000069 | 3300002704 | Bacteria | 64645 |
| 21 | JGI25156J39149_1000095 | 3300002705 | Bacteria | 64645 |
| 22 | JGI25154J39366_1000866 | 3300002738 | Bacteria | 13083 |
| 23 | JGI25157J39369_1000732 | 3300002741 | Bacteria | 17479 |
| 24 | JGI25150J39212_1000126 | 3300002774 | Bacteria | 42982 |
| 25 | JGI25159J45721_1003717 | 3300002987 | Bacteria | 5291 |
| 26 | JGI25159J45721_1006593 | 3300002987 | Bacteria | 3456 |
| 27 | JGI25151J46595_10003658 | 3300003187 | Bacteria | 8381 |
| 28 | JGI25151J46595_10007368 | 3300003187 | Bacteria | 5402 |
| 29 | JGI25165J46597_1000041 | 3300003214 | Bacteria | 272566 |
| 30 | JGI25165J46597_1000043 | 3300003214 | Bacteria | 264515 |
| 31 | JGI25153J46596_10000115 | 3300003215 | Bacteria | 91366 |
| 32 | JGI25153J46596_10000305 | 3300003215 | Bacteria | 36679 |
| 33 | JGI25153J46596_10009756 | 3300003215 | Bacteria | 4416 |
| 34 | JGI25153J46596_10019462 | 3300003215 | Bacteria | 2600 |
| 35 | JGI25153J46596_10021828 | 3300003215 | Bacteria | 2378 |
| 36 | rootL2_10134394 | 3300003322 | Bacteria | 7000 |
| 37 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 38 | JGI25160J50197_1000287 | 3300003354 | Bacteria | 36528 |
| 39 | JGI25160J50197_1005283 | 3300003354 | Bacteria | 5402 |
| 40 | JGI25161J50226_1000176 | 3300003374 | Bacteria | 42677 |
| 41 | JGI25161J50226_1000299 | 3300003374 | Bacteria | 27879 |
| 42 | JGI25161J50226_1003479 | 3300003374 | Bacteria | 3584 |
| 43 | Ga0055525_1000104 | 3300003759 | Bacteria | 134560 |
| 44 | Ga0055542_1000025 | 3300003762 | Bacteria | 263538 |
| 45 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 46 | Ga0055526_1004618 | 3300003771 | Bacteria | 8205 |
| 47 | Ga0055526_1007718 | 3300003771 | Bacteria | 5523 |
| 48 | Ga0055526_1007837 | 3300003771 | Bacteria | 5462 |
| 49 | Ga0055524_1000056 | 3300003775 | Bacteria | 141764 |
| 50 | Ga0055524_1006032 | 3300003775 | Bacteria | 5317 |
| 51 | Ga0055524_1006689 | 3300003775 | Bacteria | 4979 |
| 52 | Ga0055536_1001996 | 3300003781 | Bacteria | 11706 |
| 53 | Ga0055528_1018190 | 3300003790 | Bacteria | 2393 |
| 54 | Ga0055530_10000027 | 3300003791 | Bacteria | 129838 |
| 55 | Ga0055530_10000931 | 3300003791 | Bacteria | 23980 |
| 56 | Ga0055530_10011442 | 3300003791 | Bacteria | 3186 |
| 57 | Ga0055530_10013499 | 3300003791 | Bacteria | 2785 |
| 58 | Ga0055540_1001336 | 3300003792 | Bacteria | 14852 |
| 59 | Ga0055531_10000013 | 3300003794 | Bacteria | 187583 |
| 60 | Ga0055531_10014149 | 3300003794 | Bacteria | 3616 |
| 61 | Ga0055531_10027395 | 3300003794 | Bacteria | 2001 |
| 62 | Ga0055543_1000034 | 3300004625 | Bacteria | 128668 |
| 63 | Ga0055543_1000114 | 3300004625 | Bacteria | 69144 |
| 64 | Ga0055543_1001135 | 3300004625 | Bacteria | 11409 |
| 65 | Ga0058863_11910898 | 3300004799 | Bacteria | 1853 |
| 66 | Ga0058861_12061624 | 3300004800 | Bacteria | 1765 |
| 67 | Ga0058862_12737959 | 3300004803 | Bacteria | 1855 |
| 68 | Ga0065165_1000047 | 3300005262 | Bacteria | 197811 |
| 69 | Ga0065165_1003833 | 3300005262 | Bacteria | 10014 |
| 70 | Ga0065165_1004051 | 3300005262 | Bacteria | 9518 |
| 71 | Ga0065165_1012721 | 3300005262 | Bacteria | 3403 |
| 72 | Ga0065165_1013057 | 3300005262 | Bacteria | 3328 |
| 73 | Ga0065704_10002519 | 3300005289 | Bacteria | 5081 |
| 74 | Ga0065704_10070744 | 3300005289 | Bacteria | 16791 |
| 75 | Ga0065707_10084641 | 3300005295 | Bacteria | 6937 |
| 76 | Ga0065707_10149171 | 3300005295 | Bacteria | 1677 |
| 77 | Ga0070658_10000033 | 3300005327 | Bacteria | 147380 |
| 78 | Ga0070658_10014420 | 3300005327 | Bacteria | 6342 |
| 79 | Ga0070658_10107179 | 3300005327 | Bacteria | 2312 |
| 80 | Ga0070676_10003672 | 3300005328 | Bacteria | 8035 |
| 81 | Ga0070690_100000024 | 3300005330 | Bacteria | 69563 |
| 82 | Ga0070690_100000483 | 3300005330 | Bacteria | 20028 |
| 83 | Ga0070690_100014932 | 3300005330 | Bacteria | 4620 |
| 84 | Ga0070690_100043813 | 3300005330 | Bacteria | 2839 |
| 85 | Ga0070670_100000074 | 3300005331 | Bacteria | 97530 |
| 86 | Ga0070670_100000409 | 3300005331 | Bacteria | 35372 |
| 87 | Ga0070670_100004278 | 3300005331 | Bacteria | 11948 |
| 88 | Ga0070670_100044213 | 3300005331 | Bacteria | 3830 |
| 89 | Ga0070670_100221670 | 3300005331 | Bacteria | 1645 |
| 90 | Ga0070666_10000017 | 3300005335 | Bacteria | 190526 |
| 91 | Ga0070666_10000160 | 3300005335 | Bacteria | 46166 |
| 92 | Ga0070666_10001625 | 3300005335 | Bacteria | 13672 |
| 93 | Ga0070666_10026239 | 3300005335 | Bacteria | 3804 |
| 94 | Ga0070666_10026566 | 3300005335 | Bacteria | 3784 |
| 95 | Ga0070680_100169761 | 3300005336 | Bacteria | 1835 |
| 96 | Ga0068868_100002423 | 3300005338 | Bacteria | 12922 |
| 97 | Ga0070660_100000225 | 3300005339 | Bacteria | 37405 |
| 98 | Ga0070660_100006402 | 3300005339 | Bacteria | 8160 |
| 99 | Ga0070660_100022696 | 3300005339 | Bacteria | 4645 |
| 100 | Ga0070660_100043168 | 3300005339 | Bacteria | 3444 |
| 101 | Ga0070660_100108019 | 3300005339 | Bacteria | 2211 |
| 102 | Ga0070689_100043036 | 3300005340 | Bacteria | 3469 |
| 103 | Ga0070689_100095475 | 3300005340 | Bacteria | 2348 |
| 104 | Ga0070661_100224086 | 3300005344 | Bacteria | 1443 |
| 105 | Ga0070692_10005729 | 3300005345 | Bacteria | 5334 |
| 106 | Ga0070668_100000197 | 3300005347 | Bacteria | 39485 |
| 107 | Ga0070668_100031066 | 3300005347 | Bacteria | 4063 |
| 108 | Ga0070668_100080044 | 3300005347 | Bacteria | 2559 |
| 109 | Ga0070668_100103426 | 3300005347 | Bacteria | 2259 |
| 110 | Ga0070668_100174904 | 3300005347 | Bacteria | 1750 |
| 111 | Ga0070668_100197028 | 3300005347 | Bacteria | 1652 |
| 112 | Ga0070669_100000013 | 3300005353 | Bacteria | 210577 |
| 113 | Ga0070669_100000058 | 3300005353 | Bacteria | 110162 |
| 114 | Ga0070669_100003312 | 3300005353 | Bacteria | 11582 |
| 115 | Ga0070669_100013530 | 3300005353 | Bacteria | 5800 |
| 116 | Ga0070669_100045809 | 3300005353 | Bacteria | 3188 |
| 117 | Ga0070675_100007844 | 3300005354 | Bacteria | 8273 |
| 118 | Ga0070671_100000009 | 3300005355 | Bacteria | 206508 |
| 119 | Ga0070671_100000482 | 3300005355 | Bacteria | 27745 |
| 120 | Ga0070671_100004829 | 3300005355 | Bacteria | 10718 |
| 121 | Ga0070671_100013940 | 3300005355 | Bacteria | 6487 |
| 122 | Ga0070671_100015118 | 3300005355 | Bacteria | 6233 |
| 123 | Ga0070671_100016699 | 3300005355 | Bacteria | 5935 |
| 124 | Ga0070671_100032053 | 3300005355 | Unclassified | 4345 |
| 125 | Ga0070674_100010775 | 3300005356 | Bacteria | 5543 |
| 126 | Ga0070674_100020424 | 3300005356 | Bacteria | 4232 |
| 127 | Ga0070673_100000138 | 3300005364 | Bacteria | 34274 |
| 128 | Ga0070673_100010149 | 3300005364 | Bacteria | 6360 |
| 129 | Ga0070659_100023655 | 3300005366 | Bacteria | 4704 |
| 130 | Ga0070659_100038689 | 3300005366 | Bacteria | 3721 |
| 131 | Ga0070659_100041111 | 3300005366 | Bacteria | 3613 |
| 132 | Ga0070659_100062954 | 3300005366 | Bacteria | 2934 |
| 133 | Ga0070659_100097236 | 3300005366 | Bacteria | 2366 |
| 134 | Ga0070659_100119598 | 3300005366 | Bacteria | 2132 |
| 135 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 136 | Ga0070667_100000024 | 3300005367 | Bacteria | 191216 |
| 137 | Ga0070667_100003990 | 3300005367 | Bacteria | 12503 |
| 138 | Ga0070667_100008843 | 3300005367 | Bacteria | 8338 |
| 139 | Ga0070667_100012637 | 3300005367 | Bacteria | 6982 |
| 140 | Ga0070667_100063753 | 3300005367 | Bacteria | 3124 |
| 141 | Ga0070667_100122428 | 3300005367 | Bacteria | 2264 |
| 142 | Ga0070709_10000892 | 3300005434 | Bacteria | 16688 |
| 143 | Ga0070714_100015160 | 3300005435 | Bacteria | 6198 |
| 144 | Ga0070714_100078232 | 3300005435 | Bacteria | 2874 |
| 145 | Ga0070713_100000003 | 3300005436 | Bacteria | 245840 |
| 146 | Ga0070710_10045250 | 3300005437 | Bacteria | 2446 |
| 147 | Ga0070711_100033038 | 3300005439 | Bacteria | 3444 |
| 148 | Ga0070663_100015679 | 3300005455 | Bacteria | 4900 |
| 149 | Ga0070678_100000057 | 3300005456 | Bacteria | 40248 |
| 150 | Ga0070678_100001464 | 3300005456 | Bacteria | 12579 |
| 151 | Ga0070662_100048101 | 3300005457 | Bacteria | 3071 |
| 152 | Ga0070662_100096720 | 3300005457 | Bacteria | 2227 |
| 153 | Ga0070685_10000389 | 3300005466 | Bacteria | 26431 |
| 154 | Ga0070679_100143648 | 3300005530 | Bacteria | 2365 |
| 155 | Ga0070679_100199771 | 3300005530 | Bacteria | 1966 |
| 156 | Ga0070697_100097945 | 3300005536 | Bacteria | 2434 |
| 157 | Ga0068853_100013242 | 3300005539 | Bacteria | 6731 |
| 158 | Ga0068853_100017003 | 3300005539 | Bacteria | 5997 |
| 159 | Ga0068853_100036747 | 3300005539 | Bacteria | 4166 |
| 160 | Ga0070672_100005400 | 3300005543 | Bacteria | 8462 |
| 161 | Ga0070686_100010480 | 3300005544 | Bacteria | 5229 |
| 162 | Ga0070695_100079773 | 3300005545 | Bacteria | 2162 |
| 163 | Ga0070665_100000042 | 3300005548 | Bacteria | 292582 |
| 164 | Ga0070665_100000319 | 3300005548 | Bacteria | 74295 |
| 165 | Ga0070665_100007081 | 3300005548 | Bacteria | 11395 |
| 166 | Ga0070665_100010626 | 3300005548 | Bacteria | 9318 |
| 167 | Ga0070665_100049096 | 3300005548 | Bacteria | 4235 |
| 168 | Ga0070665_100074881 | 3300005548 | Bacteria | 3391 |
| 169 | Ga0070665_100144530 | 3300005548 | Bacteria | 2382 |
| 170 | Ga0070665_100241459 | 3300005548 | Bacteria | 1807 |
| 171 | Ga0068855_100000608 | 3300005563 | Bacteria | 43919 |
| 172 | Ga0068855_100155318 | 3300005563 | Bacteria | 2600 |
| 173 | Ga0070664_100021787 | 3300005564 | Bacteria | 5284 |
| 174 | Ga0068857_100005280 | 3300005577 | Bacteria | 11000 |
| 175 | Ga0068857_100049639 | 3300005577 | Bacteria | 3723 |
| 176 | Ga0068857_100066411 | 3300005577 | Bacteria | 3209 |
| 177 | Ga0068857_100100978 | 3300005577 | Bacteria | 2588 |
| 178 | Ga0068857_100144066 | 3300005577 | Bacteria | 2155 |
| 179 | Ga0068854_100134981 | 3300005578 | Bacteria | 1888 |
| 180 | Ga0068856_100000719 | 3300005614 | Bacteria | 36011 |
| 181 | Ga0068856_100003762 | 3300005614 | Bacteria | 15216 |
| 182 | Ga0068856_100009436 | 3300005614 | Bacteria | 9475 |
| 183 | Ga0068856_100171757 | 3300005614 | Bacteria | 2180 |
| 184 | Ga0068856_100179211 | 3300005614 | Bacteria | 2132 |
| 185 | Ga0068852_100000753 | 3300005616 | Bacteria | 21299 |
| 186 | Ga0068852_100165021 | 3300005616 | Unclassified | 2072 |
| 187 | Ga0068859_100001232 | 3300005617 | Bacteria | 26157 |
| 188 | Ga0068859_100003906 | 3300005617 | Bacteria | 15207 |
| 189 | Ga0068859_100006922 | 3300005617 | Bacteria | 11512 |
| 190 | Ga0068859_100023002 | 3300005617 | Bacteria | 6251 |
| 191 | Ga0068859_100103822 | 3300005617 | Bacteria | 2901 |
| 192 | Ga0068859_100141475 | 3300005617 | Bacteria | 2480 |
| 193 | Ga0068864_100000260 | 3300005618 | Bacteria | 47076 |
| 194 | Ga0068864_100003187 | 3300005618 | Bacteria | 13568 |
| 195 | Ga0068864_100017327 | 3300005618 | Bacteria | 6004 |
| 196 | Ga0068864_100030494 | 3300005618 | Bacteria | 4571 |
| 197 | Ga0068861_100000074 | 3300005719 | Bacteria | 48480 |
| 198 | Ga0068861_100001071 | 3300005719 | Bacteria | 16866 |
| 199 | Ga0068861_100004608 | 3300005719 | Bacteria | 9251 |
| 200 | Ga0068861_100010221 | 3300005719 | Bacteria | 6515 |
| 201 | Ga0068861_100011989 | 3300005719 | Bacteria | 6037 |
| 202 | Ga0068863_100000082 | 3300005841 | Bacteria | 105688 |
| 203 | Ga0068863_100000280 | 3300005841 | Bacteria | 52729 |
| 204 | Ga0068863_100007010 | 3300005841 | Bacteria | 11048 |
| 205 | Ga0068863_100027387 | 3300005841 | Bacteria | 5436 |
| 206 | Ga0068863_100055600 | 3300005841 | Bacteria | 3747 |
| 207 | Ga0068863_100173781 | 3300005841 | Bacteria | 2067 |
| 208 | Ga0068858_100000303 | 3300005842 | Bacteria | 52646 |
| 209 | Ga0068858_100000591 | 3300005842 | Bacteria | 37967 |
| 210 | Ga0068858_100001032 | 3300005842 | Bacteria | 28756 |
| 211 | Ga0068858_100003432 | 3300005842 | Bacteria | 15745 |
| 212 | Ga0068858_100013493 | 3300005842 | Bacteria | 7709 |
| 213 | Ga0068858_100014160 | 3300005842 | Bacteria | 7520 |
| 214 | Ga0068858_100162541 | 3300005842 | Bacteria | 2103 |
| 215 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 216 | Ga0068860_100000062 | 3300005843 | Bacteria | 190526 |
| 217 | Ga0068860_100000944 | 3300005843 | Bacteria | 32201 |
| 218 | Ga0068860_100018956 | 3300005843 | Bacteria | 6684 |
| 219 | Ga0068860_100047514 | 3300005843 | Bacteria | 4091 |
| 220 | Ga0068862_100000081 | 3300005844 | Bacteria | 113133 |
| 221 | Ga0068862_100000280 | 3300005844 | Bacteria | 56780 |
| 222 | Ga0068862_100000308 | 3300005844 | Bacteria | 53687 |
| 223 | Ga0068862_100004544 | 3300005844 | Bacteria | 11698 |
| 224 | Ga0068862_100017500 | 3300005844 | Bacteria | 5970 |
| 225 | Ga0068862_100019008 | 3300005844 | Bacteria | 5729 |
| 226 | Ga0081455_10000255 | 3300005937 | Bacteria | 69927 |
| 227 | Ga0081540_1009297 | 3300005983 | Bacteria | 6781 |
| 228 | Ga0081539_10006765 | 3300005985 | Bacteria | 10759 |
| 229 | Ga0070717_10193808 | 3300006028 | Bacteria | 1777 |
| 230 | Ga0070717_10220193 | 3300006028 | Bacteria | 1668 |
| 231 | Ga0075365_10013351 | 3300006038 | Bacteria | 4908 |
| 232 | Ga0075365_10074003 | 3300006038 | Bacteria | 2297 |
| 233 | Ga0070712_100000169 | 3300006175 | Bacteria | 35660 |
| 234 | Ga0075362_10004292 | 3300006177 | Bacteria | 5098 |
| 235 | Ga0075367_10012269 | 3300006178 | Bacteria | 4563 |
| 236 | Ga0075369_10005723 | 3300006186 | Bacteria | 4663 |
| 237 | Ga0097621_100013780 | 3300006237 | Bacteria | 6037 |
| 238 | Ga0075370_10010246 | 3300006353 | Bacteria | 4893 |
| 239 | Ga0068871_100008468 | 3300006358 | Bacteria | 7400 |
| 240 | Ga0068871_100024042 | 3300006358 | Unclassified | 4721 |
| 241 | Ga0075430_100151222 | 3300006846 | Bacteria | 1933 |
| 242 | Ga0075431_100004735 | 3300006847 | Bacteria | 13375 |
| 243 | Ga0075431_100014844 | 3300006847 | Bacteria | 7886 |
| 244 | Ga0075433_10031628 | 3300006852 | Bacteria | 4525 |
| 245 | Ga0075434_100129812 | 3300006871 | Bacteria | 2539 |
| 246 | Ga0075436_100000038 | 3300006914 | Bacteria | 82918 |
| 247 | Ga0075436_100045939 | 3300006914 | Bacteria | 3013 |
| 248 | Ga0097620_100001232 | 3300006931 | Bacteria | 26157 |
| 249 | Ga0097620_100003906 | 3300006931 | Bacteria | 15207 |
| 250 | Ga0097620_100006922 | 3300006931 | Bacteria | 11512 |
| 251 | Ga0097620_100022995 | 3300006931 | Bacteria | 6251 |
| 252 | Ga0097620_100103821 | 3300006931 | Bacteria | 2901 |
| 253 | Ga0097620_100141468 | 3300006931 | Bacteria | 2480 |
| 254 | Ga0079104_1000125 | 3300006946 | Bacteria | 110104 |
| 255 | Ga0079104_1004867 | 3300006946 | Bacteria | 5564 |
| 256 | Ga0079104_1006152 | 3300006946 | Bacteria | 4617 |
| 257 | Ga0105240_10008524 | 3300009093 | Bacteria | 14649 |
| 258 | Ga0105240_10098810 | 3300009093 | Bacteria | 3553 |
| 259 | Ga0105240_10361753 | 3300009093 | Bacteria | 1643 |
| 260 | Ga0111539_10000890 | 3300009094 | Bacteria | 39032 |
| 261 | Ga0114129_10001654 | 3300009147 | Bacteria | 30326 |
| 262 | Ga0114129_10026011 | 3300009147 | Bacteria | 8288 |
| 263 | Ga0114129_10034137 | 3300009147 | Bacteria | 7185 |
| 264 | Ga0114129_10443639 | 3300009147 | Bacteria | 1703 |
| 265 | Ga0114129_10524881 | 3300009147 | Bacteria | 1543 |
| 266 | Ga0105243_10000033 | 3300009148 | Bacteria | 180464 |
| 267 | Ga0105241_10013534 | 3300009174 | Bacteria | 5979 |
| 268 | Ga0105241_10017676 | 3300009174 | Bacteria | 5243 |
| 269 | Ga0105241_10030093 | 3300009174 | Bacteria | 4055 |
| 270 | Ga0105248_10001187 | 3300009177 | Bacteria | 29143 |
| 271 | Ga0105248_10008690 | 3300009177 | Bacteria | 11160 |
| 272 | Ga0105248_10016997 | 3300009177 | Bacteria | 8013 |
| 273 | Ga0105248_10017774 | 3300009177 | Bacteria | 7846 |
| 274 | Ga0105248_10025390 | 3300009177 | Bacteria | 6588 |
| 275 | Ga0105248_10152523 | 3300009177 | Bacteria | 2607 |
| 276 | Ga0105248_10315041 | 3300009177 | Bacteria | 1762 |
| 277 | Ga0105237_10002470 | 3300009545 | Bacteria | 22937 |
| 278 | Ga0105238_10003588 | 3300009551 | Bacteria | 15470 |
| 279 | Ga0105238_10113471 | 3300009551 | Bacteria | 2690 |
| 280 | Ga0105249_10000012 | 3300009553 | Bacteria | 292640 |
| 281 | Ga0105249_10000103 | 3300009553 | Bacteria | 118397 |
| 282 | Ga0105249_10020498 | 3300009553 | Bacteria | 5909 |
| 283 | Ga0105246_10116683 | 3300011119 | Bacteria | 1971 |
| 284 | Ga0157326_1000338 | 3300012513 | Bacteria | 5509 |
| 285 | Ga0157371_10000059 | 3300013102 | Bacteria | 170541 |
| 286 | Ga0157371_10025477 | 3300013102 | Bacteria | 4310 |
| 287 | Ga0157370_10000069 | 3300013104 | Bacteria | 112889 |
| 288 | Ga0157370_10049403 | 3300013104 | Bacteria | 4026 |
| 289 | Ga0157369_10004747 | 3300013105 | Bacteria | 15970 |
| 290 | Ga0157369_10030829 | 3300013105 | Bacteria | 5911 |
| 291 | Ga0157369_10038626 | 3300013105 | Bacteria | 5219 |
| 292 | Ga0157369_10097133 | 3300013105 | Bacteria | 3142 |
| 293 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 294 | Ga0157378_10002131 | 3300013297 | Bacteria | 17601 |
| 295 | Ga0157378_10137652 | 3300013297 | Bacteria | 2265 |
| 296 | Ga0163162_10001741 | 3300013306 | Bacteria | 20418 |
| 297 | Ga0163162_10005593 | 3300013306 | Bacteria | 12158 |
| 298 | Ga0163162_10013689 | 3300013306 | Bacteria | 7926 |
| 299 | Ga0163162_10046965 | 3300013306 | Bacteria | 4328 |
| 300 | Ga0163162_10066770 | 3300013306 | Bacteria | 3646 |
| 301 | Ga0163162_10102190 | 3300013306 | Bacteria | 2960 |
| 302 | Ga0157372_10232582 | 3300013307 | Bacteria | 2137 |
| 303 | Ga0157375_10002592 | 3300013308 | Bacteria | 15698 |
| 304 | Ga0157375_10006186 | 3300013308 | Bacteria | 10435 |
| 305 | Ga0157375_10065252 | 3300013308 | Bacteria | 3629 |
| 306 | Ga0163163_10022274 | 3300014325 | Bacteria | 5996 |
| 307 | Ga0157380_10000151 | 3300014326 | Bacteria | 39765 |
| 308 | Ga0157380_10001425 | 3300014326 | Bacteria | 15655 |
| 309 | Ga0157379_10036388 | 3300014968 | Bacteria | 4390 |
| 310 | Ga0157379_10137507 | 3300014968 | Bacteria | 2202 |
| 311 | Ga0157376_10000903 | 3300014969 | Bacteria | 19363 |
| 312 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 313 | Ga0183363_1053 | 3300015690 | Bacteria | 36839 |
| 314 | Ga0163161_10000025 | 3300017792 | Bacteria | 201127 |
| 315 | Ga0163161_10038310 | 3300017792 | Bacteria | 3438 |
| 316 | Ga0206356_11309587 | 3300020070 | Bacteria | 1807 |
| 317 | Ga0206350_11038354 | 3300020080 | Eukaryota | 1789 |
| 318 | Ga0206354_10710180 | 3300020081 | Bacteria | 1848 |
| 319 | Ga0214544_1000434 | 3300021320 | Bacteria | 75507 |
| 320 | Ga0214542_1000146 | 3300021321 | Bacteria | 103035 |
| 321 | Ga0214542_1027236 | 3300021321 | Bacteria | 2648 |
| 322 | Ga0214543_1000049 | 3300021327 | Bacteria | 149506 |
| 323 | Ga0214543_1000054 | 3300021327 | Bacteria | 140288 |
| 324 | Ga0213876_10000310 | 3300021384 | Bacteria | 42816 |
| 325 | Ga0224712_10035483 | 3300022467 | Bacteria | 1841 |
| 326 | Ga0228711_1000006 | 3300022739 | Bacteria | 202437 |
| 327 | Ga0228710_1000004 | 3300022740 | Bacteria | 250560 |
| 328 | Ga0209435_100049 | 3300025206 | Bacteria | 92067 |
| 329 | Ga0207672_1000205 | 3300025223 | Bacteria | 8314 |
| 330 | Ga0209563_100116 | 3300025230 | Bacteria | 134661 |
| 331 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 332 | Ga0207425_1004457 | 3300025245 | Bacteria | 4194 |
| 333 | Ga0209646_1000159 | 3300025246 | Bacteria | 92067 |
| 334 | Ga0209026_1000183 | 3300025250 | Bacteria | 92067 |
| 335 | Ga0209026_1000650 | 3300025250 | Bacteria | 21317 |
| 336 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 337 | Ga0209148_1000238 | 3300025254 | Bacteria | 87836 |
| 338 | Ga0209148_1003278 | 3300025254 | Bacteria | 4582 |
| 339 | Ga0209759_1000206 | 3300025256 | Bacteria | 92067 |
| 340 | Ga0209129_1000359 | 3300025258 | Bacteria | 37937 |
| 341 | Ga0209129_1006060 | 3300025258 | Bacteria | 4043 |
| 342 | Ga0209233_1000079 | 3300025261 | Bacteria | 346944 |
| 343 | Ga0209233_1000104 | 3300025261 | Bacteria | 272675 |
| 344 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 345 | Ga0209565_1000134 | 3300025263 | Bacteria | 104013 |
| 346 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 347 | Ga0209673_1000584 | 3300025273 | Bacteria | 57616 |
| 348 | Ga0209673_1003724 | 3300025273 | Bacteria | 8722 |
| 349 | Ga0209673_1004104 | 3300025273 | Bacteria | 8005 |
| 350 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 351 | Ga0209130_1000642 | 3300025284 | Bacteria | 32652 |
| 352 | Ga0209675_1003991 | 3300025291 | Bacteria | 6740 |
| 353 | Ga0209676_1001593 | 3300025292 | Bacteria | 20182 |
| 354 | Ga0209025_1000037 | 3300025294 | Bacteria | 383429 |
| 355 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 356 | Ga0209025_1000814 | 3300025294 | Bacteria | 50030 |
| 357 | Ga0209025_1011026 | 3300025294 | Bacteria | 6026 |
| 358 | Ga0209564_1000113 | 3300025295 | Bacteria | 211564 |
| 359 | Ga0209564_1001020 | 3300025295 | Bacteria | 34568 |
| 360 | Ga0209564_1006879 | 3300025295 | Bacteria | 5996 |
| 361 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 362 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 363 | Ga0209758_1001197 | 3300025297 | Bacteria | 32795 |
| 364 | Ga0209758_1004151 | 3300025297 | Bacteria | 12343 |
| 365 | Ga0209758_1008214 | 3300025297 | Bacteria | 6837 |
| 366 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 367 | Ga0209050_1000014 | 3300025298 | Bacteria | 774327 |
| 368 | Ga0209050_1002150 | 3300025298 | Bacteria | 17933 |
| 369 | Ga0209050_1009997 | 3300025298 | Bacteria | 4747 |
| 370 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 371 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 372 | Ga0209256_1000819 | 3300025299 | Bacteria | 39621 |
| 373 | Ga0209256_1002787 | 3300025299 | Bacteria | 13398 |
| 374 | Ga0209256_1007106 | 3300025299 | Bacteria | 5646 |
| 375 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 376 | Ga0207426_1000330 | 3300025302 | Bacteria | 89992 |
| 377 | Ga0207426_1000812 | 3300025302 | Bacteria | 33529 |
| 378 | Ga0207426_1028357 | 3300025302 | Bacteria | 1857 |
| 379 | Ga0209051_1000232 | 3300025303 | Bacteria | 93680 |
| 380 | Ga0209051_1009681 | 3300025303 | Bacteria | 4943 |
| 381 | Ga0209257_1000019 | 3300025304 | Bacteria | 774261 |
| 382 | Ga0209257_1003713 | 3300025304 | Bacteria | 12689 |
| 383 | Ga0209257_1005528 | 3300025304 | Bacteria | 8809 |
| 384 | Ga0209257_1018206 | 3300025304 | Bacteria | 2718 |
| 385 | Ga0207656_10043107 | 3300025321 | Bacteria | 1923 |
| 386 | Ga0207713_1004595 | 3300025735 | Bacteria | 8919 |
| 387 | Ga0207682_10011989 | 3300025893 | Bacteria | 3383 |
| 388 | Ga0207680_10000012 | 3300025903 | Bacteria | 293810 |
| 389 | Ga0207680_10001210 | 3300025903 | Bacteria | 12223 |
| 390 | Ga0207680_10005315 | 3300025903 | Bacteria | 6148 |
| 391 | Ga0207680_10025252 | 3300025903 | Bacteria | 3275 |
| 392 | Ga0207647_10000497 | 3300025904 | Bacteria | 31453 |
| 393 | Ga0207647_10001733 | 3300025904 | Bacteria | 16727 |
| 394 | Ga0207647_10025680 | 3300025904 | Bacteria | 3865 |
| 395 | Ga0207647_10043369 | 3300025904 | Bacteria | 2816 |
| 396 | Ga0207699_10000676 | 3300025906 | Bacteria | 16381 |
| 397 | Ga0207645_10002209 | 3300025907 | Bacteria | 15534 |
| 398 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 399 | Ga0207705_10000197 | 3300025909 | Bacteria | 61058 |
| 400 | Ga0207705_10016169 | 3300025909 | Bacteria | 5353 |
| 401 | Ga0207705_10179745 | 3300025909 | Bacteria | 1596 |
| 402 | Ga0207654_10000222 | 3300025911 | Bacteria | 34847 |
| 403 | Ga0207654_10000293 | 3300025911 | Bacteria | 30167 |
| 404 | Ga0207707_10160961 | 3300025912 | Bacteria | 1963 |
| 405 | Ga0207695_10000641 | 3300025913 | Bacteria | 69705 |
| 406 | Ga0207695_10033073 | 3300025913 | Bacteria | 5648 |
| 407 | Ga0207695_10069418 | 3300025913 | Bacteria | 3605 |
| 408 | Ga0207695_10080915 | 3300025913 | Bacteria | 3289 |
| 409 | Ga0207671_10002072 | 3300025914 | Bacteria | 21940 |
| 410 | Ga0207671_10003353 | 3300025914 | Bacteria | 16074 |
| 411 | Ga0207657_10041918 | 3300025919 | Bacteria | 4043 |
| 412 | Ga0207657_10087798 | 3300025919 | Bacteria | 2601 |
| 413 | Ga0207657_10105879 | 3300025919 | Bacteria | 2328 |
| 414 | Ga0207657_10119347 | 3300025919 | Bacteria | 2170 |
| 415 | Ga0207657_10134006 | 3300025919 | Bacteria | 2028 |
| 416 | Ga0207649_10000319 | 3300025920 | Bacteria | 36478 |
| 417 | Ga0207649_10055003 | 3300025920 | Bacteria | 2479 |
| 418 | Ga0207652_10056019 | 3300025921 | Bacteria | 3393 |
| 419 | Ga0207646_10046513 | 3300025922 | Unclassified | 3893 |
| 420 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 421 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 422 | Ga0207681_10000221 | 3300025923 | Bacteria | 45206 |
| 423 | Ga0207681_10000259 | 3300025923 | Bacteria | 40452 |
| 424 | Ga0207681_10000667 | 3300025923 | Bacteria | 22714 |
| 425 | Ga0207681_10044582 | 3300025923 | Bacteria | 2973 |
| 426 | Ga0207694_10003805 | 3300025924 | Bacteria | 11940 |
| 427 | Ga0207694_10055561 | 3300025924 | Bacteria | 3073 |
| 428 | Ga0207650_10000038 | 3300025925 | Bacteria | 206081 |
| 429 | Ga0207650_10001576 | 3300025925 | Bacteria | 16287 |
| 430 | Ga0207650_10002138 | 3300025925 | Bacteria | 13823 |
| 431 | Ga0207650_10007425 | 3300025925 | Bacteria | 7470 |
| 432 | Ga0207650_10027164 | 3300025925 | Bacteria | 4094 |
| 433 | Ga0207650_10100427 | 3300025925 | Bacteria | 2226 |
| 434 | Ga0207659_10002827 | 3300025926 | Bacteria | 10358 |
| 435 | Ga0207659_10118854 | 3300025926 | Bacteria | 2022 |
| 436 | Ga0207687_10039346 | 3300025927 | Bacteria | 3237 |
| 437 | Ga0207700_10000083 | 3300025928 | Bacteria | 58710 |
| 438 | Ga0207700_10034972 | 3300025928 | Bacteria | 3613 |
| 439 | Ga0207664_10011315 | 3300025929 | Bacteria | 6331 |
| 440 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 441 | Ga0207644_10000060 | 3300025931 | Bacteria | 79209 |
| 442 | Ga0207644_10000385 | 3300025931 | Bacteria | 28685 |
| 443 | Ga0207644_10000927 | 3300025931 | Bacteria | 18628 |
| 444 | Ga0207644_10002506 | 3300025931 | Bacteria | 11823 |
| 445 | Ga0207644_10017065 | 3300025931 | Bacteria | 4896 |
| 446 | Ga0207644_10017956 | 3300025931 | Unclassified | 4783 |
| 447 | Ga0207644_10037322 | 3300025931 | Bacteria | 3417 |
| 448 | Ga0207690_10010226 | 3300025932 | Bacteria | 5570 |
| 449 | Ga0207690_10010856 | 3300025932 | Bacteria | 5428 |
| 450 | Ga0207690_10013890 | 3300025932 | Bacteria | 4851 |
| 451 | Ga0207690_10087993 | 3300025932 | Bacteria | 2187 |
| 452 | Ga0207690_10142117 | 3300025932 | Bacteria | 1770 |
| 453 | Ga0207690_10148204 | 3300025932 | Unclassified | 1737 |
| 454 | Ga0207706_10003677 | 3300025933 | Bacteria | 14643 |
| 455 | Ga0207706_10009415 | 3300025933 | Bacteria | 8967 |
| 456 | Ga0207706_10141341 | 3300025933 | Bacteria | 2118 |
| 457 | Ga0207709_10000059 | 3300025935 | Bacteria | 211914 |
| 458 | Ga0207669_10005970 | 3300025937 | Bacteria | 5520 |
| 459 | Ga0207691_10000019 | 3300025940 | Bacteria | 133680 |
| 460 | Ga0207711_10002994 | 3300025941 | Bacteria | 14761 |
| 461 | Ga0207711_10011653 | 3300025941 | Bacteria | 7305 |
| 462 | Ga0207711_10014565 | 3300025941 | Bacteria | 6536 |
| 463 | Ga0207711_10029281 | 3300025941 | Bacteria | 4643 |
| 464 | Ga0207711_10224428 | 3300025941 | Bacteria | 1719 |
| 465 | Ga0207711_10268308 | 3300025941 | Bacteria | 1570 |
| 466 | Ga0207679_10017290 | 3300025945 | Unclassified | 4807 |
| 467 | Ga0207679_10067410 | 3300025945 | Bacteria | 2685 |
| 468 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 469 | Ga0207667_10000916 | 3300025949 | Bacteria | 37599 |
| 470 | Ga0207667_10005514 | 3300025949 | Bacteria | 15433 |
| 471 | Ga0207667_10020324 | 3300025949 | Bacteria | 7390 |
| 472 | Ga0207667_10044809 | 3300025949 | Bacteria | 4686 |
| 473 | Ga0207667_10086736 | 3300025949 | Bacteria | 3239 |
| 474 | Ga0207651_10001213 | 3300025960 | Bacteria | 11549 |
| 475 | Ga0207651_10059026 | 3300025960 | Bacteria | 2654 |
| 476 | Ga0207712_10000021 | 3300025961 | Bacteria | 292649 |
| 477 | Ga0207712_10000069 | 3300025961 | Bacteria | 127318 |
| 478 | Ga0207712_10020513 | 3300025961 | Bacteria | 4328 |
| 479 | Ga0207668_10000178 | 3300025972 | Bacteria | 43552 |
| 480 | Ga0207668_10000647 | 3300025972 | Bacteria | 21409 |
| 481 | Ga0207668_10001332 | 3300025972 | Bacteria | 14663 |
| 482 | Ga0207668_10022777 | 3300025972 | Bacteria | 4015 |
| 483 | Ga0207668_10109414 | 3300025972 | Bacteria | 2070 |
| 484 | Ga0207640_10117499 | 3300025981 | Bacteria | 1898 |
| 485 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 486 | Ga0207658_10000022 | 3300025986 | Bacteria | 191235 |
| 487 | Ga0207658_10005443 | 3300025986 | Bacteria | 8730 |
| 488 | Ga0207658_10014406 | 3300025986 | Bacteria | 5414 |
| 489 | Ga0207658_10045858 | 3300025986 | Bacteria | 3189 |
| 490 | Ga0207658_10064739 | 3300025986 | Bacteria | 2743 |
| 491 | Ga0207658_10079952 | 3300025986 | Bacteria | 2502 |
| 492 | Ga0207677_10002920 | 3300026023 | Bacteria | 9029 |
| 493 | Ga0207703_10000205 | 3300026035 | Bacteria | 69078 |
| 494 | Ga0207703_10000639 | 3300026035 | Bacteria | 35173 |
| 495 | Ga0207703_10000714 | 3300026035 | Bacteria | 32756 |
| 496 | Ga0207703_10014160 | 3300026035 | Bacteria | 6219 |
| 497 | Ga0207639_10000691 | 3300026041 | Bacteria | 23195 |
| 498 | Ga0207639_10003585 | 3300026041 | Bacteria | 10426 |
| 499 | Ga0207678_10000218 | 3300026067 | Bacteria | 51096 |
| 500 | Ga0207678_10025364 | 3300026067 | Bacteria | 5175 |
| 501 | Ga0207702_10000045 | 3300026078 | Bacteria | 144714 |
| 502 | Ga0207702_10002451 | 3300026078 | Bacteria | 17572 |
| 503 | Ga0207702_10002929 | 3300026078 | Bacteria | 15968 |
| 504 | Ga0207702_10028110 | 3300026078 | Bacteria | 4672 |
| 505 | Ga0207702_10032499 | 3300026078 | Bacteria | 4354 |
| 506 | Ga0207702_10104638 | 3300026078 | Bacteria | 2505 |
| 507 | Ga0207641_10000115 | 3300026088 | Bacteria | 118497 |
| 508 | Ga0207641_10000139 | 3300026088 | Bacteria | 105740 |
| 509 | Ga0207641_10000414 | 3300026088 | Bacteria | 49835 |
| 510 | Ga0207641_10002917 | 3300026088 | Bacteria | 15486 |
| 511 | Ga0207641_10008887 | 3300026088 | Bacteria | 8296 |
| 512 | Ga0207641_10033804 | 3300026088 | Bacteria | 4249 |
| 513 | Ga0207641_10236824 | 3300026088 | Bacteria | 1699 |
| 514 | Ga0207641_10321469 | 3300026088 | Bacteria | 1467 |
| 515 | Ga0207648_10096920 | 3300026089 | Bacteria | 2581 |
| 516 | Ga0207676_10000034 | 3300026095 | Bacteria | 206058 |
| 517 | Ga0207676_10000613 | 3300026095 | Bacteria | 29202 |
| 518 | Ga0207676_10001417 | 3300026095 | Bacteria | 17820 |
| 519 | Ga0207676_10005994 | 3300026095 | Bacteria | 8574 |
| 520 | Ga0207676_10035291 | 3300026095 | Bacteria | 3794 |
| 521 | Ga0207674_10000026 | 3300026116 | Bacteria | 151359 |
| 522 | Ga0207674_10027999 | 3300026116 | Bacteria | 5955 |
| 523 | Ga0207674_10037284 | 3300026116 | Bacteria | 5058 |
| 524 | Ga0207674_10041996 | 3300026116 | Bacteria | 4726 |
| 525 | Ga0207674_10050697 | 3300026116 | Bacteria | 4239 |
| 526 | Ga0207674_10057730 | 3300026116 | Bacteria | 3934 |
| 527 | Ga0207674_10086805 | 3300026116 | Bacteria | 3123 |
| 528 | Ga0207674_10164988 | 3300026116 | Bacteria | 2169 |
| 529 | Ga0207675_100000244 | 3300026118 | Bacteria | 51844 |
| 530 | Ga0207675_100000360 | 3300026118 | Bacteria | 43597 |
| 531 | Ga0207675_100000533 | 3300026118 | Bacteria | 37022 |
| 532 | Ga0207675_100006658 | 3300026118 | Bacteria | 10932 |
| 533 | Ga0207675_100028656 | 3300026118 | Bacteria | 5187 |
| 534 | Ga0207683_10002984 | 3300026121 | Bacteria | 14769 |
| 535 | Ga0207683_10020489 | 3300026121 | Bacteria | 5656 |
| 536 | Ga0207683_10020696 | 3300026121 | Bacteria | 5628 |
| 537 | Ga0207698_10000130 | 3300026142 | Bacteria | 47043 |
| 538 | Ga0207698_10274655 | 3300026142 | Unclassified | 1555 |
| 539 | Ga0209281_1000102 | 3300027111 | Bacteria | 221665 |
| 540 | Ga0209281_1000242 | 3300027111 | Bacteria | 110116 |
| 541 | Ga0209281_1000695 | 3300027111 | Bacteria | 34292 |
| 542 | Ga0209282_1000013 | 3300027666 | Bacteria | 215053 |
| 543 | Ga0209813_10000111 | 3300027866 | Bacteria | 29673 |
| 544 | Ga0209974_10004804 | 3300027876 | Bacteria | 4792 |
| 545 | Ga0207428_10047662 | 3300027907 | Bacteria | 3440 |
| 546 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 547 | Ga0268266_10000054 | 3300028379 | Bacteria | 292717 |
| 548 | Ga0268266_10000212 | 3300028379 | Bacteria | 101029 |
| 549 | Ga0268266_10012740 | 3300028379 | Bacteria | 7267 |
| 550 | Ga0268266_10031160 | 3300028379 | Bacteria | 4528 |
| 551 | Ga0268266_10056372 | 3300028379 | Bacteria | 3381 |
| 552 | Ga0268266_10115169 | 3300028379 | Bacteria | 2386 |
| 553 | Ga0268265_10000030 | 3300028380 | Bacteria | 228157 |
| 554 | Ga0268265_10000292 | 3300028380 | Bacteria | 56426 |
| 555 | Ga0268265_10000601 | 3300028380 | Bacteria | 36169 |
| 556 | Ga0268265_10000739 | 3300028380 | Bacteria | 31842 |
| 557 | Ga0268265_10006464 | 3300028380 | Bacteria | 7943 |
| 558 | Ga0268264_10000074 | 3300028381 | Bacteria | 259555 |
| 559 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 560 | Ga0268264_10000310 | 3300028381 | Bacteria | 78142 |
| 561 | Ga0268264_10002308 | 3300028381 | Bacteria | 16874 |
| 562 | Ga0268264_10018414 | 3300028381 | Bacteria | 5711 |
| 563 | Ga0268264_10046657 | 3300028381 | Bacteria | 3599 |
| 564 | Ga0307517_10015953 | 3300028786 | Bacteria | 9920 |
| 565 | Ga0307517_10028410 | 3300028786 | Bacteria | 6666 |
| 566 | Ga0307517_10094042 | 3300028786 | Bacteria | 2424 |
| 567 | Ga0268256_1004680 | 3300030500 | Bacteria | 5590 |
| 568 | Ga0307513_10054454 | 3300031456 | Bacteria | 4289 |
| 569 | Ga0307513_10109370 | 3300031456 | Bacteria | 2762 |
| 570 | Ga0307408_100002167 | 3300031548 | Bacteria | 14050 |
| 571 | Ga0307408_100134083 | 3300031548 | Bacteria | 1935 |
| 572 | Ga0307508_10000398 | 3300031616 | Bacteria | 52452 |
| 573 | Ga0307516_10137322 | 3300031730 | Bacteria | 2218 |
| 574 | Ga0307405_10029241 | 3300031731 | Bacteria | 3219 |
| 575 | Ga0307405_10047559 | 3300031731 | Bacteria | 2642 |
| 576 | Ga0307405_10049815 | 3300031731 | Bacteria | 2591 |
| 577 | Ga0307405_10086253 | 3300031731 | Bacteria | 2066 |
| 578 | Ga0307405_10098046 | 3300031731 | Bacteria | 1958 |
| 579 | Ga0307413_10053302 | 3300031824 | Bacteria | 2448 |
| 580 | Ga0307406_10039675 | 3300031901 | Bacteria | 2923 |
| 581 | Ga0307406_10176625 | 3300031901 | Bacteria | 1551 |
| 582 | Ga0307407_10019922 | 3300031903 | Bacteria | 3424 |
| 583 | Ga0307412_10019148 | 3300031911 | Bacteria | 4137 |
| 584 | Ga0307412_10023819 | 3300031911 | Bacteria | 3772 |
| 585 | Ga0315914_1000004 | 3300031967 | Bacteria | 288534 |
| 586 | Ga0307409_100106263 | 3300031995 | Bacteria | 2342 |
| 587 | Ga0307414_10016847 | 3300032004 | Bacteria | 4456 |
| 588 | Ga0307414_10083941 | 3300032004 | Bacteria | 2341 |
| 589 | Ga0307414_10224461 | 3300032004 | Bacteria | 1544 |
| 590 | Ga0307415_100159691 | 3300032126 | Bacteria | 1746 |
| 591 | Ga0307510_10008962 | 3300033180 | Bacteria | 11914 |
| 592 | Ga0307510_10052621 | 3300033180 | Bacteria | 4289 |
| 593 | Ga0315913_1000011 | 3300033430 | Bacteria | 140532 |
| 594 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 595 | Ga0373926_0012290 | 3300035083 | Bacteria | 2893 |
| 596 | Ga0373936_0042425 | 3300035113 | Bacteria | 1826 |
| 597 | Ga0373954_0006557 | 3300035118 | Bacteria | 5074 |
| 598 | Ga0373954_0101270 | 3300035118 | Bacteria | 1390 |
| 599 | Ga0373957_0005881 | 3300035120 | Bacteria | 3832 |
| 600 | Ga0373943_0004815 | 3300035170 | Bacteria | 6097 |
| 601 | Ga0373943_0036081 | 3300035170 | Bacteria | 2367 |
| 602 | Ga0373943_0046767 | 3300035170 | Bacteria | 2113 |
| 603 | Ga0373943_0081973 | 3300035170 | Bacteria | 1656 |
| 604 | Ga0373955_0051397 | 3300035172 | Bacteria | 2245 |
| 605 | Ga0373935_0004136 | 3300035692 | Bacteria | 8491 |
| 606 | Ga0373935_0025842 | 3300035692 | Bacteria | 3619 |
| 607 | Ga0373927_0013012 | 3300035695 | Bacteria | 5534 |
| 608 | Ga0373927_0156870 | 3300035695 | Bacteria | 1491 |
| 609 | Ga0373933_0014844 | 3300035724 | Bacteria | 4335 |
| 610 | Ga0373933_0045726 | 3300035724 | Bacteria | 2597 |
| 611 | Ga0373947_0016497 | 3300035725 | Bacteria | 4244 |
| 612 | Ga0373947_0086858 | 3300035725 | Bacteria | 1945 |
| 613 | Ga0373937_0004279 | 3300036401 | Bacteria | 12093 |
| 614 | Ga0373937_0016703 | 3300036401 | Bacteria | 6522 |
| 615 | Ga0373937_0027529 | 3300036401 | Bacteria | 5140 |
| 616 | Ga0373937_0110922 | 3300036401 | Bacteria | 2551 |
| 617 | Ga0373937_0144920 | 3300036401 | Bacteria | 2223 |
| 618 | Ga0373925_0002642 | 3300037068 | Bacteria | 14220 |
| 619 | Ga0373925_0038558 | 3300037068 | Bacteria | 3533 |
| 620 | Ga0373925_0054265 | 3300037068 | Bacteria | 2997 |
| 621 | Ga0373925_0131705 | 3300037068 | Bacteria | 1950 |
| 622 | Ga0395899_0001521 | 3300037312 | Bacteria | 19608 |
| 623 | Ga0395905_0109712 | 3300037471 | Bacteria | 2591 |
| 624 | Ga0436364_0910692 | 3300037853 | Bacteria | 15334 |
| 625 | Ga0436364_1027058 | 3300037853 | Bacteria | 7297 |
| 626 | Ga0395901_0091535 | 3300038443 | Bacteria | 3184 |
| 627 | Ga0237819_00949 | 3300038705 | Bacteria | 8836 |
| 628 | Ga0237816_00649 | 3300039145 | Bacteria | 2933 |
| 629 | Ga0436365_1654841 | 3300039437 | Bacteria | 47529 |
| 630 | Ga0436360_0036174 | 3300039438 | Bacteria | 2882 |
| 631 | Ga0436360_1255809 | 3300039438 | Bacteria | 2632 |
| 632 | Ga0436362_1291891 | 3300039453 | Bacteria | 4496 |
| 633 | Ga0439461_0000133 | 3300041410 | Bacteria | 9890 |
| 634 | Ga0439461_0003201 | 3300041410 | Bacteria | 2680 |
| 635 | Ga0439465_0002515 | 3300041413 | Bacteria | 5984 |
| 636 | Ga0439465_0007006 | 3300041413 | Bacteria | 3582 |
| 637 | Ga0439465_0010080 | 3300041413 | Bacteria | 2972 |
| 638 | Ga0451793_0729188 | 3300041452 | Bacteria | 1990 |
| 639 | Ga0451806_691803 | 3300041462 | Bacteria | 2065 |
| 640 | Ga0451835_0937263 | 3300041492 | Bacteria | 6890 |
| 641 | Ga0451849_0603856 | 3300041505 | Bacteria | 2074 |
| 642 | Ga0439431_0000794 | 3300041997 | Bacteria | 6831 |
| 643 | Ga0439431_0007345 | 3300041997 | Bacteria | 2456 |
| 644 | Ga0439432_010870 | 3300042006 | Bacteria | 3144 |
| 645 | Ga0439449_0002709 | 3300042007 | Bacteria | 6901 |
| 646 | Ga0439462_0002763 | 3300042015 | Bacteria | 4122 |
| 647 | Ga0439446_0003437 | 3300042156 | Bacteria | 3935 |
| 648 | Ga0466972_0012842 | 3300044658 | Bacteria | 4206 |
| 649 | Ga0466966_0060715 | 3300044684 | Bacteria | 2386 |
| 650 | Ga0466968_0007104 | 3300044735 | Bacteria | 4248 |
| 651 | Ga0466968_0014787 | 3300044735 | Bacteria | 3087 |
| 652 | Ga0466970_0042451 | 3300044765 | Bacteria | 2419 |
| 653 | Ga0466960_0058600 | 3300044901 | Bacteria | 1881 |
| 654 | Ga0466959_0019769 | 3300045049 | Bacteria | 4955 |
| 655 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 656 | Ga0451576_0032757 | 3300045051 | Bacteria | 5527 |
| 657 | Ga0495627_000157 | 3300046453 | Bacteria | 78082 |
| 658 | Ga0495627_000318 | 3300046453 | Bacteria | 47190 |
| 659 | Ga0495592_0087492 | 3300046454 | Bacteria | 2241 |
| 660 | Ga0495592_0096045 | 3300046454 | Bacteria | 2119 |
| 661 | Ga0495638_0000018 | 3300046460 | Bacteria | 389696 |
| 662 | Ga0495638_0000214 | 3300046460 | Bacteria | 81426 |
| 663 | Ga0495638_0003200 | 3300046460 | Bacteria | 12944 |
| 664 | Ga0495638_0009219 | 3300046460 | Bacteria | 6938 |
| 665 | Ga0495638_0013831 | 3300046460 | Bacteria | 5477 |
| 666 | Ga0495651_0071686 | 3300046462 | Bacteria | 2633 |
| 667 | Ga0495650_0000174 | 3300046471 | Bacteria | 142519 |
| 668 | Ga0495650_0006704 | 3300046471 | Bacteria | 7130 |
| 669 | Ga0495580_0017783 | 3300046472 | Bacteria | 5303 |
| 670 | Ga0495582_0042330 | 3300046473 | Bacteria | 2508 |
| 671 | Ga0495605_0002064 | 3300046474 | Bacteria | 12659 |
| 672 | Ga0495639_0000789 | 3300046475 | Bacteria | 14448 |
| 673 | Ga0495664_0007587 | 3300046477 | Bacteria | 6031 |
| 674 | Ga0495584_0018885 | 3300046491 | Bacteria | 3503 |
| 675 | Ga0495585_0016115 | 3300046492 | Bacteria | 4332 |
| 676 | Ga0495585_0017595 | 3300046492 | Bacteria | 4128 |
| 677 | Ga0495594_0015378 | 3300046499 | Bacteria | 4020 |
| 678 | Ga0495596_0006273 | 3300046500 | Bacteria | 5499 |
| 679 | Ga0495607_0037983 | 3300046501 | Bacteria | 2888 |
| 680 | Ga0495583_0000038 | 3300046506 | Bacteria | 243395 |
| 681 | Ga0495583_0002170 | 3300046506 | Bacteria | 17516 |
| 682 | Ga0495583_0006072 | 3300046506 | Bacteria | 7988 |
| 683 | Ga0495583_0017689 | 3300046506 | Bacteria | 3778 |
| 684 | Ga0495583_0028306 | 3300046506 | Bacteria | 2756 |
| 685 | Ga0495583_0035876 | 3300046506 | Bacteria | 2362 |
| 686 | Ga0495606_0003780 | 3300046507 | Bacteria | 15734 |
| 687 | Ga0495606_0017420 | 3300046507 | Bacteria | 5433 |
| 688 | Ga0495606_0080258 | 3300046507 | Bacteria | 2030 |
| 689 | Ga0495610_0000389 | 3300046512 | Bacteria | 45473 |
| 690 | Ga0495610_0053919 | 3300046512 | Bacteria | 1945 |
| 691 | Ga0495616_0000880 | 3300046513 | Bacteria | 21796 |
| 692 | Ga0495616_0030509 | 3300046513 | Bacteria | 2833 |
| 693 | Ga0495620_0013645 | 3300046515 | Bacteria | 4154 |
| 694 | Ga0495630_0012981 | 3300046517 | Bacteria | 6052 |
| 695 | Ga0495631_0001695 | 3300046518 | Bacteria | 13089 |
| 696 | Ga0495632_0000042 | 3300046519 | Bacteria | 145186 |
| 697 | Ga0495632_0001274 | 3300046519 | Bacteria | 21337 |
| 698 | Ga0495632_0011422 | 3300046519 | Bacteria | 5182 |
| 699 | Ga0495637_0001047 | 3300046520 | Bacteria | 17342 |
| 700 | Ga0495637_0007051 | 3300046520 | Bacteria | 5597 |
| 701 | Ga0495643_0000005 | 3300046522 | Bacteria | 443135 |
| 702 | Ga0495643_0005203 | 3300046522 | Bacteria | 8863 |
| 703 | Ga0495643_0020654 | 3300046522 | Bacteria | 3793 |
| 704 | Ga0495643_0031010 | 3300046522 | Bacteria | 2979 |
| 705 | Ga0495643_0065559 | 3300046522 | Bacteria | 1917 |
| 706 | Ga0495648_0000144 | 3300046524 | Bacteria | 85412 |
| 707 | Ga0495648_0000147 | 3300046524 | Bacteria | 84418 |
| 708 | Ga0495648_0033238 | 3300046524 | Bacteria | 3372 |
| 709 | Ga0495648_0034396 | 3300046524 | Bacteria | 3298 |
| 710 | Ga0495663_0000015 | 3300046525 | Bacteria | 145185 |
| 711 | Ga0495663_0005738 | 3300046525 | Bacteria | 3438 |
| 712 | Ga0495663_0010363 | 3300046525 | Bacteria | 2592 |
| 713 | Ga0495663_0017105 | 3300046525 | Bacteria | 2055 |
| 714 | Ga0495652_0163682 | 3300046529 | Bacteria | 1724 |
| 715 | Ga0495654_0000236 | 3300046530 | Bacteria | 51913 |
| 716 | Ga0495654_0010002 | 3300046530 | Bacteria | 5180 |
| 717 | Ga0495654_0015312 | 3300046530 | Bacteria | 4074 |
| 718 | Ga0495665_0001769 | 3300046531 | Bacteria | 11640 |
| 719 | Ga0495645_0003119 | 3300046543 | Bacteria | 11232 |
| 720 | Ga0495633_0000197 | 3300046558 | Bacteria | 76903 |
| 721 | Ga0495633_0000262 | 3300046558 | Bacteria | 62524 |
| 722 | Ga0495633_0033295 | 3300046558 | Bacteria | 2485 |
| 723 | Ga0495633_0073505 | 3300046558 | Bacteria | 1593 |
| 724 | Ga0495667_0008176 | 3300046559 | Bacteria | 7100 |
| 725 | Ga0495667_0025775 | 3300046559 | Bacteria | 3961 |
| 726 | Ga0495656_0026297 | 3300046615 | Bacteria | 2316 |
| 727 | Ga0495668_0000072 | 3300046616 | Bacteria | 167170 |
| 728 | Ga0495668_0006134 | 3300046616 | Bacteria | 7956 |
| 729 | Ga0495668_0028551 | 3300046616 | Bacteria | 3155 |
| 730 | Ga0495668_0028910 | 3300046616 | Bacteria | 3133 |
| 731 | Ga0495611_0007195 | 3300046648 | Bacteria | 4730 |
| 732 | Ga0495625_0001386 | 3300046660 | Bacteria | 29753 |
| 733 | Ga0495625_0002794 | 3300046660 | Bacteria | 18407 |
| 734 | Ga0495625_0008722 | 3300046660 | Bacteria | 8594 |
| 735 | Ga0495625_0017887 | 3300046660 | Bacteria | 5541 |
| 736 | Ga0495625_0109602 | 3300046660 | Bacteria | 1888 |
| 737 | Ga0495625_0125954 | 3300046660 | Bacteria | 1739 |
| 738 | Ga0495661_0070079 | 3300046665 | Bacteria | 2053 |
| 739 | Ga0495661_0088828 | 3300046665 | Bacteria | 1763 |
| 740 | Ga0495588_0005144 | 3300046674 | Bacteria | 5810 |
| 741 | Ga0495599_0093830 | 3300046678 | Bacteria | 1872 |
| 742 | Ga0495658_0002931 | 3300046683 | Bacteria | 8560 |
| 743 | Ga0495669_0000258 | 3300046684 | Bacteria | 30670 |
| 744 | Ga0495613_0025023 | 3300046689 | Bacteria | 4449 |
| 745 | Ga0495670_0018659 | 3300046691 | Bacteria | 3417 |
| 746 | Ga0495670_0028758 | 3300046691 | Bacteria | 2756 |
| 747 | Ga0495671_0000007 | 3300046692 | Bacteria | 443069 |
| 748 | Ga0495671_0000060 | 3300046692 | Bacteria | 107734 |
| 749 | Ga0495589_0011649 | 3300046794 | Bacteria | 4565 |
| 750 | Ga0495660_0006209 | 3300046810 | Bacteria | 7090 |
| 751 | Ga0495581_0007959 | 3300047315 | Bacteria | 6140 |
| 752 | Ga0495604_0048025 | 3300047317 | Bacteria | 3321 |
| 753 | Ga0495674_0033062 | 3300047319 | Bacteria | 4688 |
| 754 | Ga0495672_0007359 | 3300047320 | Bacteria | 8292 |
| 755 | Ga0495672_0009409 | 3300047320 | Bacteria | 7084 |
| 756 | Ga0495680_0129972 | 3300047322 | Bacteria | 1852 |
| 757 | Ga0495683_0024537 | 3300047323 | Bacteria | 3094 |
| 758 | Ga0495687_000045 | 3300047443 | Bacteria | 211968 |
| 759 | Ga0495687_000240 | 3300047443 | Bacteria | 75621 |
| 760 | Ga0495675_0034447 | 3300047444 | Bacteria | 3233 |
| 761 | Ga0495673_0000088 | 3300047469 | Bacteria | 189812 |
| 762 | Ga0495673_0016447 | 3300047469 | Bacteria | 3781 |
| 763 | Ga0495673_0041921 | 3300047469 | Bacteria | 2058 |
| 764 | Ga0495681_0000006 | 3300047470 | Bacteria | 221565 |
| 765 | Ga0495681_0004911 | 3300047470 | Bacteria | 9033 |
| 766 | Ga0495681_0016802 | 3300047470 | Bacteria | 4084 |
| 767 | Ga0495686_0000197 | 3300047472 | Bacteria | 112818 |
| 768 | Ga0495686_0000544 | 3300047472 | Bacteria | 53939 |
| 769 | Ga0495686_0000588 | 3300047472 | Bacteria | 51272 |
| 770 | Ga0495686_0004312 | 3300047472 | Bacteria | 11764 |
| 771 | Ga0495686_0010969 | 3300047472 | Bacteria | 6416 |
| 772 | Ga0495686_0021400 | 3300047472 | Bacteria | 4295 |
| 773 | Ga0495686_0054433 | 3300047472 | Bacteria | 2505 |
| 774 | Ga0495686_0125900 | 3300047472 | Bacteria | 1523 |
| 775 | Ga0495593_0002299 | 3300047673 | Bacteria | 11458 |
| 776 | Ga0495602_0003534 | 3300048088 | Bacteria | 16152 |
| 777 | Ga0495614_0002616 | 3300048089 | Bacteria | 8001 |
| 778 | Ga0495626_0045817 | 3300048091 | Bacteria | 2040 |
| 779 | Ga0496101_0004194 | 3300048904 | Bacteria | 9032 |
| 780 | Ga0496102_0000043 | 3300048905 | Bacteria | 189201 |
| 781 | Ga0496102_0000106 | 3300048905 | Bacteria | 118841 |
| 782 | Ga0496102_0011122 | 3300048905 | Bacteria | 7750 |
| 783 | Ga0496103_0000069 | 3300048906 | Bacteria | 121542 |
| 784 | Ga0496103_0000095 | 3300048906 | Bacteria | 98260 |
| 785 | Ga0496103_0000133 | 3300048906 | Bacteria | 78740 |
| 786 | Ga0496103_0002980 | 3300048906 | Bacteria | 10483 |
| 787 | Ga0496104_0000060 | 3300048907 | Bacteria | 117966 |
| 788 | Ga0496104_0067340 | 3300048907 | Bacteria | 3401 |
| 789 | Ga0496104_0077771 | 3300048907 | Bacteria | 3161 |
| 790 | Ga0496104_0109404 | 3300048907 | Bacteria | 2649 |
| 791 | Ga0496105_0000274 | 3300048908 | Bacteria | 34048 |
| 792 | Ga0496105_0041343 | 3300048908 | Bacteria | 3799 |
| 793 | Ga0496105_0062920 | 3300048908 | Bacteria | 3062 |
| 794 | Ga0496105_0079109 | 3300048908 | Bacteria | 2715 |
| 795 | Ga0496106_0000338 | 3300048909 | Bacteria | 32910 |
| 796 | Ga0496106_0001196 | 3300048909 | Bacteria | 19346 |
| 797 | Ga0496107_0002397 | 3300048910 | Bacteria | 12134 |
| 798 | Ga0496108_0001297 | 3300048911 | Bacteria | 19637 |
| 799 | Ga0496108_0045490 | 3300048911 | Bacteria | 3666 |
| 800 | Ga0496109_0056144 | 3300048912 | Bacteria | 3593 |
| 801 | Ga0496110_0038618 | 3300048913 | Bacteria | 4155 |
| 802 | Ga0496111_0000685 | 3300048914 | Bacteria | 17853 |
| 803 | Ga0496111_0034979 | 3300048914 | Bacteria | 3588 |
| 804 | Ga0496112_0175508 | 3300048915 | Bacteria | 2108 |
| 805 | Ga0496113_0001855 | 3300048916 | Bacteria | 12041 |
| 806 | Ga0496113_0002586 | 3300048916 | Bacteria | 10570 |
| 807 | Ga0496113_0023903 | 3300048916 | Bacteria | 4338 |
| 808 | Ga0496114_0003386 | 3300048917 | Bacteria | 12242 |
| 809 | Ga0496115_0000009 | 3300048918 | Bacteria | 234372 |
| 810 | Ga0496115_0001130 | 3300048918 | Bacteria | 19264 |
| 811 | Ga0496116_0007300 | 3300048919 | Bacteria | 9843 |
| 812 | Ga0496116_0014376 | 3300048919 | Bacteria | 6327 |
| 813 | Ga0496116_0041259 | 3300048919 | Bacteria | 3168 |
| 814 | Ga0496117_0000104 | 3300048920 | Bacteria | 189201 |
| 815 | Ga0496117_0000185 | 3300048920 | Bacteria | 127413 |
| 816 | Ga0496117_0000366 | 3300048920 | Bacteria | 78816 |
| 817 | Ga0496117_0002165 | 3300048920 | Bacteria | 25611 |
| 818 | Ga0496117_0013629 | 3300048920 | Bacteria | 7080 |
| 819 | Ga0496117_0015041 | 3300048920 | Bacteria | 6628 |
| 820 | Ga0496118_0000077 | 3300048921 | Bacteria | 192298 |
| 821 | Ga0496118_0000080 | 3300048921 | Bacteria | 189201 |
| 822 | Ga0496118_0003332 | 3300048921 | Bacteria | 20326 |
| 823 | Ga0496118_0013982 | 3300048921 | Bacteria | 7539 |
| 824 | Ga0496118_0031034 | 3300048921 | Bacteria | 4443 |
| 825 | Ga0496118_0041709 | 3300048921 | Bacteria | 3629 |
| 826 | Ga0496119_0001213 | 3300048922 | Bacteria | 32201 |
| 827 | Ga0496119_0008938 | 3300048922 | Bacteria | 8700 |
| 828 | Ga0496119_0052767 | 3300048922 | Bacteria | 2488 |
| 829 | Ga0496120_0001109 | 3300048923 | Bacteria | 35064 |
| 830 | Ga0496121_0001230 | 3300048924 | Bacteria | 44601 |
| 831 | Ga0496121_0001994 | 3300048924 | Bacteria | 32423 |
| 832 | Ga0496121_0002144 | 3300048924 | Bacteria | 30983 |
| 833 | Ga0496121_0002478 | 3300048924 | Bacteria | 28115 |
| 834 | Ga0496121_0003590 | 3300048924 | Bacteria | 21898 |
| 835 | Ga0496121_0006338 | 3300048924 | Bacteria | 14748 |
| 836 | Ga0496121_0089230 | 3300048924 | Bacteria | 2415 |
| 837 | Ga0496122_0000018 | 3300048925 | Bacteria | 426350 |
| 838 | Ga0496122_0000147 | 3300048925 | Bacteria | 165589 |
| 839 | Ga0496122_0002719 | 3300048925 | Bacteria | 24543 |
| 840 | Ga0496122_0002984 | 3300048925 | Bacteria | 23033 |
| 841 | Ga0496122_0004287 | 3300048925 | Bacteria | 17866 |
| 842 | Ga0496122_0011451 | 3300048925 | Bacteria | 8977 |
| 843 | Ga0496122_0011913 | 3300048925 | Bacteria | 8732 |
| 844 | Ga0496122_0017578 | 3300048925 | Bacteria | 6674 |
| 845 | Ga0496122_0088083 | 3300048925 | Bacteria | 2130 |
| 846 | Ga0496122_0096638 | 3300048925 | Bacteria | 1991 |
| 847 | Ga0496123_0000015 | 3300048926 | Bacteria | 426088 |
| 848 | Ga0496123_0000158 | 3300048926 | Bacteria | 136078 |
| 849 | Ga0496123_0002233 | 3300048926 | Bacteria | 24544 |
| 850 | Ga0496123_0009579 | 3300048926 | Bacteria | 8700 |
| 851 | Ga0496123_0020668 | 3300048926 | Bacteria | 5144 |
| 852 | Ga0496123_0020817 | 3300048926 | Bacteria | 5117 |
| 853 | Ga0496123_0060977 | 3300048926 | Bacteria | 2428 |
| 854 | Ga0496123_0074867 | 3300048926 | Bacteria | 2093 |
| 855 | Ga0496124_0000050 | 3300048927 | Bacteria | 258041 |
| 856 | Ga0496124_0000093 | 3300048927 | Bacteria | 189201 |
| 857 | Ga0496124_0000703 | 3300048927 | Bacteria | 54743 |
| 858 | Ga0496124_0001819 | 3300048927 | Bacteria | 29505 |
| 859 | Ga0496124_0046920 | 3300048927 | Bacteria | 3698 |
| 860 | Ga0496124_0053549 | 3300048927 | Bacteria | 3419 |
| 861 | Ga0496124_0109096 | 3300048927 | Bacteria | 2231 |
| 862 | Ga0496125_0000114 | 3300048928 | Bacteria | 182012 |
| 863 | Ga0496125_0002943 | 3300048928 | Bacteria | 21430 |
| 864 | Ga0496125_0051834 | 3300048928 | Bacteria | 3380 |
| 865 | Ga0496126_0000113 | 3300048929 | Bacteria | 192212 |
| 866 | Ga0496126_0000195 | 3300048929 | Bacteria | 135582 |
| 867 | Ga0496126_0000294 | 3300048929 | Bacteria | 106327 |
| 868 | Ga0496126_0014568 | 3300048929 | Bacteria | 7942 |
| 869 | Ga0496126_0018207 | 3300048929 | Bacteria | 6970 |
| 870 | Ga0496126_0055342 | 3300048929 | Bacteria | 3590 |
| 871 | Ga0496126_0055898 | 3300048929 | Bacteria | 3569 |
| 872 | Ga0496126_0093366 | 3300048929 | Bacteria | 2642 |
| 873 | Ga0496126_0122718 | 3300048929 | Bacteria | 2251 |
| 874 | Ga0495682_0010402 | 3300049460 | Bacteria | 3605 |
| 875 | Ga0501292_000117 | 3300049515 | Bacteria | 14110 |
| 876 | Ga0501294_000670 | 3300049517 | Bacteria | 3854 |
| 877 | Ga0501032_0003709 | 3300049569 | Bacteria | 11594 |
| 878 | Ga0501033_0011114 | 3300049570 | Bacteria | 6897 |
| 879 | Ga0501033_0110784 | 3300049570 | Bacteria | 1998 |
| 880 | Ga0501033_0133467 | 3300049570 | Bacteria | 1797 |
| 881 | Ga0501034_0002130 | 3300049571 | Bacteria | 24593 |
| 882 | Ga0501034_0035340 | 3300049571 | Bacteria | 5066 |
| 883 | Ga0501034_0236801 | 3300049571 | Bacteria | 1773 |
| 884 | Ga0501036_0052198 | 3300049572 | Bacteria | 3462 |
| 885 | Ga0501037_0010333 | 3300049573 | Bacteria | 6848 |
| 886 | Ga0501037_0017394 | 3300049573 | Bacteria | 5295 |
| 887 | Ga0501038_0000423 | 3300049574 | Bacteria | 36823 |
| 888 | Ga0501038_0059572 | 3300049574 | Bacteria | 3270 |
| 889 | Ga0501038_0280500 | 3300049574 | Bacteria | 1312 |
| 890 | Ga0501039_0000228 | 3300049575 | Bacteria | 40749 |
| 891 | Ga0501040_0000401 | 3300049576 | Bacteria | 25582 |
| 892 | Ga0501041_0000068 | 3300049577 | Bacteria | 39067 |
| 893 | Ga0501042_0000225 | 3300049578 | Bacteria | 27025 |
| 894 | Ga0501042_0004646 | 3300049578 | Bacteria | 8764 |
| 895 | Ga0501043_0006877 | 3300049579 | Bacteria | 9077 |
| 896 | Ga0501043_0026913 | 3300049579 | Bacteria | 4513 |
| 897 | Ga0501043_0058007 | 3300049579 | Bacteria | 3039 |
| 898 | Ga0501043_0058400 | 3300049579 | Unclassified | 3028 |
| 899 | Ga0501046_0047770 | 3300049580 | Bacteria | 3392 |
| 900 | Ga0501046_0064267 | 3300049580 | Bacteria | 2865 |
| 901 | Ga0501047_0015644 | 3300049581 | Bacteria | 7228 |
| 902 | Ga0501048_0033352 | 3300049582 | Bacteria | 3719 |
| 903 | Ga0501068_0006265 | 3300049584 | Bacteria | 6547 |
| 904 | Ga0501068_0057140 | 3300049584 | Bacteria | 2365 |
| 905 | Ga0501068_0090858 | 3300049584 | Bacteria | 1884 |
| 906 | Ga0501071_0000943 | 3300049587 | Bacteria | 15815 |
| 907 | Ga0501071_0041124 | 3300049587 | Unclassified | 3310 |
| 908 | Ga0501072_0000133 | 3300049588 | Bacteria | 55596 |
| 909 | Ga0501073_0008046 | 3300049589 | Bacteria | 7827 |
| 910 | Ga0501074_0040848 | 3300049590 | Unclassified | 3358 |
| 911 | Ga0501075_0000065 | 3300049591 | Bacteria | 46049 |
| 912 | Ga0501075_0003810 | 3300049591 | Bacteria | 10148 |
| 913 | Ga0501075_0006150 | 3300049591 | Bacteria | 8252 |
| 914 | Ga0501075_0029149 | 3300049591 | Bacteria | 4080 |
| 915 | Ga0501076_0000120 | 3300049592 | Bacteria | 43155 |
| 916 | Ga0501076_0010487 | 3300049592 | Bacteria | 6878 |
| 917 | Ga0501076_0073841 | 3300049592 | Unclassified | 2731 |
| 918 | Ga0501077_0000108 | 3300049593 | Bacteria | 43917 |
| 919 | Ga0501222_001581 | 3300049662 | Bacteria | 3166 |
| 920 | Ga0501223_000025 | 3300049663 | Bacteria | 58092 |
| 921 | Ga0501223_000367 | 3300049663 | Bacteria | 11110 |
| 922 | Ga0501224_000028 | 3300049664 | Bacteria | 53596 |
| 923 | Ga0501233_000183 | 3300049668 | Bacteria | 9154 |
| 924 | Ga0501249_001102 | 3300049679 | Bacteria | 5711 |
| 925 | Ga0501257_002893 | 3300049686 | Bacteria | 3640 |
| 926 | Ga0501261_000498 | 3300049690 | Bacteria | 5028 |
| 927 | Ga0501225_0000842 | 3300049705 | Bacteria | 9554 |
| 928 | Ga0501225_0001033 | 3300049705 | Bacteria | 8731 |
| 929 | Ga0501079_0003036 | 3300049741 | Bacteria | 12287 |
| 930 | Ga0501079_0007424 | 3300049741 | Bacteria | 8295 |
| 931 | Ga0501080_0003323 | 3300049742 | Bacteria | 14193 |
| 932 | Ga0501081_0000705 | 3300049743 | Bacteria | 19322 |
| 933 | Ga0501081_0031876 | 3300049743 | Unclassified | 3573 |
| 934 | Ga0501083_0009775 | 3300049744 | Bacteria | 6772 |
| 935 | Ga0501241_001834 | 3300049758 | Bacteria | 4185 |
| 936 | Ga0501279_000004 | 3300049775 | Bacteria | 175612 |
| 937 | Ga0501280_000014 | 3300049776 | Bacteria | 57720 |
| 938 | Ga0501281_00189 | 3300049777 | Bacteria | 7123 |
| 939 | Ga0501035_0044401 | 3300049822 | Bacteria | 4002 |
| 940 | Ga0501035_0075331 | 3300049822 | Unclassified | 2985 |
| 941 | Ga0501035_0118966 | 3300049822 | Bacteria | 2311 |
| 942 | Ga0501035_0140319 | 3300049822 | Bacteria | 2101 |
| 943 | Ga0501044_0026843 | 3300049823 | Bacteria | 6095 |
| 944 | Ga0501044_0040197 | 3300049823 | Bacteria | 4875 |
| 945 | Ga0501044_0102020 | 3300049823 | Bacteria | 2886 |
| 946 | Ga0501045_0000389 | 3300049824 | Bacteria | 26607 |
| 947 | Ga0501226_000191 | 3300049853 | Bacteria | 9822 |
| 948 | nmdc:mga03683_6454_c1 | 3300050489 | Bacteria | 4017 |
| 949 | nmdc:mga0yw44_12216_c1 | 3300050492 | Bacteria | 4467 |
| 950 | nmdc:mga0k408_16763_c1 | 3300050493 | Bacteria | 4071 |
| 951 | nmdc:mga06z11_195_c1 | 3300050494 | Bacteria | 24343 |
| 952 | nmdc:mga04h51_420_c1 | 3300050495 | Bacteria | 10192 |
| 953 | nmdc:mga07m45_6743_c1 | 3300050496 | Bacteria | 5827 |
| 954 | nmdc:mga05p37_21251_c1 | 3300050507 | Bacteria | 7857 |
| 955 | nmdc:mga05p37_32544_c1 | 3300050507 | Bacteria | 6378 |
| 956 | nmdc:mga05p37_446694_c1 | 3300050507 | Bacteria | 1498 |
| 957 | nmdc:mga08y16_11558_c1 | 3300050511 | Bacteria | 9280 |
| 958 | nmdc:mga08y16_1414_c1 | 3300050511 | Bacteria | 24082 |
| 959 | nmdc:mga0n895_45942_c1 | 3300050512 | Bacteria | 4264 |
| 960 | nmdc:mga0rr50_50701_c1 | 3300050513 | Bacteria | 3076 |
| 961 | nmdc:mga08x19_95_c1 | 3300050514 | Bacteria | 78182 |
| 962 | nmdc:mga0a205_18078_c1 | 3300050515 | Bacteria | 6623 |
| 963 | nmdc:mga0a205_276294_c1 | 3300050515 | Bacteria | 1556 |
| 964 | nmdc:mga0a205_41220_c1 | 3300050515 | Bacteria | 4446 |
| 965 | nmdc:mga0sz30_40997_c1 | 3300050516 | Bacteria | 1946 |
| 966 | Ga0495612_0000632 | 3300053078 | Bacteria | 14129 |
| 967 | Ga0500610_0000364 | 3300053079 | Bacteria | 13658 |
| 968 | Ga0500610_0025760 | 3300053079 | Bacteria | 2937 |
| 969 | Ga0495619_0015018 | 3300053085 | Bacteria | 4894 |
| 970 | Ga0500643_000093 | 3300053087 | Bacteria | 93451 |
| 971 | Ga0500643_000135 | 3300053087 | Bacteria | 74911 |
| 972 | Ga0500643_000606 | 3300053087 | Bacteria | 24434 |
| 973 | Ga0500643_001944 | 3300053087 | Bacteria | 11194 |
| 974 | Ga0500643_003937 | 3300053087 | Bacteria | 6884 |
| 975 | Ga0500643_025214 | 3300053087 | Bacteria | 1878 |
| 976 | Ga0500566_0000696 | 3300053094 | Bacteria | 18967 |
| 977 | Ga0500555_003899 | 3300053103 | Bacteria | 4243 |
| 978 | Ga0500556_0000197 | 3300053104 | Bacteria | 49633 |
| 979 | Ga0500557_000292 | 3300053105 | Bacteria | 6735 |
| 980 | Ga0500562_011252 | 3300053108 | Bacteria | 2271 |
| 981 | Ga0500569_014218 | 3300053109 | Bacteria | 1965 |
| 982 | Ga0500592_000056 | 3300053116 | Bacteria | 31914 |
| 983 | Ga0500592_001060 | 3300053116 | Bacteria | 4499 |
| 984 | Ga0500595_002230 | 3300053119 | Bacteria | 9841 |
| 985 | Ga0500595_002716 | 3300053119 | Bacteria | 8574 |
| 986 | Ga0500597_023742 | 3300053120 | Bacteria | 2454 |
| 987 | Ga0500607_003805 | 3300053121 | Bacteria | 10780 |
| 988 | Ga0500618_002112 | 3300053125 | Bacteria | 7866 |
| 989 | Ga0500642_0000011 | 3300053130 | Bacteria | 215963 |
| 990 | Ga0500642_0013377 | 3300053130 | Bacteria | 3013 |
| 991 | Ga0500658_0001519 | 3300053134 | Bacteria | 9303 |
| 992 | Ga0500658_0005819 | 3300053134 | Bacteria | 4592 |
| 993 | Ga0500658_0010069 | 3300053134 | Bacteria | 3489 |
| 994 | Ga0500559_0007673 | 3300053136 | Bacteria | 4764 |
| 995 | Ga0500559_0017644 | 3300053136 | Bacteria | 3015 |
| 996 | Ga0500559_0044993 | 3300053136 | Bacteria | 1931 |
| 997 | Ga0500564_006756 | 3300053138 | Bacteria | 4810 |
| 998 | Ga0500568_0001075 | 3300053139 | Bacteria | 18488 |
| 999 | Ga0500568_0048447 | 3300053139 | Bacteria | 1680 |
| 1000 | Ga0500590_002666 | 3300053148 | Bacteria | 8015 |
| 1001 | Ga0500616_0009045 | 3300053153 | Bacteria | 6098 |
| 1002 | Ga0500616_0017475 | 3300053153 | Bacteria | 4068 |
| 1003 | Ga0500616_0041719 | 3300053153 | Bacteria | 2460 |
| 1004 | Ga0500616_0072211 | 3300053153 | Bacteria | 1755 |
| 1005 | Ga0500622_0061457 | 3300053156 | Bacteria | 1915 |
| 1006 | Ga0500622_0105632 | 3300053156 | Bacteria | 1381 |
| 1007 | Ga0500624_000024 | 3300053157 | Bacteria | 114404 |
| 1008 | Ga0500624_000062 | 3300053157 | Bacteria | 66317 |
| 1009 | Ga0500624_000105 | 3300053157 | Bacteria | 40162 |
| 1010 | Ga0500627_0000844 | 3300053158 | Bacteria | 8195 |
| 1011 | Ga0500627_0000889 | 3300053158 | Bacteria | 8007 |
| 1012 | Ga0500627_0011244 | 3300053158 | Bacteria | 3296 |
| 1013 | Ga0500636_0003773 | 3300053177 | Bacteria | 8558 |
| 1014 | Ga0500636_0034004 | 3300053177 | Bacteria | 3016 |
| 1015 | Ga0500637_0000692 | 3300053178 | Bacteria | 13419 |
| 1016 | Ga0500567_009748 | 3300053723 | Bacteria | 4580 |
| 1017 | Ga0500611_004434 | 3300053727 | Bacteria | 1894 |
| 1018 | Ga0500625_000039 | 3300053729 | Bacteria | 43868 |
| 1019 | Ga0500645_000134 | 3300053730 | Bacteria | 58275 |
| 1020 | Ga0500645_000767 | 3300053730 | Bacteria | 19511 |
| 1021 | Ga0500596_005462 | 3300053735 | Bacteria | 2233 |
| 1022 | Ga0501084_0003536 | 3300054114 | Bacteria | 12682 |
| 1023 | Ga0590071_004250 | 3300059421 | Bacteria | 3486 |
| 1024 | Ga0590075_001519 | 3300059424 | Bacteria | 5778 |
| 1025 | Ga0501082_0001005 | 3300060353 | Bacteria | 24909 |
| 1026 | Ga0501082_0060529 | 3300060353 | Bacteria | 3260 |
| 1027 | Ga0501082_0199736 | 3300060353 | Bacteria | 1740 |
| 1028 | Ga0530510_0000050 | 3300061734 | Bacteria | 55919 |
| 1029 | Ga0530510_0122252 | 3300061734 | Bacteria | 1911 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0280500 | Ga0501038_0280500_218_1291 | 354 |
| 2 | 3300035118 | Ga0373954_0101270 | Ga0373954_0101270_240_1352 | 365 |
| 3 | 3300035170 | Ga0373943_0081973 | Ga0373943_0081973_478_1590 | 366 |
| 4 | 3300035695 | Ga0373927_0156870 | Ga0373927_0156870_85_1197 | 366 |
| 5 | iso_pu_bacteria | 2967671571 | 2967673812 | 375 |
| 6 | iso_pu_bacteria | 2970019648 | 2970021648 | 375 |
| 7 | 3300003762 | Ga0055542_1000025 | Ga0055542_1000025199 | 377 |
| 8 | 3300003763 | Ga0055529_1000014 | Ga0055529_100001454 | 377 |
| 9 | 3300025254 | Ga0209148_1000011 | Ga0209148_100001155 | 377 |
| 10 | 3300025272 | Ga0209455_1000006 | Ga0209455_10000061139 | 377 |
| 11 | 3300025986 | Ga0207658_10045858 | Ga0207658_100458584 | 379 |
| 12 | 3300049822 | Ga0501035_0140319 | Ga0501035_0140319_47_1210 | 383 |
| 13 | 3300009148 | Ga0105243_10000033 | Ga0105243_1000003340 | 385 |
| 14 | 3300025935 | Ga0207709_10000059 | Ga0207709_10000059212 | 385 |
| 15 | 3300048925 | Ga0496122_0011913 | Ga0496122_0011913_6042_7373 | 389 |
| 16 | 3300048926 | Ga0496123_0020817 | Ga0496123_0020817_1550_2881 | 389 |
| 17 | 3300048928 | Ga0496125_0000114 | Ga0496125_0000114_6369_7700 | 389 |
| 18 | 3300005339 | Ga0070660_100108019 | Ga0070660_1001080192 | 390 |
| 19 | 3300005366 | Ga0070659_100041111 | Ga0070659_1000411113 | 390 |
| 20 | 3300005435 | Ga0070714_100078232 | Ga0070714_1000782323 | 390 |
| 21 | 3300025919 | Ga0207657_10105879 | Ga0207657_101058792 | 390 |
| 22 | 3300025932 | Ga0207690_10010856 | Ga0207690_100108563 | 390 |
| 23 | 3300025949 | Ga0207667_10020324 | Ga0207667_100203246 | 390 |
| 24 | 3300035083 | Ga0373926_0012290 | Ga0373926_0012290_1089_2288 | 390 |
| 25 | 3300035113 | Ga0373936_0042425 | Ga0373936_0042425_192_1391 | 390 |
| 26 | 3300035170 | Ga0373943_0004815 | Ga0373943_0004815_1763_2962 | 390 |
| 27 | 3300035692 | Ga0373935_0004136 | Ga0373935_0004136_3619_4818 | 390 |
| 28 | 3300035695 | Ga0373927_0013012 | Ga0373927_0013012_2596_3795 | 390 |
| 29 | 3300037068 | Ga0373925_0002642 | Ga0373925_0002642_5842_7041 | 390 |
| 30 | 3300046472 | Ga0495580_0017783 | Ga0495580_0017783_3650_4849 | 390 |
| 31 | 3300046473 | Ga0495582_0042330 | Ga0495582_0042330_855_2054 | 390 |
| 32 | 3300046475 | Ga0495639_0000789 | Ga0495639_0000789_9136_10335 | 390 |
| 33 | 3300046517 | Ga0495630_0012981 | Ga0495630_0012981_2076_3275 | 390 |
| 34 | 3300046524 | Ga0495648_0000147 | Ga0495648_0000147_77128_78459 | 390 |
| 35 | 3300046531 | Ga0495665_0001769 | Ga0495665_0001769_7668_8867 | 390 |
| 36 | 3300046674 | Ga0495588_0005144 | Ga0495588_0005144_4266_5465 | 390 |
| 37 | 3300046683 | Ga0495658_0002931 | Ga0495658_0002931_3682_4881 | 390 |
| 38 | 3300046689 | Ga0495613_0025023 | Ga0495613_0025023_2619_3818 | 390 |
| 39 | 3300047315 | Ga0495581_0007959 | Ga0495581_0007959_3819_5018 | 390 |
| 40 | 3300047673 | Ga0495593_0002299 | Ga0495593_0002299_2731_3930 | 390 |
| 41 | 3300048089 | Ga0495614_0002616 | Ga0495614_0002616_4078_5277 | 390 |
| 42 | 3300047443 | Ga0495687_000045 | Ga0495687_000045_208424_209755 | 394 |
| 43 | 3300039438 | Ga0436360_1255809 | Ga0436360_1255809_623_1858 | 395 |
| 44 | 3300013308 | Ga0157375_10065252 | Ga0157375_100652523 | 400 |
| 45 | 3300053735 | Ga0500596_005462 | Ga0500596_005462_99_1430 | 400 |
| 46 | 3300004800 | Ga0058861_12061624 | Ga0058861_120616241 | 402 |
| 47 | 3300005327 | Ga0070658_10014420 | Ga0070658_100144206 | 402 |
| 48 | 3300005366 | Ga0070659_100119598 | Ga0070659_1001195982 | 402 |
| 49 | 3300025909 | Ga0207705_10016169 | Ga0207705_100161694 | 402 |
| 50 | 3300025932 | Ga0207690_10087993 | Ga0207690_100879932 | 402 |
| 51 | 3300036401 | Ga0373937_0110922 | Ga0373937_0110922_490_1779 | 402 |
| 52 | 3300046454 | Ga0495592_0096045 | Ga0495592_0096045_746_2035 | 402 |
| 53 | 3300046678 | Ga0495599_0093830 | Ga0495599_0093830_160_1449 | 402 |
| 54 | 3300046558 | Ga0495633_0073505 | Ga0495633_0073505_359_1579 | 404 |
| 55 | 3300006038 | Ga0075365_10074003 | Ga0075365_100740032 | 405 |
| 56 | 3300005331 | Ga0070670_100044213 | Ga0070670_1000442132 | 406 |
| 57 | 3300005367 | Ga0070667_100122428 | Ga0070667_1001224283 | 406 |
| 58 | 3300048911 | Ga0496108_0045490 | Ga0496108_0045490_1426_2745 | 406 |
| 59 | 3300048912 | Ga0496109_0056144 | Ga0496109_0056144_745_2064 | 406 |
| 60 | 3300048913 | Ga0496110_0038618 | Ga0496110_0038618_1930_3249 | 406 |
| 61 | 3300048915 | Ga0496112_0175508 | Ga0496112_0175508_526_1845 | 406 |
| 62 | 3300048916 | Ga0496113_0023903 | Ga0496113_0023903_1792_3111 | 406 |
| 63 | 3300048928 | Ga0496125_0051834 | Ga0496125_0051834_688_2007 | 406 |
| 64 | 3300005842 | Ga0068858_100014160 | Ga0068858_1000141605 | 408 |
| 65 | 3300025972 | Ga0207668_10109414 | Ga0207668_101094142 | 408 |
| 66 | 3300036401 | Ga0373937_0144920 | Ga0373937_0144920_24_1259 | 408 |
| 67 | 3300005347 | Ga0070668_100000197 | Ga0070668_10000019737 | 409 |
| 68 | 3300005355 | Ga0070671_100000482 | Ga0070671_10000048227 | 409 |
| 69 | 3300005548 | Ga0070665_100241459 | Ga0070665_1002414592 | 409 |
| 70 | 3300005719 | Ga0068861_100010221 | Ga0068861_1000102213 | 409 |
| 71 | 3300005841 | Ga0068863_100027387 | Ga0068863_1000273874 | 409 |
| 72 | 3300005844 | Ga0068862_100017500 | Ga0068862_1000175003 | 409 |
| 73 | 3300013104 | Ga0157370_10049403 | Ga0157370_100494032 | 409 |
| 74 | 3300025941 | Ga0207711_10268308 | Ga0207711_102683081 | 409 |
| 75 | 3300026088 | Ga0207641_10000115 | Ga0207641_1000011580 | 409 |
| 76 | 3300026088 | Ga0207641_10008887 | Ga0207641_1000888711 | 409 |
| 77 | 3300026095 | Ga0207676_10005994 | Ga0207676_100059946 | 409 |
| 78 | 3300026118 | Ga0207675_100028656 | Ga0207675_1000286564 | 409 |
| 79 | 3300002459 | JGI24751J29686_10000235 | JGI24751J29686_1000023511 | 410 |
| 80 | 3300032126 | Ga0307415_100159691 | Ga0307415_1001596913 | 410 |
| 81 | 3300045049 | Ga0466959_0019769 | Ga0466959_0019769_2475_3710 | 410 |
| 82 | 3300046499 | Ga0495594_0015378 | Ga0495594_0015378_1188_2453 | 410 |
| 83 | 3300046506 | Ga0495583_0000038 | Ga0495583_0000038_186167_187405 | 410 |
| 84 | 3300046665 | Ga0495661_0070079 | Ga0495661_0070079_610_1848 | 410 |
| 85 | 3300047320 | Ga0495672_0007359 | Ga0495672_0007359_4821_6080 | 410 |
| 86 | 3300053103 | Ga0500555_003899 | Ga0500555_003899_461_1699 | 410 |
| 87 | 3300053108 | Ga0500562_011252 | Ga0500562_011252_323_1570 | 410 |
| 88 | 3300009147 | Ga0114129_10524881 | Ga0114129_105248812 | 412 |
| 89 | 3300025304 | Ga0209257_1018206 | Ga0209257_10182063 | 412 |
| 90 | 3300005330 | Ga0070690_100000483 | Ga0070690_1000004835 | 414 |
| 91 | 3300005331 | Ga0070670_100004278 | Ga0070670_1000042782 | 414 |
| 92 | 3300005338 | Ga0068868_100002423 | Ga0068868_1000024238 | 414 |
| 93 | 3300005355 | Ga0070671_100032053 | Ga0070671_1000320532 | 414 |
| 94 | 3300005364 | Ga0070673_100010149 | Ga0070673_1000101493 | 414 |
| 95 | 3300005367 | Ga0070667_100012637 | Ga0070667_1000126374 | 414 |
| 96 | 3300005618 | Ga0068864_100003187 | Ga0068864_1000031873 | 414 |
| 97 | 3300005841 | Ga0068863_100055600 | Ga0068863_1000556003 | 414 |
| 98 | 3300006358 | Ga0068871_100024042 | Ga0068871_1000240425 | 414 |
| 99 | 3300009177 | Ga0105248_10008690 | Ga0105248_1000869013 | 414 |
| 100 | 3300011119 | Ga0105246_10116683 | Ga0105246_101166832 | 414 |
| 101 | 3300013306 | Ga0163162_10013689 | Ga0163162_100136897 | 414 |
| 102 | 3300013308 | Ga0157375_10006186 | Ga0157375_100061862 | 414 |
| 103 | 3300014325 | Ga0163163_10022274 | Ga0163163_100222746 | 414 |
| 104 | 3300025925 | Ga0207650_10002138 | Ga0207650_100021388 | 414 |
| 105 | 3300025931 | Ga0207644_10017956 | Ga0207644_100179566 | 414 |
| 106 | 3300025941 | Ga0207711_10011653 | Ga0207711_100116536 | 414 |
| 107 | 3300025945 | Ga0207679_10017290 | Ga0207679_100172904 | 414 |
| 108 | 3300025960 | Ga0207651_10059026 | Ga0207651_100590264 | 414 |
| 109 | 3300026023 | Ga0207677_10002920 | Ga0207677_100029204 | 414 |
| 110 | 3300026088 | Ga0207641_10033804 | Ga0207641_100338043 | 414 |
| 111 | 3300033180 | Ga0307510_10052621 | Ga0307510_100526214 | 415 |
| 112 | 3300041413 | Ga0439465_0010080 | Ga0439465_0010080_1005_2378 | 415 |
| 113 | 3300005336 | Ga0070680_100169761 | Ga0070680_1001697612 | 416 |
| 114 | 3300025912 | Ga0207707_10160961 | Ga0207707_101609612 | 416 |
| 115 | 3300053085 | Ga0495619_0015018 | Ga0495619_0015018_1982_3316 | 416 |
| 116 | 3300059421 | Ga0590071_004250 | Ga0590071_004250_1095_2378 | 416 |
| 117 | 3300059424 | Ga0590075_001519 | Ga0590075_001519_2172_3455 | 416 |
| 118 | 3300005295 | Ga0065707_10084641 | Ga0065707_100846412 | 417 |
| 119 | 3300006846 | Ga0075430_100151222 | Ga0075430_1001512222 | 417 |
| 120 | 3300006847 | Ga0075431_100004735 | Ga0075431_1000047355 | 417 |
| 121 | 3300006847 | Ga0075431_100014844 | Ga0075431_1000148445 | 417 |
| 122 | 3300006852 | Ga0075433_10031628 | Ga0075433_100316284 | 417 |
| 123 | 3300009147 | Ga0114129_10001654 | Ga0114129_100016548 | 417 |
| 124 | 3300009147 | Ga0114129_10026011 | Ga0114129_100260115 | 417 |
| 125 | 3300009147 | Ga0114129_10034137 | Ga0114129_100341374 | 417 |
| 126 | 3300009147 | Ga0114129_10443639 | Ga0114129_104436392 | 417 |
| 127 | 3300013306 | Ga0163162_10005593 | Ga0163162_100055932 | 417 |
| 128 | 3300025922 | Ga0207646_10046513 | Ga0207646_100465131 | 417 |
| 129 | 3300025933 | Ga0207706_10141341 | Ga0207706_101413412 | 417 |
| 130 | 3300026121 | Ga0207683_10020489 | Ga0207683_100204893 | 417 |
| 131 | 3300027876 | Ga0209974_10004804 | Ga0209974_100048042 | 417 |
| 132 | 3300031456 | Ga0307513_10109370 | Ga0307513_101093702 | 417 |
| 133 | 3300031901 | Ga0307406_10176625 | Ga0307406_101766251 | 417 |
| 134 | 3300035725 | Ga0373947_0016497 | Ga0373947_0016497_1562_2848 | 417 |
| 135 | 3300037068 | Ga0373925_0131705 | Ga0373925_0131705_348_1634 | 417 |
| 136 | 3300045051 | Ga0451576_0032757 | Ga0451576_0032757_3872_5158 | 417 |
| 137 | 3300049569 | Ga0501032_0003709 | Ga0501032_0003709_3049_4335 | 417 |
| 138 | 3300049570 | Ga0501033_0011114 | Ga0501033_0011114_4550_5836 | 417 |
| 139 | 3300049572 | Ga0501036_0052198 | Ga0501036_0052198_168_1454 | 417 |
| 140 | 3300049573 | Ga0501037_0010333 | Ga0501037_0010333_1482_2768 | 417 |
| 141 | 3300049573 | Ga0501037_0017394 | Ga0501037_0017394_1982_3268 | 417 |
| 142 | 3300049574 | Ga0501038_0000423 | Ga0501038_0000423_25517_26803 | 417 |
| 143 | 3300049574 | Ga0501038_0059572 | Ga0501038_0059572_519_1805 | 417 |
| 144 | 3300049575 | Ga0501039_0000228 | Ga0501039_0000228_8842_10128 | 417 |
| 145 | 3300049576 | Ga0501040_0000401 | Ga0501040_0000401_13550_14836 | 417 |
| 146 | 3300049577 | Ga0501041_0000068 | Ga0501041_0000068_30310_31596 | 417 |
| 147 | 3300049578 | Ga0501042_0000225 | Ga0501042_0000225_2229_3515 | 417 |
| 148 | 3300049578 | Ga0501042_0004646 | Ga0501042_0004646_2960_4246 | 417 |
| 149 | 3300049579 | Ga0501043_0006877 | Ga0501043_0006877_6900_8186 | 417 |
| 150 | 3300049579 | Ga0501043_0058400 | Ga0501043_0058400_1642_2928 | 417 |
| 151 | 3300049580 | Ga0501046_0047770 | Ga0501046_0047770_893_2179 | 417 |
| 152 | 3300049582 | Ga0501048_0033352 | Ga0501048_0033352_391_1677 | 417 |
| 153 | 3300049584 | Ga0501068_0006265 | Ga0501068_0006265_2351_3637 | 417 |
| 154 | 3300049584 | Ga0501068_0057140 | Ga0501068_0057140_796_2082 | 417 |
| 155 | 3300049584 | Ga0501068_0090858 | Ga0501068_0090858_136_1431 | 417 |
| 156 | 3300049587 | Ga0501071_0000943 | Ga0501071_0000943_2081_3367 | 417 |
| 157 | 3300049587 | Ga0501071_0041124 | Ga0501071_0041124_146_1468 | 417 |
| 158 | 3300049588 | Ga0501072_0000133 | Ga0501072_0000133_10240_11526 | 417 |
| 159 | 3300049589 | Ga0501073_0008046 | Ga0501073_0008046_5110_6396 | 417 |
| 160 | 3300049590 | Ga0501074_0040848 | Ga0501074_0040848_2003_3289 | 417 |
| 161 | 3300049591 | Ga0501075_0000065 | Ga0501075_0000065_30649_31935 | 417 |
| 162 | 3300049591 | Ga0501075_0003810 | Ga0501075_0003810_5398_6693 | 417 |
| 163 | 3300049591 | Ga0501075_0006150 | Ga0501075_0006150_3021_4343 | 417 |
| 164 | 3300049591 | Ga0501075_0029149 | Ga0501075_0029149_2075_3361 | 417 |
| 165 | 3300049592 | Ga0501076_0000120 | Ga0501076_0000120_8828_10114 | 417 |
| 166 | 3300049592 | Ga0501076_0010487 | Ga0501076_0010487_608_1903 | 417 |
| 167 | 3300049592 | Ga0501076_0073841 | Ga0501076_0073841_959_2281 | 417 |
| 168 | 3300049593 | Ga0501077_0000108 | Ga0501077_0000108_13396_14682 | 417 |
| 169 | 3300049741 | Ga0501079_0003036 | Ga0501079_0003036_7472_8758 | 417 |
| 170 | 3300049741 | Ga0501079_0007424 | Ga0501079_0007424_3650_4945 | 417 |
| 171 | 3300049742 | Ga0501080_0003323 | Ga0501080_0003323_10420_11706 | 417 |
| 172 | 3300049743 | Ga0501081_0000705 | Ga0501081_0000705_8842_10128 | 417 |
| 173 | 3300049743 | Ga0501081_0031876 | Ga0501081_0031876_1345_2667 | 417 |
| 174 | 3300049744 | Ga0501083_0009775 | Ga0501083_0009775_1514_2800 | 417 |
| 175 | 3300049822 | Ga0501035_0044401 | Ga0501035_0044401_2009_3295 | 417 |
| 176 | 3300049822 | Ga0501035_0075331 | Ga0501035_0075331_1191_2477 | 417 |
| 177 | 3300049823 | Ga0501044_0026843 | Ga0501044_0026843_2458_3744 | 417 |
| 178 | 3300049824 | Ga0501045_0000389 | Ga0501045_0000389_5492_6778 | 417 |
| 179 | 3300050507 | nmdc:mga05p37_21251_c1 | nmdc:mga05p37_21251_c1_2408_3694 | 417 |
| 180 | 3300050507 | nmdc:mga05p37_32544_c1 | nmdc:mga05p37_32544_c1_4644_5930 | 417 |
| 181 | 3300050507 | nmdc:mga05p37_446694_c1 | nmdc:mga05p37_446694_c1_105_1391 | 417 |
| 182 | 3300050511 | nmdc:mga08y16_11558_c1 | nmdc:mga08y16_11558_c1_3650_4939 | 417 |
| 183 | 3300050515 | nmdc:mga0a205_18078_c1 | nmdc:mga0a205_18078_c1_485_1771 | 417 |
| 184 | 3300050515 | nmdc:mga0a205_276294_c1 | nmdc:mga0a205_276294_c1_231_1517 | 417 |
| 185 | 3300050515 | nmdc:mga0a205_41220_c1 | nmdc:mga0a205_41220_c1_1195_2481 | 417 |
| 186 | 3300054114 | Ga0501084_0003536 | Ga0501084_0003536_9195_10481 | 417 |
| 187 | 3300060353 | Ga0501082_0001005 | Ga0501082_0001005_20295_21581 | 417 |
| 188 | 3300060353 | Ga0501082_0060529 | Ga0501082_0060529_879_2174 | 417 |
| 189 | 3300060353 | Ga0501082_0199736 | Ga0501082_0199736_65_1387 | 417 |
| 190 | 3300061734 | Ga0530510_0000050 | Ga0530510_0000050_44394_45680 | 417 |
| 191 | 3300061734 | Ga0530510_0122252 | Ga0530510_0122252_519_1805 | 417 |
| 192 | 3300005328 | Ga0070676_10003672 | Ga0070676_100036723 | 418 |
| 193 | 3300005330 | Ga0070690_100014932 | Ga0070690_1000149324 | 418 |
| 194 | 3300005335 | Ga0070666_10001625 | Ga0070666_100016258 | 418 |
| 195 | 3300005340 | Ga0070689_100043036 | Ga0070689_1000430364 | 418 |
| 196 | 3300005340 | Ga0070689_100095475 | Ga0070689_1000954752 | 418 |
| 197 | 3300005354 | Ga0070675_100007844 | Ga0070675_1000078444 | 418 |
| 198 | 3300005356 | Ga0070674_100010775 | Ga0070674_1000107752 | 418 |
| 199 | 3300005364 | Ga0070673_100000138 | Ga0070673_1000001389 | 418 |
| 200 | 3300005366 | Ga0070659_100097236 | Ga0070659_1000972362 | 418 |
| 201 | 3300005456 | Ga0070678_100001464 | Ga0070678_1000014645 | 418 |
| 202 | 3300005536 | Ga0070697_100097945 | Ga0070697_1000979453 | 418 |
| 203 | 3300005543 | Ga0070672_100005400 | Ga0070672_1000054003 | 418 |
| 204 | 3300005564 | Ga0070664_100021787 | Ga0070664_1000217874 | 418 |
| 205 | 3300005616 | Ga0068852_100165021 | Ga0068852_1001650212 | 418 |
| 206 | 3300005983 | Ga0081540_1009297 | Ga0081540_10092977 | 418 |
| 207 | 3300006237 | Ga0097621_100013780 | Ga0097621_1000137803 | 418 |
| 208 | 3300006358 | Ga0068871_100008468 | Ga0068871_1000084682 | 418 |
| 209 | 3300009094 | Ga0111539_10000890 | Ga0111539_100008909 | 418 |
| 210 | 3300013308 | Ga0157375_10002592 | Ga0157375_100025929 | 418 |
| 211 | 3300014969 | Ga0157376_10000903 | Ga0157376_1000090314 | 418 |
| 212 | 3300025893 | Ga0207682_10011989 | Ga0207682_100119891 | 418 |
| 213 | 3300025903 | Ga0207680_10025252 | Ga0207680_100252523 | 418 |
| 214 | 3300025907 | Ga0207645_10002209 | Ga0207645_100022097 | 418 |
| 215 | 3300025925 | Ga0207650_10027164 | Ga0207650_100271644 | 418 |
| 216 | 3300025926 | Ga0207659_10002827 | Ga0207659_100028279 | 418 |
| 217 | 3300025932 | Ga0207690_10148204 | Ga0207690_101482042 | 418 |
| 218 | 3300025933 | Ga0207706_10009415 | Ga0207706_100094154 | 418 |
| 219 | 3300025940 | Ga0207691_10000019 | Ga0207691_100000199 | 418 |
| 220 | 3300025945 | Ga0207679_10067410 | Ga0207679_100674103 | 418 |
| 221 | 3300025960 | Ga0207651_10001213 | Ga0207651_100012132 | 418 |
| 222 | 3300026116 | Ga0207674_10086805 | Ga0207674_100868054 | 418 |
| 223 | 3300026121 | Ga0207683_10002984 | Ga0207683_100029847 | 418 |
| 224 | 3300026142 | Ga0207698_10274655 | Ga0207698_102746551 | 418 |
| 225 | 3300027907 | Ga0207428_10047662 | Ga0207428_100476621 | 418 |
| 226 | 3300031548 | Ga0307408_100134083 | Ga0307408_1001340833 | 418 |
| 227 | 3300031903 | Ga0307407_10019922 | Ga0307407_100199222 | 418 |
| 228 | 3300031995 | Ga0307409_100106263 | Ga0307409_1001062633 | 418 |
| 229 | 3300048907 | Ga0496104_0109404 | Ga0496104_0109404_380_1699 | 418 |
| 230 | 3300048908 | Ga0496105_0079109 | Ga0496105_0079109_283_1602 | 418 |
| 231 | 3300048917 | Ga0496114_0003386 | Ga0496114_0003386_6794_8113 | 418 |
| 232 | 3300050511 | nmdc:mga08y16_1414_c1 | nmdc:mga08y16_1414_c1_13097_14416 | 418 |
| 233 | 3300046525 | Ga0495663_0010363 | Ga0495663_0010363_1031_2365 | 420 |
| 234 | 3300053116 | Ga0500592_001060 | Ga0500592_001060_1174_2508 | 420 |
| 235 | 3300053139 | Ga0500568_0048447 | Ga0500568_0048447_213_1547 | 420 |
| 236 | 3300053727 | Ga0500611_004434 | Ga0500611_004434_439_1773 | 420 |
| 237 | 3300009553 | Ga0105249_10000103 | Ga0105249_1000010352 | 422 |
| 238 | 3300013297 | Ga0157378_10137652 | Ga0157378_101376521 | 422 |
| 239 | 3300046530 | Ga0495654_0010002 | Ga0495654_0010002_2652_3923 | 422 |
| 240 | 3300046616 | Ga0495668_0028910 | Ga0495668_0028910_680_1951 | 422 |
| 241 | 3300046794 | Ga0495589_0011649 | Ga0495589_0011649_1298_2569 | 422 |
| 242 | 3300048905 | Ga0496102_0000043 | Ga0496102_0000043_184714_185985 | 422 |
| 243 | 3300048906 | Ga0496103_0000133 | Ga0496103_0000133_3217_4488 | 422 |
| 244 | 3300048919 | Ga0496116_0014376 | Ga0496116_0014376_3205_4476 | 422 |
| 245 | 3300048920 | Ga0496117_0000104 | Ga0496117_0000104_184714_185985 | 422 |
| 246 | 3300048921 | Ga0496118_0000080 | Ga0496118_0000080_3217_4488 | 422 |
| 247 | 3300048927 | Ga0496124_0000093 | Ga0496124_0000093_3217_4488 | 422 |
| 248 | 3300053087 | Ga0500643_001944 | Ga0500643_001944_1796_3064 | 422 |
| 249 | 3300053136 | Ga0500559_0007673 | Ga0500559_0007673_1689_2957 | 422 |
| 250 | 3300053158 | Ga0500627_0000889 | Ga0500627_0000889_5293_6564 | 422 |
| 251 | 3300053094 | Ga0500566_0000696 | Ga0500566_0000696_1533_2810 | 425 |
| 252 | 3300039438 | Ga0436360_0036174 | Ga0436360_0036174_1302_2591 | 426 |
| 253 | 3300005327 | Ga0070658_10000033 | Ga0070658_1000003366 | 427 |
| 254 | 3300005339 | Ga0070660_100000225 | Ga0070660_1000002254 | 427 |
| 255 | 3300005345 | Ga0070692_10005729 | Ga0070692_100057292 | 427 |
| 256 | 3300005366 | Ga0070659_100023655 | Ga0070659_1000236556 | 427 |
| 257 | 3300005439 | Ga0070711_100033038 | Ga0070711_1000330382 | 427 |
| 258 | 3300005614 | Ga0068856_100171757 | Ga0068856_1001717571 | 427 |
| 259 | 3300006028 | Ga0070717_10193808 | Ga0070717_101938082 | 427 |
| 260 | 3300013105 | Ga0157369_10030829 | Ga0157369_100308295 | 427 |
| 261 | 3300021384 | Ga0213876_10000310 | Ga0213876_1000031039 | 427 |
| 262 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021950 | 427 |
| 263 | 3300025928 | Ga0207700_10034972 | Ga0207700_100349723 | 427 |
| 264 | 3300025932 | Ga0207690_10013890 | Ga0207690_100138906 | 427 |
| 265 | 3300025932 | Ga0207690_10142117 | Ga0207690_101421172 | 427 |
| 266 | 3300035118 | Ga0373954_0006557 | Ga0373954_0006557_3016_4350 | 427 |
| 267 | 3300035120 | Ga0373957_0005881 | Ga0373957_0005881_939_2273 | 427 |
| 268 | 3300035170 | Ga0373943_0046767 | Ga0373943_0046767_725_2059 | 427 |
| 269 | 3300035692 | Ga0373935_0025842 | Ga0373935_0025842_235_1569 | 427 |
| 270 | 3300035724 | Ga0373933_0014844 | Ga0373933_0014844_1551_2885 | 427 |
| 271 | 3300035725 | Ga0373947_0086858 | Ga0373947_0086858_429_1763 | 427 |
| 272 | 3300036401 | Ga0373937_0004279 | Ga0373937_0004279_6118_7452 | 427 |
| 273 | 3300036401 | Ga0373937_0027529 | Ga0373937_0027529_2890_4224 | 427 |
| 274 | 3300037068 | Ga0373925_0038558 | Ga0373925_0038558_899_2233 | 427 |
| 275 | 3300039437 | Ga0436365_1654841 | Ga0436365_1654841_8341_9651 | 427 |
| 276 | 3300046477 | Ga0495664_0007587 | Ga0495664_0007587_2522_3856 | 427 |
| 277 | 3300046543 | Ga0495645_0003119 | Ga0495645_0003119_2165_3499 | 427 |
| 278 | 3300046559 | Ga0495667_0008176 | Ga0495667_0008176_3266_4579 | 427 |
| 279 | 3300046559 | Ga0495667_0025775 | Ga0495667_0025775_2606_3940 | 427 |
| 280 | 3300046691 | Ga0495670_0028758 | Ga0495670_0028758_336_1634 | 427 |
| 281 | 3300047317 | Ga0495604_0048025 | Ga0495604_0048025_259_1593 | 427 |
| 282 | 3300047444 | Ga0495675_0034447 | Ga0495675_0034447_835_2169 | 427 |
| 283 | 3300048088 | Ga0495602_0003534 | Ga0495602_0003534_9134_10468 | 427 |
| 284 | 3300053078 | Ga0495612_0000632 | Ga0495612_0000632_4619_5953 | 427 |
| 285 | 3300005841 | Ga0068863_100173781 | Ga0068863_1001737812 | 428 |
| 286 | 3300048929 | Ga0496126_0122718 | Ga0496126_0122718_853_2148 | 428 |
| 287 | 3300005985 | Ga0081539_10006765 | Ga0081539_100067653 | 430 |
| 288 | 3300017792 | Ga0163161_10038310 | Ga0163161_100383104 | 430 |
| 289 | 3300046522 | Ga0495643_0031010 | Ga0495643_0031010_1021_2388 | 430 |
| 290 | 3300047469 | Ga0495673_0041921 | Ga0495673_0041921_616_1947 | 430 |
| 291 | 3300048926 | Ga0496123_0060977 | Ga0496123_0060977_395_1747 | 430 |
| 292 | 3300048927 | Ga0496124_0053549 | Ga0496124_0053549_1402_2754 | 430 |
| 293 | 3300053130 | Ga0500642_0013377 | Ga0500642_0013377_1085_2416 | 430 |
| 294 | 3300031824 | Ga0307413_10053302 | Ga0307413_100533023 | 431 |
| 295 | 3300053153 | Ga0500616_0041719 | Ga0500616_0041719_422_1750 | 431 |
| 296 | iso_pu_bacteria | 2643221618 | 2644103793 | 431 |
| 297 | iso_pu_bacteria | 2643221626 | 2644144674 | 431 |
| 298 | iso_pu_bacteria | 2643221655 | 2644306723 | 431 |
| 299 | iso_pu_bacteria | 2643221659 | 2644330914 | 431 |
| 300 | iso_pu_bacteria | 2643221698 | 2644541133 | 431 |
| 301 | iso_pu_bacteria | 2643221712 | 2644612334 | 431 |
| 302 | iso_pu_bacteria | 2671180139 | 2671693757 | 431 |
| 303 | iso_pu_bacteria | 2844163670 | 2844164740 | 431 |
| 304 | 3300002704 | JGI25155J39150_1000069 | JGI25155J39150_10000695 | 432 |
| 305 | 3300002705 | JGI25156J39149_1000095 | JGI25156J39149_10000955 | 432 |
| 306 | 3300002738 | JGI25154J39366_1000866 | JGI25154J39366_100086612 | 432 |
| 307 | 3300002741 | JGI25157J39369_1000732 | JGI25157J39369_100073215 | 432 |
| 308 | 3300002987 | JGI25159J45721_1003717 | JGI25159J45721_10037174 | 432 |
| 309 | 3300002987 | JGI25159J45721_1006593 | JGI25159J45721_10065931 | 432 |
| 310 | 3300003187 | JGI25151J46595_10003658 | JGI25151J46595_100036583 | 432 |
| 311 | 3300003187 | JGI25151J46595_10007368 | JGI25151J46595_100073687 | 432 |
| 312 | 3300003215 | JGI25153J46596_10019462 | JGI25153J46596_100194622 | 432 |
| 313 | 3300003215 | JGI25153J46596_10021828 | JGI25153J46596_100218281 | 432 |
| 314 | 3300003354 | JGI25160J50197_1000003 | JGI25160J50197_100000327 | 432 |
| 315 | 3300003354 | JGI25160J50197_1000287 | JGI25160J50197_100028740 | 432 |
| 316 | 3300003354 | JGI25160J50197_1005283 | JGI25160J50197_10052837 | 432 |
| 317 | 3300003374 | JGI25161J50226_1000176 | JGI25161J50226_10001764 | 432 |
| 318 | 3300003374 | JGI25161J50226_1000299 | JGI25161J50226_10002995 | 432 |
| 319 | 3300003374 | JGI25161J50226_1003479 | JGI25161J50226_10034793 | 432 |
| 320 | 3300003771 | Ga0055526_1004618 | Ga0055526_10046185 | 432 |
| 321 | 3300003771 | Ga0055526_1007837 | Ga0055526_10078373 | 432 |
| 322 | 3300003775 | Ga0055524_1006032 | Ga0055524_10060328 | 432 |
| 323 | 3300003775 | Ga0055524_1006689 | Ga0055524_10066893 | 432 |
| 324 | 3300003781 | Ga0055536_1001996 | Ga0055536_10019964 | 432 |
| 325 | 3300003790 | Ga0055528_1018190 | Ga0055528_10181902 | 432 |
| 326 | 3300003791 | Ga0055530_10011442 | Ga0055530_100114422 | 432 |
| 327 | 3300003794 | Ga0055531_10027395 | Ga0055531_100273951 | 432 |
| 328 | 3300004625 | Ga0055543_1000034 | Ga0055543_1000034127 | 432 |
| 329 | 3300004625 | Ga0055543_1000114 | Ga0055543_100011475 | 432 |
| 330 | 3300004625 | Ga0055543_1001135 | Ga0055543_10011358 | 432 |
| 331 | 3300004799 | Ga0058863_11910898 | Ga0058863_119108981 | 432 |
| 332 | 3300004803 | Ga0058862_12737959 | Ga0058862_127379591 | 432 |
| 333 | 3300005262 | Ga0065165_1000047 | Ga0065165_1000047147 | 432 |
| 334 | 3300005262 | Ga0065165_1004051 | Ga0065165_10040514 | 432 |
| 335 | 3300005548 | Ga0070665_100049096 | Ga0070665_1000490966 | 432 |
| 336 | 3300005548 | Ga0070665_100074881 | Ga0070665_1000748813 | 432 |
| 337 | 3300006038 | Ga0075365_10013351 | Ga0075365_100133513 | 432 |
| 338 | 3300006177 | Ga0075362_10004292 | Ga0075362_100042925 | 432 |
| 339 | 3300006178 | Ga0075367_10012269 | Ga0075367_100122692 | 432 |
| 340 | 3300006186 | Ga0075369_10005723 | Ga0075369_100057237 | 432 |
| 341 | 3300006353 | Ga0075370_10010246 | Ga0075370_100102463 | 432 |
| 342 | 3300006946 | Ga0079104_1000125 | Ga0079104_100012589 | 432 |
| 343 | 3300006946 | Ga0079104_1004867 | Ga0079104_10048672 | 432 |
| 344 | 3300006946 | Ga0079104_1006152 | Ga0079104_10061523 | 432 |
| 345 | 3300013105 | Ga0157369_10097133 | Ga0157369_100971334 | 432 |
| 346 | 3300013249 | Ga0171463_1001 | Ga0171463_10011255 | 432 |
| 347 | 3300015690 | Ga0183363_1053 | Ga0183363_105318 | 432 |
| 348 | 3300020070 | Ga0206356_11309587 | Ga0206356_113095871 | 432 |
| 349 | 3300020080 | Ga0206350_11038354 | Ga0206350_110383542 | 432 |
| 350 | 3300020081 | Ga0206354_10710180 | Ga0206354_107101802 | 432 |
| 351 | 3300021320 | Ga0214544_1000434 | Ga0214544_100043437 | 432 |
| 352 | 3300021321 | Ga0214542_1000146 | Ga0214542_10001463 | 432 |
| 353 | 3300021321 | Ga0214542_1027236 | Ga0214542_10272364 | 432 |
| 354 | 3300021327 | Ga0214543_1000049 | Ga0214543_100004934 | 432 |
| 355 | 3300021327 | Ga0214543_1000054 | Ga0214543_100005493 | 432 |
| 356 | 3300022467 | Ga0224712_10035483 | Ga0224712_100354831 | 432 |
| 357 | 3300022739 | Ga0228711_1000006 | Ga0228711_100000644 | 432 |
| 358 | 3300022740 | Ga0228710_1000004 | Ga0228710_100000492 | 432 |
| 359 | 3300025206 | Ga0209435_100049 | Ga0209435_10004963 | 432 |
| 360 | 3300025245 | Ga0207425_1004457 | Ga0207425_10044574 | 432 |
| 361 | 3300025246 | Ga0209646_1000159 | Ga0209646_100015963 | 432 |
| 362 | 3300025250 | Ga0209026_1000183 | Ga0209026_100018363 | 432 |
| 363 | 3300025256 | Ga0209759_1000206 | Ga0209759_100020663 | 432 |
| 364 | 3300025258 | Ga0209129_1006060 | Ga0209129_10060604 | 432 |
| 365 | 3300025273 | Ga0209673_1000584 | Ga0209673_100058413 | 432 |
| 366 | 3300025273 | Ga0209673_1003724 | Ga0209673_10037243 | 432 |
| 367 | 3300025284 | Ga0209130_1000005 | Ga0209130_1000005453 | 432 |
| 368 | 3300025284 | Ga0209130_1000642 | Ga0209130_100064219 | 432 |
| 369 | 3300025292 | Ga0209676_1001593 | Ga0209676_100159310 | 432 |
| 370 | 3300025294 | Ga0209025_1000037 | Ga0209025_1000037334 | 432 |
| 371 | 3300025294 | Ga0209025_1000814 | Ga0209025_100081438 | 432 |
| 372 | 3300025294 | Ga0209025_1011026 | Ga0209025_10110267 | 432 |
| 373 | 3300025295 | Ga0209564_1000113 | Ga0209564_1000113143 | 432 |
| 374 | 3300025295 | Ga0209564_1006879 | Ga0209564_10068793 | 432 |
| 375 | 3300025297 | Ga0209758_1001197 | Ga0209758_10011977 | 432 |
| 376 | 3300025297 | Ga0209758_1004151 | Ga0209758_10041513 | 432 |
| 377 | 3300025298 | Ga0209050_1002150 | Ga0209050_100215013 | 432 |
| 378 | 3300025299 | Ga0209256_1000819 | Ga0209256_100081926 | 432 |
| 379 | 3300025299 | Ga0209256_1002787 | Ga0209256_10027873 | 432 |
| 380 | 3300025299 | Ga0209256_1007106 | Ga0209256_10071067 | 432 |
| 381 | 3300025302 | Ga0207426_1000015 | Ga0207426_1000015146 | 432 |
| 382 | 3300025302 | Ga0207426_1000330 | Ga0207426_100033023 | 432 |
| 383 | 3300025302 | Ga0207426_1000812 | Ga0207426_10008127 | 432 |
| 384 | 3300025303 | Ga0209051_1009681 | Ga0209051_10096813 | 432 |
| 385 | 3300025304 | Ga0209257_1003713 | Ga0209257_100371314 | 432 |
| 386 | 3300027111 | Ga0209281_1000102 | Ga0209281_100010227 | 432 |
| 387 | 3300027111 | Ga0209281_1000242 | Ga0209281_100024286 | 432 |
| 388 | 3300027111 | Ga0209281_1000695 | Ga0209281_100069522 | 432 |
| 389 | 3300027666 | Ga0209282_1000013 | Ga0209282_100001362 | 432 |
| 390 | 3300028379 | Ga0268266_10056372 | Ga0268266_100563723 | 432 |
| 391 | 3300030500 | Ga0268256_1004680 | Ga0268256_10046807 | 432 |
| 392 | 3300031456 | Ga0307513_10054454 | Ga0307513_100544543 | 432 |
| 393 | 3300031730 | Ga0307516_10137322 | Ga0307516_101373222 | 432 |
| 394 | 3300031731 | Ga0307405_10049815 | Ga0307405_100498153 | 432 |
| 395 | 3300031901 | Ga0307406_10039675 | Ga0307406_100396752 | 432 |
| 396 | 3300031967 | Ga0315914_1000004 | Ga0315914_100000497 | 432 |
| 397 | 3300032004 | Ga0307414_10083941 | Ga0307414_100839412 | 432 |
| 398 | 3300033430 | Ga0315913_1000011 | Ga0315913_100001193 | 432 |
| 399 | 3300033464 | Ga0315915_1000003 | Ga0315915_1000003204 | 432 |
| 400 | 3300041410 | Ga0439461_0000133 | Ga0439461_0000133_6848_8182 | 432 |
| 401 | 3300041413 | Ga0439465_0002515 | Ga0439465_0002515_161_1495 | 432 |
| 402 | 3300041492 | Ga0451835_0937263 | Ga0451835_0937263_5274_6632 | 432 |
| 403 | 3300041505 | Ga0451849_0603856 | Ga0451849_0603856_444_1802 | 432 |
| 404 | 3300041997 | Ga0439431_0000794 | Ga0439431_0000794_1012_2346 | 432 |
| 405 | 3300042007 | Ga0439449_0002709 | Ga0439449_0002709_2901_4268 | 432 |
| 406 | 3300042015 | Ga0439462_0002763 | Ga0439462_0002763_1712_3046 | 432 |
| 407 | 3300044735 | Ga0466968_0007104 | Ga0466968_0007104_770_2137 | 432 |
| 408 | 3300044765 | Ga0466970_0042451 | Ga0466970_0042451_1002_2369 | 432 |
| 409 | 3300046460 | Ga0495638_0003200 | Ga0495638_0003200_2398_3807 | 432 |
| 410 | 3300046460 | Ga0495638_0009219 | Ga0495638_0009219_2822_4168 | 432 |
| 411 | 3300046474 | Ga0495605_0002064 | Ga0495605_0002064_9210_10598 | 432 |
| 412 | 3300046492 | Ga0495585_0016115 | Ga0495585_0016115_849_2237 | 432 |
| 413 | 3300046501 | Ga0495607_0037983 | Ga0495607_0037983_646_2001 | 432 |
| 414 | 3300046506 | Ga0495583_0017689 | Ga0495583_0017689_761_2149 | 432 |
| 415 | 3300046507 | Ga0495606_0017420 | Ga0495606_0017420_1490_2848 | 432 |
| 416 | 3300046512 | Ga0495610_0053919 | Ga0495610_0053919_199_1554 | 432 |
| 417 | 3300046513 | Ga0495616_0030509 | Ga0495616_0030509_156_1544 | 432 |
| 418 | 3300046515 | Ga0495620_0013645 | Ga0495620_0013645_2455_3813 | 432 |
| 419 | 3300046518 | Ga0495631_0001695 | Ga0495631_0001695_9541_10929 | 432 |
| 420 | 3300046519 | Ga0495632_0011422 | Ga0495632_0011422_2920_4308 | 432 |
| 421 | 3300046522 | Ga0495643_0065559 | Ga0495643_0065559_287_1645 | 432 |
| 422 | 3300046524 | Ga0495648_0034396 | Ga0495648_0034396_1813_3201 | 432 |
| 423 | 3300046530 | Ga0495654_0000236 | Ga0495654_0000236_39524_40891 | 432 |
| 424 | 3300046615 | Ga0495656_0026297 | Ga0495656_0026297_26_1384 | 432 |
| 425 | 3300046616 | Ga0495668_0006134 | Ga0495668_0006134_1150_2538 | 432 |
| 426 | 3300046660 | Ga0495625_0008722 | Ga0495625_0008722_5046_6434 | 432 |
| 427 | 3300046660 | Ga0495625_0109602 | Ga0495625_0109602_259_1617 | 432 |
| 428 | 3300046810 | Ga0495660_0006209 | Ga0495660_0006209_3604_4992 | 432 |
| 429 | 3300047320 | Ga0495672_0009409 | Ga0495672_0009409_2763_4172 | 432 |
| 430 | 3300048091 | Ga0495626_0045817 | Ga0495626_0045817_649_2001 | 432 |
| 431 | 3300048909 | Ga0496106_0001196 | Ga0496106_0001196_15066_16418 | 432 |
| 432 | 3300048914 | Ga0496111_0000685 | Ga0496111_0000685_3841_5205 | 432 |
| 433 | 3300048920 | Ga0496117_0002165 | Ga0496117_0002165_12908_14275 | 432 |
| 434 | 3300048922 | Ga0496119_0008938 | Ga0496119_0008938_3694_5046 | 432 |
| 435 | 3300048925 | Ga0496122_0000018 | Ga0496122_0000018_366541_367908 | 432 |
| 436 | 3300048925 | Ga0496122_0000147 | Ga0496122_0000147_88233_89600 | 432 |
| 437 | 3300048925 | Ga0496122_0011451 | Ga0496122_0011451_3066_4430 | 432 |
| 438 | 3300048926 | Ga0496123_0000015 | Ga0496123_0000015_366541_367908 | 432 |
| 439 | 3300048926 | Ga0496123_0000158 | Ga0496123_0000158_124204_125571 | 432 |
| 440 | 3300048926 | Ga0496123_0020668 | Ga0496123_0020668_2601_3965 | 432 |
| 441 | 3300048927 | Ga0496124_0046920 | Ga0496124_0046920_1449_2816 | 432 |
| 442 | 3300048928 | Ga0496125_0002943 | Ga0496125_0002943_10587_11954 | 432 |
| 443 | 3300048929 | Ga0496126_0000195 | Ga0496126_0000195_10107_11474 | 432 |
| 444 | 3300048929 | Ga0496126_0055342 | Ga0496126_0055342_859_2211 | 432 |
| 445 | 3300048929 | Ga0496126_0093366 | Ga0496126_0093366_119_1486 | 432 |
| 446 | 3300049460 | Ga0495682_0010402 | Ga0495682_0010402_1968_3356 | 432 |
| 447 | 3300049570 | Ga0501033_0133467 | Ga0501033_0133467_399_1766 | 432 |
| 448 | 3300049571 | Ga0501034_0035340 | Ga0501034_0035340_2863_4230 | 432 |
| 449 | 3300049571 | Ga0501034_0236801 | Ga0501034_0236801_138_1448 | 432 |
| 450 | 3300050489 | nmdc:mga03683_6454_c1 | nmdc:mga03683_6454_c1_2011_3369 | 432 |
| 451 | 3300050492 | nmdc:mga0yw44_12216_c1 | nmdc:mga0yw44_12216_c1_187_1545 | 432 |
| 452 | 3300050493 | nmdc:mga0k408_16763_c1 | nmdc:mga0k408_16763_c1_1706_3064 | 432 |
| 453 | 3300050496 | nmdc:mga07m45_6743_c1 | nmdc:mga07m45_6743_c1_3364_4722 | 432 |
| 454 | 3300050516 | nmdc:mga0sz30_40997_c1 | nmdc:mga0sz30_40997_c1_179_1537 | 432 |
| 455 | 3300053079 | Ga0500610_0025760 | Ga0500610_0025760_298_1686 | 432 |
| 456 | 3300053087 | Ga0500643_025214 | Ga0500643_025214_134_1474 | 432 |
| 457 | 3300053105 | Ga0500557_000292 | Ga0500557_000292_3646_5034 | 432 |
| 458 | 3300053109 | Ga0500569_014218 | Ga0500569_014218_349_1737 | 432 |
| 459 | 3300053125 | Ga0500618_002112 | Ga0500618_002112_1230_2597 | 432 |
| 460 | 3300053134 | Ga0500658_0010069 | Ga0500658_0010069_534_1892 | 432 |
| 461 | 3300053136 | Ga0500559_0017644 | Ga0500559_0017644_589_1935 | 432 |
| 462 | 3300053139 | Ga0500568_0001075 | Ga0500568_0001075_5471_6880 | 432 |
| 463 | 3300053153 | Ga0500616_0017475 | Ga0500616_0017475_1652_3010 | 432 |
| 464 | 3300053156 | Ga0500622_0061457 | Ga0500622_0061457_38_1396 | 432 |
| 465 | iso_pu_bacteria | 2508501122 | 2509111528 | 432 |
| 466 | iso_pu_bacteria | 2509276019 | 2509375475 | 432 |
| 467 | iso_pu_bacteria | 2510065057 | 2510307088 | 432 |
| 468 | iso_pu_bacteria | 2510917022 | 2511132166 | 432 |
| 469 | iso_pu_bacteria | 2511231027 | 2511392031 | 432 |
| 470 | iso_pu_bacteria | 2511231052 | 2511498857 | 432 |
| 471 | iso_pu_bacteria | 2512047086 | 2512534993 | 432 |
| 472 | iso_pu_bacteria | 2512875026 | 2512973187 | 432 |
| 473 | iso_pu_bacteria | 2513237084 | 2513570728 | 432 |
| 474 | iso_pu_bacteria | 2513237085 | 2513575053 | 432 |
| 475 | iso_pu_bacteria | 2513237086 | 2513588295 | 432 |
| 476 | iso_pu_bacteria | 2513237089 | 2513603547 | 432 |
| 477 | iso_pu_bacteria | 2513237091 | 2513619082 | 432 |
| 478 | iso_pu_bacteria | 2513237140 | 2513882570 | 432 |
| 479 | iso_pu_bacteria | 2513237143 | 2513904554 | 432 |
| 480 | iso_pu_bacteria | 2513237156 | 2513983251 | 432 |
| 481 | iso_pu_bacteria | 2513237160 | 2514005787 | 432 |
| 482 | iso_pu_bacteria | 2515154107 | 2515607283 | 432 |
| 483 | iso_pu_bacteria | 2515154134 | 2515741279 | 432 |
| 484 | iso_pu_bacteria | 2516143018 | 2516204823 | 432 |
| 485 | iso_pu_bacteria | 2516653046 | 2516895134 | 432 |
| 486 | iso_pu_bacteria | 2516653085 | 2517078629 | 432 |
| 487 | iso_pu_bacteria | 2517487022 | 2517571810 | 432 |
| 488 | iso_pu_bacteria | 2524023207 | 2524452462 | 432 |
| 489 | iso_pu_bacteria | 2524023209 | 2524462170 | 432 |
| 490 | iso_pu_bacteria | 2534681786 | 2535485645 | 432 |
| 491 | iso_pu_bacteria | 2551306084 | 2551678399 | 432 |
| 492 | iso_pu_bacteria | 2551306085 | 2551688990 | 432 |
| 493 | iso_pu_bacteria | 2551306086 | 2551696385 | 432 |
| 494 | iso_pu_bacteria | 2551306087 | 2551699360 | 432 |
| 495 | iso_pu_bacteria | 2551306089 | 2551711590 | 432 |
| 496 | iso_pu_bacteria | 2551306090 | 2551719850 | 432 |
| 497 | iso_pu_bacteria | 2558860100 | 2558866573 | 432 |
| 498 | iso_pu_bacteria | 2582581307 | 2585276344 | 432 |
| 499 | iso_pu_bacteria | 2585427526 | 2585524056 | 432 |
| 500 | iso_pu_bacteria | 2585427531 | 2585564144 | 432 |
| 501 | iso_pu_bacteria | 2585427608 | 2585897277 | 432 |
| 502 | iso_pu_bacteria | 2585427609 | 2585903009 | 432 |
| 503 | iso_pu_bacteria | 2585428125 | 2587978416 | 432 |
| 504 | iso_pu_bacteria | 2599185236 | 2599718554 | 432 |
| 505 | iso_pu_bacteria | 2599185352 | 2600195273 | 432 |
| 506 | iso_pu_bacteria | 2600254933 | 2600376829 | 432 |
| 507 | iso_pu_bacteria | 2615840698 | 2616551734 | 432 |
| 508 | iso_pu_bacteria | 2643221557 | 2643805786 | 432 |
| 509 | iso_pu_bacteria | 2643221610 | 2644065962 | 432 |
| 510 | iso_pu_bacteria | 2643221668 | 2644380266 | 432 |
| 511 | iso_pu_bacteria | 2643221675 | 2644417293 | 432 |
| 512 | iso_pu_bacteria | 2643221680 | 2644450689 | 432 |
| 513 | iso_pu_bacteria | 2643221723 | 2644671467 | 432 |
| 514 | iso_pu_bacteria | 2643221726 | 2644692886 | 432 |
| 515 | iso_pu_bacteria | 2657244999 | 2657682796 | 432 |
| 516 | iso_pu_bacteria | 2690316117 | 2692320617 | 432 |
| 517 | iso_pu_bacteria | 2724679232 | 2725947204 | 432 |
| 518 | iso_pu_bacteria | 2751185800 | 2753358372 | 432 |
| 519 | iso_pu_bacteria | 2751185821 | 2753459947 | 432 |
| 520 | iso_pu_bacteria | 2757320392 | 2757570152 | 432 |
| 521 | iso_pu_bacteria | 2758568016 | 2758640596 | 432 |
| 522 | iso_pu_bacteria | 2765235802 | 2765465918 | 432 |
| 523 | iso_pu_bacteria | 2765235942 | 2766067306 | 432 |
| 524 | iso_pu_bacteria | 2767802442 | 2770196511 | 432 |
| 525 | iso_pu_bacteria | 2775506902 | 2776269364 | 432 |
| 526 | iso_pu_bacteria | 2775506904 | 2776283497 | 432 |
| 527 | iso_pu_bacteria | 2775507049 | 2776915866 | 432 |
| 528 | iso_pu_bacteria | 2791355082 | 2792583400 | 432 |
| 529 | iso_pu_bacteria | 2791355091 | 2792620998 | 432 |
| 530 | iso_pu_bacteria | 2791355092 | 2792625213 | 432 |
| 531 | iso_pu_bacteria | 2791355094 | 2792637623 | 432 |
| 532 | iso_pu_bacteria | 2802428858 | 2802720828 | 432 |
| 533 | iso_pu_bacteria | 2802428859 | 2802724434 | 432 |
| 534 | iso_pu_bacteria | 2802428860 | 2802729901 | 432 |
| 535 | iso_pu_bacteria | 2802428861 | 2802737245 | 432 |
| 536 | iso_pu_bacteria | 2802428862 | 2802746375 | 432 |
| 537 | iso_pu_bacteria | 2802428863 | 2802751864 | 432 |
| 538 | iso_pu_bacteria | 2802429268 | 2804754016 | 432 |
| 539 | iso_pu_bacteria | 2802429633 | 2806049213 | 432 |
| 540 | iso_pu_bacteria | 2802429634 | 2806056130 | 432 |
| 541 | iso_pu_bacteria | 2802429635 | 2806063138 | 432 |
| 542 | iso_pu_bacteria | 2802429636 | 2806070736 | 432 |
| 543 | iso_pu_bacteria | 2802429637 | 2806077597 | 432 |
| 544 | iso_pu_bacteria | 2818991448 | 2819613225 | 432 |
| 545 | iso_pu_bacteria | 2818991461 | 2819685715 | 432 |
| 546 | iso_pu_bacteria | 2821123053 | 2821123110 | 432 |
| 547 | iso_pu_bacteria | 2837651117 | 2837651543 | 432 |
| 548 | iso_pu_bacteria | 2838074704 | 2838074885 | 432 |
| 549 | iso_pu_bacteria | 2838686498 | 2838689941 | 432 |
| 550 | iso_pu_bacteria | 2838729681 | 2838731330 | 432 |
| 551 | iso_pu_bacteria | 2838736955 | 2838739866 | 432 |
| 552 | iso_pu_bacteria | 2838742623 | 2838744271 | 432 |
| 553 | iso_pu_bacteria | 2839993093 | 2839993560 | 432 |
| 554 | iso_pu_bacteria | 2840764183 | 2840766535 | 432 |
| 555 | iso_pu_bacteria | 2841840854 | 2841844010 | 432 |
| 556 | iso_pu_bacteria | 2841851746 | 2841852844 | 432 |
| 557 | iso_pu_bacteria | 2842110456 | 2842112855 | 432 |
| 558 | iso_pu_bacteria | 2842140634 | 2842143731 | 432 |
| 559 | iso_pu_bacteria | 2842156927 | 2842160171 | 432 |
| 560 | iso_pu_bacteria | 2842163707 | 2842165850 | 432 |
| 561 | iso_pu_bacteria | 2842180545 | 2842184163 | 432 |
| 562 | iso_pu_bacteria | 2842229732 | 2842231745 | 432 |
| 563 | iso_pu_bacteria | 2842243621 | 2842245753 | 432 |
| 564 | iso_pu_bacteria | 2842257432 | 2842260131 | 432 |
| 565 | iso_pu_bacteria | 2842271015 | 2842273575 | 432 |
| 566 | iso_pu_bacteria | 2842298080 | 2842303528 | 432 |
| 567 | iso_pu_bacteria | 2842304105 | 2842308573 | 432 |
| 568 | iso_pu_bacteria | 2842357229 | 2842362799 | 432 |
| 569 | iso_pu_bacteria | 2842509118 | 2842515351 | 432 |
| 570 | iso_pu_bacteria | 2842871566 | 2842875008 | 432 |
| 571 | iso_pu_bacteria | 2844454524 | 2844456689 | 432 |
| 572 | iso_pu_bacteria | 2847417321 | 2847421277 | 432 |
| 573 | iso_pu_bacteria | 2848992105 | 2848996065 | 432 |
| 574 | iso_pu_bacteria | 2850079185 | 2850079458 | 432 |
| 575 | iso_pu_bacteria | 2852387548 | 2852387646 | 432 |
| 576 | iso_pu_bacteria | 2854911287 | 2854913880 | 432 |
| 577 | iso_pu_bacteria | 2855825444 | 2855827778 | 432 |
| 578 | iso_pu_bacteria | 2855839649 | 2855843142 | 432 |
| 579 | iso_pu_bacteria | 2855872281 | 2855877773 | 432 |
| 580 | iso_pu_bacteria | 2857516855 | 2857520990 | 432 |
| 581 | iso_pu_bacteria | 2857531043 | 2857533937 | 432 |
| 582 | iso_pu_bacteria | 2858800743 | 2858802874 | 432 |
| 583 | iso_pu_bacteria | 2891373044 | 2891375031 | 432 |
| 584 | iso_pu_bacteria | 2894652903 | 2894653513 | 432 |
| 585 | iso_pu_bacteria | 2896384573 | 2896388640 | 432 |
| 586 | iso_pu_bacteria | 2904578770 | 2904579777 | 432 |
| 587 | iso_pu_bacteria | 2913295892 | 2913298392 | 432 |
| 588 | iso_pu_bacteria | 2915650412 | 2915650754 | 432 |
| 589 | iso_pu_bacteria | 2915980308 | 2915982683 | 432 |
| 590 | iso_pu_bacteria | 2915986958 | 2915989870 | 432 |
| 591 | iso_pu_bacteria | 2915993759 | 2915999734 | 432 |
| 592 | iso_pu_bacteria | 2916000859 | 2916002244 | 432 |
| 593 | iso_pu_bacteria | 2916007675 | 2916008911 | 432 |
| 594 | iso_pu_bacteria | 2916014648 | 2916016259 | 432 |
| 595 | iso_pu_bacteria | 2916021584 | 2916022365 | 432 |
| 596 | iso_pu_bacteria | 2916028427 | 2916033415 | 432 |
| 597 | iso_pu_bacteria | 2916035215 | 2916037098 | 432 |
| 598 | iso_pu_bacteria | 2916041962 | 2916046969 | 432 |
| 599 | iso_pu_bacteria | 2916048683 | 2916054916 | 432 |
| 600 | iso_pu_bacteria | 2916055098 | 2916056745 | 432 |
| 601 | iso_pu_bacteria | 2916061851 | 2916063931 | 432 |
| 602 | iso_pu_bacteria | 2916076590 | 2916078739 | 432 |
| 603 | iso_pu_bacteria | 2919119836 | 2919120555 | 432 |
| 604 | iso_pu_bacteria | 2920760137 | 2920763869 | 432 |
| 605 | iso_pu_bacteria | 2920822456 | 2920822829 | 432 |
| 606 | iso_pu_bacteria | 2921201388 | 2921202015 | 432 |
| 607 | iso_pu_bacteria | 2921208531 | 2921209714 | 432 |
| 608 | iso_pu_bacteria | 2921237296 | 2921237990 | 432 |
| 609 | iso_pu_bacteria | 2921244191 | 2921244358 | 432 |
| 610 | iso_pu_bacteria | 2921250672 | 2921256342 | 432 |
| 611 | iso_pu_bacteria | 2921257292 | 2921261469 | 432 |
| 612 | iso_pu_bacteria | 2921263974 | 2921265815 | 432 |
| 613 | iso_pu_bacteria | 2921282425 | 2921283901 | 432 |
| 614 | iso_pu_bacteria | 2921289301 | 2921291484 | 432 |
| 615 | iso_pu_bacteria | 2921296804 | 2921303048 | 432 |
| 616 | iso_pu_bacteria | 2924144063 | 2924145304 | 432 |
| 617 | iso_pu_bacteria | 2924150972 | 2924155172 | 432 |
| 618 | iso_pu_bacteria | 2924158325 | 2924162530 | 432 |
| 619 | iso_pu_bacteria | 2924165586 | 2924167329 | 432 |
| 620 | iso_pu_bacteria | 2924172951 | 2924173449 | 432 |
| 621 | iso_pu_bacteria | 2924179722 | 2924182797 | 432 |
| 622 | iso_pu_bacteria | 2924186466 | 2924187065 | 432 |
| 623 | iso_pu_bacteria | 2924193448 | 2924197280 | 432 |
| 624 | iso_pu_bacteria | 2924200457 | 2924202157 | 432 |
| 625 | iso_pu_bacteria | 2924207177 | 2924210979 | 432 |
| 626 | iso_pu_bacteria | 2924214083 | 2924215374 | 432 |
| 627 | iso_pu_bacteria | 2924221636 | 2924225211 | 432 |
| 628 | iso_pu_bacteria | 2924228884 | 2924230383 | 432 |
| 629 | iso_pu_bacteria | 2928521798 | 2928522580 | 432 |
| 630 | iso_pu_bacteria | 2933570622 | 2933575021 | 432 |
| 631 | iso_pu_bacteria | 2933586486 | 2933588255 | 432 |
| 632 | iso_pu_bacteria | 2935901341 | 2935902224 | 432 |
| 633 | iso_pu_bacteria | 2936375103 | 2936380379 | 432 |
| 634 | iso_pu_bacteria | 2936996657 | 2936998728 | 432 |
| 635 | iso_pu_bacteria | 2937002841 | 2937003451 | 432 |
| 636 | iso_pu_bacteria | 2937009748 | 2937010525 | 432 |
| 637 | iso_pu_bacteria | 2937016420 | 2937017296 | 432 |
| 638 | iso_pu_bacteria | 2937023124 | 2937025656 | 432 |
| 639 | iso_pu_bacteria | 2937029754 | 2937030569 | 432 |
| 640 | iso_pu_bacteria | 2937036028 | 2937039037 | 432 |
| 641 | iso_pu_bacteria | 2937042894 | 2937045701 | 432 |
| 642 | iso_pu_bacteria | 2937049772 | 2937054873 | 432 |
| 643 | iso_pu_bacteria | 2937056579 | 2937057692 | 432 |
| 644 | iso_pu_bacteria | 2937063883 | 2937070862 | 432 |
| 645 | iso_pu_bacteria | 2937071275 | 2937076146 | 432 |
| 646 | iso_pu_bacteria | 2937078374 | 2937083910 | 432 |
| 647 | iso_pu_bacteria | 2937084907 | 2937088557 | 432 |
| 648 | iso_pu_bacteria | 2937091812 | 2937096653 | 432 |
| 649 | iso_pu_bacteria | 2937098957 | 2937100679 | 432 |
| 650 | iso_pu_bacteria | 2937106411 | 2937111675 | 432 |
| 651 | iso_pu_bacteria | 2937113482 | 2937115897 | 432 |
| 652 | iso_pu_bacteria | 2937119839 | 2937125705 | 432 |
| 653 | iso_pu_bacteria | 2937126314 | 2937130831 | 432 |
| 654 | iso_pu_bacteria | 2941499720 | 2941504023 | 432 |
| 655 | iso_pu_bacteria | 2954011201 | 2954014039 | 432 |
| 656 | iso_pu_bacteria | 2957375807 | 2957378003 | 432 |
| 657 | iso_pu_bacteria | 2957382221 | 2957383288 | 432 |
| 658 | iso_pu_bacteria | 2957388812 | 2957390585 | 432 |
| 659 | iso_pu_bacteria | 2957395598 | 2957401430 | 432 |
| 660 | iso_pu_bacteria | 2957402308 | 2957407386 | 432 |
| 661 | iso_pu_bacteria | 2957408893 | 2957409947 | 432 |
| 662 | iso_pu_bacteria | 2957415311 | 2957416529 | 432 |
| 663 | iso_pu_bacteria | 2957422303 | 2957422608 | 432 |
| 664 | iso_pu_bacteria | 2957430029 | 2957435166 | 432 |
| 665 | iso_pu_bacteria | 2957437181 | 2957441457 | 432 |
| 666 | iso_pu_bacteria | 2957443900 | 2957447808 | 432 |
| 667 | iso_pu_bacteria | 2957450854 | 2957451840 | 432 |
| 668 | iso_pu_bacteria | 2957457609 | 2957460712 | 432 |
| 669 | iso_pu_bacteria | 2957464669 | 2957468040 | 432 |
| 670 | iso_pu_bacteria | 2957471148 | 2957475928 | 432 |
| 671 | iso_pu_bacteria | 2957478035 | 2957484641 | 432 |
| 672 | iso_pu_bacteria | 2957484790 | 2957485502 | 432 |
| 673 | iso_pu_bacteria | 2957491536 | 2957492052 | 432 |
| 674 | iso_pu_bacteria | 2957498199 | 2957502969 | 432 |
| 675 | iso_pu_bacteria | 2957505466 | 2957506899 | 432 |
| 676 | iso_pu_bacteria | 2960584000 | 2960585956 | 432 |
| 677 | iso_pu_bacteria | 2960591022 | 2960593183 | 432 |
| 678 | iso_pu_bacteria | 2960597568 | 2960600932 | 432 |
| 679 | iso_pu_bacteria | 2960603979 | 2960607754 | 432 |
| 680 | iso_pu_bacteria | 2960610863 | 2960615663 | 432 |
| 681 | iso_pu_bacteria | 2960617483 | 2960620949 | 432 |
| 682 | iso_pu_bacteria | 2960624210 | 2960626196 | 432 |
| 683 | iso_pu_bacteria | 2960631154 | 2960635358 | 432 |
| 684 | iso_pu_bacteria | 2960637947 | 2960640416 | 432 |
| 685 | iso_pu_bacteria | 2960645483 | 2960646993 | 432 |
| 686 | iso_pu_bacteria | 2960652885 | 2960656376 | 432 |
| 687 | iso_pu_bacteria | 2960660292 | 2960664265 | 432 |
| 688 | iso_pu_bacteria | 2960667422 | 2960670913 | 432 |
| 689 | iso_pu_bacteria | 2960674078 | 2960677434 | 432 |
| 690 | iso_pu_bacteria | 2960680706 | 2960682643 | 432 |
| 691 | iso_pu_bacteria | 2960687367 | 2960692762 | 432 |
| 692 | iso_pu_bacteria | 2960693952 | 2960697788 | 432 |
| 693 | iso_pu_bacteria | 2964607997 | 2964609969 | 432 |
| 694 | iso_pu_bacteria | 2964615318 | 2964618223 | 432 |
| 695 | iso_pu_bacteria | 2964621998 | 2964627397 | 432 |
| 696 | iso_pu_bacteria | 2964628898 | 2964631552 | 432 |
| 697 | iso_pu_bacteria | 2964636051 | 2964641332 | 432 |
| 698 | iso_pu_bacteria | 2964643177 | 2964645445 | 432 |
| 699 | iso_pu_bacteria | 2964649959 | 2964651396 | 432 |
| 700 | iso_pu_bacteria | 2964656573 | 2964662965 | 432 |
| 701 | iso_pu_bacteria | 2964663802 | 2964668677 | 432 |
| 702 | iso_pu_bacteria | 2964670856 | 2964672328 | 432 |
| 703 | iso_pu_bacteria | 2964678106 | 2964682247 | 432 |
| 704 | iso_pu_bacteria | 2964685014 | 2964690663 | 432 |
| 705 | iso_pu_bacteria | 2964691889 | 2964695189 | 432 |
| 706 | iso_pu_bacteria | 2964698721 | 2964700000 | 432 |
| 707 | iso_pu_bacteria | 2964705432 | 2964710026 | 432 |
| 708 | iso_pu_bacteria | 2964712639 | 2964716072 | 432 |
| 709 | iso_pu_bacteria | 2964719344 | 2964725860 | 432 |
| 710 | iso_pu_bacteria | 2967664464 | 2967669276 | 432 |
| 711 | iso_pu_bacteria | 2967678726 | 2967683504 | 432 |
| 712 | iso_pu_bacteria | 2967686174 | 2967688467 | 432 |
| 713 | iso_pu_bacteria | 2967693043 | 2967694595 | 432 |
| 714 | iso_pu_bacteria | 2967699805 | 2967705465 | 432 |
| 715 | iso_pu_bacteria | 2967706974 | 2967714015 | 432 |
| 716 | iso_pu_bacteria | 2967714385 | 2967716255 | 432 |
| 717 | iso_pu_bacteria | 2967721400 | 2967725899 | 432 |
| 718 | iso_pu_bacteria | 2967728569 | 2967733798 | 432 |
| 719 | iso_pu_bacteria | 2967735183 | 2967740902 | 432 |
| 720 | iso_pu_bacteria | 2967742019 | 2967742823 | 432 |
| 721 | iso_pu_bacteria | 2967748971 | 2967751544 | 432 |
| 722 | iso_pu_bacteria | 2967755722 | 2967758480 | 432 |
| 723 | iso_pu_bacteria | 2967762386 | 2967766394 | 432 |
| 724 | iso_pu_bacteria | 2967769361 | 2967775532 | 432 |
| 725 | iso_pu_bacteria | 2967775926 | 2967776969 | 432 |
| 726 | iso_pu_bacteria | 2970026789 | 2970031947 | 432 |
| 727 | iso_pu_bacteria | 2970033650 | 2970038033 | 432 |
| 728 | iso_pu_bacteria | 2970040964 | 2970046758 | 432 |
| 729 | iso_pu_bacteria | 2970047711 | 2970054404 | 432 |
| 730 | iso_pu_bacteria | 2970054988 | 2970056023 | 432 |
| 731 | iso_pu_bacteria | 2970061556 | 2970064585 | 432 |
| 732 | iso_pu_bacteria | 2970068827 | 2970073417 | 432 |
| 733 | iso_pu_bacteria | 2970076120 | 2970077175 | 432 |
| 734 | iso_pu_bacteria | 2970082768 | 2970085092 | 432 |
| 735 | iso_pu_bacteria | 2970088815 | 2970095719 | 432 |
| 736 | iso_pu_bacteria | 2970095765 | 2970099319 | 432 |
| 737 | iso_pu_bacteria | 2970102677 | 2970106235 | 432 |
| 738 | iso_pu_bacteria | 2970109326 | 2970112622 | 432 |
| 739 | iso_pu_bacteria | 2970116247 | 2970118867 | 432 |
| 740 | iso_pu_bacteria | 2970122695 | 2970122764 | 432 |
| 741 | iso_pu_bacteria | 2970129317 | 2970130896 | 432 |
| 742 | iso_pu_bacteria | 2970136068 | 2970139340 | 432 |
| 743 | iso_pu_bacteria | 2970143518 | 2970145287 | 432 |
| 744 | iso_pu_bacteria | 2970149975 | 2970153331 | 432 |
| 745 | iso_pu_bacteria | 2970156795 | 2970160483 | 432 |
| 746 | iso_pu_bacteria | 2970164137 | 2970165615 | 432 |
| 747 | iso_pu_bacteria | 2970170962 | 2970177794 | 432 |
| 748 | iso_pu_bacteria | 2970177841 | 2970182080 | 432 |
| 749 | iso_pu_bacteria | 2970184632 | 2970186924 | 432 |
| 750 | iso_pu_bacteria | 2970191845 | 2970193263 | 432 |
| 751 | iso_pu_bacteria | 2977516862 | 2977522187 | 432 |
| 752 | iso_pu_bacteria | 2977523885 | 2977525544 | 432 |
| 753 | iso_pu_bacteria | 2977530762 | 2977530916 | 432 |
| 754 | iso_pu_bacteria | 2977537788 | 2977538807 | 432 |
| 755 | iso_pu_bacteria | 2977544691 | 2977546942 | 432 |
| 756 | iso_pu_bacteria | 2977551784 | 2977556311 | 432 |
| 757 | iso_pu_bacteria | 2977558990 | 2977561846 | 432 |
| 758 | iso_pu_bacteria | 2977565890 | 2977572402 | 432 |
| 759 | iso_pu_bacteria | 2977572785 | 2977576267 | 432 |
| 760 | iso_pu_bacteria | 2977579622 | 2977581071 | 432 |
| 761 | iso_pu_bacteria | 2989349275 | 2989351518 | 432 |
| 762 | iso_pu_bacteria | 2989771324 | 2989774462 | 432 |
| 763 | iso_pu_bacteria | 3002141150 | 3002141873 | 432 |
| 764 | iso_pu_bacteria | 3003930520 | 3003931433 | 432 |
| 765 | iso_pu_bacteria | 3005409236 | 3005410531 | 432 |
| 766 | iso_pu_bacteria | 3005416602 | 3005419321 | 432 |
| 767 | iso_pu_bacteria | 643692032 | 643827767 | 432 |
| 768 | iso_pu_bacteria | 648276728 | 648738288 | 432 |
| 769 | iso_pu_bacteria | 8003992118 | 8003995728 | 432 |
| 770 | iso_pu_bacteria | 8003999396 | 8004003482 | 432 |
| 771 | iso_pu_bacteria | 8005307578 | 8005310154 | 432 |
| 772 | iso_pu_bacteria | 8005314921 | 8005317524 | 432 |
| 773 | iso_pu_bacteria | 8005376324 | 8005378198 | 432 |
| 774 | iso_pu_bacteria | 8005484373 | 8005489263 | 432 |
| 775 | iso_pu_bacteria | 8005556819 | 8005559868 | 432 |
| 776 | iso_pu_bacteria | 8005563573 | 8005564634 | 432 |
| 777 | iso_pu_bacteria | 8005570704 | 8005570998 | 432 |
| 778 | iso_pu_bacteria | 8005645114 | 8005645398 | 432 |
| 779 | iso_pu_bacteria | 8005682033 | 8005687757 | 432 |
| 780 | iso_pu_bacteria | 8018163183 | 8018167709 | 432 |
| 781 | iso_pu_bacteria | 8023680758 | 8023681370 | 432 |
| 782 | iso_pu_bacteria | 8024479707 | 8024481797 | 432 |
| 783 | iso_pu_bacteria | 8046767195 | 8046774115 | 432 |
| 784 | iso_pu_bacteria | 8049293176 | 8049296633 | 432 |
| 785 | iso_pu_bacteria | 8054558443 | 8054562443 | 432 |
| 786 | iso_pu_bacteria | 8056875544 | 8056878565 | 432 |
| 787 | iso_pu_bacteria | 8057575449 | 8057577935 | 432 |
| 788 | 3300002774 | JGI25150J39212_1000126 | JGI25150J39212_100012614 | 433 |
| 789 | 3300003214 | JGI25165J46597_1000041 | JGI25165J46597_1000041184 | 433 |
| 790 | 3300003215 | JGI25153J46596_10000305 | JGI25153J46596_100003054 | 433 |
| 791 | 3300003215 | JGI25153J46596_10009756 | JGI25153J46596_100097563 | 433 |
| 792 | 3300003771 | Ga0055526_1007718 | Ga0055526_10077182 | 433 |
| 793 | 3300003775 | Ga0055524_1000056 | Ga0055524_100005630 | 433 |
| 794 | 3300003791 | Ga0055530_10000027 | Ga0055530_100000274 | 433 |
| 795 | 3300003791 | Ga0055530_10000931 | Ga0055530_100009317 | 433 |
| 796 | 3300003791 | Ga0055530_10013499 | Ga0055530_100134994 | 433 |
| 797 | 3300003792 | Ga0055540_1001336 | Ga0055540_10013362 | 433 |
| 798 | 3300003794 | Ga0055531_10000013 | Ga0055531_10000013159 | 433 |
| 799 | 3300003794 | Ga0055531_10014149 | Ga0055531_100141493 | 433 |
| 800 | 3300005262 | Ga0065165_1003833 | Ga0065165_100383311 | 433 |
| 801 | 3300005262 | Ga0065165_1012721 | Ga0065165_10127213 | 433 |
| 802 | 3300005262 | Ga0065165_1013057 | Ga0065165_10130572 | 433 |
| 803 | 3300005353 | Ga0070669_100013530 | Ga0070669_1000135304 | 433 |
| 804 | 3300005355 | Ga0070671_100004829 | Ga0070671_1000048293 | 433 |
| 805 | 3300005530 | Ga0070679_100143648 | Ga0070679_1001436482 | 433 |
| 806 | 3300005539 | Ga0068853_100036747 | Ga0068853_1000367474 | 433 |
| 807 | 3300005548 | Ga0070665_100000319 | Ga0070665_10000031967 | 433 |
| 808 | 3300005618 | Ga0068864_100030494 | Ga0068864_1000304943 | 433 |
| 809 | 3300005842 | Ga0068858_100000591 | Ga0068858_10000059125 | 433 |
| 810 | 3300005842 | Ga0068858_100013493 | Ga0068858_1000134939 | 433 |
| 811 | 3300009177 | Ga0105248_10016997 | Ga0105248_100169979 | 433 |
| 812 | 3300009177 | Ga0105248_10025390 | Ga0105248_100253902 | 433 |
| 813 | 3300009551 | Ga0105238_10113471 | Ga0105238_101134711 | 433 |
| 814 | 3300013306 | Ga0163162_10102190 | Ga0163162_101021903 | 433 |
| 815 | 3300025245 | Ga0207425_1000041 | Ga0207425_100004182 | 433 |
| 816 | 3300025258 | Ga0209129_1000359 | Ga0209129_10003599 | 433 |
| 817 | 3300025261 | Ga0209233_1000104 | Ga0209233_1000104187 | 433 |
| 818 | 3300025263 | Ga0209565_1000008 | Ga0209565_1000008608 | 433 |
| 819 | 3300025263 | Ga0209565_1000134 | Ga0209565_100013474 | 433 |
| 820 | 3300025273 | Ga0209673_1004104 | Ga0209673_100410410 | 433 |
| 821 | 3300025291 | Ga0209675_1003991 | Ga0209675_10039913 | 433 |
| 822 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068251 | 433 |
| 823 | 3300025295 | Ga0209564_1001020 | Ga0209564_100102012 | 433 |
| 824 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004150 | 433 |
| 825 | 3300025297 | Ga0209758_1008214 | Ga0209758_10082147 | 433 |
| 826 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012099 | 433 |
| 827 | 3300025298 | Ga0209050_1000014 | Ga0209050_10000144 | 433 |
| 828 | 3300025298 | Ga0209050_1009997 | Ga0209050_10099973 | 433 |
| 829 | 3300025299 | Ga0209256_1000009 | Ga0209256_1000009261 | 433 |
| 830 | 3300025299 | Ga0209256_1000010 | Ga0209256_1000010185 | 433 |
| 831 | 3300025302 | Ga0207426_1028357 | Ga0207426_10283572 | 433 |
| 832 | 3300025303 | Ga0209051_1000232 | Ga0209051_100023232 | 433 |
| 833 | 3300025304 | Ga0209257_1000019 | Ga0209257_1000019688 | 433 |
| 834 | 3300025304 | Ga0209257_1005528 | Ga0209257_10055283 | 433 |
| 835 | 3300025921 | Ga0207652_10056019 | Ga0207652_100560193 | 433 |
| 836 | 3300025923 | Ga0207681_10000667 | Ga0207681_1000066723 | 433 |
| 837 | 3300025927 | Ga0207687_10039346 | Ga0207687_100393464 | 433 |
| 838 | 3300025931 | Ga0207644_10037322 | Ga0207644_100373224 | 433 |
| 839 | 3300025941 | Ga0207711_10014565 | Ga0207711_100145652 | 433 |
| 840 | 3300025941 | Ga0207711_10029281 | Ga0207711_100292814 | 433 |
| 841 | 3300026035 | Ga0207703_10000205 | Ga0207703_1000020546 | 433 |
| 842 | 3300026035 | Ga0207703_10000639 | Ga0207703_1000063912 | 433 |
| 843 | 3300026095 | Ga0207676_10001417 | Ga0207676_100014173 | 433 |
| 844 | 3300028379 | Ga0268266_10000212 | Ga0268266_1000021249 | 433 |
| 845 | 3300028381 | Ga0268264_10018414 | Ga0268264_100184145 | 433 |
| 846 | 3300031616 | Ga0307508_10000398 | Ga0307508_100003987 | 433 |
| 847 | 3300033180 | Ga0307510_10008962 | Ga0307510_100089625 | 433 |
| 848 | 3300041410 | Ga0439461_0003201 | Ga0439461_0003201_615_1952 | 433 |
| 849 | 3300041413 | Ga0439465_0007006 | Ga0439465_0007006_56_1393 | 433 |
| 850 | 3300041997 | Ga0439431_0007345 | Ga0439431_0007345_116_1453 | 433 |
| 851 | 3300042006 | Ga0439432_010870 | Ga0439432_010870_115_1452 | 433 |
| 852 | 3300042156 | Ga0439446_0003437 | Ga0439446_0003437_1106_2443 | 433 |
| 853 | 3300045051 | Ga0451576_0000023 | Ga0451576_0000023_202526_203950 | 433 |
| 854 | 3300046660 | Ga0495625_0001386 | Ga0495625_0001386_26918_28243 | 433 |
| 855 | 3300048918 | Ga0496115_0001130 | Ga0496115_0001130_12609_13934 | 433 |
| 856 | 3300048924 | Ga0496121_0003590 | Ga0496121_0003590_18001_19326 | 433 |
| 857 | 3300048924 | Ga0496121_0006338 | Ga0496121_0006338_2634_3953 | 433 |
| 858 | 3300048924 | Ga0496121_0089230 | Ga0496121_0089230_1020_2345 | 433 |
| 859 | 3300048925 | Ga0496122_0002719 | Ga0496122_0002719_2016_3350 | 433 |
| 860 | 3300048926 | Ga0496123_0002233 | Ga0496123_0002233_2007_3341 | 433 |
| 861 | 3300048929 | Ga0496126_0018207 | Ga0496126_0018207_153_1472 | 433 |
| 862 | 3300049822 | Ga0501035_0118966 | Ga0501035_0118966_435_1736 | 433 |
| 863 | 3300049823 | Ga0501044_0040197 | Ga0501044_0040197_2686_4053 | 433 |
| 864 | 3300053087 | Ga0500643_003937 | Ga0500643_003937_4185_5510 | 433 |
| 865 | 3300053119 | Ga0500595_002230 | Ga0500595_002230_7420_8757 | 433 |
| 866 | 3300053120 | Ga0500597_023742 | Ga0500597_023742_672_2060 | 433 |
| 867 | 3300053134 | Ga0500658_0001519 | Ga0500658_0001519_1805_3130 | 433 |
| 868 | 3300053136 | Ga0500559_0044993 | Ga0500559_0044993_36_1361 | 433 |
| 869 | 3300053148 | Ga0500590_002666 | Ga0500590_002666_2663_4021 | 433 |
| 870 | 3300053156 | Ga0500622_0105632 | Ga0500622_0105632_10_1344 | 433 |
| 871 | 3300053157 | Ga0500624_000062 | Ga0500624_000062_28218_29606 | 433 |
| 872 | 3300053178 | Ga0500637_0000692 | Ga0500637_0000692_10537_11925 | 433 |
| 873 | iso_pu_bacteria | 2643221622 | 2644126070 | 433 |
| 874 | iso_pu_bacteria | 2879163058 | 2879165962 | 433 |
| 875 | iso_pu_bacteria | 2896253425 | 2896255487 | 433 |
| 876 | 3300005289 | Ga0065704_10070744 | Ga0065704_1007074410 | 434 |
| 877 | 3300005330 | Ga0070690_100043813 | Ga0070690_1000438133 | 434 |
| 878 | 3300005335 | Ga0070666_10026566 | Ga0070666_100265664 | 434 |
| 879 | 3300005347 | Ga0070668_100174904 | Ga0070668_1001749042 | 434 |
| 880 | 3300005355 | Ga0070671_100015118 | Ga0070671_1000151189 | 434 |
| 881 | 3300005367 | Ga0070667_100008843 | Ga0070667_1000088439 | 434 |
| 882 | 3300005548 | Ga0070665_100007081 | Ga0070665_1000070818 | 434 |
| 883 | 3300005548 | Ga0070665_100010626 | Ga0070665_10001062612 | 434 |
| 884 | 3300005577 | Ga0068857_100144066 | Ga0068857_1001440662 | 434 |
| 885 | 3300005614 | Ga0068856_100179211 | Ga0068856_1001792113 | 434 |
| 886 | 3300005617 | Ga0068859_100103822 | Ga0068859_1001038224 | 434 |
| 887 | 3300005841 | Ga0068863_100007010 | Ga0068863_1000070104 | 434 |
| 888 | 3300005842 | Ga0068858_100162541 | Ga0068858_1001625411 | 434 |
| 889 | 3300005843 | Ga0068860_100000944 | Ga0068860_10000094425 | 434 |
| 890 | 3300005843 | Ga0068860_100047514 | Ga0068860_1000475145 | 434 |
| 891 | 3300005844 | Ga0068862_100000280 | Ga0068862_10000028026 | 434 |
| 892 | 3300005844 | Ga0068862_100019008 | Ga0068862_10001900810 | 434 |
| 893 | 3300006028 | Ga0070717_10220193 | Ga0070717_102201931 | 434 |
| 894 | 3300006931 | Ga0097620_100103821 | Ga0097620_1001038214 | 434 |
| 895 | 3300009093 | Ga0105240_10361753 | Ga0105240_103617531 | 434 |
| 896 | 3300009177 | Ga0105248_10152523 | Ga0105248_101525232 | 434 |
| 897 | 3300009545 | Ga0105237_10002470 | Ga0105237_1000247021 | 434 |
| 898 | 3300009553 | Ga0105249_10020498 | Ga0105249_100204987 | 434 |
| 899 | 3300013297 | Ga0157378_10002131 | Ga0157378_1000213119 | 434 |
| 900 | 3300013306 | Ga0163162_10066770 | Ga0163162_100667705 | 434 |
| 901 | 3300025735 | Ga0207713_1004595 | Ga0207713_100459512 | 434 |
| 902 | 3300025914 | Ga0207671_10002072 | Ga0207671_100020729 | 434 |
| 903 | 3300025923 | Ga0207681_10000259 | Ga0207681_1000025918 | 434 |
| 904 | 3300025931 | Ga0207644_10000060 | Ga0207644_1000006050 | 434 |
| 905 | 3300025931 | Ga0207644_10002506 | Ga0207644_1000250611 | 434 |
| 906 | 3300025941 | Ga0207711_10224428 | Ga0207711_102244282 | 434 |
| 907 | 3300025961 | Ga0207712_10000069 | Ga0207712_1000006954 | 434 |
| 908 | 3300025961 | Ga0207712_10020513 | Ga0207712_100205135 | 434 |
| 909 | 3300025986 | Ga0207658_10005443 | Ga0207658_100054436 | 434 |
| 910 | 3300025986 | Ga0207658_10064739 | Ga0207658_100647394 | 434 |
| 911 | 3300026088 | Ga0207641_10002917 | Ga0207641_100029175 | 434 |
| 912 | 3300026088 | Ga0207641_10236824 | Ga0207641_102368242 | 434 |
| 913 | 3300026116 | Ga0207674_10164988 | Ga0207674_101649882 | 434 |
| 914 | 3300028379 | Ga0268266_10012740 | Ga0268266_100127404 | 434 |
| 915 | 3300028380 | Ga0268265_10000739 | Ga0268265_1000073924 | 434 |
| 916 | 3300028380 | Ga0268265_10006464 | Ga0268265_100064649 | 434 |
| 917 | 3300028381 | Ga0268264_10002308 | Ga0268264_100023083 | 434 |
| 918 | 3300028381 | Ga0268264_10046657 | Ga0268264_100466574 | 434 |
| 919 | 3300035170 | Ga0373943_0036081 | Ga0373943_0036081_309_1646 | 434 |
| 920 | 3300035724 | Ga0373933_0045726 | Ga0373933_0045726_1138_2475 | 434 |
| 921 | 3300037068 | Ga0373925_0054265 | Ga0373925_0054265_398_1735 | 434 |
| 922 | 3300037853 | Ga0436364_1027058 | Ga0436364_1027058_704_2047 | 434 |
| 923 | 3300039453 | Ga0436362_1291891 | Ga0436362_1291891_498_1841 | 434 |
| 924 | 3300046454 | Ga0495592_0087492 | Ga0495592_0087492_366_1700 | 434 |
| 925 | 3300046462 | Ga0495651_0071686 | Ga0495651_0071686_635_1969 | 434 |
| 926 | 3300046529 | Ga0495652_0163682 | Ga0495652_0163682_73_1407 | 434 |
| 927 | 3300047319 | Ga0495674_0033062 | Ga0495674_0033062_1095_2483 | 434 |
| 928 | 3300047322 | Ga0495680_0129972 | Ga0495680_0129972_410_1798 | 434 |
| 929 | 3300048904 | Ga0496101_0004194 | Ga0496101_0004194_4807_6288 | 434 |
| 930 | 3300048905 | Ga0496102_0000106 | Ga0496102_0000106_71784_73265 | 434 |
| 931 | 3300048906 | Ga0496103_0000095 | Ga0496103_0000095_30764_32245 | 434 |
| 932 | 3300048907 | Ga0496104_0000060 | Ga0496104_0000060_15668_17149 | 434 |
| 933 | 3300048907 | Ga0496104_0077771 | Ga0496104_0077771_1358_2704 | 434 |
| 934 | 3300048908 | Ga0496105_0000274 | Ga0496105_0000274_9873_11354 | 434 |
| 935 | 3300048909 | Ga0496106_0000338 | Ga0496106_0000338_28981_30327 | 434 |
| 936 | 3300048910 | Ga0496107_0002397 | Ga0496107_0002397_6381_7727 | 434 |
| 937 | 3300048916 | Ga0496113_0001855 | Ga0496113_0001855_2698_4044 | 434 |
| 938 | 3300048916 | Ga0496113_0002586 | Ga0496113_0002586_197_1678 | 434 |
| 939 | 3300048920 | Ga0496117_0000366 | Ga0496117_0000366_47709_49190 | 434 |
| 940 | 3300048921 | Ga0496118_0003332 | Ga0496118_0003332_6885_8366 | 434 |
| 941 | 3300048921 | Ga0496118_0041709 | Ga0496118_0041709_1843_3183 | 434 |
| 942 | 3300048922 | Ga0496119_0001213 | Ga0496119_0001213_19229_20710 | 434 |
| 943 | 3300048922 | Ga0496119_0052767 | Ga0496119_0052767_717_2057 | 434 |
| 944 | 3300048923 | Ga0496120_0001109 | Ga0496120_0001109_10889_12370 | 434 |
| 945 | 3300048924 | Ga0496121_0001994 | Ga0496121_0001994_28730_30211 | 434 |
| 946 | 3300048924 | Ga0496121_0002478 | Ga0496121_0002478_18832_20172 | 434 |
| 947 | 3300048925 | Ga0496122_0004287 | Ga0496122_0004287_6475_7956 | 434 |
| 948 | 3300048925 | Ga0496122_0096638 | Ga0496122_0096638_62_1390 | 434 |
| 949 | 3300048927 | Ga0496124_0000703 | Ga0496124_0000703_52078_53406 | 434 |
| 950 | 3300048927 | Ga0496124_0001819 | Ga0496124_0001819_15209_16690 | 434 |
| 951 | 3300048927 | Ga0496124_0109096 | Ga0496124_0109096_148_1476 | 434 |
| 952 | 3300048929 | Ga0496126_0000294 | Ga0496126_0000294_60228_61709 | 434 |
| 953 | 3300048929 | Ga0496126_0055898 | Ga0496126_0055898_829_2157 | 434 |
| 954 | 3300049758 | Ga0501241_001834 | Ga0501241_001834_354_1682 | 434 |
| 955 | iso_pu_bacteria | 2599185359 | 2600225479 | 434 |
| 956 | iso_pu_bacteria | 2818991466 | 2819713914 | 434 |
| 957 | iso_pu_bacteria | 2919138771 | 2919141165 | 434 |
| 958 | iso_pu_bacteria | 2928526807 | 2928528472 | 434 |
| 959 | iso_pu_bacteria | 2928968154 | 2928970019 | 434 |
| 960 | 3300001904 | JGI24736J21556_1001548 | JGI24736J21556_10015484 | 435 |
| 961 | 3300001989 | JGI24739J22299_10003612 | JGI24739J22299_100036125 | 435 |
| 962 | 3300002067 | JGI24735J21928_10008073 | JGI24735J21928_100080733 | 435 |
| 963 | 3300002070 | JGI24750J21931_1000436 | JGI24750J21931_10004369 | 435 |
| 964 | 3300002074 | JGI24748J21848_1000063 | JGI24748J21848_100006315 | 435 |
| 965 | 3300002076 | JGI24749J21850_1000018 | JGI24749J21850_100001816 | 435 |
| 966 | 3300002239 | JGI24034J26672_10000007 | JGI24034J26672_1000000738 | 435 |
| 967 | 3300002459 | JGI24751J29686_10000115 | JGI24751J29686_1000011529 | 435 |
| 968 | 3300002459 | JGI24751J29686_10004035 | JGI24751J29686_100040353 | 435 |
| 969 | 3300003215 | JGI25153J46596_10000115 | JGI25153J46596_1000011511 | 435 |
| 970 | 3300003759 | Ga0055525_1000104 | Ga0055525_1000104120 | 435 |
| 971 | 3300005295 | Ga0065707_10149171 | Ga0065707_101491711 | 435 |
| 972 | 3300005330 | Ga0070690_100000024 | Ga0070690_1000000243 | 435 |
| 973 | 3300005331 | Ga0070670_100000074 | Ga0070670_10000007417 | 435 |
| 974 | 3300005331 | Ga0070670_100000409 | Ga0070670_10000040959 | 435 |
| 975 | 3300005335 | Ga0070666_10000017 | Ga0070666_10000017181 | 435 |
| 976 | 3300005339 | Ga0070660_100022696 | Ga0070660_1000226964 | 435 |
| 977 | 3300005347 | Ga0070668_100080044 | Ga0070668_1000800441 | 435 |
| 978 | 3300005353 | Ga0070669_100000058 | Ga0070669_10000005818 | 435 |
| 979 | 3300005353 | Ga0070669_100003312 | Ga0070669_1000033122 | 435 |
| 980 | 3300005355 | Ga0070671_100013940 | Ga0070671_1000139405 | 435 |
| 981 | 3300005356 | Ga0070674_100020424 | Ga0070674_1000204244 | 435 |
| 982 | 3300005366 | Ga0070659_100038689 | Ga0070659_1000386893 | 435 |
| 983 | 3300005366 | Ga0070659_100062954 | Ga0070659_1000629542 | 435 |
| 984 | 3300005367 | Ga0070667_100000017 | Ga0070667_10000001726 | 435 |
| 985 | 3300005367 | Ga0070667_100003990 | Ga0070667_1000039909 | 435 |
| 986 | 3300005367 | Ga0070667_100063753 | Ga0070667_1000637531 | 435 |
| 987 | 3300005434 | Ga0070709_10000892 | Ga0070709_1000089212 | 435 |
| 988 | 3300005435 | Ga0070714_100015160 | Ga0070714_1000151603 | 435 |
| 989 | 3300005436 | Ga0070713_100000003 | Ga0070713_10000000330 | 435 |
| 990 | 3300005437 | Ga0070710_10045250 | Ga0070710_100452502 | 435 |
| 991 | 3300005456 | Ga0070678_100000057 | Ga0070678_10000005714 | 435 |
| 992 | 3300005466 | Ga0070685_10000389 | Ga0070685_1000038924 | 435 |
| 993 | 3300005530 | Ga0070679_100199771 | Ga0070679_1001997712 | 435 |
| 994 | 3300005539 | Ga0068853_100017003 | Ga0068853_1000170034 | 435 |
| 995 | 3300005544 | Ga0070686_100010480 | Ga0070686_1000104804 | 435 |
| 996 | 3300005545 | Ga0070695_100079773 | Ga0070695_1000797732 | 435 |
| 997 | 3300005548 | Ga0070665_100000042 | Ga0070665_100000042182 | 435 |
| 998 | 3300005563 | Ga0068855_100000608 | Ga0068855_10000060816 | 435 |
| 999 | 3300005577 | Ga0068857_100100978 | Ga0068857_1001009784 | 435 |
| 1000 | 3300005578 | Ga0068854_100134981 | Ga0068854_1001349812 | 435 |
| 1001 | 3300005614 | Ga0068856_100000719 | Ga0068856_10000071924 | 435 |
| 1002 | 3300005614 | Ga0068856_100003762 | Ga0068856_1000037625 | 435 |
| 1003 | 3300005617 | Ga0068859_100001232 | Ga0068859_1000012324 | 435 |
| 1004 | 3300005617 | Ga0068859_100003906 | Ga0068859_1000039063 | 435 |
| 1005 | 3300005617 | Ga0068859_100023002 | Ga0068859_1000230025 | 435 |
| 1006 | 3300005617 | Ga0068859_100141475 | Ga0068859_1001414754 | 435 |
| 1007 | 3300005618 | Ga0068864_100000260 | Ga0068864_10000026016 | 435 |
| 1008 | 3300005618 | Ga0068864_100017327 | Ga0068864_1000173274 | 435 |
| 1009 | 3300005719 | Ga0068861_100000074 | Ga0068861_10000007447 | 435 |
| 1010 | 3300005719 | Ga0068861_100001071 | Ga0068861_1000010715 | 435 |
| 1011 | 3300005719 | Ga0068861_100011989 | Ga0068861_1000119893 | 435 |
| 1012 | 3300005841 | Ga0068863_100000280 | Ga0068863_10000028037 | 435 |
| 1013 | 3300005842 | Ga0068858_100000303 | Ga0068858_10000030354 | 435 |
| 1014 | 3300005842 | Ga0068858_100001032 | Ga0068858_10000103212 | 435 |
| 1015 | 3300005843 | Ga0068860_100000056 | Ga0068860_100000056219 | 435 |
| 1016 | 3300005843 | Ga0068860_100000062 | Ga0068860_1000000623 | 435 |
| 1017 | 3300005844 | Ga0068862_100000081 | Ga0068862_10000008126 | 435 |
| 1018 | 3300005844 | Ga0068862_100000308 | Ga0068862_10000030846 | 435 |
| 1019 | 3300005937 | Ga0081455_10000255 | Ga0081455_1000025569 | 435 |
| 1020 | 3300006175 | Ga0070712_100000169 | Ga0070712_1000001695 | 435 |
| 1021 | 3300006871 | Ga0075434_100129812 | Ga0075434_1001298122 | 435 |
| 1022 | 3300006914 | Ga0075436_100000038 | Ga0075436_10000003886 | 435 |
| 1023 | 3300006914 | Ga0075436_100045939 | Ga0075436_1000459394 | 435 |
| 1024 | 3300006931 | Ga0097620_100001232 | Ga0097620_1000012324 | 435 |
| 1025 | 3300006931 | Ga0097620_100003906 | Ga0097620_10000390615 | 435 |
| 1026 | 3300006931 | Ga0097620_100022995 | Ga0097620_1000229955 | 435 |
| 1027 | 3300006931 | Ga0097620_100141468 | Ga0097620_1001414684 | 435 |
| 1028 | 3300009093 | Ga0105240_10008524 | Ga0105240_100085248 | 435 |
| 1029 | 3300009174 | Ga0105241_10017676 | Ga0105241_100176763 | 435 |
| 1030 | 3300009174 | Ga0105241_10030093 | Ga0105241_100300935 | 435 |
| 1031 | 3300009177 | Ga0105248_10001187 | Ga0105248_100011875 | 435 |
| 1032 | 3300009177 | Ga0105248_10017774 | Ga0105248_100177749 | 435 |
| 1033 | 3300009551 | Ga0105238_10003588 | Ga0105238_100035888 | 435 |
| 1034 | 3300009553 | Ga0105249_10000012 | Ga0105249_10000012106 | 435 |
| 1035 | 3300013102 | Ga0157371_10000059 | Ga0157371_10000059143 | 435 |
| 1036 | 3300013102 | Ga0157371_10025477 | Ga0157371_100254772 | 435 |
| 1037 | 3300013105 | Ga0157369_10004747 | Ga0157369_1000474715 | 435 |
| 1038 | 3300013306 | Ga0163162_10046965 | Ga0163162_100469654 | 435 |
| 1039 | 3300013307 | Ga0157372_10232582 | Ga0157372_102325821 | 435 |
| 1040 | 3300014326 | Ga0157380_10000151 | Ga0157380_100001516 | 435 |
| 1041 | 3300014326 | Ga0157380_10001425 | Ga0157380_1000142517 | 435 |
| 1042 | 3300014968 | Ga0157379_10036388 | Ga0157379_100363884 | 435 |
| 1043 | 3300014968 | Ga0157379_10137507 | Ga0157379_101375074 | 435 |
| 1044 | 3300015690 | Ga0183363_1004 | Ga0183363_1004259 | 435 |
| 1045 | 3300017792 | Ga0163161_10000025 | Ga0163161_10000025181 | 435 |
| 1046 | 3300025223 | Ga0207672_1000205 | Ga0207672_10002056 | 435 |
| 1047 | 3300025230 | Ga0209563_100116 | Ga0209563_10011618 | 435 |
| 1048 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001781 | 435 |
| 1049 | 3300025321 | Ga0207656_10043107 | Ga0207656_100431072 | 435 |
| 1050 | 3300025903 | Ga0207680_10000012 | Ga0207680_10000012180 | 435 |
| 1051 | 3300025904 | Ga0207647_10001733 | Ga0207647_1000173318 | 435 |
| 1052 | 3300025904 | Ga0207647_10025680 | Ga0207647_100256804 | 435 |
| 1053 | 3300025906 | Ga0207699_10000676 | Ga0207699_1000067611 | 435 |
| 1054 | 3300025909 | Ga0207705_10000197 | Ga0207705_1000019753 | 435 |
| 1055 | 3300025911 | Ga0207654_10000222 | Ga0207654_1000022223 | 435 |
| 1056 | 3300025911 | Ga0207654_10000293 | Ga0207654_1000029322 | 435 |
| 1057 | 3300025913 | Ga0207695_10000641 | Ga0207695_1000064138 | 435 |
| 1058 | 3300025913 | Ga0207695_10069418 | Ga0207695_100694183 | 435 |
| 1059 | 3300025913 | Ga0207695_10080915 | Ga0207695_100809153 | 435 |
| 1060 | 3300025914 | Ga0207671_10003353 | Ga0207671_100033535 | 435 |
| 1061 | 3300025919 | Ga0207657_10087798 | Ga0207657_100877983 | 435 |
| 1062 | 3300025920 | Ga0207649_10000319 | Ga0207649_100003194 | 435 |
| 1063 | 3300025920 | Ga0207649_10055003 | Ga0207649_100550033 | 435 |
| 1064 | 3300025923 | Ga0207681_10000003 | Ga0207681_10000003535 | 435 |
| 1065 | 3300025923 | Ga0207681_10000221 | Ga0207681_1000022142 | 435 |
| 1066 | 3300025924 | Ga0207694_10003805 | Ga0207694_100038055 | 435 |
| 1067 | 3300025925 | Ga0207650_10000038 | Ga0207650_10000038166 | 435 |
| 1068 | 3300025925 | Ga0207650_10007425 | Ga0207650_1000742513 | 435 |
| 1069 | 3300025925 | Ga0207650_10100427 | Ga0207650_101004271 | 435 |
| 1070 | 3300025926 | Ga0207659_10118854 | Ga0207659_101188542 | 435 |
| 1071 | 3300025928 | Ga0207700_10000083 | Ga0207700_1000008330 | 435 |
| 1072 | 3300025929 | Ga0207664_10011315 | Ga0207664_100113156 | 435 |
| 1073 | 3300025931 | Ga0207644_10000385 | Ga0207644_100003853 | 435 |
| 1074 | 3300025931 | Ga0207644_10000927 | Ga0207644_100009278 | 435 |
| 1075 | 3300025932 | Ga0207690_10010226 | Ga0207690_100102264 | 435 |
| 1076 | 3300025933 | Ga0207706_10003677 | Ga0207706_1000367717 | 435 |
| 1077 | 3300025937 | Ga0207669_10005970 | Ga0207669_100059703 | 435 |
| 1078 | 3300025941 | Ga0207711_10002994 | Ga0207711_100029948 | 435 |
| 1079 | 3300025949 | Ga0207667_10000002 | Ga0207667_1000000212 | 435 |
| 1080 | 3300025949 | Ga0207667_10000916 | Ga0207667_1000091616 | 435 |
| 1081 | 3300025949 | Ga0207667_10005514 | Ga0207667_1000551411 | 435 |
| 1082 | 3300025949 | Ga0207667_10044809 | Ga0207667_100448093 | 435 |
| 1083 | 3300025961 | Ga0207712_10000021 | Ga0207712_10000021180 | 435 |
| 1084 | 3300025972 | Ga0207668_10000178 | Ga0207668_1000017832 | 435 |
| 1085 | 3300025972 | Ga0207668_10022777 | Ga0207668_100227772 | 435 |
| 1086 | 3300025981 | Ga0207640_10117499 | Ga0207640_101174992 | 435 |
| 1087 | 3300025986 | Ga0207658_10000011 | Ga0207658_10000011214 | 435 |
| 1088 | 3300025986 | Ga0207658_10014406 | Ga0207658_100144065 | 435 |
| 1089 | 3300025986 | Ga0207658_10079952 | Ga0207658_100799522 | 435 |
| 1090 | 3300026035 | Ga0207703_10000714 | Ga0207703_1000071433 | 435 |
| 1091 | 3300026035 | Ga0207703_10014160 | Ga0207703_100141603 | 435 |
| 1092 | 3300026041 | Ga0207639_10003585 | Ga0207639_100035856 | 435 |
| 1093 | 3300026067 | Ga0207678_10025364 | Ga0207678_100253642 | 435 |
| 1094 | 3300026078 | Ga0207702_10000045 | Ga0207702_10000045129 | 435 |
| 1095 | 3300026078 | Ga0207702_10002929 | Ga0207702_1000292910 | 435 |
| 1096 | 3300026078 | Ga0207702_10032499 | Ga0207702_100324993 | 435 |
| 1097 | 3300026078 | Ga0207702_10104638 | Ga0207702_101046383 | 435 |
| 1098 | 3300026088 | Ga0207641_10000414 | Ga0207641_1000041434 | 435 |
| 1099 | 3300026089 | Ga0207648_10096920 | Ga0207648_100969202 | 435 |
| 1100 | 3300026095 | Ga0207676_10000034 | Ga0207676_1000003417 | 435 |
| 1101 | 3300026095 | Ga0207676_10035291 | Ga0207676_100352913 | 435 |
| 1102 | 3300026116 | Ga0207674_10000026 | Ga0207674_1000002679 | 435 |
| 1103 | 3300026116 | Ga0207674_10027999 | Ga0207674_100279996 | 435 |
| 1104 | 3300026116 | Ga0207674_10041996 | Ga0207674_100419965 | 435 |
| 1105 | 3300026118 | Ga0207675_100000244 | Ga0207675_1000002443 | 435 |
| 1106 | 3300026118 | Ga0207675_100000360 | Ga0207675_10000036017 | 435 |
| 1107 | 3300026118 | Ga0207675_100006658 | Ga0207675_10000665810 | 435 |
| 1108 | 3300026121 | Ga0207683_10020696 | Ga0207683_100206964 | 435 |
| 1109 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022939 | 435 |
| 1110 | 3300028379 | Ga0268266_10000054 | Ga0268266_10000054179 | 435 |
| 1111 | 3300028379 | Ga0268266_10031160 | Ga0268266_100311602 | 435 |
| 1112 | 3300028380 | Ga0268265_10000030 | Ga0268265_1000003073 | 435 |
| 1113 | 3300028380 | Ga0268265_10000292 | Ga0268265_1000029224 | 435 |
| 1114 | 3300028381 | Ga0268264_10000074 | Ga0268264_10000074180 | 435 |
| 1115 | 3300028381 | Ga0268264_10000089 | Ga0268264_1000008933 | 435 |
| 1116 | 3300028786 | Ga0307517_10015953 | Ga0307517_100159536 | 435 |
| 1117 | 3300028786 | Ga0307517_10028410 | Ga0307517_100284106 | 435 |
| 1118 | 3300028786 | Ga0307517_10094042 | Ga0307517_100940422 | 435 |
| 1119 | 3300031731 | Ga0307405_10086253 | Ga0307405_100862532 | 435 |
| 1120 | 3300031911 | Ga0307412_10019148 | Ga0307412_100191482 | 435 |
| 1121 | 3300032004 | Ga0307414_10016847 | Ga0307414_100168474 | 435 |
| 1122 | 3300035172 | Ga0373955_0051397 | Ga0373955_0051397_133_1479 | 435 |
| 1123 | 3300036401 | Ga0373937_0016703 | Ga0373937_0016703_3751_5097 | 435 |
| 1124 | 3300038443 | Ga0395901_0091535 | Ga0395901_0091535_1578_2909 | 435 |
| 1125 | 3300046460 | Ga0495638_0000214 | Ga0495638_0000214_1280_2626 | 435 |
| 1126 | 3300046471 | Ga0495650_0000174 | Ga0495650_0000174_6842_8173 | 435 |
| 1127 | 3300046492 | Ga0495585_0017595 | Ga0495585_0017595_2426_3757 | 435 |
| 1128 | 3300046500 | Ga0495596_0006273 | Ga0495596_0006273_922_2253 | 435 |
| 1129 | 3300046506 | Ga0495583_0006072 | Ga0495583_0006072_5989_7320 | 435 |
| 1130 | 3300046506 | Ga0495583_0028306 | Ga0495583_0028306_1091_2422 | 435 |
| 1131 | 3300046506 | Ga0495583_0035876 | Ga0495583_0035876_998_2329 | 435 |
| 1132 | 3300046522 | Ga0495643_0005203 | Ga0495643_0005203_6476_7843 | 435 |
| 1133 | 3300046522 | Ga0495643_0020654 | Ga0495643_0020654_295_1626 | 435 |
| 1134 | 3300046525 | Ga0495663_0005738 | Ga0495663_0005738_990_2336 | 435 |
| 1135 | 3300046525 | Ga0495663_0017105 | Ga0495663_0017105_653_1984 | 435 |
| 1136 | 3300046558 | Ga0495633_0033295 | Ga0495633_0033295_198_1529 | 435 |
| 1137 | 3300046616 | Ga0495668_0000072 | Ga0495668_0000072_69455_70786 | 435 |
| 1138 | 3300046616 | Ga0495668_0028551 | Ga0495668_0028551_1387_2721 | 435 |
| 1139 | 3300046648 | Ga0495611_0007195 | Ga0495611_0007195_1888_3219 | 435 |
| 1140 | 3300046660 | Ga0495625_0002794 | Ga0495625_0002794_1447_2793 | 435 |
| 1141 | 3300046660 | Ga0495625_0017887 | Ga0495625_0017887_1654_3144 | 435 |
| 1142 | 3300046660 | Ga0495625_0125954 | Ga0495625_0125954_116_1462 | 435 |
| 1143 | 3300046684 | Ga0495669_0000258 | Ga0495669_0000258_5392_6723 | 435 |
| 1144 | 3300046691 | Ga0495670_0018659 | Ga0495670_0018659_364_1713 | 435 |
| 1145 | 3300047323 | Ga0495683_0024537 | Ga0495683_0024537_74_1405 | 435 |
| 1146 | 3300047443 | Ga0495687_000240 | Ga0495687_000240_72089_73420 | 435 |
| 1147 | 3300047470 | Ga0495681_0004911 | Ga0495681_0004911_5874_7205 | 435 |
| 1148 | 3300047472 | Ga0495686_0000544 | Ga0495686_0000544_50021_51352 | 435 |
| 1149 | 3300047472 | Ga0495686_0010969 | Ga0495686_0010969_1094_2422 | 435 |
| 1150 | 3300047472 | Ga0495686_0021400 | Ga0495686_0021400_1313_2659 | 435 |
| 1151 | 3300048905 | Ga0496102_0011122 | Ga0496102_0011122_6379_7710 | 435 |
| 1152 | 3300048906 | Ga0496103_0000069 | Ga0496103_0000069_114046_115377 | 435 |
| 1153 | 3300048906 | Ga0496103_0002980 | Ga0496103_0002980_3275_4609 | 435 |
| 1154 | 3300048907 | Ga0496104_0067340 | Ga0496104_0067340_1330_2661 | 435 |
| 1155 | 3300048908 | Ga0496105_0041343 | Ga0496105_0041343_1113_2444 | 435 |
| 1156 | 3300048908 | Ga0496105_0062920 | Ga0496105_0062920_1171_2505 | 435 |
| 1157 | 3300048914 | Ga0496111_0034979 | Ga0496111_0034979_918_2249 | 435 |
| 1158 | 3300048918 | Ga0496115_0000009 | Ga0496115_0000009_227019_228350 | 435 |
| 1159 | 3300048919 | Ga0496116_0007300 | Ga0496116_0007300_2325_3656 | 435 |
| 1160 | 3300048920 | Ga0496117_0000185 | Ga0496117_0000185_6167_7498 | 435 |
| 1161 | 3300048920 | Ga0496117_0015041 | Ga0496117_0015041_2070_3404 | 435 |
| 1162 | 3300048921 | Ga0496118_0000077 | Ga0496118_0000077_184662_185993 | 435 |
| 1163 | 3300048921 | Ga0496118_0013982 | Ga0496118_0013982_428_1762 | 435 |
| 1164 | 3300048924 | Ga0496121_0001230 | Ga0496121_0001230_6250_7581 | 435 |
| 1165 | 3300048927 | Ga0496124_0000050 | Ga0496124_0000050_250453_251784 | 435 |
| 1166 | 3300048929 | Ga0496126_0000113 | Ga0496126_0000113_184704_186035 | 435 |
| 1167 | 3300049571 | Ga0501034_0002130 | Ga0501034_0002130_21693_23021 | 435 |
| 1168 | 3300049663 | Ga0501223_000367 | Ga0501223_000367_1767_3095 | 435 |
| 1169 | 3300049664 | Ga0501224_000028 | Ga0501224_000028_6733_8061 | 435 |
| 1170 | 3300049668 | Ga0501233_000183 | Ga0501233_000183_6229_7557 | 435 |
| 1171 | 3300049705 | Ga0501225_0001033 | Ga0501225_0001033_6687_8015 | 435 |
| 1172 | 3300049853 | Ga0501226_000191 | Ga0501226_000191_1767_3095 | 435 |
| 1173 | 3300050512 | nmdc:mga0n895_45942_c1 | nmdc:mga0n895_45942_c1_2452_3798 | 435 |
| 1174 | 3300050513 | nmdc:mga0rr50_50701_c1 | nmdc:mga0rr50_50701_c1_694_2040 | 435 |
| 1175 | 3300050514 | nmdc:mga08x19_95_c1 | nmdc:mga08x19_95_c1_6711_8063 | 435 |
| 1176 | 3300053079 | Ga0500610_0000364 | Ga0500610_0000364_6811_8142 | 435 |
| 1177 | 3300053087 | Ga0500643_000135 | Ga0500643_000135_35816_37150 | 435 |
| 1178 | 3300053087 | Ga0500643_000606 | Ga0500643_000606_1562_2902 | 435 |
| 1179 | 3300053104 | Ga0500556_0000197 | Ga0500556_0000197_46388_47878 | 435 |
| 1180 | 3300053119 | Ga0500595_002716 | Ga0500595_002716_5551_6882 | 435 |
| 1181 | 3300053121 | Ga0500607_003805 | Ga0500607_003805_2780_4138 | 435 |
| 1182 | 3300053130 | Ga0500642_0000011 | Ga0500642_0000011_153667_155157 | 435 |
| 1183 | 3300053134 | Ga0500658_0005819 | Ga0500658_0005819_3096_4442 | 435 |
| 1184 | 3300053138 | Ga0500564_006756 | Ga0500564_006756_436_1794 | 435 |
| 1185 | 3300053153 | Ga0500616_0009045 | Ga0500616_0009045_3409_4755 | 435 |
| 1186 | 3300053177 | Ga0500636_0003773 | Ga0500636_0003773_5383_6750 | 435 |
| 1187 | 3300053723 | Ga0500567_009748 | Ga0500567_009748_2956_4314 | 435 |
| 1188 | 3300053729 | Ga0500625_000039 | Ga0500625_000039_24309_25667 | 435 |
| 1189 | 3300053730 | Ga0500645_000134 | Ga0500645_000134_5405_6736 | 435 |
| 1190 | 3300053730 | Ga0500645_000767 | Ga0500645_000767_1533_3023 | 435 |
| 1191 | iso_pu_bacteria | 2599185354 | 2600200336 | 435 |
| 1192 | iso_pu_bacteria | 2739367664 | 2739649478 | 435 |
| 1193 | iso_pu_bacteria | 2739367865 | 2740027951 | 435 |
| 1194 | iso_pu_bacteria | 2751185897 | 2753763883 | 435 |
| 1195 | iso_pu_bacteria | 2830075706 | 2830076954 | 435 |
| 1196 | iso_pu_bacteria | 2885429604 | 2885430331 | 435 |
| 1197 | iso_pu_bacteria | 2928027323 | 2928030281 | 435 |
| 1198 | iso_pu_bacteria | 2946787523 | 2946787723 | 435 |
| 1199 | iso_pu_bacteria | 2984555340 | 2984558858 | 435 |
| 1200 | iso_pu_bacteria | 2984564862 | 2984566628 | 435 |
| 1201 | iso_pu_bacteria | 2990265787 | 2990266543 | 435 |
| 1202 | iso_pu_bacteria | 2993356040 | 2993357824 | 435 |
| 1203 | iso_pu_bacteria | 2993693658 | 2993695659 | 435 |
| 1204 | iso_pu_bacteria | 8057101203 | 8057103754 | 435 |
| 1205 | 3300001904 | JGI24736J21556_1000185 | JGI24736J21556_10001859 | 436 |
| 1206 | 3300001915 | JGI24741J21665_1000045 | JGI24741J21665_100004524 | 436 |
| 1207 | 3300001989 | JGI24739J22299_10000095 | JGI24739J22299_100000958 | 436 |
| 1208 | 3300001989 | JGI24739J22299_10011937 | JGI24739J22299_100119372 | 436 |
| 1209 | 3300001990 | JGI24737J22298_10014256 | JGI24737J22298_100142561 | 436 |
| 1210 | 3300002067 | JGI24735J21928_10004127 | JGI24735J21928_100041271 | 436 |
| 1211 | 3300002067 | JGI24735J21928_10014478 | JGI24735J21928_100144784 | 436 |
| 1212 | 3300002067 | JGI24735J21928_10023493 | JGI24735J21928_100234932 | 436 |
| 1213 | 3300002075 | JGI24738J21930_10000967 | JGI24738J21930_100009678 | 436 |
| 1214 | 3300003214 | JGI25165J46597_1000043 | JGI25165J46597_1000043148 | 436 |
| 1215 | 3300003322 | rootL2_10134394 | rootL2_101343949 | 436 |
| 1216 | 3300005289 | Ga0065704_10002519 | Ga0065704_100025193 | 436 |
| 1217 | 3300005327 | Ga0070658_10107179 | Ga0070658_101071792 | 436 |
| 1218 | 3300005331 | Ga0070670_100221670 | Ga0070670_1002216701 | 436 |
| 1219 | 3300005335 | Ga0070666_10000160 | Ga0070666_100001605 | 436 |
| 1220 | 3300005335 | Ga0070666_10026239 | Ga0070666_100262393 | 436 |
| 1221 | 3300005339 | Ga0070660_100006402 | Ga0070660_1000064026 | 436 |
| 1222 | 3300005339 | Ga0070660_100043168 | Ga0070660_1000431684 | 436 |
| 1223 | 3300005344 | Ga0070661_100224086 | Ga0070661_1002240861 | 436 |
| 1224 | 3300005347 | Ga0070668_100031066 | Ga0070668_1000310662 | 436 |
| 1225 | 3300005347 | Ga0070668_100103426 | Ga0070668_1001034261 | 436 |
| 1226 | 3300005347 | Ga0070668_100197028 | Ga0070668_1001970282 | 436 |
| 1227 | 3300005353 | Ga0070669_100000013 | Ga0070669_100000013146 | 436 |
| 1228 | 3300005353 | Ga0070669_100045809 | Ga0070669_1000458093 | 436 |
| 1229 | 3300005355 | Ga0070671_100000009 | Ga0070671_10000000977 | 436 |
| 1230 | 3300005355 | Ga0070671_100016699 | Ga0070671_1000166994 | 436 |
| 1231 | 3300005367 | Ga0070667_100000024 | Ga0070667_10000002498 | 436 |
| 1232 | 3300005455 | Ga0070663_100015679 | Ga0070663_1000156794 | 436 |
| 1233 | 3300005457 | Ga0070662_100048101 | Ga0070662_1000481013 | 436 |
| 1234 | 3300005457 | Ga0070662_100096720 | Ga0070662_1000967202 | 436 |
| 1235 | 3300005539 | Ga0068853_100013242 | Ga0068853_1000132428 | 436 |
| 1236 | 3300005548 | Ga0070665_100144530 | Ga0070665_1001445302 | 436 |
| 1237 | 3300005563 | Ga0068855_100155318 | Ga0068855_1001553182 | 436 |
| 1238 | 3300005577 | Ga0068857_100005280 | Ga0068857_1000052804 | 436 |
| 1239 | 3300005577 | Ga0068857_100049639 | Ga0068857_1000496392 | 436 |
| 1240 | 3300005577 | Ga0068857_100066411 | Ga0068857_1000664114 | 436 |
| 1241 | 3300005614 | Ga0068856_100009436 | Ga0068856_1000094367 | 436 |
| 1242 | 3300005616 | Ga0068852_100000753 | Ga0068852_1000007537 | 436 |
| 1243 | 3300005617 | Ga0068859_100006922 | Ga0068859_1000069223 | 436 |
| 1244 | 3300005719 | Ga0068861_100004608 | Ga0068861_1000046083 | 436 |
| 1245 | 3300005841 | Ga0068863_100000082 | Ga0068863_10000008222 | 436 |
| 1246 | 3300005842 | Ga0068858_100003432 | Ga0068858_10000343210 | 436 |
| 1247 | 3300005843 | Ga0068860_100018956 | Ga0068860_1000189562 | 436 |
| 1248 | 3300005844 | Ga0068862_100004544 | Ga0068862_1000045449 | 436 |
| 1249 | 3300006931 | Ga0097620_100006922 | Ga0097620_1000069223 | 436 |
| 1250 | 3300009093 | Ga0105240_10098810 | Ga0105240_100988101 | 436 |
| 1251 | 3300009174 | Ga0105241_10013534 | Ga0105241_100135348 | 436 |
| 1252 | 3300009177 | Ga0105248_10315041 | Ga0105248_103150412 | 436 |
| 1253 | 3300012513 | Ga0157326_1000338 | Ga0157326_10003387 | 436 |
| 1254 | 3300013104 | Ga0157370_10000069 | Ga0157370_1000006935 | 436 |
| 1255 | 3300013105 | Ga0157369_10038626 | Ga0157369_100386262 | 436 |
| 1256 | 3300013306 | Ga0163162_10001741 | Ga0163162_100017418 | 436 |
| 1257 | 3300025250 | Ga0209026_1000650 | Ga0209026_10006508 | 436 |
| 1258 | 3300025254 | Ga0209148_1000238 | Ga0209148_100023832 | 436 |
| 1259 | 3300025254 | Ga0209148_1003278 | Ga0209148_10032784 | 436 |
| 1260 | 3300025261 | Ga0209233_1000079 | Ga0209233_1000079122 | 436 |
| 1261 | 3300025903 | Ga0207680_10001210 | Ga0207680_100012106 | 436 |
| 1262 | 3300025903 | Ga0207680_10005315 | Ga0207680_100053153 | 436 |
| 1263 | 3300025904 | Ga0207647_10000497 | Ga0207647_1000049721 | 436 |
| 1264 | 3300025904 | Ga0207647_10043369 | Ga0207647_100433694 | 436 |
| 1265 | 3300025909 | Ga0207705_10179745 | Ga0207705_101797452 | 436 |
| 1266 | 3300025913 | Ga0207695_10033073 | Ga0207695_100330737 | 436 |
| 1267 | 3300025919 | Ga0207657_10041918 | Ga0207657_100419183 | 436 |
| 1268 | 3300025919 | Ga0207657_10119347 | Ga0207657_101193472 | 436 |
| 1269 | 3300025919 | Ga0207657_10134006 | Ga0207657_101340063 | 436 |
| 1270 | 3300025923 | Ga0207681_10000008 | Ga0207681_1000000886 | 436 |
| 1271 | 3300025923 | Ga0207681_10044582 | Ga0207681_100445824 | 436 |
| 1272 | 3300025924 | Ga0207694_10055561 | Ga0207694_100555613 | 436 |
| 1273 | 3300025925 | Ga0207650_10001576 | Ga0207650_100015763 | 436 |
| 1274 | 3300025931 | Ga0207644_10000006 | Ga0207644_1000000676 | 436 |
| 1275 | 3300025931 | Ga0207644_10017065 | Ga0207644_100170653 | 436 |
| 1276 | 3300025949 | Ga0207667_10086736 | Ga0207667_100867364 | 436 |
| 1277 | 3300025972 | Ga0207668_10000647 | Ga0207668_1000064721 | 436 |
| 1278 | 3300025972 | Ga0207668_10001332 | Ga0207668_1000133210 | 436 |
| 1279 | 3300025986 | Ga0207658_10000022 | Ga0207658_1000002282 | 436 |
| 1280 | 3300026041 | Ga0207639_10000691 | Ga0207639_1000069111 | 436 |
| 1281 | 3300026067 | Ga0207678_10000218 | Ga0207678_1000021834 | 436 |
| 1282 | 3300026078 | Ga0207702_10002451 | Ga0207702_1000245110 | 436 |
| 1283 | 3300026078 | Ga0207702_10028110 | Ga0207702_100281103 | 436 |
| 1284 | 3300026088 | Ga0207641_10000139 | Ga0207641_1000013982 | 436 |
| 1285 | 3300026088 | Ga0207641_10321469 | Ga0207641_103214691 | 436 |
| 1286 | 3300026095 | Ga0207676_10000613 | Ga0207676_1000061329 | 436 |
| 1287 | 3300026116 | Ga0207674_10037284 | Ga0207674_100372844 | 436 |
| 1288 | 3300026116 | Ga0207674_10050697 | Ga0207674_100506973 | 436 |
| 1289 | 3300026116 | Ga0207674_10057730 | Ga0207674_100577303 | 436 |
| 1290 | 3300026118 | Ga0207675_100000533 | Ga0207675_10000053338 | 436 |
| 1291 | 3300026142 | Ga0207698_10000130 | Ga0207698_1000013051 | 436 |
| 1292 | 3300027866 | Ga0209813_10000111 | Ga0209813_1000011120 | 436 |
| 1293 | 3300028379 | Ga0268266_10115169 | Ga0268266_101151692 | 436 |
| 1294 | 3300028380 | Ga0268265_10000601 | Ga0268265_1000060128 | 436 |
| 1295 | 3300028381 | Ga0268264_10000310 | Ga0268264_100003108 | 436 |
| 1296 | 3300031548 | Ga0307408_100002167 | Ga0307408_1000021678 | 436 |
| 1297 | 3300031731 | Ga0307405_10029241 | Ga0307405_100292411 | 436 |
| 1298 | 3300031731 | Ga0307405_10047559 | Ga0307405_100475593 | 436 |
| 1299 | 3300031731 | Ga0307405_10098046 | Ga0307405_100980463 | 436 |
| 1300 | 3300031911 | Ga0307412_10023819 | Ga0307412_100238193 | 436 |
| 1301 | 3300032004 | Ga0307414_10224461 | Ga0307414_102244611 | 436 |
| 1302 | 3300037312 | Ga0395899_0001521 | Ga0395899_0001521_330_1667 | 436 |
| 1303 | 3300037471 | Ga0395905_0109712 | Ga0395905_0109712_703_2040 | 436 |
| 1304 | 3300037853 | Ga0436364_0910692 | Ga0436364_0910692_1138_2478 | 436 |
| 1305 | 3300038705 | Ga0237819_00949 | Ga0237819_00949_3411_4748 | 436 |
| 1306 | 3300039145 | Ga0237816_00649 | Ga0237816_00649_1575_2912 | 436 |
| 1307 | 3300041452 | Ga0451793_0729188 | Ga0451793_0729188_176_1513 | 436 |
| 1308 | 3300041462 | Ga0451806_691803 | Ga0451806_691803_346_1683 | 436 |
| 1309 | 3300044658 | Ga0466972_0012842 | Ga0466972_0012842_1943_3280 | 436 |
| 1310 | 3300044684 | Ga0466966_0060715 | Ga0466966_0060715_248_1585 | 436 |
| 1311 | 3300044735 | Ga0466968_0014787 | Ga0466968_0014787_737_2095 | 436 |
| 1312 | 3300044901 | Ga0466960_0058600 | Ga0466960_0058600_165_1502 | 436 |
| 1313 | 3300046453 | Ga0495627_000157 | Ga0495627_000157_18875_20185 | 436 |
| 1314 | 3300046453 | Ga0495627_000318 | Ga0495627_000318_24361_25701 | 436 |
| 1315 | 3300046460 | Ga0495638_0000018 | Ga0495638_0000018_366430_367800 | 436 |
| 1316 | 3300046460 | Ga0495638_0013831 | Ga0495638_0013831_1519_2871 | 436 |
| 1317 | 3300046471 | Ga0495650_0006704 | Ga0495650_0006704_1479_2819 | 436 |
| 1318 | 3300046491 | Ga0495584_0018885 | Ga0495584_0018885_792_2132 | 436 |
| 1319 | 3300046506 | Ga0495583_0002170 | Ga0495583_0002170_14777_16147 | 436 |
| 1320 | 3300046507 | Ga0495606_0003780 | Ga0495606_0003780_2881_4221 | 436 |
| 1321 | 3300046507 | Ga0495606_0080258 | Ga0495606_0080258_480_1820 | 436 |
| 1322 | 3300046512 | Ga0495610_0000389 | Ga0495610_0000389_29413_30723 | 436 |
| 1323 | 3300046513 | Ga0495616_0000880 | Ga0495616_0000880_18758_20068 | 436 |
| 1324 | 3300046519 | Ga0495632_0000042 | Ga0495632_0000042_25873_27213 | 436 |
| 1325 | 3300046519 | Ga0495632_0001274 | Ga0495632_0001274_16099_17469 | 436 |
| 1326 | 3300046520 | Ga0495637_0001047 | Ga0495637_0001047_15715_17055 | 436 |
| 1327 | 3300046520 | Ga0495637_0007051 | Ga0495637_0007051_2769_4079 | 436 |
| 1328 | 3300046522 | Ga0495643_0000005 | Ga0495643_0000005_415920_417260 | 436 |
| 1329 | 3300046524 | Ga0495648_0000144 | Ga0495648_0000144_63278_64648 | 436 |
| 1330 | 3300046524 | Ga0495648_0033238 | Ga0495648_0033238_1115_2455 | 436 |
| 1331 | 3300046525 | Ga0495663_0000015 | Ga0495663_0000015_117973_119313 | 436 |
| 1332 | 3300046530 | Ga0495654_0015312 | Ga0495654_0015312_2307_3644 | 436 |
| 1333 | 3300046558 | Ga0495633_0000197 | Ga0495633_0000197_46004_47344 | 436 |
| 1334 | 3300046558 | Ga0495633_0000262 | Ga0495633_0000262_25873_27213 | 436 |
| 1335 | 3300046665 | Ga0495661_0088828 | Ga0495661_0088828_75_1385 | 436 |
| 1336 | 3300046692 | Ga0495671_0000007 | Ga0495671_0000007_415854_417194 | 436 |
| 1337 | 3300046692 | Ga0495671_0000060 | Ga0495671_0000060_104924_106294 | 436 |
| 1338 | 3300047469 | Ga0495673_0000088 | Ga0495673_0000088_104924_106294 | 436 |
| 1339 | 3300047469 | Ga0495673_0016447 | Ga0495673_0016447_1660_3000 | 436 |
| 1340 | 3300047470 | Ga0495681_0000006 | Ga0495681_0000006_181247_182557 | 436 |
| 1341 | 3300047470 | Ga0495681_0016802 | Ga0495681_0016802_1459_2799 | 436 |
| 1342 | 3300047472 | Ga0495686_0000197 | Ga0495686_0000197_2112_3467 | 436 |
| 1343 | 3300047472 | Ga0495686_0000588 | Ga0495686_0000588_2895_4235 | 436 |
| 1344 | 3300047472 | Ga0495686_0004312 | Ga0495686_0004312_9930_11270 | 436 |
| 1345 | 3300047472 | Ga0495686_0054433 | Ga0495686_0054433_1127_2437 | 436 |
| 1346 | 3300047472 | Ga0495686_0125900 | Ga0495686_0125900_86_1396 | 436 |
| 1347 | 3300048911 | Ga0496108_0001297 | Ga0496108_0001297_1522_2832 | 436 |
| 1348 | 3300048919 | Ga0496116_0041259 | Ga0496116_0041259_753_2063 | 436 |
| 1349 | 3300048920 | Ga0496117_0013629 | Ga0496117_0013629_5137_6447 | 436 |
| 1350 | 3300048921 | Ga0496118_0031034 | Ga0496118_0031034_2805_4142 | 436 |
| 1351 | 3300048924 | Ga0496121_0002144 | Ga0496121_0002144_1317_2627 | 436 |
| 1352 | 3300048925 | Ga0496122_0002984 | Ga0496122_0002984_10179_11516 | 436 |
| 1353 | 3300048925 | Ga0496122_0017578 | Ga0496122_0017578_1768_3105 | 436 |
| 1354 | 3300048925 | Ga0496122_0088083 | Ga0496122_0088083_397_1749 | 436 |
| 1355 | 3300048926 | Ga0496123_0009579 | Ga0496123_0009579_6361_7698 | 436 |
| 1356 | 3300048926 | Ga0496123_0074867 | Ga0496123_0074867_240_1577 | 436 |
| 1357 | 3300048929 | Ga0496126_0014568 | Ga0496126_0014568_1327_2637 | 436 |
| 1358 | 3300049515 | Ga0501292_000117 | Ga0501292_000117_2548_3861 | 436 |
| 1359 | 3300049517 | Ga0501294_000670 | Ga0501294_000670_2397_3716 | 436 |
| 1360 | 3300049570 | Ga0501033_0110784 | Ga0501033_0110784_445_1800 | 436 |
| 1361 | 3300049579 | Ga0501043_0026913 | Ga0501043_0026913_206_1561 | 436 |
| 1362 | 3300049579 | Ga0501043_0058007 | Ga0501043_0058007_405_1751 | 436 |
| 1363 | 3300049580 | Ga0501046_0064267 | Ga0501046_0064267_1286_2635 | 436 |
| 1364 | 3300049581 | Ga0501047_0015644 | Ga0501047_0015644_4600_5946 | 436 |
| 1365 | 3300049662 | Ga0501222_001581 | Ga0501222_001581_1718_3055 | 436 |
| 1366 | 3300049663 | Ga0501223_000025 | Ga0501223_000025_1640_2950 | 436 |
| 1367 | 3300049679 | Ga0501249_001102 | Ga0501249_001102_1259_2605 | 436 |
| 1368 | 3300049686 | Ga0501257_002893 | Ga0501257_002893_1616_2953 | 436 |
| 1369 | 3300049690 | Ga0501261_000498 | Ga0501261_000498_3597_4910 | 436 |
| 1370 | 3300049705 | Ga0501225_0000842 | Ga0501225_0000842_6482_7792 | 436 |
| 1371 | 3300049775 | Ga0501279_000004 | Ga0501279_000004_171840_173153 | 436 |
| 1372 | 3300049776 | Ga0501280_000014 | Ga0501280_000014_53855_55168 | 436 |
| 1373 | 3300049777 | Ga0501281_00189 | Ga0501281_00189_51_1364 | 436 |
| 1374 | 3300049823 | Ga0501044_0102020 | Ga0501044_0102020_1210_2556 | 436 |
| 1375 | 3300050494 | nmdc:mga06z11_195_c1 | nmdc:mga06z11_195_c1_2721_4031 | 436 |
| 1376 | 3300050495 | nmdc:mga04h51_420_c1 | nmdc:mga04h51_420_c1_8052_9362 | 436 |
| 1377 | 3300053087 | Ga0500643_000093 | Ga0500643_000093_90351_91664 | 436 |
| 1378 | 3300053116 | Ga0500592_000056 | Ga0500592_000056_30079_31416 | 436 |
| 1379 | 3300053153 | Ga0500616_0072211 | Ga0500616_0072211_241_1581 | 436 |
| 1380 | 3300053157 | Ga0500624_000024 | Ga0500624_000024_69399_70715 | 436 |
| 1381 | 3300053157 | Ga0500624_000105 | Ga0500624_000105_32784_34142 | 436 |
| 1382 | 3300053158 | Ga0500627_0000844 | Ga0500627_0000844_2452_3789 | 436 |
| 1383 | 3300053158 | Ga0500627_0011244 | Ga0500627_0011244_18_1328 | 436 |
| 1384 | 3300053177 | Ga0500636_0034004 | Ga0500636_0034004_1439_2797 | 436 |
| 1385 | iso_pu_bacteria | 2512564014 | 2512643021 | 436 |
| 1386 | iso_pu_bacteria | 2643221541 | 2643729421 | 436 |
| 1387 | iso_pu_bacteria | 2643221605 | 2644039139 | 436 |
| 1388 | iso_pu_bacteria | 2643221606 | 2644045897 | 436 |
| 1389 | iso_pu_bacteria | 2643221671 | 2644393474 | 436 |
| 1390 | iso_pu_bacteria | 2775507255 | 2778124311 | 436 |
| 1391 | iso_pu_bacteria | 2919709256 | 2919709946 | 436 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pqc-assembly1.cif.gz_A | cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog | 0.9835 | 2 | 435 |
| 2pqd-assembly1.cif.gz_A | a100g cp4 epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog | 0.9834 | 2 | 435 |
| 3tr1-assembly1.cif.gz_A | structure of a 3-phosphoshikimate 1-carboxyvinyltransferase (aroa) from coxiella burnetii | 0.9776 | 2 | 433 |
| 3slh-assembly3.cif.gz_C | 1.70 angstrom resolution structure of 3-phosphoshikimate 1-carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate | 0.9774 | 2 | 433 |
| 2pqc-assembly1.cif.gz_A | cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog | 0.9768 | 2 | 435 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gg6A02 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.9895 | 19 | 233 | 3.65.10.10 |
| 2gg6A02 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.9849 | 19 | 233 | 3.65.10.10 |
| 2ggaA01 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.9728 | 234 | 435 | 3.65.10.10 |
| 5bufA01 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.9693 | 234 | 434 | 3.65.10.10 |
| af_Q05615_22_211_3.65.10.10 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.957 | 18 | 209 | 3.65.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0E9MP87-F1-model_v4 | 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) | 0.9955 | 1 | 432 |
GO:0003866
GO:0005737 GO:0008652 GO:0009073 GO:0009423 |
| AF-A0A7U4LE28-F1-model_v4 | 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) | 0.9953 | 1 | 432 |
GO:0003866
GO:0005737 GO:0008652 GO:0009073 GO:0009423 |
| AF-A0A529LR22-F1-model_v4 | 3-phosphoshikimate 1-carboxyvinyltransferase | 0.9945 | 196 | 342 |
GO:0003866
GO:0009423 |
| AF-A0A1G7SGL2-F1-model_v4 | 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) | 0.9929 | 2 | 434 |
GO:0003866
GO:0005737 GO:0008652 GO:0009073 GO:0009423 |
| AF-A0A523G0H3-F1-model_v4 | 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) | 0.9927 | 2 | 435 |
GO:0003866
GO:0005737 GO:0008652 GO:0009073 GO:0009423 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar