F493551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1385 | 768 | 1197 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_102753106|Ga0307409_1027531061 |
| Length | 94 |
| Sequence | MPAYWIAHVEVSDEARYGEYAKRAGPAIAAHGGKFLARGGRHVQLEGNDRARNVVVEFPDLASAEACYRSAAYQEALGYAKGASVRDLVVVEGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 17 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 18 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 19 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 20 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 21 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 22 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 23 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 24 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 25 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 26 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 27 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 28 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 29 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 30 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 31 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 32 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 33 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 34 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 35 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 36 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 37 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 38 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 39 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 40 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 41 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 42 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 43 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 44 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 45 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 46 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 47 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 48 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 49 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 50 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 51 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 52 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 53 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 54 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 55 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 56 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 57 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 58 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 59 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 60 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 61 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 62 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 63 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 64 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 65 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 66 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 67 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 68 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 69 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 70 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 71 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 72 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 73 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 74 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 75 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 76 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 77 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 78 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 79 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 80 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 81 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 82 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 83 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 84 | 2904699407 | |||
| 85 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 86 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 87 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 88 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 89 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 90 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 91 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 92 | 2922368715 | |||
| 93 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 94 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 95 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 96 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 97 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 98 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 99 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 100 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 101 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 102 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 103 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 104 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 105 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 106 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 107 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 108 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 109 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 110 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 111 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 112 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 113 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 114 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 115 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 116 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 117 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 118 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 119 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 120 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 121 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 122 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 123 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 124 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 125 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 126 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 127 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 128 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 129 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 130 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 131 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 132 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 133 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 134 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 135 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 136 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 137 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 138 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 139 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 140 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 141 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 142 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 143 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 144 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 145 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 146 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 147 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 148 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 149 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 150 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 151 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 152 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 153 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 154 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 155 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 156 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 157 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 158 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 159 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 160 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 161 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 162 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 163 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 164 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 165 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 166 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 167 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 168 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 169 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 170 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 171 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 172 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 173 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 174 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 175 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 176 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 177 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 178 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 179 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 180 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 181 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 182 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 183 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 184 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 185 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 186 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 187 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 188 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 189 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 190 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 191 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 192 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 196 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 199 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 201 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 203 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 205 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 206 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 207 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 209 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 216 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 220 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 222 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 224 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 226 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 227 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 232 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 233 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 234 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 235 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 236 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 237 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 238 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 239 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 241 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 242 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 246 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 247 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 249 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 250 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 251 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 253 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 254 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 255 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 256 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 257 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 258 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 259 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 260 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 261 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 262 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 263 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 264 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 265 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 266 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 268 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 269 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 270 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 271 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 272 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 273 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 274 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 275 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 276 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 277 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 278 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 280 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 281 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 282 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 283 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 284 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 285 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 286 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 287 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 289 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 290 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 291 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 292 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 293 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 294 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 299 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 304 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 307 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 311 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 312 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 313 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 316 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 317 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 318 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 325 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 326 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 329 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 330 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 331 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 332 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 333 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 334 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 335 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 336 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 337 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 338 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 339 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 340 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 341 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 342 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 343 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 345 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 346 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 348 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 350 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 351 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 421 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 422 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 423 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 424 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 439 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 441 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 445 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 446 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 448 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 449 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 450 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 451 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 452 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 453 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 454 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 455 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 456 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 457 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 458 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 459 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 460 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 461 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 462 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 463 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 464 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 465 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 466 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 467 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 468 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 469 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 470 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 471 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 472 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 473 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 474 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 475 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 476 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 477 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 478 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 479 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 480 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 481 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 482 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 483 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 484 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 485 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 486 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 487 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 488 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 489 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 490 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 491 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 492 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 493 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 494 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 495 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 496 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 497 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 498 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 499 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 500 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 501 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 502 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 503 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 504 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 505 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 506 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 507 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 508 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 509 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 510 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 511 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 512 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 513 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 514 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 515 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 516 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 517 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 518 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 519 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 520 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 521 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 522 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 523 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 524 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 525 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 526 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 527 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 528 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 529 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 530 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 531 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 532 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 533 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 534 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 535 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 536 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 537 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 538 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 625 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 626 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 627 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 628 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 629 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 630 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 631 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 632 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 633 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 634 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 635 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 636 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 637 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 638 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 639 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 640 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 641 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 642 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 643 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 644 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 645 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 646 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 647 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 649 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 650 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 651 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 652 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 653 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 654 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 655 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 656 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 657 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 658 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 659 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 660 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 661 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 662 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 663 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 664 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 665 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 666 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 667 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 668 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 669 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 670 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 671 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 672 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 673 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 674 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 675 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 676 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 677 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 678 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 679 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 680 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 681 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 682 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 683 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 684 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 685 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 686 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 687 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 688 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 689 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 692 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 694 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 695 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 696 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 697 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 698 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 699 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 700 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 701 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 702 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 703 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 704 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 705 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 706 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 707 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 708 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 709 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 710 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 711 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 712 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 713 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 714 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 715 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 716 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 717 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 718 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 719 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 720 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 721 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 722 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 723 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 724 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 725 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 726 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 727 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 728 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 729 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 730 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 731 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 732 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 733 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 734 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 735 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 736 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 737 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 738 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 739 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 740 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 741 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 742 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 743 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 744 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 745 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 746 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 747 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 748 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 749 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 750 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 751 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 752 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 753 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 754 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 755 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 756 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 757 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 758 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 759 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 760 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 761 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 762 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 763 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 764 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 765 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 766 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 767 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 768 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.26 |
| Metatranscriptomes | 0.29 |
| Isolates | 13.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.61 |
| Nodule | 11.41 |
| Rhizoplane | 4.69 |
| Rhizosphere | 66.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C1608 | 2010549000 | Bacteria | 1195 |
| 2 | RicEn_FSXC2379_b1 | 2010549000 | Bacteria | 794 |
| 3 | JGI24032J14994_100498 | 3300001430 | Bacteria | 2057 |
| 4 | JGI24736J21556_1030537 | 3300001904 | Bacteria | 833 |
| 5 | JGI24741J21665_1022626 | 3300001915 | Bacteria | 974 |
| 6 | JGI24752J21851_1058508 | 3300001976 | Bacteria | 530 |
| 7 | JGI24746J21847_1000164 | 3300001977 | Bacteria | 8612 |
| 8 | JGI24747J21853_1000867 | 3300001978 | Bacteria | 2082 |
| 9 | JGI24740J21852_10021616 | 3300001979 | Bacteria | 2227 |
| 10 | JGI24739J22299_10000152 | 3300001989 | Bacteria | 22301 |
| 11 | JGI24739J22299_10036217 | 3300001989 | Bacteria | 1668 |
| 12 | JGI24737J22298_10002832 | 3300001990 | Bacteria | 6144 |
| 13 | JGI24737J22298_10003593 | 3300001990 | Bacteria | 5467 |
| 14 | JGI24737J22298_10004593 | 3300001990 | Bacteria | 4804 |
| 15 | JGI24743J22301_10036218 | 3300001991 | Bacteria | 982 |
| 16 | JGI24750J21931_1000497 | 3300002070 | Bacteria | 6166 |
| 17 | JGI24750J21931_1000592 | 3300002070 | Bacteria | 5515 |
| 18 | JGI24750J21931_1007504 | 3300002070 | Bacteria | 1373 |
| 19 | JGI24745J21846_1000135 | 3300002073 | Bacteria | 5648 |
| 20 | JGI24748J21848_1000406 | 3300002074 | Bacteria | 4840 |
| 21 | JGI24738J21930_10000005 | 3300002075 | Bacteria | 42207 |
| 22 | JGI24749J21850_1000199 | 3300002076 | Bacteria | 9677 |
| 23 | JGI24744J21845_10000538 | 3300002077 | Bacteria | 6792 |
| 24 | JGI24035J26624_1000104 | 3300002126 | Bacteria | 7174 |
| 25 | JGI24033J26618_1002293 | 3300002155 | Bacteria | 1946 |
| 26 | JGI24034J26672_10016367 | 3300002239 | Bacteria | 1142 |
| 27 | JGI24742J22300_10000102 | 3300002244 | Bacteria | 12525 |
| 28 | JGI24742J22300_10000282 | 3300002244 | Bacteria | 7682 |
| 29 | JGI24751J29686_10007280 | 3300002459 | Bacteria | 2260 |
| 30 | JGI25406J46586_10011591 | 3300003203 | Bacteria | 3862 |
| 31 | JGI25165J46597_1008157 | 3300003214 | Bacteria | 1668 |
| 32 | JGI25160J50197_1001122 | 3300003354 | Bacteria | 13673 |
| 33 | JGI25160J50197_1020925 | 3300003354 | Bacteria | 1959 |
| 34 | JGI25160J50197_1078087 | 3300003354 | Bacteria | 619 |
| 35 | JGI26145J50221_1006209 | 3300003371 | Bacteria | 997 |
| 36 | JGI25404J52841_10006995 | 3300003659 | Bacteria | 2374 |
| 37 | JGI25404J52841_10012821 | 3300003659 | Bacteria | 1818 |
| 38 | JGI25404J52841_10018798 | 3300003659 | Bacteria | 1498 |
| 39 | JGI25404J52841_10094693 | 3300003659 | Bacteria | 625 |
| 40 | Ga0055526_1091498 | 3300003771 | Bacteria | 573 |
| 41 | Ga0055524_1057430 | 3300003775 | Bacteria | 831 |
| 42 | Ga0055531_10011202 | 3300003794 | Bacteria | 4358 |
| 43 | JGI25405J52794_10062438 | 3300003911 | Bacteria | 807 |
| 44 | JGI25405J52794_10096839 | 3300003911 | Bacteria | 656 |
| 45 | Ga0055543_1029757 | 3300004625 | Bacteria | 958 |
| 46 | Ga0065165_1009364 | 3300005262 | Bacteria | 4404 |
| 47 | Ga0065165_1021770 | 3300005262 | Bacteria | 2216 |
| 48 | Ga0065165_1023472 | 3300005262 | Bacteria | 2091 |
| 49 | Ga0065165_1136923 | 3300005262 | Bacteria | 581 |
| 50 | Ga0065712_10008945 | 3300005290 | Bacteria | 2400 |
| 51 | Ga0065712_10070038 | 3300005290 | Bacteria | 6388 |
| 52 | Ga0065712_10076486 | 3300005290 | Bacteria | 3645 |
| 53 | Ga0065715_10001162 | 3300005293 | Bacteria | 6917 |
| 54 | Ga0065715_10935511 | 3300005293 | Bacteria | 564 |
| 55 | Ga0070658_10071251 | 3300005327 | Bacteria | 2847 |
| 56 | Ga0070676_10000789 | 3300005328 | Bacteria | 15625 |
| 57 | Ga0070676_10386244 | 3300005328 | Bacteria | 971 |
| 58 | Ga0070683_100000345 | 3300005329 | Bacteria | 31885 |
| 59 | Ga0070683_100187827 | 3300005329 | Bacteria | 1962 |
| 60 | Ga0070683_101304579 | 3300005329 | Bacteria | 698 |
| 61 | Ga0070690_100007432 | 3300005330 | Bacteria | 6278 |
| 62 | Ga0070690_100204002 | 3300005330 | Bacteria | 1377 |
| 63 | Ga0070670_100013204 | 3300005331 | Bacteria | 7076 |
| 64 | Ga0070670_100238088 | 3300005331 | Bacteria | 1584 |
| 65 | Ga0070670_100278346 | 3300005331 | Bacteria | 1461 |
| 66 | Ga0070670_101129682 | 3300005331 | Bacteria | 715 |
| 67 | Ga0070677_10000389 | 3300005333 | Bacteria | 15407 |
| 68 | Ga0068869_100001864 | 3300005334 | Bacteria | 12681 |
| 69 | Ga0070666_10111076 | 3300005335 | Bacteria | 1896 |
| 70 | Ga0070680_100005473 | 3300005336 | Bacteria | 9607 |
| 71 | Ga0070680_100041530 | 3300005336 | Bacteria | 3729 |
| 72 | Ga0070680_100057667 | 3300005336 | Bacteria | 3175 |
| 73 | Ga0070680_101318137 | 3300005336 | Bacteria | 625 |
| 74 | Ga0070682_100000458 | 3300005337 | Bacteria | 25727 |
| 75 | Ga0070682_100059840 | 3300005337 | Bacteria | 2407 |
| 76 | Ga0070682_100218834 | 3300005337 | Bacteria | 1354 |
| 77 | Ga0070682_100324082 | 3300005337 | Bacteria | 1139 |
| 78 | Ga0068868_100000376 | 3300005338 | Bacteria | 30404 |
| 79 | Ga0068868_100420776 | 3300005338 | Bacteria | 1157 |
| 80 | Ga0070660_100001420 | 3300005339 | Bacteria | 16311 |
| 81 | Ga0070660_100046112 | 3300005339 | Bacteria | 3339 |
| 82 | Ga0070660_100139446 | 3300005339 | Bacteria | 1944 |
| 83 | Ga0070660_100693540 | 3300005339 | Bacteria | 853 |
| 84 | Ga0070689_100001572 | 3300005340 | Bacteria | 14570 |
| 85 | Ga0070689_100071627 | 3300005340 | Bacteria | 2708 |
| 86 | Ga0070689_100529671 | 3300005340 | Bacteria | 1013 |
| 87 | Ga0070689_100665220 | 3300005340 | Bacteria | 907 |
| 88 | Ga0070691_10000417 | 3300005341 | Bacteria | 15597 |
| 89 | Ga0070691_10780900 | 3300005341 | Bacteria | 580 |
| 90 | Ga0070687_100002155 | 3300005343 | Bacteria | 7281 |
| 91 | Ga0070687_100058408 | 3300005343 | Bacteria | 2026 |
| 92 | Ga0070687_101158899 | 3300005343 | Bacteria | 568 |
| 93 | Ga0070661_100001708 | 3300005344 | Bacteria | 15225 |
| 94 | Ga0070661_100133110 | 3300005344 | Bacteria | 1869 |
| 95 | Ga0070661_100257876 | 3300005344 | Bacteria | 1347 |
| 96 | Ga0070661_100339178 | 3300005344 | Bacteria | 1177 |
| 97 | Ga0070692_10000078 | 3300005345 | Bacteria | 20284 |
| 98 | Ga0070692_10009194 | 3300005345 | Bacteria | 4445 |
| 99 | Ga0070668_100001228 | 3300005347 | Bacteria | 18229 |
| 100 | Ga0070668_100010386 | 3300005347 | Bacteria | 6917 |
| 101 | Ga0070669_100000873 | 3300005353 | Bacteria | 21980 |
| 102 | Ga0070669_100047333 | 3300005353 | Bacteria | 3137 |
| 103 | Ga0070669_100115177 | 3300005353 | Bacteria | 2044 |
| 104 | Ga0070669_100322880 | 3300005353 | Bacteria | 1247 |
| 105 | Ga0070675_100014644 | 3300005354 | Bacteria | 6185 |
| 106 | Ga0070675_100033712 | 3300005354 | Bacteria | 4152 |
| 107 | Ga0070675_101108095 | 3300005354 | Bacteria | 728 |
| 108 | Ga0070675_101300371 | 3300005354 | Bacteria | 670 |
| 109 | Ga0070671_100000318 | 3300005355 | Bacteria | 32840 |
| 110 | Ga0070671_100097880 | 3300005355 | Bacteria | 2460 |
| 111 | Ga0070674_100001672 | 3300005356 | Bacteria | 11985 |
| 112 | Ga0070674_100391470 | 3300005356 | Bacteria | 1133 |
| 113 | Ga0070673_100002621 | 3300005364 | Bacteria | 10996 |
| 114 | Ga0070673_102187560 | 3300005364 | Bacteria | 526 |
| 115 | Ga0070688_100001932 | 3300005365 | Bacteria | 10409 |
| 116 | Ga0070688_100032747 | 3300005365 | Bacteria | 3137 |
| 117 | Ga0070659_100001601 | 3300005366 | Bacteria | 16297 |
| 118 | Ga0070659_100201725 | 3300005366 | Bacteria | 1638 |
| 119 | Ga0070659_100962930 | 3300005366 | Bacteria | 748 |
| 120 | Ga0070667_100012018 | 3300005367 | Bacteria | 7168 |
| 121 | Ga0070667_100094662 | 3300005367 | Bacteria | 2574 |
| 122 | Ga0070667_100095483 | 3300005367 | Bacteria | 2563 |
| 123 | Ga0070667_100830490 | 3300005367 | Bacteria | 859 |
| 124 | Ga0070703_10009498 | 3300005406 | Bacteria | 2743 |
| 125 | Ga0070703_10053704 | 3300005406 | Bacteria | 1297 |
| 126 | Ga0070709_10216548 | 3300005434 | Bacteria | 1364 |
| 127 | Ga0070709_11194481 | 3300005434 | Bacteria | 611 |
| 128 | Ga0070714_100404021 | 3300005435 | Bacteria | 1292 |
| 129 | Ga0070714_100813678 | 3300005435 | Bacteria | 905 |
| 130 | Ga0070714_102037223 | 3300005435 | Bacteria | 560 |
| 131 | Ga0070714_102105439 | 3300005435 | Bacteria | 550 |
| 132 | Ga0070713_100978402 | 3300005436 | Bacteria | 816 |
| 133 | Ga0070713_101116947 | 3300005436 | Bacteria | 762 |
| 134 | Ga0070710_10014694 | 3300005437 | Bacteria | 3945 |
| 135 | Ga0070701_10000388 | 3300005438 | Bacteria | 14825 |
| 136 | Ga0070705_100050569 | 3300005440 | Bacteria | 2418 |
| 137 | Ga0070705_100904128 | 3300005440 | Bacteria | 710 |
| 138 | Ga0070700_100000409 | 3300005441 | Bacteria | 21951 |
| 139 | Ga0070694_100000312 | 3300005444 | Bacteria | 26105 |
| 140 | Ga0070694_100018197 | 3300005444 | Bacteria | 4457 |
| 141 | Ga0070708_100008294 | 3300005445 | Bacteria | 8342 |
| 142 | Ga0070663_100003029 | 3300005455 | Bacteria | 9597 |
| 143 | Ga0070663_100149893 | 3300005455 | Bacteria | 1788 |
| 144 | Ga0070663_101596343 | 3300005455 | Bacteria | 581 |
| 145 | Ga0070663_102069294 | 3300005455 | Bacteria | 513 |
| 146 | Ga0070678_100000673 | 3300005456 | Bacteria | 16791 |
| 147 | Ga0070678_100571669 | 3300005456 | Bacteria | 1006 |
| 148 | Ga0070678_101085359 | 3300005456 | Bacteria | 739 |
| 149 | Ga0070662_100011704 | 3300005457 | Bacteria | 5791 |
| 150 | Ga0070662_100019810 | 3300005457 | Bacteria | 4574 |
| 151 | Ga0070662_100231254 | 3300005457 | Bacteria | 1479 |
| 152 | Ga0070681_10001501 | 3300005458 | Bacteria | 20642 |
| 153 | Ga0070681_10075545 | 3300005458 | Bacteria | 3329 |
| 154 | Ga0070681_10300250 | 3300005458 | Bacteria | 1516 |
| 155 | Ga0070681_11721812 | 3300005458 | Bacteria | 553 |
| 156 | Ga0068867_100002561 | 3300005459 | Bacteria | 12815 |
| 157 | Ga0070685_10031691 | 3300005466 | Bacteria | 2956 |
| 158 | Ga0070685_10109412 | 3300005466 | Bacteria | 1700 |
| 159 | Ga0070685_10176548 | 3300005466 | Bacteria | 1372 |
| 160 | Ga0070706_101694545 | 3300005467 | Bacteria | 576 |
| 161 | Ga0070707_100905260 | 3300005468 | Bacteria | 847 |
| 162 | Ga0070679_100013134 | 3300005530 | Bacteria | 7928 |
| 163 | Ga0070679_100083369 | 3300005530 | Bacteria | 3185 |
| 164 | Ga0070679_100235744 | 3300005530 | Bacteria | 1789 |
| 165 | Ga0070684_100004125 | 3300005535 | Bacteria | 10996 |
| 166 | Ga0070684_100189935 | 3300005535 | Bacteria | 1869 |
| 167 | Ga0070684_100236315 | 3300005535 | Bacteria | 1669 |
| 168 | Ga0070684_100314538 | 3300005535 | Bacteria | 1438 |
| 169 | Ga0070684_101560474 | 3300005535 | Bacteria | 622 |
| 170 | Ga0068853_100013239 | 3300005539 | Bacteria | 6732 |
| 171 | Ga0068853_100199229 | 3300005539 | Bacteria | 1822 |
| 172 | Ga0068853_100328659 | 3300005539 | Bacteria | 1418 |
| 173 | Ga0070672_100005118 | 3300005543 | Bacteria | 8651 |
| 174 | Ga0070672_100384903 | 3300005543 | Bacteria | 1200 |
| 175 | Ga0070672_100419171 | 3300005543 | Bacteria | 1150 |
| 176 | Ga0070686_100005340 | 3300005544 | Bacteria | 7107 |
| 177 | Ga0070686_100007239 | 3300005544 | Bacteria | 6182 |
| 178 | Ga0070686_100736735 | 3300005544 | Bacteria | 789 |
| 179 | Ga0070695_100001168 | 3300005545 | Bacteria | 14419 |
| 180 | Ga0070695_100008421 | 3300005545 | Bacteria | 6123 |
| 181 | Ga0070696_100028030 | 3300005546 | Bacteria | 3841 |
| 182 | Ga0070696_100182007 | 3300005546 | Bacteria | 1559 |
| 183 | Ga0070696_101093909 | 3300005546 | Bacteria | 670 |
| 184 | Ga0070696_101548196 | 3300005546 | Unclassified | 568 |
| 185 | Ga0070693_100002738 | 3300005547 | Bacteria | 8120 |
| 186 | Ga0070693_100143814 | 3300005547 | Bacteria | 1504 |
| 187 | Ga0070665_100024095 | 3300005548 | Bacteria | 6128 |
| 188 | Ga0070665_100073736 | 3300005548 | Bacteria | 3419 |
| 189 | Ga0070665_100258812 | 3300005548 | Bacteria | 1741 |
| 190 | Ga0070665_100674196 | 3300005548 | Bacteria | 1047 |
| 191 | Ga0070665_100990875 | 3300005548 | Bacteria | 853 |
| 192 | Ga0070665_102120303 | 3300005548 | Bacteria | 566 |
| 193 | Ga0070665_102600922 | 3300005548 | Bacteria | 507 |
| 194 | Ga0070704_100002142 | 3300005549 | Bacteria | 10996 |
| 195 | Ga0070704_100012760 | 3300005549 | Bacteria | 5197 |
| 196 | Ga0068855_100032409 | 3300005563 | Bacteria | 6240 |
| 197 | Ga0068855_100795644 | 3300005563 | Bacteria | 1005 |
| 198 | Ga0070664_100002197 | 3300005564 | Bacteria | 15671 |
| 199 | Ga0070664_100090718 | 3300005564 | Bacteria | 2645 |
| 200 | Ga0070664_100192491 | 3300005564 | Bacteria | 1817 |
| 201 | Ga0070664_100297517 | 3300005564 | Bacteria | 1458 |
| 202 | Ga0070664_100474545 | 3300005564 | Bacteria | 1151 |
| 203 | Ga0068857_100000914 | 3300005577 | Bacteria | 22274 |
| 204 | Ga0068857_100385717 | 3300005577 | Bacteria | 1302 |
| 205 | Ga0068854_100002267 | 3300005578 | Bacteria | 11836 |
| 206 | Ga0068854_100164147 | 3300005578 | Bacteria | 1723 |
| 207 | Ga0068854_100224413 | 3300005578 | Bacteria | 1488 |
| 208 | Ga0068856_100007024 | 3300005614 | Bacteria | 10998 |
| 209 | Ga0068856_100129914 | 3300005614 | Bacteria | 2524 |
| 210 | Ga0068856_100176210 | 3300005614 | Bacteria | 2151 |
| 211 | Ga0068856_100216043 | 3300005614 | Bacteria | 1933 |
| 212 | Ga0070702_100000793 | 3300005615 | Bacteria | 12038 |
| 213 | Ga0070702_100611363 | 3300005615 | Bacteria | 819 |
| 214 | Ga0068852_100001040 | 3300005616 | Bacteria | 18256 |
| 215 | Ga0068852_100019926 | 3300005616 | Bacteria | 5323 |
| 216 | Ga0068852_100281520 | 3300005616 | Bacteria | 1603 |
| 217 | Ga0068852_100560263 | 3300005616 | Bacteria | 1144 |
| 218 | Ga0068852_100596253 | 3300005616 | Bacteria | 1109 |
| 219 | Ga0068852_101590085 | 3300005616 | Bacteria | 676 |
| 220 | Ga0068859_100023516 | 3300005617 | Bacteria | 6183 |
| 221 | Ga0068859_100030436 | 3300005617 | Bacteria | 5416 |
| 222 | Ga0068864_100001093 | 3300005618 | Bacteria | 22722 |
| 223 | Ga0068864_100551765 | 3300005618 | Bacteria | 1114 |
| 224 | Ga0068864_102529688 | 3300005618 | Bacteria | 519 |
| 225 | Ga0068866_10000678 | 3300005718 | Bacteria | 15464 |
| 226 | Ga0068861_100008814 | 3300005719 | Bacteria | 6947 |
| 227 | Ga0068861_100154224 | 3300005719 | Bacteria | 1888 |
| 228 | Ga0068861_100441800 | 3300005719 | Bacteria | 1164 |
| 229 | Ga0068861_100964657 | 3300005719 | Bacteria | 812 |
| 230 | Ga0068870_10000128 | 3300005840 | Bacteria | 26100 |
| 231 | Ga0068863_100006135 | 3300005841 | Bacteria | 11786 |
| 232 | Ga0068858_100007003 | 3300005842 | Bacteria | 10954 |
| 233 | Ga0068858_100245972 | 3300005842 | Bacteria | 1698 |
| 234 | Ga0068858_100581234 | 3300005842 | Bacteria | 1086 |
| 235 | Ga0068858_100734336 | 3300005842 | Bacteria | 961 |
| 236 | Ga0068858_102352298 | 3300005842 | Bacteria | 527 |
| 237 | Ga0068860_100009283 | 3300005843 | Bacteria | 9773 |
| 238 | Ga0068860_100068439 | 3300005843 | Bacteria | 3373 |
| 239 | Ga0068860_100958438 | 3300005843 | Bacteria | 873 |
| 240 | Ga0068862_100016288 | 3300005844 | Bacteria | 6185 |
| 241 | Ga0068862_100017378 | 3300005844 | Bacteria | 5990 |
| 242 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 243 | Ga0081455_10010596 | 3300005937 | Bacteria | 9328 |
| 244 | Ga0081455_10018872 | 3300005937 | Bacteria | 6544 |
| 245 | Ga0081455_10030798 | 3300005937 | Bacteria | 4868 |
| 246 | Ga0081455_10065070 | 3300005937 | Bacteria | 3051 |
| 247 | Ga0081455_10081865 | 3300005937 | Bacteria | 2643 |
| 248 | Ga0081455_10380821 | 3300005937 | Bacteria | 985 |
| 249 | Ga0081538_10011886 | 3300005981 | Bacteria | 7027 |
| 250 | Ga0081540_1002951 | 3300005983 | Bacteria | 13661 |
| 251 | Ga0081540_1003344 | 3300005983 | Bacteria | 12715 |
| 252 | Ga0081540_1008907 | 3300005983 | Bacteria | 6957 |
| 253 | Ga0081540_1009850 | 3300005983 | Bacteria | 6535 |
| 254 | Ga0081540_1012850 | 3300005983 | Bacteria | 5476 |
| 255 | Ga0081540_1080929 | 3300005983 | Bacteria | 1462 |
| 256 | Ga0081540_1216532 | 3300005983 | Bacteria | 684 |
| 257 | Ga0081539_10002161 | 3300005985 | Bacteria | 28946 |
| 258 | Ga0081539_10002854 | 3300005985 | Bacteria | 22994 |
| 259 | Ga0081539_10052381 | 3300005985 | Bacteria | 2293 |
| 260 | Ga0081539_10305745 | 3300005985 | Bacteria | 682 |
| 261 | Ga0070717_10050719 | 3300006028 | Bacteria | 3412 |
| 262 | Ga0070717_10052545 | 3300006028 | Bacteria | 3357 |
| 263 | Ga0075365_10088472 | 3300006038 | Bacteria | 2107 |
| 264 | Ga0075365_10632495 | 3300006038 | Bacteria | 756 |
| 265 | Ga0075365_10938966 | 3300006038 | Bacteria | 610 |
| 266 | Ga0075368_10012526 | 3300006042 | Bacteria | 3102 |
| 267 | Ga0075368_10336959 | 3300006042 | Bacteria | 655 |
| 268 | Ga0075368_10437985 | 3300006042 | Bacteria | 578 |
| 269 | Ga0075363_100067838 | 3300006048 | Bacteria | 1933 |
| 270 | Ga0075363_100188469 | 3300006048 | Bacteria | 1176 |
| 271 | Ga0075363_100188948 | 3300006048 | Bacteria | 1174 |
| 272 | Ga0075363_100504016 | 3300006048 | Bacteria | 719 |
| 273 | Ga0075364_10078336 | 3300006051 | Bacteria | 2183 |
| 274 | Ga0075364_10462832 | 3300006051 | Bacteria | 866 |
| 275 | Ga0075364_10484450 | 3300006051 | Bacteria | 845 |
| 276 | Ga0070715_10149141 | 3300006163 | Bacteria | 1144 |
| 277 | Ga0070716_101640461 | 3300006173 | Bacteria | 529 |
| 278 | Ga0070712_100263900 | 3300006175 | Bacteria | 1381 |
| 279 | Ga0075362_10202488 | 3300006177 | Bacteria | 966 |
| 280 | Ga0075367_10096618 | 3300006178 | Bacteria | 1802 |
| 281 | Ga0075367_10115630 | 3300006178 | Bacteria | 1649 |
| 282 | Ga0075367_10578463 | 3300006178 | Bacteria | 713 |
| 283 | Ga0075367_10589226 | 3300006178 | Bacteria | 706 |
| 284 | Ga0075367_10601054 | 3300006178 | Bacteria | 699 |
| 285 | Ga0075367_10607986 | 3300006178 | Bacteria | 695 |
| 286 | Ga0075369_10079883 | 3300006186 | Bacteria | 1449 |
| 287 | Ga0075369_10110706 | 3300006186 | Bacteria | 1237 |
| 288 | Ga0075369_10120497 | 3300006186 | Bacteria | 1187 |
| 289 | Ga0075366_10021740 | 3300006195 | Bacteria | 3730 |
| 290 | Ga0075366_10356187 | 3300006195 | Bacteria | 898 |
| 291 | Ga0075366_10767014 | 3300006195 | Bacteria | 599 |
| 292 | Ga0097621_100000012 | 3300006237 | Bacteria | 105108 |
| 293 | Ga0097621_100500282 | 3300006237 | Bacteria | 1101 |
| 294 | Ga0097621_100551898 | 3300006237 | Bacteria | 1049 |
| 295 | Ga0075370_10057807 | 3300006353 | Bacteria | 2205 |
| 296 | Ga0075370_10071042 | 3300006353 | Bacteria | 1991 |
| 297 | Ga0075370_10146723 | 3300006353 | Bacteria | 1381 |
| 298 | Ga0068871_100000414 | 3300006358 | Bacteria | 29494 |
| 299 | Ga0068871_101755095 | 3300006358 | Bacteria | 589 |
| 300 | Ga0075428_100810322 | 3300006844 | Bacteria | 995 |
| 301 | Ga0075430_101614740 | 3300006846 | Bacteria | 532 |
| 302 | Ga0075433_10018274 | 3300006852 | Bacteria | 5823 |
| 303 | Ga0075434_100001246 | 3300006871 | Bacteria | 21184 |
| 304 | Ga0075434_100545932 | 3300006871 | Bacteria | 1179 |
| 305 | Ga0068865_100000908 | 3300006881 | Bacteria | 16791 |
| 306 | Ga0068865_100108699 | 3300006881 | Bacteria | 2042 |
| 307 | Ga0075436_100693543 | 3300006914 | Bacteria | 754 |
| 308 | Ga0097620_100023517 | 3300006931 | Bacteria | 6183 |
| 309 | Ga0097620_100030437 | 3300006931 | Bacteria | 5416 |
| 310 | Ga0097620_100933804 | 3300006931 | Bacteria | 951 |
| 311 | Ga0099825_1027887 | 3300006941 | Bacteria | 2819 |
| 312 | Ga0099824_1009581 | 3300006942 | Bacteria | 11847 |
| 313 | Ga0099824_1033850 | 3300006942 | Bacteria | 1692 |
| 314 | Ga0099822_1000911 | 3300006943 | Bacteria | 31714 |
| 315 | Ga0099822_1041384 | 3300006943 | Bacteria | 2488 |
| 316 | Ga0099823_1012311 | 3300006944 | Bacteria | 8653 |
| 317 | Ga0075435_100099129 | 3300007076 | Bacteria | 2413 |
| 318 | Ga0075435_100300148 | 3300007076 | Bacteria | 1374 |
| 319 | Ga0099794_10313305 | 3300007265 | Bacteria | 813 |
| 320 | Ga0105251_10153201 | 3300009011 | Bacteria | 1040 |
| 321 | Ga0105250_10017271 | 3300009092 | Bacteria | 2934 |
| 322 | Ga0105250_10122121 | 3300009092 | Bacteria | 1071 |
| 323 | Ga0105240_10006733 | 3300009093 | Bacteria | 16828 |
| 324 | Ga0105240_10021715 | 3300009093 | Bacteria | 8533 |
| 325 | Ga0105240_10105946 | 3300009093 | Bacteria | 3412 |
| 326 | Ga0105240_10830924 | 3300009093 | Bacteria | 999 |
| 327 | Ga0111539_10007702 | 3300009094 | Bacteria | 13753 |
| 328 | Ga0111539_10069230 | 3300009094 | Bacteria | 4167 |
| 329 | Ga0111539_12038065 | 3300009094 | Bacteria | 666 |
| 330 | Ga0105245_10000090 | 3300009098 | Bacteria | 90378 |
| 331 | Ga0105245_10129919 | 3300009098 | Bacteria | 2362 |
| 332 | Ga0105245_10206389 | 3300009098 | Bacteria | 1889 |
| 333 | Ga0105245_10338097 | 3300009098 | Bacteria | 1488 |
| 334 | Ga0105245_11543743 | 3300009098 | Bacteria | 715 |
| 335 | Ga0105247_10003459 | 3300009101 | Bacteria | 10293 |
| 336 | Ga0105247_10019467 | 3300009101 | Bacteria | 4075 |
| 337 | Ga0105247_10040318 | 3300009101 | Bacteria | 2854 |
| 338 | Ga0105247_10690922 | 3300009101 | Bacteria | 767 |
| 339 | Ga0114129_11073010 | 3300009147 | Bacteria | 1010 |
| 340 | Ga0105243_10002504 | 3300009148 | Bacteria | 15327 |
| 341 | Ga0105243_10129090 | 3300009148 | Bacteria | 2142 |
| 342 | Ga0105243_10158299 | 3300009148 | Bacteria | 1950 |
| 343 | Ga0105241_10000475 | 3300009174 | Bacteria | 30331 |
| 344 | Ga0105241_10041983 | 3300009174 | Bacteria | 3458 |
| 345 | Ga0105241_10303676 | 3300009174 | Bacteria | 1370 |
| 346 | Ga0105242_10001283 | 3300009176 | Bacteria | 19844 |
| 347 | Ga0105248_10003064 | 3300009177 | Bacteria | 18528 |
| 348 | Ga0105248_10004418 | 3300009177 | Bacteria | 15562 |
| 349 | Ga0105248_10094136 | 3300009177 | Bacteria | 3374 |
| 350 | Ga0105237_10002267 | 3300009545 | Bacteria | 23930 |
| 351 | Ga0105237_10066313 | 3300009545 | Bacteria | 3605 |
| 352 | Ga0105237_10080045 | 3300009545 | Bacteria | 3257 |
| 353 | Ga0105237_10303800 | 3300009545 | Bacteria | 1599 |
| 354 | Ga0105237_10610498 | 3300009545 | Bacteria | 1098 |
| 355 | Ga0105237_11326812 | 3300009545 | Bacteria | 726 |
| 356 | Ga0105238_10041820 | 3300009551 | Bacteria | 4642 |
| 357 | Ga0105238_10384723 | 3300009551 | Bacteria | 1395 |
| 358 | Ga0105238_10437279 | 3300009551 | Bacteria | 1304 |
| 359 | Ga0105238_10545617 | 3300009551 | Bacteria | 1163 |
| 360 | Ga0105238_11268903 | 3300009551 | Bacteria | 762 |
| 361 | Ga0105249_10001598 | 3300009553 | Bacteria | 19845 |
| 362 | Ga0105249_10006092 | 3300009553 | Bacteria | 10456 |
| 363 | Ga0105249_10617523 | 3300009553 | Bacteria | 1140 |
| 364 | Ga0105249_11533539 | 3300009553 | Bacteria | 739 |
| 365 | Ga0105239_10018565 | 3300010375 | Bacteria | 7683 |
| 366 | Ga0105239_10036649 | 3300010375 | Bacteria | 5383 |
| 367 | Ga0105239_10040255 | 3300010375 | Bacteria | 5121 |
| 368 | Ga0105239_10119145 | 3300010375 | Bacteria | 2929 |
| 369 | Ga0105239_10167699 | 3300010375 | Bacteria | 2455 |
| 370 | Ga0105239_10502229 | 3300010375 | Bacteria | 1379 |
| 371 | Ga0105239_13564552 | 3300010375 | Bacteria | 506 |
| 372 | Ga0105246_10000263 | 3300011119 | Bacteria | 27266 |
| 373 | Ga0105246_11461355 | 3300011119 | Bacteria | 640 |
| 374 | Ga0157340_1009937 | 3300012473 | Bacteria | 662 |
| 375 | Ga0157344_1025724 | 3300012476 | Bacteria | 536 |
| 376 | Ga0157314_1001161 | 3300012500 | Bacteria | 1955 |
| 377 | Ga0157373_10161320 | 3300013100 | Bacteria | 1577 |
| 378 | Ga0157371_10051992 | 3300013102 | Bacteria | 2910 |
| 379 | Ga0157370_10248202 | 3300013104 | Bacteria | 1646 |
| 380 | Ga0157370_10347519 | 3300013104 | Bacteria | 1367 |
| 381 | Ga0157369_10093465 | 3300013105 | Bacteria | 3210 |
| 382 | Ga0157369_10809520 | 3300013105 | Bacteria | 962 |
| 383 | Ga0157369_11526521 | 3300013105 | Bacteria | 679 |
| 384 | Ga0157369_11679706 | 3300013105 | Bacteria | 645 |
| 385 | Ga0157369_12671230 | 3300013105 | Bacteria | 503 |
| 386 | Ga0157374_10001375 | 3300013296 | Bacteria | 20675 |
| 387 | Ga0157374_10291518 | 3300013296 | Bacteria | 1613 |
| 388 | Ga0157374_11180448 | 3300013296 | Bacteria | 787 |
| 389 | Ga0157378_10002550 | 3300013297 | Bacteria | 16210 |
| 390 | Ga0157378_10014596 | 3300013297 | Bacteria | 6877 |
| 391 | Ga0157378_13074281 | 3300013297 | Bacteria | 518 |
| 392 | Ga0163162_10003792 | 3300013306 | Bacteria | 14496 |
| 393 | Ga0163162_10482238 | 3300013306 | Bacteria | 1371 |
| 394 | Ga0157372_10002994 | 3300013307 | Bacteria | 18215 |
| 395 | Ga0157372_10308235 | 3300013307 | Bacteria | 1842 |
| 396 | Ga0157372_12753305 | 3300013307 | Bacteria | 564 |
| 397 | Ga0157372_12788277 | 3300013307 | Bacteria | 560 |
| 398 | Ga0157375_10002382 | 3300013308 | Bacteria | 16270 |
| 399 | Ga0157375_10276078 | 3300013308 | Bacteria | 1843 |
| 400 | Ga0157375_12056920 | 3300013308 | Bacteria | 679 |
| 401 | Ga0163163_10005972 | 3300014325 | Bacteria | 10590 |
| 402 | Ga0163163_10012135 | 3300014325 | Bacteria | 7840 |
| 403 | Ga0163163_11171980 | 3300014325 | Bacteria | 831 |
| 404 | Ga0157380_10000334 | 3300014326 | Bacteria | 28309 |
| 405 | Ga0157380_10493558 | 3300014326 | Bacteria | 1187 |
| 406 | Ga0157380_12468072 | 3300014326 | Bacteria | 585 |
| 407 | Ga0182008_10446941 | 3300014497 | Bacteria | 702 |
| 408 | Ga0157377_10000249 | 3300014745 | Bacteria | 26676 |
| 409 | Ga0157379_10002491 | 3300014968 | Bacteria | 15418 |
| 410 | Ga0157379_10053828 | 3300014968 | Bacteria | 3596 |
| 411 | Ga0157379_10058339 | 3300014968 | Bacteria | 3451 |
| 412 | Ga0157379_10421914 | 3300014968 | Bacteria | 1229 |
| 413 | Ga0157376_10000709 | 3300014969 | Bacteria | 21576 |
| 414 | Ga0157376_11240021 | 3300014969 | Bacteria | 775 |
| 415 | Ga0157376_11457758 | 3300014969 | Bacteria | 717 |
| 416 | Ga0157376_12344763 | 3300014969 | Bacteria | 573 |
| 417 | Ga0163161_10001471 | 3300017792 | Bacteria | 17429 |
| 418 | Ga0163161_11805712 | 3300017792 | Bacteria | 544 |
| 419 | Ga0206353_10185621 | 3300020082 | Bacteria | 2787 |
| 420 | Ga0214544_1008398 | 3300021320 | Bacteria | 17199 |
| 421 | Ga0214542_1005602 | 3300021321 | Bacteria | 23717 |
| 422 | Ga0214542_1036118 | 3300021321 | Bacteria | 1482 |
| 423 | Ga0214545_1000640 | 3300021324 | Bacteria | 58221 |
| 424 | Ga0214545_1034133 | 3300021324 | Bacteria | 1788 |
| 425 | Ga0214543_1009848 | 3300021327 | Bacteria | 14584 |
| 426 | Ga0214543_1039535 | 3300021327 | Bacteria | 1296 |
| 427 | Ga0213873_10039639 | 3300021358 | Bacteria | 1208 |
| 428 | Ga0213873_10078927 | 3300021358 | Bacteria | 918 |
| 429 | Ga0213874_10324072 | 3300021377 | Bacteria | 585 |
| 430 | Ga0213876_10076495 | 3300021384 | Bacteria | 1767 |
| 431 | Ga0213876_10229172 | 3300021384 | Bacteria | 987 |
| 432 | Ga0213875_10248293 | 3300021388 | Bacteria | 839 |
| 433 | Ga0224572_1005889 | 3300024225 | Bacteria | 2203 |
| 434 | Ga0228598_1046037 | 3300024227 | Bacteria | 863 |
| 435 | Ga0209677_107668 | 3300025253 | Bacteria | 2241 |
| 436 | Ga0209148_1000275 | 3300025254 | Bacteria | 80696 |
| 437 | Ga0209233_1001359 | 3300025261 | Bacteria | 9739 |
| 438 | Ga0207666_1000082 | 3300025271 | Bacteria | 15637 |
| 439 | Ga0209455_1013785 | 3300025272 | Bacteria | 1862 |
| 440 | Ga0209673_1017321 | 3300025273 | Bacteria | 2659 |
| 441 | Ga0207673_1000240 | 3300025290 | Bacteria | 5596 |
| 442 | Ga0209564_1009422 | 3300025295 | Bacteria | 4650 |
| 443 | Ga0209564_1015893 | 3300025295 | Bacteria | 3036 |
| 444 | Ga0209758_1001177 | 3300025297 | Bacteria | 33138 |
| 445 | Ga0209758_1001736 | 3300025297 | Bacteria | 24275 |
| 446 | Ga0209758_1004318 | 3300025297 | Bacteria | 11959 |
| 447 | Ga0209758_1007225 | 3300025297 | Bacteria | 7643 |
| 448 | Ga0209758_1017374 | 3300025297 | Bacteria | 3587 |
| 449 | Ga0209758_1047251 | 3300025297 | Bacteria | 1542 |
| 450 | Ga0209256_1014969 | 3300025299 | Bacteria | 2745 |
| 451 | Ga0207426_1001527 | 3300025302 | Bacteria | 18868 |
| 452 | Ga0207426_1001552 | 3300025302 | Bacteria | 18651 |
| 453 | Ga0207426_1003596 | 3300025302 | Bacteria | 8234 |
| 454 | Ga0207426_1022473 | 3300025302 | Bacteria | 2164 |
| 455 | Ga0207426_1027412 | 3300025302 | Bacteria | 1898 |
| 456 | Ga0209257_1003456 | 3300025304 | Bacteria | 13530 |
| 457 | Ga0209257_1026569 | 3300025304 | Bacteria | 1947 |
| 458 | Ga0207697_10000161 | 3300025315 | Bacteria | 33629 |
| 459 | Ga0207697_10131525 | 3300025315 | Bacteria | 1081 |
| 460 | Ga0207656_10631489 | 3300025321 | Bacteria | 547 |
| 461 | Ga0207696_1027904 | 3300025711 | Bacteria | 1737 |
| 462 | Ga0207713_1057849 | 3300025735 | Bacteria | 1496 |
| 463 | Ga0207653_10001232 | 3300025885 | Bacteria | 8360 |
| 464 | Ga0207682_10000164 | 3300025893 | Bacteria | 30348 |
| 465 | Ga0207642_10155480 | 3300025899 | Bacteria | 1222 |
| 466 | Ga0207710_10001285 | 3300025900 | Bacteria | 12691 |
| 467 | Ga0207688_10000426 | 3300025901 | Bacteria | 19817 |
| 468 | Ga0207680_10092349 | 3300025903 | Bacteria | 1928 |
| 469 | Ga0207647_10011699 | 3300025904 | Bacteria | 6141 |
| 470 | Ga0207647_10074901 | 3300025904 | Bacteria | 2038 |
| 471 | Ga0207685_10063706 | 3300025905 | Bacteria | 1469 |
| 472 | Ga0207699_10403469 | 3300025906 | Bacteria | 974 |
| 473 | Ga0207699_11212291 | 3300025906 | Bacteria | 559 |
| 474 | Ga0207645_10000040 | 3300025907 | Bacteria | 87876 |
| 475 | Ga0207643_10000082 | 3300025908 | Bacteria | 62322 |
| 476 | Ga0207643_10380061 | 3300025908 | Bacteria | 890 |
| 477 | Ga0207705_10026866 | 3300025909 | Bacteria | 4102 |
| 478 | Ga0207705_10704587 | 3300025909 | Bacteria | 785 |
| 479 | Ga0207684_10463597 | 3300025910 | Bacteria | 1087 |
| 480 | Ga0207654_10000364 | 3300025911 | Bacteria | 26734 |
| 481 | Ga0207654_10083585 | 3300025911 | Bacteria | 1928 |
| 482 | Ga0207654_10202299 | 3300025911 | Bacteria | 1308 |
| 483 | Ga0207707_10002424 | 3300025912 | Bacteria | 16786 |
| 484 | Ga0207707_10054633 | 3300025912 | Bacteria | 3476 |
| 485 | Ga0207707_10062173 | 3300025912 | Bacteria | 3249 |
| 486 | Ga0207707_10517454 | 3300025912 | Bacteria | 1016 |
| 487 | Ga0207695_10000107 | 3300025913 | Bacteria | 252606 |
| 488 | Ga0207695_10098338 | 3300025913 | Bacteria | 2926 |
| 489 | Ga0207695_10233891 | 3300025913 | Bacteria | 1741 |
| 490 | Ga0207695_10612112 | 3300025913 | Bacteria | 970 |
| 491 | Ga0207695_11115400 | 3300025913 | Bacteria | 669 |
| 492 | Ga0207671_10007354 | 3300025914 | Bacteria | 9563 |
| 493 | Ga0207671_10056653 | 3300025914 | Bacteria | 2904 |
| 494 | Ga0207671_10183041 | 3300025914 | Bacteria | 1631 |
| 495 | Ga0207671_11180659 | 3300025914 | Bacteria | 599 |
| 496 | Ga0207693_10015206 | 3300025915 | Bacteria | 6177 |
| 497 | Ga0207693_10169696 | 3300025915 | Bacteria | 1718 |
| 498 | Ga0207660_10000501 | 3300025917 | Bacteria | 26097 |
| 499 | Ga0207660_10127218 | 3300025917 | Bacteria | 1936 |
| 500 | Ga0207660_10129945 | 3300025917 | Bacteria | 1916 |
| 501 | Ga0207660_11695780 | 3300025917 | Bacteria | 508 |
| 502 | Ga0207662_10066962 | 3300025918 | Bacteria | 2165 |
| 503 | Ga0207662_10069506 | 3300025918 | Bacteria | 2128 |
| 504 | Ga0207662_10122337 | 3300025918 | Bacteria | 1633 |
| 505 | Ga0207657_10002764 | 3300025919 | Bacteria | 18896 |
| 506 | Ga0207657_10048811 | 3300025919 | Bacteria | 3694 |
| 507 | Ga0207657_10294043 | 3300025919 | Bacteria | 1287 |
| 508 | Ga0207657_10302268 | 3300025919 | Bacteria | 1267 |
| 509 | Ga0207649_10000788 | 3300025920 | Bacteria | 20473 |
| 510 | Ga0207649_10104857 | 3300025920 | Bacteria | 1878 |
| 511 | Ga0207649_10285849 | 3300025920 | Bacteria | 1201 |
| 512 | Ga0207649_10545726 | 3300025920 | Bacteria | 886 |
| 513 | Ga0207652_10001134 | 3300025921 | Bacteria | 23993 |
| 514 | Ga0207652_10067223 | 3300025921 | Bacteria | 3107 |
| 515 | Ga0207652_10171401 | 3300025921 | Bacteria | 1948 |
| 516 | Ga0207652_10327388 | 3300025921 | Bacteria | 1383 |
| 517 | Ga0207646_10266598 | 3300025922 | Bacteria | 1548 |
| 518 | Ga0207681_10000539 | 3300025923 | Bacteria | 26052 |
| 519 | Ga0207681_10350826 | 3300025923 | Bacteria | 1181 |
| 520 | Ga0207681_10375559 | 3300025923 | Bacteria | 1143 |
| 521 | Ga0207694_10045291 | 3300025924 | Bacteria | 3398 |
| 522 | Ga0207694_10050997 | 3300025924 | Bacteria | 3207 |
| 523 | Ga0207694_10316187 | 3300025924 | Bacteria | 1288 |
| 524 | Ga0207694_11591151 | 3300025924 | Bacteria | 551 |
| 525 | Ga0207650_10001604 | 3300025925 | Bacteria | 16143 |
| 526 | Ga0207650_10104673 | 3300025925 | Bacteria | 2183 |
| 527 | Ga0207650_10562197 | 3300025925 | Bacteria | 957 |
| 528 | Ga0207659_10004978 | 3300025926 | Bacteria | 8051 |
| 529 | Ga0207659_10153697 | 3300025926 | Bacteria | 1799 |
| 530 | Ga0207659_10413123 | 3300025926 | Bacteria | 1131 |
| 531 | Ga0207659_10558044 | 3300025926 | Bacteria | 974 |
| 532 | Ga0207687_10000063 | 3300025927 | Bacteria | 83105 |
| 533 | Ga0207700_10019315 | 3300025928 | Bacteria | 4601 |
| 534 | Ga0207700_10647816 | 3300025928 | Bacteria | 942 |
| 535 | Ga0207664_10336651 | 3300025929 | Bacteria | 1334 |
| 536 | Ga0207664_10745355 | 3300025929 | Bacteria | 881 |
| 537 | Ga0207664_11337393 | 3300025929 | Bacteria | 636 |
| 538 | Ga0207644_10000661 | 3300025931 | Bacteria | 21786 |
| 539 | Ga0207644_10091510 | 3300025931 | Bacteria | 2268 |
| 540 | Ga0207644_10256665 | 3300025931 | Bacteria | 1396 |
| 541 | Ga0207690_10000086 | 3300025932 | Bacteria | 77995 |
| 542 | Ga0207690_10380337 | 3300025932 | Bacteria | 1122 |
| 543 | Ga0207706_10019107 | 3300025933 | Bacteria | 6164 |
| 544 | Ga0207706_10340223 | 3300025933 | Bacteria | 1305 |
| 545 | Ga0207706_10363597 | 3300025933 | Bacteria | 1257 |
| 546 | Ga0207686_10001237 | 3300025934 | Bacteria | 14782 |
| 547 | Ga0207709_10001095 | 3300025935 | Bacteria | 19865 |
| 548 | Ga0207670_10000264 | 3300025936 | Bacteria | 32854 |
| 549 | Ga0207670_10028387 | 3300025936 | Bacteria | 3552 |
| 550 | Ga0207670_10359565 | 3300025936 | Bacteria | 1155 |
| 551 | Ga0207669_10000228 | 3300025937 | Bacteria | 25653 |
| 552 | Ga0207704_10000107 | 3300025938 | Bacteria | 45669 |
| 553 | Ga0207704_10855321 | 3300025938 | Bacteria | 763 |
| 554 | Ga0207704_10999319 | 3300025938 | Bacteria | 707 |
| 555 | Ga0207704_11800361 | 3300025938 | Bacteria | 527 |
| 556 | Ga0207665_10000694 | 3300025939 | Bacteria | 22798 |
| 557 | Ga0207691_10001173 | 3300025940 | Bacteria | 26058 |
| 558 | Ga0207691_10390120 | 3300025940 | Bacteria | 1188 |
| 559 | Ga0207711_10004273 | 3300025941 | Bacteria | 12204 |
| 560 | Ga0207711_10012191 | 3300025941 | Bacteria | 7147 |
| 561 | Ga0207711_10648103 | 3300025941 | Bacteria | 985 |
| 562 | Ga0207711_10774540 | 3300025941 | Bacteria | 894 |
| 563 | Ga0207689_10001082 | 3300025942 | Bacteria | 26263 |
| 564 | Ga0207689_10206229 | 3300025942 | Bacteria | 1624 |
| 565 | Ga0207661_10000427 | 3300025944 | Bacteria | 27219 |
| 566 | Ga0207661_10476198 | 3300025944 | Bacteria | 1139 |
| 567 | Ga0207661_11483823 | 3300025944 | Bacteria | 622 |
| 568 | Ga0207679_10000025 | 3300025945 | Bacteria | 203699 |
| 569 | Ga0207679_10448343 | 3300025945 | Bacteria | 1144 |
| 570 | Ga0207679_10532162 | 3300025945 | Bacteria | 1052 |
| 571 | Ga0207679_10701099 | 3300025945 | Bacteria | 919 |
| 572 | Ga0207679_11238659 | 3300025945 | Bacteria | 685 |
| 573 | Ga0207667_10006928 | 3300025949 | Bacteria | 13696 |
| 574 | Ga0207667_10375633 | 3300025949 | Bacteria | 1448 |
| 575 | Ga0207667_10676039 | 3300025949 | Bacteria | 1036 |
| 576 | Ga0207651_10000081 | 3300025960 | Bacteria | 42817 |
| 577 | Ga0207651_10839172 | 3300025960 | Bacteria | 816 |
| 578 | Ga0207651_11536689 | 3300025960 | Bacteria | 600 |
| 579 | Ga0207712_10000587 | 3300025961 | Bacteria | 29197 |
| 580 | Ga0207712_10016688 | 3300025961 | Bacteria | 4758 |
| 581 | Ga0207668_10000171 | 3300025972 | Bacteria | 44795 |
| 582 | Ga0207640_10001295 | 3300025981 | Bacteria | 13585 |
| 583 | Ga0207640_10184781 | 3300025981 | Bacteria | 1566 |
| 584 | Ga0207640_10390485 | 3300025981 | Bacteria | 1130 |
| 585 | Ga0207658_10000940 | 3300025986 | Bacteria | 24033 |
| 586 | Ga0207658_10535107 | 3300025986 | Bacteria | 1047 |
| 587 | Ga0207677_10000447 | 3300026023 | Bacteria | 27944 |
| 588 | Ga0207677_10383178 | 3300026023 | Bacteria | 1187 |
| 589 | Ga0207677_11049957 | 3300026023 | Bacteria | 741 |
| 590 | Ga0207703_10006213 | 3300026035 | Bacteria | 9560 |
| 591 | Ga0207703_10085667 | 3300026035 | Bacteria | 2638 |
| 592 | Ga0207703_11266951 | 3300026035 | Bacteria | 709 |
| 593 | Ga0207703_11386263 | 3300026035 | Bacteria | 676 |
| 594 | Ga0207639_10196744 | 3300026041 | Bacteria | 1726 |
| 595 | Ga0207639_10221467 | 3300026041 | Bacteria | 1634 |
| 596 | Ga0207639_10602681 | 3300026041 | Bacteria | 1013 |
| 597 | Ga0207639_11144247 | 3300026041 | Bacteria | 730 |
| 598 | Ga0207678_10001776 | 3300026067 | Bacteria | 19742 |
| 599 | Ga0207678_10087980 | 3300026067 | Bacteria | 2655 |
| 600 | Ga0207678_10113758 | 3300026067 | Bacteria | 2309 |
| 601 | Ga0207678_10777730 | 3300026067 | Bacteria | 845 |
| 602 | Ga0207678_11253062 | 3300026067 | Bacteria | 656 |
| 603 | Ga0207702_10006918 | 3300026078 | Bacteria | 9712 |
| 604 | Ga0207702_11291274 | 3300026078 | Bacteria | 724 |
| 605 | Ga0207641_10001385 | 3300026088 | Bacteria | 23881 |
| 606 | Ga0207648_10009579 | 3300026089 | Bacteria | 9267 |
| 607 | Ga0207676_10001643 | 3300026095 | Bacteria | 16474 |
| 608 | Ga0207676_10203783 | 3300026095 | Bacteria | 1750 |
| 609 | Ga0207674_10001963 | 3300026116 | Bacteria | 26041 |
| 610 | Ga0207674_10101501 | 3300026116 | Bacteria | 2858 |
| 611 | Ga0207674_10399009 | 3300026116 | Bacteria | 1329 |
| 612 | Ga0207674_10456876 | 3300026116 | Bacteria | 1234 |
| 613 | Ga0207674_10966893 | 3300026116 | Bacteria | 820 |
| 614 | Ga0207675_100002289 | 3300026118 | Bacteria | 19016 |
| 615 | Ga0207675_100172842 | 3300026118 | Bacteria | 2066 |
| 616 | Ga0207675_100454248 | 3300026118 | Bacteria | 1270 |
| 617 | Ga0207675_100715948 | 3300026118 | Bacteria | 1011 |
| 618 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 619 | Ga0207683_10336690 | 3300026121 | Bacteria | 1383 |
| 620 | Ga0207683_12148403 | 3300026121 | Bacteria | 506 |
| 621 | Ga0207698_10002904 | 3300026142 | Bacteria | 10245 |
| 622 | Ga0207698_11269177 | 3300026142 | Bacteria | 751 |
| 623 | Ga0209973_1024639 | 3300027252 | Bacteria | 820 |
| 624 | Ga0209389_1000153 | 3300027296 | Bacteria | 58606 |
| 625 | Ga0209389_1001970 | 3300027296 | Bacteria | 15193 |
| 626 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 627 | Ga0209589_1001441 | 3300027357 | Bacteria | 39301 |
| 628 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 629 | Ga0209489_100936 | 3300027361 | Bacteria | 58586 |
| 630 | Ga0209489_107925 | 3300027361 | Bacteria | 15193 |
| 631 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 632 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 633 | Ga0209967_1024526 | 3300027364 | Bacteria | 890 |
| 634 | Ga0209981_1051746 | 3300027378 | Bacteria | 623 |
| 635 | Ga0209996_1066226 | 3300027395 | Bacteria | 558 |
| 636 | Ga0209984_1012409 | 3300027424 | Bacteria | 1110 |
| 637 | Ga0209995_1023444 | 3300027471 | Bacteria | 1026 |
| 638 | Ga0209968_1007446 | 3300027526 | Bacteria | 1656 |
| 639 | Ga0209999_1027018 | 3300027543 | Bacteria | 1062 |
| 640 | Ga0209982_1008888 | 3300027552 | Bacteria | 1479 |
| 641 | Ga0210002_1000477 | 3300027617 | Bacteria | 5435 |
| 642 | Ga0209983_1004381 | 3300027665 | Bacteria | 2968 |
| 643 | Ga0209588_1030270 | 3300027671 | Bacteria | 1729 |
| 644 | Ga0209971_1003482 | 3300027682 | Bacteria | 3732 |
| 645 | Ga0209966_1002279 | 3300027695 | Bacteria | 3199 |
| 646 | Ga0209998_10017619 | 3300027717 | Bacteria | 1511 |
| 647 | Ga0209813_10019795 | 3300027866 | Bacteria | 1876 |
| 648 | Ga0209813_10283706 | 3300027866 | Bacteria | 638 |
| 649 | Ga0209974_10036531 | 3300027876 | Bacteria | 1632 |
| 650 | Ga0207428_10001279 | 3300027907 | Bacteria | 26927 |
| 651 | Ga0268266_10133468 | 3300028379 | Bacteria | 2222 |
| 652 | Ga0268266_10138462 | 3300028379 | Bacteria | 2182 |
| 653 | Ga0268266_10141267 | 3300028379 | Bacteria | 2161 |
| 654 | Ga0268266_11163424 | 3300028379 | Bacteria | 746 |
| 655 | Ga0268265_10001152 | 3300028380 | Bacteria | 23269 |
| 656 | Ga0268265_11174183 | 3300028380 | Bacteria | 764 |
| 657 | Ga0268265_11451951 | 3300028380 | Bacteria | 689 |
| 658 | Ga0268264_10000886 | 3300028381 | Bacteria | 31552 |
| 659 | Ga0268264_10764967 | 3300028381 | Bacteria | 963 |
| 660 | Ga0268264_10892555 | 3300028381 | Bacteria | 892 |
| 661 | Ga0268264_12701494 | 3300028381 | Bacteria | 500 |
| 662 | Ga0265334_10101418 | 3300028573 | Bacteria | 1042 |
| 663 | Ga0265338_10048758 | 3300028800 | Bacteria | 3848 |
| 664 | Ga0265762_1048865 | 3300030760 | Bacteria | 844 |
| 665 | Ga0265330_10153765 | 3300031235 | Bacteria | 977 |
| 666 | Ga0265330_10231390 | 3300031235 | Bacteria | 780 |
| 667 | Ga0265320_10022931 | 3300031240 | Bacteria | 3333 |
| 668 | Ga0265325_10004936 | 3300031241 | Bacteria | 8318 |
| 669 | Ga0265340_10042317 | 3300031247 | Bacteria | 2237 |
| 670 | Ga0265340_10084294 | 3300031247 | Bacteria | 1492 |
| 671 | Ga0265339_10002208 | 3300031249 | Bacteria | 14116 |
| 672 | Ga0265316_10300661 | 3300031344 | Bacteria | 1169 |
| 673 | Ga0307509_10163406 | 3300031507 | Bacteria | 2119 |
| 674 | Ga0265313_10002423 | 3300031595 | Bacteria | 16122 |
| 675 | Ga0265313_10021599 | 3300031595 | Bacteria | 3516 |
| 676 | Ga0307508_10803923 | 3300031616 | Bacteria | 558 |
| 677 | Ga0265314_10001439 | 3300031711 | Bacteria | 26627 |
| 678 | Ga0265314_10131333 | 3300031711 | Bacteria | 1562 |
| 679 | Ga0307409_102753106 | 3300031995 | Bacteria | 520 |
| 680 | Ga0307414_10277404 | 3300032004 | Bacteria | 1407 |
| 681 | Ga0307411_10692387 | 3300032005 | Bacteria | 887 |
| 682 | Ga0307510_10047169 | 3300033180 | Bacteria | 4620 |
| 683 | Ga0307510_10057372 | 3300033180 | Bacteria | 4042 |
| 684 | Ga0307510_10468699 | 3300033180 | Bacteria | 701 |
| 685 | Ga0373930_0019403 | 3300034816 | Bacteria | 1315 |
| 686 | Ga0373950_0012634 | 3300034818 | Bacteria | 1397 |
| 687 | Ga0373958_0000496 | 3300034819 | Bacteria | 4853 |
| 688 | Ga0373958_0021372 | 3300034819 | Bacteria | 1200 |
| 689 | Ga0373938_0000501 | 3300034957 | Bacteria | 6326 |
| 690 | Ga0373928_0001329 | 3300035084 | Bacteria | 4849 |
| 691 | Ga0373929_0005182 | 3300035085 | Bacteria | 2342 |
| 692 | Ga0373929_0005356 | 3300035085 | Bacteria | 2307 |
| 693 | Ga0373940_0006151 | 3300035088 | Bacteria | 2643 |
| 694 | Ga0373944_0090244 | 3300035089 | Bacteria | 1023 |
| 695 | Ga0373944_0207684 | 3300035089 | Bacteria | 711 |
| 696 | Ga0373949_0001039 | 3300035090 | Bacteria | 8489 |
| 697 | Ga0373949_0002241 | 3300035090 | Bacteria | 5051 |
| 698 | Ga0373951_0001036 | 3300035091 | Bacteria | 7473 |
| 699 | Ga0373951_0009429 | 3300035091 | Bacteria | 2197 |
| 700 | Ga0373952_0000019 | 3300035092 | Bacteria | 19182 |
| 701 | Ga0373923_0114522 | 3300035111 | Bacteria | 1200 |
| 702 | Ga0373932_0001702 | 3300035112 | Bacteria | 5980 |
| 703 | Ga0373936_0006248 | 3300035113 | Bacteria | 4492 |
| 704 | Ga0373939_0000216 | 3300035114 | Bacteria | 15784 |
| 705 | Ga0373939_0001911 | 3300035114 | Bacteria | 4985 |
| 706 | Ga0373939_0040991 | 3300035114 | Bacteria | 1394 |
| 707 | Ga0373941_0000554 | 3300035115 | Bacteria | 7456 |
| 708 | Ga0373941_0000816 | 3300035115 | Bacteria | 6394 |
| 709 | Ga0373953_0018189 | 3300035117 | Bacteria | 2597 |
| 710 | Ga0373954_0045439 | 3300035118 | Bacteria | 2052 |
| 711 | Ga0373956_0580804 | 3300035119 | Bacteria | 535 |
| 712 | Ga0373960_0000120 | 3300035121 | Bacteria | 12660 |
| 713 | Ga0373960_0434649 | 3300035121 | Bacteria | 512 |
| 714 | Ga0373946_0006187 | 3300035171 | Bacteria | 4334 |
| 715 | Ga0373961_0002336 | 3300035241 | Bacteria | 4952 |
| 716 | Ga0373962_0001149 | 3300035242 | Bacteria | 6171 |
| 717 | Ga0373962_0051820 | 3300035242 | Bacteria | 1184 |
| 718 | Ga0373924_0066939 | 3300035410 | Bacteria | 1510 |
| 719 | Ga0373931_0000168 | 3300035691 | Bacteria | 28567 |
| 720 | Ga0373931_0494830 | 3300035691 | Bacteria | 788 |
| 721 | Ga0373931_0525007 | 3300035691 | Bacteria | 766 |
| 722 | Ga0373931_0534481 | 3300035691 | Bacteria | 760 |
| 723 | Ga0373935_0005287 | 3300035692 | Bacteria | 7594 |
| 724 | Ga0373927_0000121 | 3300035695 | Bacteria | 59449 |
| 725 | Ga0373927_0302343 | 3300035695 | Bacteria | 1053 |
| 726 | Ga0373933_0001546 | 3300035724 | Bacteria | 13469 |
| 727 | Ga0373947_0000118 | 3300035725 | Bacteria | 39817 |
| 728 | Ga0373947_0692793 | 3300035725 | Bacteria | 695 |
| 729 | Ga0373937_0465433 | 3300036401 | Bacteria | 1201 |
| 730 | Ga0373937_1552861 | 3300036401 | Bacteria | 609 |
| 731 | Ga0373925_0003905 | 3300037068 | Bacteria | 11385 |
| 732 | Ga0373925_0290237 | 3300037068 | Bacteria | 1319 |
| 733 | Ga0373925_0306580 | 3300037068 | Bacteria | 1283 |
| 734 | Ga0373925_0512941 | 3300037068 | Bacteria | 985 |
| 735 | Ga0373925_1662082 | 3300037068 | Bacteria | 522 |
| 736 | Ga0395900_0000623 | 3300037418 | Bacteria | 47633 |
| 737 | Ga0395900_0304771 | 3300037418 | Bacteria | 1578 |
| 738 | Ga0395898_0005100 | 3300037466 | Bacteria | 14229 |
| 739 | Ga0395898_0091902 | 3300037466 | Bacteria | 2919 |
| 740 | Ga0395898_0159166 | 3300037466 | Bacteria | 2160 |
| 741 | Ga0395905_0008122 | 3300037471 | Bacteria | 10371 |
| 742 | Ga0395905_0101686 | 3300037471 | Bacteria | 2698 |
| 743 | Ga0395905_0110910 | 3300037471 | Bacteria | 2576 |
| 744 | Ga0395905_0978275 | 3300037471 | Bacteria | 749 |
| 745 | Ga0436364_0763481 | 3300037853 | Bacteria | 839 |
| 746 | Ga0395901_0025332 | 3300038443 | Bacteria | 6089 |
| 747 | Ga0395901_0186453 | 3300038443 | Bacteria | 2176 |
| 748 | Ga0395901_0240390 | 3300038443 | Bacteria | 1889 |
| 749 | Ga0395901_1922363 | 3300038443 | Bacteria | 539 |
| 750 | Ga0242419_006070 | 3300038698 | Bacteria | 871 |
| 751 | Ga0436365_0051319 | 3300039437 | Bacteria | 5468 |
| 752 | Ga0436365_1514182 | 3300039437 | Bacteria | 697 |
| 753 | Ga0436365_1635461 | 3300039437 | Bacteria | 1638 |
| 754 | Ga0436360_0080726 | 3300039438 | Bacteria | 717 |
| 755 | Ga0436360_0202439 | 3300039438 | Bacteria | 3479 |
| 756 | Ga0436360_1015043 | 3300039438 | Bacteria | 1024 |
| 757 | Ga0436361_0623870 | 3300039447 | Bacteria | 1736 |
| 758 | Ga0436363_0224834 | 3300039450 | Bacteria | 1230 |
| 759 | Ga0436363_0319292 | 3300039450 | Bacteria | 1095 |
| 760 | Ga0436363_0431126 | 3300039450 | Bacteria | 873 |
| 761 | Ga0436363_1088775 | 3300039450 | Bacteria | 1250 |
| 762 | Ga0436362_0138270 | 3300039453 | Bacteria | 4263 |
| 763 | Ga0436362_0419658 | 3300039453 | Bacteria | 1650 |
| 764 | Ga0436362_0743365 | 3300039453 | Bacteria | 575 |
| 765 | Ga0439465_0135724 | 3300041413 | Bacteria | 871 |
| 766 | Ga0439465_0235665 | 3300041413 | Bacteria | 674 |
| 767 | Ga0451791_1212031 | 3300041451 | Bacteria | 1168 |
| 768 | Ga0451791_1591294 | 3300041451 | Bacteria | 1199 |
| 769 | Ga0451793_0115389 | 3300041452 | Bacteria | 647 |
| 770 | Ga0451797_1054811 | 3300041453 | Bacteria | 509 |
| 771 | Ga0451795_0985424 | 3300041456 | Bacteria | 732 |
| 772 | Ga0451798_0684963 | 3300041458 | Bacteria | 1024 |
| 773 | Ga0451802_0613368 | 3300041460 | Bacteria | 692 |
| 774 | Ga0451802_1363334 | 3300041460 | Bacteria | 527 |
| 775 | Ga0451807_2241141 | 3300041486 | Bacteria | 925 |
| 776 | Ga0451839_0152791 | 3300041496 | Bacteria | 571 |
| 777 | Ga0451839_1021691 | 3300041496 | Bacteria | 510 |
| 778 | Ga0451849_1088658 | 3300041505 | Bacteria | 758 |
| 779 | Ga0451851_0249131 | 3300041507 | Bacteria | 513 |
| 780 | Ga0439437_001742 | 3300042000 | Bacteria | 2304 |
| 781 | Ga0439441_019518 | 3300042001 | Bacteria | 1234 |
| 782 | Ga0439443_059278 | 3300042003 | Bacteria | 683 |
| 783 | Ga0439448_0067783 | 3300042005 | Bacteria | 1186 |
| 784 | Ga0439448_0098198 | 3300042005 | Bacteria | 993 |
| 785 | Ga0439450_088189 | 3300042008 | Bacteria | 777 |
| 786 | Ga0439455_0008897 | 3300042012 | Bacteria | 2165 |
| 787 | Ga0439435_0022509 | 3300042436 | Bacteria | 1646 |
| 788 | Ga0439444_0044691 | 3300042437 | Bacteria | 882 |
| 789 | Ga0439464_0006642 | 3300042439 | Bacteria | 3018 |
| 790 | Ga0439440_0132644 | 3300042993 | Unclassified | 702 |
| 791 | Ga0466969_0004242 | 3300044656 | Bacteria | 7622 |
| 792 | Ga0466969_0129828 | 3300044656 | Bacteria | 1169 |
| 793 | Ga0466969_0577827 | 3300044656 | Bacteria | 515 |
| 794 | Ga0466972_0001791 | 3300044658 | Bacteria | 10523 |
| 795 | Ga0466972_0024641 | 3300044658 | Bacteria | 2985 |
| 796 | Ga0466972_0119362 | 3300044658 | Bacteria | 1244 |
| 797 | Ga0466972_0124633 | 3300044658 | Bacteria | 1214 |
| 798 | Ga0466972_0148608 | 3300044658 | Bacteria | 1102 |
| 799 | Ga0466965_0093556 | 3300044683 | Bacteria | 1531 |
| 800 | Ga0466965_0217095 | 3300044683 | Bacteria | 1018 |
| 801 | Ga0466966_0001051 | 3300044684 | Bacteria | 17608 |
| 802 | Ga0466966_0389774 | 3300044684 | Bacteria | 837 |
| 803 | Ga0466966_0474628 | 3300044684 | Bacteria | 752 |
| 804 | Ga0466966_0917341 | 3300044684 | Bacteria | 528 |
| 805 | Ga0466961_0005739 | 3300044693 | Bacteria | 7854 |
| 806 | Ga0466961_0274903 | 3300044693 | Bacteria | 1032 |
| 807 | Ga0466963_0030126 | 3300044694 | Bacteria | 3499 |
| 808 | Ga0466964_0059002 | 3300044706 | Bacteria | 1592 |
| 809 | Ga0466971_0088729 | 3300044719 | Bacteria | 1415 |
| 810 | Ga0466968_0019273 | 3300044735 | Bacteria | 2746 |
| 811 | Ga0466970_0080544 | 3300044765 | Bacteria | 1760 |
| 812 | Ga0466970_0416824 | 3300044765 | Bacteria | 767 |
| 813 | Ga0466970_0564740 | 3300044765 | Bacteria | 658 |
| 814 | Ga0466960_0023639 | 3300044901 | Bacteria | 2761 |
| 815 | Ga0466959_0406614 | 3300045049 | Bacteria | 925 |
| 816 | Ga0466958_0289156 | 3300045836 | Bacteria | 1051 |
| 817 | Ga0466967_0073407 | 3300045976 | Bacteria | 3070 |
| 818 | Ga0466967_0213410 | 3300045976 | Bacteria | 1831 |
| 819 | Ga0466967_0941903 | 3300045976 | Bacteria | 859 |
| 820 | Ga0466967_1111338 | 3300045976 | Bacteria | 788 |
| 821 | Ga0466967_1877775 | 3300045976 | Bacteria | 596 |
| 822 | Ga0466967_2229155 | 3300045976 | Bacteria | 544 |
| 823 | Ga0495617_030446 | 3300046452 | Bacteria | 1814 |
| 824 | Ga0495592_0052893 | 3300046454 | Bacteria | 3013 |
| 825 | Ga0495592_0164753 | 3300046454 | Bacteria | 1522 |
| 826 | Ga0495603_0000053 | 3300046455 | Bacteria | 49373 |
| 827 | Ga0495603_0052299 | 3300046455 | Bacteria | 2425 |
| 828 | Ga0495603_0057979 | 3300046455 | Bacteria | 2290 |
| 829 | Ga0495603_0137674 | 3300046455 | Bacteria | 1421 |
| 830 | Ga0495590_0250539 | 3300046457 | Bacteria | 659 |
| 831 | Ga0495590_0319548 | 3300046457 | Bacteria | 586 |
| 832 | Ga0495629_0000879 | 3300046459 | Bacteria | 24220 |
| 833 | Ga0495629_0650542 | 3300046459 | Bacteria | 702 |
| 834 | Ga0495638_0030449 | 3300046460 | Bacteria | 3474 |
| 835 | Ga0495638_0033944 | 3300046460 | Bacteria | 3259 |
| 836 | Ga0495641_0001147 | 3300046461 | Bacteria | 22816 |
| 837 | Ga0495651_0006742 | 3300046462 | Bacteria | 8781 |
| 838 | Ga0495580_0001877 | 3300046472 | Bacteria | 18497 |
| 839 | Ga0495582_0000186 | 3300046473 | Bacteria | 34006 |
| 840 | Ga0495605_0214392 | 3300046474 | Bacteria | 834 |
| 841 | Ga0495639_0000078 | 3300046475 | Bacteria | 46048 |
| 842 | Ga0495639_0170302 | 3300046475 | Bacteria | 1057 |
| 843 | Ga0495639_0183763 | 3300046475 | Bacteria | 1019 |
| 844 | Ga0495662_0001412 | 3300046476 | Bacteria | 11898 |
| 845 | Ga0495662_0194068 | 3300046476 | Bacteria | 1001 |
| 846 | Ga0495664_0048155 | 3300046477 | Bacteria | 2530 |
| 847 | Ga0495664_0100006 | 3300046477 | Bacteria | 1746 |
| 848 | Ga0495594_0000103 | 3300046499 | Bacteria | 39690 |
| 849 | Ga0495594_0056232 | 3300046499 | Bacteria | 2171 |
| 850 | Ga0495596_0434902 | 3300046500 | Bacteria | 512 |
| 851 | Ga0495607_0450617 | 3300046501 | Bacteria | 578 |
| 852 | Ga0495607_0507967 | 3300046501 | Bacteria | 534 |
| 853 | Ga0495583_0117172 | 3300046506 | Bacteria | 1124 |
| 854 | Ga0495583_0428435 | 3300046506 | Bacteria | 519 |
| 855 | Ga0495606_0021503 | 3300046507 | Bacteria | 4725 |
| 856 | Ga0495606_0087985 | 3300046507 | Bacteria | 1916 |
| 857 | Ga0495608_0123473 | 3300046511 | Bacteria | 1659 |
| 858 | Ga0495610_0192021 | 3300046512 | Bacteria | 842 |
| 859 | Ga0495616_0203405 | 3300046513 | Bacteria | 869 |
| 860 | Ga0495618_0092321 | 3300046514 | Bacteria | 1936 |
| 861 | Ga0495620_0158003 | 3300046515 | Bacteria | 882 |
| 862 | Ga0495628_0008202 | 3300046516 | Bacteria | 8983 |
| 863 | Ga0495628_0054033 | 3300046516 | Bacteria | 3167 |
| 864 | Ga0495628_0707827 | 3300046516 | Bacteria | 711 |
| 865 | Ga0495630_0003914 | 3300046517 | Bacteria | 10413 |
| 866 | Ga0495630_0388668 | 3300046517 | Bacteria | 1069 |
| 867 | Ga0495631_0507640 | 3300046518 | Bacteria | 514 |
| 868 | Ga0495632_0312683 | 3300046519 | Bacteria | 695 |
| 869 | Ga0495632_0362937 | 3300046519 | Bacteria | 636 |
| 870 | Ga0495637_0119799 | 3300046520 | Bacteria | 1014 |
| 871 | Ga0495643_0023626 | 3300046522 | Bacteria | 3492 |
| 872 | Ga0495643_0243841 | 3300046522 | Bacteria | 842 |
| 873 | Ga0495644_0105274 | 3300046523 | Bacteria | 1069 |
| 874 | Ga0495648_0011773 | 3300046524 | Bacteria | 6565 |
| 875 | Ga0495648_0212783 | 3300046524 | Bacteria | 959 |
| 876 | Ga0495648_0393557 | 3300046524 | Bacteria | 621 |
| 877 | Ga0495663_0353195 | 3300046525 | Bacteria | 536 |
| 878 | Ga0495666_0001779 | 3300046526 | Bacteria | 10634 |
| 879 | Ga0495666_0065729 | 3300046526 | Bacteria | 1730 |
| 880 | Ga0495642_0265770 | 3300046528 | Bacteria | 751 |
| 881 | Ga0495652_0150715 | 3300046529 | Bacteria | 1817 |
| 882 | Ga0495652_0238017 | 3300046529 | Bacteria | 1357 |
| 883 | Ga0495654_0116440 | 3300046530 | Bacteria | 1214 |
| 884 | Ga0495665_0000190 | 3300046531 | Bacteria | 31563 |
| 885 | Ga0495640_0001297 | 3300046533 | Bacteria | 19633 |
| 886 | Ga0495640_0130139 | 3300046533 | Bacteria | 1629 |
| 887 | Ga0495640_0537942 | 3300046533 | Bacteria | 709 |
| 888 | Ga0495587_0010408 | 3300046536 | Bacteria | 5922 |
| 889 | Ga0495598_0042248 | 3300046537 | Bacteria | 1337 |
| 890 | Ga0495645_0060216 | 3300046543 | Bacteria | 2752 |
| 891 | Ga0495622_0001547 | 3300046557 | Bacteria | 11434 |
| 892 | Ga0495622_0033426 | 3300046557 | Bacteria | 2400 |
| 893 | Ga0495622_0037463 | 3300046557 | Bacteria | 2259 |
| 894 | Ga0495622_0333714 | 3300046557 | Bacteria | 657 |
| 895 | Ga0495667_0110133 | 3300046559 | Bacteria | 1779 |
| 896 | Ga0495656_0343965 | 3300046615 | Bacteria | 772 |
| 897 | Ga0495656_0611051 | 3300046615 | Bacteria | 584 |
| 898 | Ga0495656_0629729 | 3300046615 | Bacteria | 575 |
| 899 | Ga0495668_0174901 | 3300046616 | Bacteria | 1176 |
| 900 | Ga0495668_0191619 | 3300046616 | Bacteria | 1120 |
| 901 | Ga0495668_0312109 | 3300046616 | Bacteria | 862 |
| 902 | Ga0495634_0001169 | 3300046642 | Bacteria | 24315 |
| 903 | Ga0495634_0046747 | 3300046642 | Bacteria | 2920 |
| 904 | Ga0495611_0050268 | 3300046648 | Bacteria | 1877 |
| 905 | Ga0495625_0094117 | 3300046660 | Bacteria | 2068 |
| 906 | Ga0495625_0267767 | 3300046660 | Bacteria | 1104 |
| 907 | Ga0495635_0000368 | 3300046663 | Bacteria | 28703 |
| 908 | Ga0495635_0000985 | 3300046663 | Bacteria | 18760 |
| 909 | Ga0495635_0124568 | 3300046663 | Bacteria | 1757 |
| 910 | Ga0495659_0013263 | 3300046664 | Bacteria | 2682 |
| 911 | Ga0495661_0123940 | 3300046665 | Bacteria | 1424 |
| 912 | Ga0495661_0266784 | 3300046665 | Bacteria | 868 |
| 913 | Ga0495588_0003732 | 3300046674 | Bacteria | 6659 |
| 914 | Ga0495588_0024229 | 3300046674 | Bacteria | 3013 |
| 915 | Ga0495588_0405946 | 3300046674 | Bacteria | 715 |
| 916 | Ga0495657_0009428 | 3300046675 | Bacteria | 7397 |
| 917 | Ga0495599_0067631 | 3300046678 | Bacteria | 2231 |
| 918 | Ga0495599_0222496 | 3300046678 | Bacteria | 1154 |
| 919 | Ga0495646_0011058 | 3300046680 | Bacteria | 5733 |
| 920 | Ga0495646_0020279 | 3300046680 | Bacteria | 4206 |
| 921 | Ga0495647_0000720 | 3300046681 | Bacteria | 9794 |
| 922 | Ga0495647_0102158 | 3300046681 | Bacteria | 1188 |
| 923 | Ga0495658_0005321 | 3300046683 | Bacteria | 6333 |
| 924 | Ga0495658_0810041 | 3300046683 | Bacteria | 599 |
| 925 | Ga0495669_0280639 | 3300046684 | Bacteria | 801 |
| 926 | Ga0495613_0004274 | 3300046689 | Bacteria | 10700 |
| 927 | Ga0495613_0170277 | 3300046689 | Bacteria | 1546 |
| 928 | Ga0495624_0000504 | 3300046690 | Bacteria | 30575 |
| 929 | Ga0495624_0192605 | 3300046690 | Bacteria | 1240 |
| 930 | Ga0495670_0075745 | 3300046691 | Bacteria | 1708 |
| 931 | Ga0495671_0084620 | 3300046692 | Bacteria | 1554 |
| 932 | Ga0495649_0022151 | 3300046694 | Bacteria | 3555 |
| 933 | Ga0495649_0196381 | 3300046694 | Bacteria | 1049 |
| 934 | Ga0495589_0240153 | 3300046794 | Bacteria | 848 |
| 935 | Ga0495600_0002231 | 3300046809 | Bacteria | 11032 |
| 936 | Ga0495600_0038619 | 3300046809 | Bacteria | 3107 |
| 937 | Ga0495660_0123810 | 3300046810 | Bacteria | 1305 |
| 938 | Ga0495581_0000501 | 3300047315 | Bacteria | 20012 |
| 939 | Ga0495604_0003943 | 3300047317 | Bacteria | 11814 |
| 940 | Ga0495604_0874787 | 3300047317 | Bacteria | 563 |
| 941 | Ga0495674_0000228 | 3300047319 | Bacteria | 46998 |
| 942 | Ga0495674_0066520 | 3300047319 | Bacteria | 3126 |
| 943 | Ga0495672_0199732 | 3300047320 | Bacteria | 1001 |
| 944 | Ga0495676_0015031 | 3300047321 | Bacteria | 6909 |
| 945 | Ga0495676_0343712 | 3300047321 | Bacteria | 998 |
| 946 | Ga0495680_0005216 | 3300047322 | Bacteria | 12265 |
| 947 | Ga0495683_0068028 | 3300047323 | Bacteria | 1753 |
| 948 | Ga0495683_0077797 | 3300047323 | Bacteria | 1621 |
| 949 | Ga0495683_0081109 | 3300047323 | Bacteria | 1582 |
| 950 | Ga0495683_0291900 | 3300047323 | Bacteria | 703 |
| 951 | Ga0495687_015336 | 3300047443 | Bacteria | 3902 |
| 952 | Ga0495675_0009631 | 3300047444 | Bacteria | 6016 |
| 953 | Ga0495675_0368120 | 3300047444 | Bacteria | 843 |
| 954 | Ga0495677_0083670 | 3300047445 | Bacteria | 1198 |
| 955 | Ga0495677_0094653 | 3300047445 | Bacteria | 1127 |
| 956 | Ga0495677_0380474 | 3300047445 | Bacteria | 558 |
| 957 | Ga0495673_0270268 | 3300047469 | Bacteria | 616 |
| 958 | Ga0495681_0389328 | 3300047470 | Bacteria | 523 |
| 959 | Ga0495684_0135777 | 3300047471 | Bacteria | 1846 |
| 960 | Ga0495686_0026275 | 3300047472 | Bacteria | 3810 |
| 961 | Ga0495593_0000033 | 3300047673 | Bacteria | 58363 |
| 962 | Ga0495602_0019579 | 3300048088 | Bacteria | 6715 |
| 963 | Ga0495602_0575539 | 3300048088 | Bacteria | 777 |
| 964 | Ga0495614_0011420 | 3300048089 | Bacteria | 3911 |
| 965 | Ga0495615_0040399 | 3300048090 | Bacteria | 1161 |
| 966 | Ga0495626_0030649 | 3300048091 | Bacteria | 2594 |
| 967 | Ga0495626_0280746 | 3300048091 | Bacteria | 662 |
| 968 | Ga0496100_0000503 | 3300048903 | Bacteria | 18785 |
| 969 | Ga0496101_0000510 | 3300048904 | Bacteria | 24389 |
| 970 | Ga0496101_0156450 | 3300048904 | Bacteria | 1746 |
| 971 | Ga0496101_0386092 | 3300048904 | Bacteria | 1102 |
| 972 | Ga0496101_0848610 | 3300048904 | Bacteria | 720 |
| 973 | Ga0496102_0003114 | 3300048905 | Bacteria | 14069 |
| 974 | Ga0496102_0126849 | 3300048905 | Bacteria | 2386 |
| 975 | Ga0496102_0202660 | 3300048905 | Bacteria | 1870 |
| 976 | Ga0496102_0292943 | 3300048905 | Bacteria | 1534 |
| 977 | Ga0496103_0002544 | 3300048906 | Bacteria | 11424 |
| 978 | Ga0496103_0356521 | 3300048906 | Bacteria | 940 |
| 979 | Ga0496104_0017224 | 3300048907 | Bacteria | 6575 |
| 980 | Ga0496104_0029119 | 3300048907 | Bacteria | 5121 |
| 981 | Ga0496104_0029932 | 3300048907 | Bacteria | 5056 |
| 982 | Ga0496104_0602756 | 3300048907 | Bacteria | 1008 |
| 983 | Ga0496105_0005872 | 3300048908 | Bacteria | 9360 |
| 984 | Ga0496105_0171815 | 3300048908 | Bacteria | 1776 |
| 985 | Ga0496105_1233987 | 3300048908 | Bacteria | 549 |
| 986 | Ga0496106_0000327 | 3300048909 | Bacteria | 33634 |
| 987 | Ga0496106_0115424 | 3300048909 | Bacteria | 2094 |
| 988 | Ga0496107_0000143 | 3300048910 | Bacteria | 35680 |
| 989 | Ga0496107_0025470 | 3300048910 | Bacteria | 4188 |
| 990 | Ga0496107_0148058 | 3300048910 | Bacteria | 1736 |
| 991 | Ga0496107_0477856 | 3300048910 | Bacteria | 925 |
| 992 | Ga0496107_0580426 | 3300048910 | Bacteria | 829 |
| 993 | Ga0496108_0001249 | 3300048911 | Bacteria | 19881 |
| 994 | Ga0496108_0002170 | 3300048911 | Bacteria | 15738 |
| 995 | Ga0496108_0075429 | 3300048911 | Bacteria | 2849 |
| 996 | Ga0496108_1510326 | 3300048911 | Bacteria | 559 |
| 997 | Ga0496109_0000372 | 3300048912 | Bacteria | 40804 |
| 998 | Ga0496109_0001114 | 3300048912 | Bacteria | 22296 |
| 999 | Ga0496109_0145117 | 3300048912 | Bacteria | 2220 |
| 1000 | Ga0496109_0329923 | 3300048912 | Bacteria | 1440 |
| 1001 | Ga0496110_0010802 | 3300048913 | Bacteria | 7444 |
| 1002 | Ga0496110_0032262 | 3300048913 | Bacteria | 4522 |
| 1003 | Ga0496110_0665185 | 3300048913 | Bacteria | 942 |
| 1004 | Ga0496110_0980379 | 3300048913 | Bacteria | 752 |
| 1005 | Ga0496111_0001119 | 3300048914 | Bacteria | 14845 |
| 1006 | Ga0496111_0122249 | 3300048914 | Bacteria | 1923 |
| 1007 | Ga0496112_0025093 | 3300048915 | Bacteria | 5719 |
| 1008 | Ga0496112_0037410 | 3300048915 | Bacteria | 4737 |
| 1009 | Ga0496112_0161531 | 3300048915 | Bacteria | 2207 |
| 1010 | Ga0496112_0673436 | 3300048915 | Bacteria | 963 |
| 1011 | Ga0496112_0921646 | 3300048915 | Bacteria | 795 |
| 1012 | Ga0496113_0016164 | 3300048916 | Bacteria | 5150 |
| 1013 | Ga0496113_0023412 | 3300048916 | Bacteria | 4379 |
| 1014 | Ga0496113_0037303 | 3300048916 | Bacteria | 3565 |
| 1015 | Ga0496113_0224472 | 3300048916 | Bacteria | 1497 |
| 1016 | Ga0496114_0002293 | 3300048917 | Bacteria | 14586 |
| 1017 | Ga0496114_0067931 | 3300048917 | Bacteria | 2991 |
| 1018 | Ga0496114_0600170 | 3300048917 | Bacteria | 971 |
| 1019 | Ga0496114_0938436 | 3300048917 | Bacteria | 747 |
| 1020 | Ga0496115_0000555 | 3300048918 | Bacteria | 28955 |
| 1021 | Ga0496115_0016170 | 3300048918 | Bacteria | 5675 |
| 1022 | Ga0496115_0472890 | 3300048918 | Bacteria | 1010 |
| 1023 | Ga0496116_0047052 | 3300048919 | Bacteria | 2907 |
| 1024 | Ga0496116_0099838 | 3300048919 | Bacteria | 1737 |
| 1025 | Ga0496118_0041922 | 3300048921 | Bacteria | 3618 |
| 1026 | Ga0496118_0081158 | 3300048921 | Bacteria | 2278 |
| 1027 | Ga0496118_0227616 | 3300048921 | Bacteria | 1079 |
| 1028 | Ga0496118_0297511 | 3300048921 | Bacteria | 888 |
| 1029 | Ga0496119_0009360 | 3300048922 | Bacteria | 8423 |
| 1030 | Ga0496119_0053835 | 3300048922 | Bacteria | 2455 |
| 1031 | Ga0496119_0354845 | 3300048922 | Bacteria | 709 |
| 1032 | Ga0496120_0004718 | 3300048923 | Bacteria | 11225 |
| 1033 | Ga0496120_0156549 | 3300048923 | Bacteria | 1140 |
| 1034 | Ga0496121_0078626 | 3300048924 | Bacteria | 2621 |
| 1035 | Ga0496121_0083053 | 3300048924 | Bacteria | 2530 |
| 1036 | Ga0496121_0116972 | 3300048924 | Bacteria | 2020 |
| 1037 | Ga0496121_0136042 | 3300048924 | Bacteria | 1830 |
| 1038 | Ga0496121_0413523 | 3300048924 | Bacteria | 880 |
| 1039 | Ga0496124_0315973 | 3300048927 | Bacteria | 1121 |
| 1040 | Ga0496126_0012253 | 3300048929 | Bacteria | 8796 |
| 1041 | Ga0496126_0214284 | 3300048929 | Bacteria | 1620 |
| 1042 | Ga0496126_0409102 | 3300048929 | Bacteria | 1099 |
| 1043 | Ga0496126_0735377 | 3300048929 | Bacteria | 763 |
| 1044 | Ga0496126_1391407 | 3300048929 | Bacteria | 507 |
| 1045 | Ga0495682_0033259 | 3300049460 | Bacteria | 1903 |
| 1046 | Ga0501032_0018358 | 3300049569 | Bacteria | 4901 |
| 1047 | Ga0501033_0217060 | 3300049570 | Bacteria | 1362 |
| 1048 | Ga0501034_0014156 | 3300049571 | Bacteria | 8221 |
| 1049 | Ga0501034_0258683 | 3300049571 | Bacteria | 1684 |
| 1050 | Ga0501034_0807348 | 3300049571 | Bacteria | 830 |
| 1051 | Ga0501034_1718694 | 3300049571 | Bacteria | 500 |
| 1052 | Ga0501036_0021648 | 3300049572 | Bacteria | 5405 |
| 1053 | Ga0501037_0110087 | 3300049573 | Bacteria | 1984 |
| 1054 | Ga0501038_0029854 | 3300049574 | Bacteria | 4829 |
| 1055 | Ga0501039_0020116 | 3300049575 | Bacteria | 5117 |
| 1056 | Ga0501039_0655183 | 3300049575 | Bacteria | 822 |
| 1057 | Ga0501040_0846192 | 3300049576 | Bacteria | 662 |
| 1058 | Ga0501042_1363028 | 3300049578 | Bacteria | 517 |
| 1059 | Ga0501043_0020670 | 3300049579 | Bacteria | 5164 |
| 1060 | Ga0501043_1281147 | 3300049579 | Bacteria | 512 |
| 1061 | Ga0501046_0331951 | 3300049580 | Bacteria | 1106 |
| 1062 | Ga0501047_0511683 | 3300049581 | Bacteria | 1027 |
| 1063 | Ga0501047_0782210 | 3300049581 | Bacteria | 769 |
| 1064 | Ga0501047_1425808 | 3300049581 | Bacteria | 508 |
| 1065 | Ga0501067_0109307 | 3300049583 | Bacteria | 1537 |
| 1066 | Ga0501067_0173376 | 3300049583 | Bacteria | 1201 |
| 1067 | Ga0501067_0567901 | 3300049583 | Bacteria | 635 |
| 1068 | Ga0501067_0878796 | 3300049583 | Bacteria | 506 |
| 1069 | Ga0501068_0382417 | 3300049584 | Bacteria | 906 |
| 1070 | Ga0501069_0079589 | 3300049585 | Bacteria | 1845 |
| 1071 | Ga0501069_0096009 | 3300049585 | Bacteria | 1679 |
| 1072 | Ga0501070_0567041 | 3300049586 | Bacteria | 907 |
| 1073 | Ga0501070_0928544 | 3300049586 | Bacteria | 678 |
| 1074 | Ga0501071_1503593 | 3300049587 | Bacteria | 520 |
| 1075 | Ga0501072_0006089 | 3300049588 | Bacteria | 9204 |
| 1076 | Ga0501072_0046675 | 3300049588 | Bacteria | 3410 |
| 1077 | Ga0501072_0758788 | 3300049588 | Bacteria | 761 |
| 1078 | Ga0501073_0069012 | 3300049589 | Bacteria | 2463 |
| 1079 | Ga0501073_0621788 | 3300049589 | Bacteria | 746 |
| 1080 | Ga0501074_0023893 | 3300049590 | Bacteria | 4441 |
| 1081 | Ga0501074_0505132 | 3300049590 | Bacteria | 856 |
| 1082 | Ga0501075_1021414 | 3300049591 | Bacteria | 628 |
| 1083 | Ga0501076_0230372 | 3300049592 | Bacteria | 1514 |
| 1084 | Ga0501076_0325901 | 3300049592 | Bacteria | 1260 |
| 1085 | Ga0501077_0015784 | 3300049593 | Bacteria | 4756 |
| 1086 | Ga0501079_0350618 | 3300049741 | Bacteria | 1156 |
| 1087 | Ga0501080_0284181 | 3300049742 | Bacteria | 1503 |
| 1088 | Ga0501080_1229030 | 3300049742 | Bacteria | 643 |
| 1089 | Ga0501081_0170893 | 3300049743 | Bacteria | 1569 |
| 1090 | Ga0501083_0081561 | 3300049744 | Bacteria | 2144 |
| 1091 | Ga0501083_0094600 | 3300049744 | Bacteria | 1972 |
| 1092 | Ga0501083_0236461 | 3300049744 | Bacteria | 1189 |
| 1093 | Ga0501083_0600349 | 3300049744 | Bacteria | 716 |
| 1094 | Ga0501083_0888587 | 3300049744 | Bacteria | 580 |
| 1095 | Ga0501083_1012307 | 3300049744 | Unclassified | 541 |
| 1096 | Ga0501035_0062437 | 3300049822 | Bacteria | 3315 |
| 1097 | nmdc:mga03n38_156690_c1 | 3300050490 | Bacteria | 1150 |
| 1098 | nmdc:mga03n38_330829_c1 | 3300050490 | Bacteria | 825 |
| 1099 | nmdc:mga03n38_359809_c1 | 3300050490 | Bacteria | 794 |
| 1100 | nmdc:mga03n38_368717_c1 | 3300050490 | Bacteria | 785 |
| 1101 | nmdc:mga03n38_446070_c1 | 3300050490 | Bacteria | 719 |
| 1102 | nmdc:mga00v17_593731_c1 | 3300050491 | Unclassified | 714 |
| 1103 | nmdc:mga00v17_744843_c1 | 3300050491 | Bacteria | 626 |
| 1104 | nmdc:mga0yw44_1061021_c1 | 3300050492 | Bacteria | 548 |
| 1105 | nmdc:mga0yw44_13917_c1 | 3300050492 | Bacteria | 4253 |
| 1106 | nmdc:mga0yw44_166441_c1 | 3300050492 | Bacteria | 1446 |
| 1107 | nmdc:mga0yw44_2244_c1 | 3300050492 | Bacteria | 8150 |
| 1108 | nmdc:mga0k408_57039_c1 | 3300050493 | Bacteria | 2267 |
| 1109 | nmdc:mga0k408_668968_c1 | 3300050493 | Bacteria | 610 |
| 1110 | nmdc:mga06z11_124555_c1 | 3300050494 | Bacteria | 1441 |
| 1111 | nmdc:mga06z11_131151_c1 | 3300050494 | Bacteria | 1408 |
| 1112 | nmdc:mga06z11_186895_c1 | 3300050494 | Bacteria | 1197 |
| 1113 | nmdc:mga06z11_316866_c1 | 3300050494 | Bacteria | 930 |
| 1114 | nmdc:mga06z11_319435_c1 | 3300050494 | Bacteria | 926 |
| 1115 | nmdc:mga06z11_515165_c1 | 3300050494 | Bacteria | 725 |
| 1116 | nmdc:mga04h51_30189_c1 | 3300050495 | Bacteria | 1704 |
| 1117 | nmdc:mga07m45_10126_c1 | 3300050496 | Bacteria | 4914 |
| 1118 | nmdc:mga07m45_219520_c1 | 3300050496 | Bacteria | 1106 |
| 1119 | nmdc:mga07m45_34313_c1 | 3300050496 | Bacteria | 2820 |
| 1120 | nmdc:mga07m45_353521_c1 | 3300050496 | Bacteria | 854 |
| 1121 | nmdc:mga07m45_42894_c1 | 3300050496 | Bacteria | 2536 |
| 1122 | nmdc:mga05p37_582763_c1 | 3300050507 | Bacteria | 1266 |
| 1123 | nmdc:mga08y16_3663_c1 | 3300050511 | Bacteria | 15989 |
| 1124 | nmdc:mga0n895_436512_c1 | 3300050512 | Bacteria | 1323 |
| 1125 | nmdc:mga0n895_55_c1 | 3300050512 | Bacteria | 66529 |
| 1126 | nmdc:mga0rr50_230836_c1 | 3300050513 | Bacteria | 1531 |
| 1127 | nmdc:mga0rr50_357645_c1 | 3300050513 | Bacteria | 1229 |
| 1128 | nmdc:mga0a205_5630_c2 | 3300050515 | Bacteria | 8326 |
| 1129 | nmdc:mga0sz30_164413_c1 | 3300050516 | Bacteria | 983 |
| 1130 | nmdc:mga0sz30_200254_c1 | 3300050516 | Bacteria | 887 |
| 1131 | nmdc:mga0sz30_54247_c2 | 3300050516 | Bacteria | 1274 |
| 1132 | nmdc:mga0sz30_556945_c1 | 3300050516 | Bacteria | 517 |
| 1133 | nmdc:mga0sz30_86267_c1 | 3300050516 | Bacteria | 1363 |
| 1134 | Ga0495601_0036600 | 3300053077 | Bacteria | 3066 |
| 1135 | Ga0495601_0102791 | 3300053077 | Bacteria | 1847 |
| 1136 | Ga0495612_0446188 | 3300053078 | Bacteria | 591 |
| 1137 | Ga0500635_0121463 | 3300053080 | Bacteria | 978 |
| 1138 | Ga0495619_0004738 | 3300053085 | Bacteria | 8654 |
| 1139 | Ga0495619_0043221 | 3300053085 | Bacteria | 2954 |
| 1140 | Ga0495619_1005209 | 3300053085 | Bacteria | 558 |
| 1141 | Ga0500578_0161655 | 3300053086 | Bacteria | 1389 |
| 1142 | Ga0500643_000063 | 3300053087 | Bacteria | 122135 |
| 1143 | Ga0500643_196316 | 3300053087 | Bacteria | 541 |
| 1144 | Ga0500644_0155773 | 3300053088 | Bacteria | 920 |
| 1145 | Ga0500581_342998 | 3300053089 | Bacteria | 570 |
| 1146 | Ga0500647_0174997 | 3300053091 | Bacteria | 988 |
| 1147 | Ga0500651_0105613 | 3300053093 | Bacteria | 1723 |
| 1148 | Ga0500566_0009826 | 3300053094 | Bacteria | 5649 |
| 1149 | Ga0500566_0067843 | 3300053094 | Bacteria | 2007 |
| 1150 | Ga0500641_0033083 | 3300053096 | Bacteria | 2050 |
| 1151 | Ga0500555_034459 | 3300053103 | Bacteria | 1425 |
| 1152 | Ga0500556_0013711 | 3300053104 | Bacteria | 2459 |
| 1153 | Ga0500557_000177 | 3300053105 | Bacteria | 12798 |
| 1154 | Ga0500562_098476 | 3300053108 | Bacteria | 796 |
| 1155 | Ga0500569_077700 | 3300053109 | Bacteria | 1056 |
| 1156 | Ga0500594_0012364 | 3300053118 | Bacteria | 2010 |
| 1157 | Ga0500595_017336 | 3300053119 | Bacteria | 2660 |
| 1158 | Ga0500595_179950 | 3300053119 | Bacteria | 586 |
| 1159 | Ga0500607_267376 | 3300053121 | Bacteria | 663 |
| 1160 | Ga0500614_070524 | 3300053123 | Bacteria | 958 |
| 1161 | Ga0500617_070874 | 3300053124 | Bacteria | 1527 |
| 1162 | Ga0500626_067371 | 3300053128 | Bacteria | 1596 |
| 1163 | Ga0500652_170659 | 3300053131 | Bacteria | 895 |
| 1164 | Ga0500559_0124460 | 3300053136 | Bacteria | 1200 |
| 1165 | Ga0500559_0425577 | 3300053136 | Bacteria | 616 |
| 1166 | Ga0500568_0019253 | 3300053139 | Bacteria | 2970 |
| 1167 | Ga0500568_0262257 | 3300053139 | Bacteria | 629 |
| 1168 | Ga0500577_0025610 | 3300053142 | Bacteria | 1998 |
| 1169 | Ga0500577_0048303 | 3300053142 | Bacteria | 1586 |
| 1170 | Ga0500585_211349 | 3300053144 | Bacteria | 640 |
| 1171 | Ga0500588_0030517 | 3300053146 | Bacteria | 1547 |
| 1172 | Ga0500589_092826 | 3300053147 | Bacteria | 1326 |
| 1173 | Ga0500589_177959 | 3300053147 | Bacteria | 839 |
| 1174 | Ga0500590_372429 | 3300053148 | Bacteria | 500 |
| 1175 | Ga0500604_0333313 | 3300053151 | Bacteria | 527 |
| 1176 | Ga0500616_0038934 | 3300053153 | Bacteria | 2565 |
| 1177 | Ga0500616_0041628 | 3300053153 | Bacteria | 2464 |
| 1178 | Ga0500616_0391717 | 3300053153 | Bacteria | 557 |
| 1179 | Ga0500620_123812 | 3300053155 | Bacteria | 906 |
| 1180 | Ga0500627_0034508 | 3300053158 | Bacteria | 2145 |
| 1181 | Ga0500627_0215976 | 3300053158 | Bacteria | 857 |
| 1182 | Ga0500633_0077982 | 3300053160 | Bacteria | 1194 |
| 1183 | Ga0500638_053079 | 3300053162 | Bacteria | 1957 |
| 1184 | Ga0500638_308756 | 3300053162 | Bacteria | 606 |
| 1185 | Ga0500636_0000143 | 3300053177 | Bacteria | 37566 |
| 1186 | Ga0500625_000062 | 3300053729 | Bacteria | 20235 |
| 1187 | Ga0500609_016664 | 3300053731 | Bacteria | 997 |
| 1188 | Ga0500552_123777 | 3300053733 | Bacteria | 505 |
| 1189 | Ga0500599_000538 | 3300053736 | Bacteria | 3987 |
| 1190 | Ga0500601_000652 | 3300053737 | Bacteria | 4766 |
| 1191 | Ga0501084_0041580 | 3300054114 | Bacteria | 3846 |
| 1192 | Ga0501084_0657102 | 3300054114 | Bacteria | 885 |
| 1193 | Ga0587070_194221 | 3300059491 | Bacteria | 536 |
| 1194 | Ga0587085_096112 | 3300059506 | Bacteria | 619 |
| 1195 | Ga0501082_0620034 | 3300060353 | Bacteria | 947 |
| 1196 | Ga0501082_0724227 | 3300060353 | Bacteria | 871 |
| 1197 | Ga0466962_0194169 | 3300061719 | Bacteria | 991 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8016613128 | 8016618524 | 84 |
| 2 | 3300005356 | Ga0070674_100391470 | Ga0070674_1003914703 | 86 |
| 3 | 3300050490 | nmdc:mga03n38_156690_c1 | nmdc:mga03n38_156690_c1_10_285 | 91 |
| 4 | 3300053148 | Ga0500590_372429 | Ga0500590_372429_199_477 | 92 |
| 5 | 3300031995 | Ga0307409_102753106 | Ga0307409_1027531061 | 94 |
| 6 | 3300041456 | Ga0451795_0985424 | Ga0451795_0985424_50_334 | 94 |
| 7 | iso_pu_bacteria | 2524023228 | 2524537105 | 94 |
| 8 | iso_pu_bacteria | 2667528175 | 2671119992 | 94 |
| 9 | iso_pu_bacteria | 2874604998 | 2874608121 | 94 |
| 10 | iso_pu_bacteria | 2903748898 | 2903749505 | 94 |
| 11 | iso_pu_bacteria | 2904690495 | 2904690562 | 94 |
| 12 | iso_pu_bacteria | 2904699407 | 2904708755 | 94 |
| 13 | iso_pu_bacteria | 2908756301 | 2908756639 | 94 |
| 14 | iso_pu_bacteria | 3005474847 | 3005475012 | 94 |
| 15 | iso_pu_bacteria | 8006933436 | 8006936309 | 94 |
| 16 | iso_pu_bacteria | 8006973647 | 8006976278 | 94 |
| 17 | iso_pu_bacteria | 8056689827 | 8056693349 | 94 |
| 18 | 3300039450 | Ga0436363_0319292 | Ga0436363_0319292_161_460 | 95 |
| 19 | 3300009553 | Ga0105249_10617523 | Ga0105249_106175232 | 96 |
| 20 | iso_pu_bacteria | 2513237094 | 2513644110 | 96 |
| 21 | iso_pu_bacteria | 2513237101 | 2513695059 | 96 |
| 22 | iso_pu_bacteria | 2513237141 | 2513888722 | 96 |
| 23 | iso_pu_bacteria | 2643221547 | 2643758047 | 96 |
| 24 | iso_pu_bacteria | 2728368998 | 2728754941 | 96 |
| 25 | iso_pu_bacteria | 2744054633 | 2745081636 | 96 |
| 26 | iso_pu_bacteria | 2876808645 | 2876817195 | 96 |
| 27 | iso_pu_bacteria | 2879099564 | 2879108605 | 96 |
| 28 | iso_pu_bacteria | 2879110137 | 2879112110 | 96 |
| 29 | iso_pu_bacteria | 2922361189 | 2922364051 | 96 |
| 30 | iso_pu_bacteria | 2922368715 | 2922368997 | 96 |
| 31 | iso_pu_bacteria | 2922386360 | 2922392629 | 96 |
| 32 | iso_pu_bacteria | 2932784394 | 2932792867 | 96 |
| 33 | iso_pu_bacteria | 2932809354 | 2932812222 | 96 |
| 34 | iso_pu_bacteria | 2932818245 | 2932823213 | 96 |
| 35 | iso_pu_bacteria | 2932828146 | 2932836128 | 96 |
| 36 | iso_pu_bacteria | 2935616580 | 2935618465 | 96 |
| 37 | iso_pu_bacteria | 2935638405 | 2935641137 | 96 |
| 38 | iso_pu_bacteria | 2935665750 | 2935670053 | 96 |
| 39 | iso_pu_bacteria | 2935675223 | 2935679094 | 96 |
| 40 | iso_pu_bacteria | 2935684952 | 2935689968 | 96 |
| 41 | iso_pu_bacteria | 2935694250 | 2935698489 | 96 |
| 42 | iso_pu_bacteria | 2935703347 | 2935711424 | 96 |
| 43 | iso_pu_bacteria | 2935713505 | 2935717487 | 96 |
| 44 | iso_pu_bacteria | 2935722832 | 2935723843 | 96 |
| 45 | iso_pu_bacteria | 2935732158 | 2935740052 | 96 |
| 46 | iso_pu_bacteria | 2935741537 | 2935749315 | 96 |
| 47 | iso_pu_bacteria | 2935750917 | 2935757322 | 96 |
| 48 | iso_pu_bacteria | 2935760218 | 2935763592 | 96 |
| 49 | iso_pu_bacteria | 2935801545 | 2935803981 | 96 |
| 50 | iso_pu_bacteria | 2935810662 | 2935819400 | 96 |
| 51 | iso_pu_bacteria | 2935827899 | 2935835716 | 96 |
| 52 | iso_pu_bacteria | 2935837841 | 2935844663 | 96 |
| 53 | iso_pu_bacteria | 2935855204 | 2935862890 | 96 |
| 54 | iso_pu_bacteria | 2935864058 | 2935866632 | 96 |
| 55 | iso_pu_bacteria | 2935873716 | 2935874939 | 96 |
| 56 | iso_pu_bacteria | 2935992306 | 2935999786 | 96 |
| 57 | iso_pu_bacteria | 2936002035 | 2936004577 | 96 |
| 58 | iso_pu_bacteria | 2936037263 | 2936046113 | 96 |
| 59 | iso_pu_bacteria | 2940556831 | 2940563235 | 96 |
| 60 | iso_pu_bacteria | 2941538514 | 2941543152 | 96 |
| 61 | iso_pu_bacteria | 8006964411 | 8006969306 | 96 |
| 62 | iso_pu_bacteria | 8016511872 | 8016518243 | 96 |
| 63 | iso_pu_bacteria | 8017057580 | 8017058409 | 96 |
| 64 | iso_pu_bacteria | 8019576017 | 8019577287 | 96 |
| 65 | iso_pu_bacteria | 8019586578 | 8019595368 | 96 |
| 66 | iso_pu_bacteria | 8019597564 | 8019606391 | 96 |
| 67 | 3300003203 | JGI25406J46586_10011591 | JGI25406J46586_100115913 | 97 |
| 68 | 3300005548 | Ga0070665_100073736 | Ga0070665_1000737364 | 97 |
| 69 | 3300005985 | Ga0081539_10002854 | Ga0081539_1000285411 | 97 |
| 70 | 3300027671 | Ga0209588_1030270 | Ga0209588_10302702 | 97 |
| 71 | 3300028379 | Ga0268266_11163424 | Ga0268266_111634241 | 97 |
| 72 | 3300031507 | Ga0307509_10163406 | Ga0307509_101634063 | 97 |
| 73 | 3300035089 | Ga0373944_0090244 | Ga0373944_0090244_245_538 | 97 |
| 74 | 3300035111 | Ga0373923_0114522 | Ga0373923_0114522_344_637 | 97 |
| 75 | 3300035113 | Ga0373936_0006248 | Ga0373936_0006248_2727_3020 | 97 |
| 76 | 3300035117 | Ga0373953_0018189 | Ga0373953_0018189_720_1013 | 97 |
| 77 | 3300035118 | Ga0373954_0045439 | Ga0373954_0045439_1453_1746 | 97 |
| 78 | 3300035171 | Ga0373946_0006187 | Ga0373946_0006187_2239_2532 | 97 |
| 79 | 3300035410 | Ga0373924_0066939 | Ga0373924_0066939_277_570 | 97 |
| 80 | 3300035692 | Ga0373935_0005287 | Ga0373935_0005287_3786_4079 | 97 |
| 81 | 3300035695 | Ga0373927_0000121 | Ga0373927_0000121_7730_8023 | 97 |
| 82 | 3300035725 | Ga0373947_0000118 | Ga0373947_0000118_11327_11620 | 97 |
| 83 | 3300036401 | Ga0373937_1552861 | Ga0373937_1552861_241_534 | 97 |
| 84 | 3300037068 | Ga0373925_0003905 | Ga0373925_0003905_7602_7895 | 97 |
| 85 | 3300046454 | Ga0495592_0052893 | Ga0495592_0052893_1420_1713 | 97 |
| 86 | 3300046455 | Ga0495603_0000053 | Ga0495603_0000053_31927_32220 | 97 |
| 87 | 3300046459 | Ga0495629_0000879 | Ga0495629_0000879_16990_17283 | 97 |
| 88 | 3300046461 | Ga0495641_0001147 | Ga0495641_0001147_11646_11939 | 97 |
| 89 | 3300046472 | Ga0495580_0001877 | Ga0495580_0001877_3333_3626 | 97 |
| 90 | 3300046473 | Ga0495582_0000186 | Ga0495582_0000186_15429_15722 | 97 |
| 91 | 3300046475 | Ga0495639_0000078 | Ga0495639_0000078_35619_35912 | 97 |
| 92 | 3300046476 | Ga0495662_0001412 | Ga0495662_0001412_8931_9224 | 97 |
| 93 | 3300046477 | Ga0495664_0048155 | Ga0495664_0048155_72_365 | 97 |
| 94 | 3300046499 | Ga0495594_0000103 | Ga0495594_0000103_13637_13930 | 97 |
| 95 | 3300046516 | Ga0495628_0054033 | Ga0495628_0054033_1114_1407 | 97 |
| 96 | 3300046517 | Ga0495630_0003914 | Ga0495630_0003914_3711_4004 | 97 |
| 97 | 3300046526 | Ga0495666_0001779 | Ga0495666_0001779_8209_8502 | 97 |
| 98 | 3300046531 | Ga0495665_0000190 | Ga0495665_0000190_19414_19707 | 97 |
| 99 | 3300046533 | Ga0495640_0001297 | Ga0495640_0001297_15637_15930 | 97 |
| 100 | 3300046557 | Ga0495622_0001547 | Ga0495622_0001547_4578_4871 | 97 |
| 101 | 3300046642 | Ga0495634_0001169 | Ga0495634_0001169_22594_22887 | 97 |
| 102 | 3300046663 | Ga0495635_0000985 | Ga0495635_0000985_14625_14918 | 97 |
| 103 | 3300046680 | Ga0495646_0020279 | Ga0495646_0020279_1569_1862 | 97 |
| 104 | 3300046681 | Ga0495647_0000720 | Ga0495647_0000720_5853_6146 | 97 |
| 105 | 3300046683 | Ga0495658_0005321 | Ga0495658_0005321_3109_3402 | 97 |
| 106 | 3300046689 | Ga0495613_0004274 | Ga0495613_0004274_6877_7170 | 97 |
| 107 | 3300046690 | Ga0495624_0000504 | Ga0495624_0000504_9359_9652 | 97 |
| 108 | 3300047315 | Ga0495581_0000501 | Ga0495581_0000501_17155_17448 | 97 |
| 109 | 3300047317 | Ga0495604_0874787 | Ga0495604_0874787_62_355 | 97 |
| 110 | 3300047319 | Ga0495674_0000228 | Ga0495674_0000228_29587_29880 | 97 |
| 111 | 3300047320 | Ga0495672_0199732 | Ga0495672_0199732_558_851 | 97 |
| 112 | 3300047321 | Ga0495676_0015031 | Ga0495676_0015031_6085_6378 | 97 |
| 113 | 3300047673 | Ga0495593_0000033 | Ga0495593_0000033_52101_52394 | 97 |
| 114 | 3300048089 | Ga0495614_0011420 | Ga0495614_0011420_104_397 | 97 |
| 115 | 3300049575 | Ga0501039_0655183 | Ga0501039_0655183_135_428 | 97 |
| 116 | 3300049744 | Ga0501083_0081561 | Ga0501083_0081561_516_809 | 97 |
| 117 | 3300053077 | Ga0495601_0036600 | Ga0495601_0036600_1918_2211 | 97 |
| 118 | 3300053085 | Ga0495619_0004738 | Ga0495619_0004738_4335_4628 | 97 |
| 119 | iso_pu_bacteria | 2513237104 | 2513720358 | 97 |
| 120 | iso_pu_bacteria | 2881364244 | 2881365373 | 97 |
| 121 | iso_pu_bacteria | 2885409591 | 2885413922 | 97 |
| 122 | iso_pu_bacteria | 2906626472 | 2906627792 | 97 |
| 123 | iso_pu_bacteria | 8006926726 | 8006930145 | 97 |
| 124 | 3300003659 | JGI25404J52841_10018798 | JGI25404J52841_100187982 | 98 |
| 125 | 3300005327 | Ga0070658_10071251 | Ga0070658_100712514 | 98 |
| 126 | 3300005937 | Ga0081455_10380821 | Ga0081455_103808211 | 98 |
| 127 | 3300005983 | Ga0081540_1008907 | Ga0081540_10089076 | 98 |
| 128 | 3300006844 | Ga0075428_100810322 | Ga0075428_1008103222 | 98 |
| 129 | 3300006941 | Ga0099825_1027887 | Ga0099825_10278874 | 98 |
| 130 | 3300006942 | Ga0099824_1009581 | Ga0099824_10095813 | 98 |
| 131 | 3300006943 | Ga0099822_1000911 | Ga0099822_100091116 | 98 |
| 132 | 3300009545 | Ga0105237_11326812 | Ga0105237_113268122 | 98 |
| 133 | 3300010375 | Ga0105239_10502229 | Ga0105239_105022292 | 98 |
| 134 | 3300025909 | Ga0207705_10704587 | Ga0207705_107045872 | 98 |
| 135 | 3300027357 | Ga0209589_1000021 | Ga0209589_1000021171 | 98 |
| 136 | 3300027361 | Ga0209489_100028 | Ga0209489_100028171 | 98 |
| 137 | 3300027363 | Ga0209700_100037 | Ga0209700_100037171 | 98 |
| 138 | 3300033180 | Ga0307510_10468699 | Ga0307510_104686992 | 98 |
| 139 | 3300041460 | Ga0451802_1363334 | Ga0451802_1363334_30_326 | 98 |
| 140 | 3300046455 | Ga0495603_0052299 | Ga0495603_0052299_597_893 | 98 |
| 141 | 3300046474 | Ga0495605_0214392 | Ga0495605_0214392_225_521 | 98 |
| 142 | 3300046519 | Ga0495632_0362937 | Ga0495632_0362937_258_554 | 98 |
| 143 | 3300046557 | Ga0495622_0333714 | Ga0495622_0333714_78_374 | 98 |
| 144 | 3300046674 | Ga0495588_0003732 | Ga0495588_0003732_5946_6242 | 98 |
| 145 | 3300046684 | Ga0495669_0280639 | Ga0495669_0280639_221_517 | 98 |
| 146 | 3300048909 | Ga0496106_0115424 | Ga0496106_0115424_433_729 | 98 |
| 147 | 3300048910 | Ga0496107_0148058 | Ga0496107_0148058_240_536 | 98 |
| 148 | 3300048924 | Ga0496121_0116972 | Ga0496121_0116972_566_862 | 98 |
| 149 | iso_pu_bacteria | 2508501009 | 2508539111 | 99 |
| 150 | iso_pu_bacteria | 2508501042 | 2508695421 | 99 |
| 151 | iso_pu_bacteria | 2511231028 | 2511400021 | 99 |
| 152 | iso_pu_bacteria | 2513237092 | 2513626247 | 99 |
| 153 | iso_pu_bacteria | 2513237095 | 2513647650 | 99 |
| 154 | iso_pu_bacteria | 2513237102 | 2513702186 | 99 |
| 155 | iso_pu_bacteria | 2513237139 | 2513873584 | 99 |
| 156 | iso_pu_bacteria | 2513237161 | 2514012429 | 99 |
| 157 | iso_pu_bacteria | 2515154112 | 2515627386 | 99 |
| 158 | iso_pu_bacteria | 2517093001 | 2517107079 | 99 |
| 159 | iso_pu_bacteria | 2617270735 | 2617351045 | 99 |
| 160 | iso_pu_bacteria | 2617270741 | 2617373704 | 99 |
| 161 | iso_pu_bacteria | 2791355196 | 2793061987 | 99 |
| 162 | iso_pu_bacteria | 2802429603 | 2805915668 | 99 |
| 163 | iso_pu_bacteria | 2816332527 | 2818237594 | 99 |
| 164 | iso_pu_bacteria | 2824600985 | 2824606959 | 99 |
| 165 | iso_pu_bacteria | 2824609381 | 2824612268 | 99 |
| 166 | iso_pu_bacteria | 2824617872 | 2824620757 | 99 |
| 167 | iso_pu_bacteria | 2824626560 | 2824629815 | 99 |
| 168 | iso_pu_bacteria | 2824635225 | 2824641769 | 99 |
| 169 | iso_pu_bacteria | 2824644064 | 2824648362 | 99 |
| 170 | iso_pu_bacteria | 2824653114 | 2824655125 | 99 |
| 171 | iso_pu_bacteria | 2824671348 | 2824677187 | 99 |
| 172 | iso_pu_bacteria | 2824679649 | 2824685135 | 99 |
| 173 | iso_pu_bacteria | 2824687955 | 2824693656 | 99 |
| 174 | iso_pu_bacteria | 2824696289 | 2824699040 | 99 |
| 175 | iso_pu_bacteria | 2824704595 | 2824712314 | 99 |
| 176 | iso_pu_bacteria | 2824714736 | 2824722118 | 99 |
| 177 | iso_pu_bacteria | 2824723954 | 2824731046 | 99 |
| 178 | iso_pu_bacteria | 2824732956 | 2824738073 | 99 |
| 179 | iso_pu_bacteria | 2824746037 | 2824751506 | 99 |
| 180 | iso_pu_bacteria | 2824753945 | 2824757683 | 99 |
| 181 | iso_pu_bacteria | 2824763712 | 2824768805 | 99 |
| 182 | iso_pu_bacteria | 2824773399 | 2824775578 | 99 |
| 183 | iso_pu_bacteria | 2838122688 | 2838124457 | 99 |
| 184 | iso_pu_bacteria | 2841941048 | 2841945143 | 99 |
| 185 | iso_pu_bacteria | 2841949485 | 2841951925 | 99 |
| 186 | iso_pu_bacteria | 2841957949 | 2841965378 | 99 |
| 187 | iso_pu_bacteria | 2841966195 | 2841970680 | 99 |
| 188 | iso_pu_bacteria | 2841974524 | 2841980029 | 99 |
| 189 | iso_pu_bacteria | 2841983080 | 2841985208 | 99 |
| 190 | iso_pu_bacteria | 2842038055 | 2842043566 | 99 |
| 191 | iso_pu_bacteria | 2842045827 | 2842052444 | 99 |
| 192 | iso_pu_bacteria | 2844315083 | 2844315245 | 99 |
| 193 | iso_pu_bacteria | 2847930680 | 2847931018 | 99 |
| 194 | iso_pu_bacteria | 2847939898 | 2847942097 | 99 |
| 195 | iso_pu_bacteria | 2849076700 | 2849082981 | 99 |
| 196 | iso_pu_bacteria | 2857509624 | 2857511868 | 99 |
| 197 | iso_pu_bacteria | 2874590934 | 2874594389 | 99 |
| 198 | iso_pu_bacteria | 2874612657 | 2874613494 | 99 |
| 199 | iso_pu_bacteria | 2874628541 | 2874628858 | 99 |
| 200 | iso_pu_bacteria | 2874645413 | 2874649720 | 99 |
| 201 | iso_pu_bacteria | 2876771140 | 2876773881 | 99 |
| 202 | iso_pu_bacteria | 2876818435 | 2876818783 | 99 |
| 203 | iso_pu_bacteria | 2879074833 | 2879078395 | 99 |
| 204 | iso_pu_bacteria | 2879083081 | 2879085852 | 99 |
| 205 | iso_pu_bacteria | 2879127579 | 2879131009 | 99 |
| 206 | iso_pu_bacteria | 2879142872 | 2879148756 | 99 |
| 207 | iso_pu_bacteria | 2881665667 | 2881671684 | 99 |
| 208 | iso_pu_bacteria | 2885366525 | 2885371083 | 99 |
| 209 | iso_pu_bacteria | 2888378607 | 2888379649 | 99 |
| 210 | iso_pu_bacteria | 2888388044 | 2888390733 | 99 |
| 211 | iso_pu_bacteria | 2888419890 | 2888420363 | 99 |
| 212 | iso_pu_bacteria | 2889033259 | 2889035562 | 99 |
| 213 | iso_pu_bacteria | 2903727486 | 2903732144 | 99 |
| 214 | iso_pu_bacteria | 2904711408 | 2904713115 | 99 |
| 215 | iso_pu_bacteria | 2906602504 | 2906604222 | 99 |
| 216 | iso_pu_bacteria | 2906643746 | 2906647404 | 99 |
| 217 | iso_pu_bacteria | 2908775508 | 2908776194 | 99 |
| 218 | iso_pu_bacteria | 2922393267 | 2922394183 | 99 |
| 219 | iso_pu_bacteria | 2932794094 | 2932794371 | 99 |
| 220 | iso_pu_bacteria | 2932801729 | 2932807992 | 99 |
| 221 | iso_pu_bacteria | 2935608549 | 2935615246 | 99 |
| 222 | iso_pu_bacteria | 2935648319 | 2935656088 | 99 |
| 223 | iso_pu_bacteria | 2935656913 | 2935664923 | 99 |
| 224 | iso_pu_bacteria | 2935777560 | 2935783069 | 99 |
| 225 | iso_pu_bacteria | 2935785616 | 2935787915 | 99 |
| 226 | iso_pu_bacteria | 2935793552 | 2935796509 | 99 |
| 227 | iso_pu_bacteria | 2935819856 | 2935825376 | 99 |
| 228 | iso_pu_bacteria | 2935847175 | 2935853210 | 99 |
| 229 | iso_pu_bacteria | 2935883170 | 2935890096 | 99 |
| 230 | iso_pu_bacteria | 2935908558 | 2935910033 | 99 |
| 231 | iso_pu_bacteria | 2935916978 | 2935918658 | 99 |
| 232 | iso_pu_bacteria | 2935926038 | 2935928056 | 99 |
| 233 | iso_pu_bacteria | 2935934488 | 2935936072 | 99 |
| 234 | iso_pu_bacteria | 2935942939 | 2935944375 | 99 |
| 235 | iso_pu_bacteria | 2935951376 | 2935952812 | 99 |
| 236 | iso_pu_bacteria | 2935959822 | 2935962585 | 99 |
| 237 | iso_pu_bacteria | 2935967501 | 2935969652 | 99 |
| 238 | iso_pu_bacteria | 2935975950 | 2935980760 | 99 |
| 239 | iso_pu_bacteria | 2935984226 | 2935985079 | 99 |
| 240 | iso_pu_bacteria | 2936011229 | 2936018981 | 99 |
| 241 | iso_pu_bacteria | 2936019824 | 2936027627 | 99 |
| 242 | iso_pu_bacteria | 2936028420 | 2936036450 | 99 |
| 243 | iso_pu_bacteria | 2936046547 | 2936054512 | 99 |
| 244 | iso_pu_bacteria | 2936055302 | 2936056248 | 99 |
| 245 | iso_pu_bacteria | 2941531003 | 2941535567 | 99 |
| 246 | iso_pu_bacteria | 3005483717 | 3005486841 | 99 |
| 247 | iso_pu_bacteria | 3005506211 | 3005509218 | 99 |
| 248 | iso_pu_bacteria | 3005587118 | 3005592266 | 99 |
| 249 | iso_pu_bacteria | 3005594810 | 3005594970 | 99 |
| 250 | iso_pu_bacteria | 3005710791 | 3005710947 | 99 |
| 251 | iso_pu_bacteria | 3005718088 | 3005718251 | 99 |
| 252 | iso_pu_bacteria | 8016522445 | 8016526082 | 99 |
| 253 | iso_pu_bacteria | 8016530956 | 8016539690 | 99 |
| 254 | iso_pu_bacteria | 8016539877 | 8016543994 | 99 |
| 255 | iso_pu_bacteria | 8016548790 | 8016549312 | 99 |
| 256 | iso_pu_bacteria | 8016557553 | 8016557738 | 99 |
| 257 | iso_pu_bacteria | 8016566248 | 8016569393 | 99 |
| 258 | iso_pu_bacteria | 8016575299 | 8016582013 | 99 |
| 259 | iso_pu_bacteria | 8016583857 | 8016586443 | 99 |
| 260 | iso_pu_bacteria | 8016595262 | 8016595766 | 99 |
| 261 | iso_pu_bacteria | 8016603502 | 8016606627 | 99 |
| 262 | iso_pu_bacteria | 8016622563 | 8016623259 | 99 |
| 263 | iso_pu_bacteria | 8016630954 | 8016635743 | 99 |
| 264 | iso_pu_bacteria | 8019530166 | 8019530970 | 99 |
| 265 | iso_pu_bacteria | 8019538911 | 8019540614 | 99 |
| 266 | iso_pu_bacteria | 8019547302 | 8019550278 | 99 |
| 267 | iso_pu_bacteria | 8019619141 | 8019622913 | 99 |
| 268 | iso_pu_bacteria | 8019629233 | 8019630196 | 99 |
| 269 | iso_pu_bacteria | 8019648815 | 8019652537 | 99 |
| 270 | iso_pu_bacteria | 8019668869 | 8019676821 | 99 |
| 271 | iso_pu_bacteria | 8019687851 | 8019696349 | 99 |
| 272 | iso_pu_bacteria | 8056967851 | 8056971235 | 99 |
| 273 | 2010549000 | RicEn_FSXC2379_b1 | RicEn_191080 | 100 |
| 274 | 3300001430 | JGI24032J14994_100498 | JGI24032J14994_1004982 | 100 |
| 275 | 3300001904 | JGI24736J21556_1030537 | JGI24736J21556_10305372 | 100 |
| 276 | 3300001915 | JGI24741J21665_1022626 | JGI24741J21665_10226261 | 100 |
| 277 | 3300001976 | JGI24752J21851_1058508 | JGI24752J21851_10585082 | 100 |
| 278 | 3300001977 | JGI24746J21847_1000164 | JGI24746J21847_10001648 | 100 |
| 279 | 3300001978 | JGI24747J21853_1000867 | JGI24747J21853_10008673 | 100 |
| 280 | 3300001979 | JGI24740J21852_10021616 | JGI24740J21852_100216162 | 100 |
| 281 | 3300001989 | JGI24739J22299_10000152 | JGI24739J22299_1000015210 | 100 |
| 282 | 3300001990 | JGI24737J22298_10002832 | JGI24737J22298_100028322 | 100 |
| 283 | 3300001990 | JGI24737J22298_10003593 | JGI24737J22298_100035934 | 100 |
| 284 | 3300001990 | JGI24737J22298_10004593 | JGI24737J22298_100045932 | 100 |
| 285 | 3300001991 | JGI24743J22301_10036218 | JGI24743J22301_100362182 | 100 |
| 286 | 3300002070 | JGI24750J21931_1000497 | JGI24750J21931_10004976 | 100 |
| 287 | 3300002070 | JGI24750J21931_1000592 | JGI24750J21931_10005924 | 100 |
| 288 | 3300002070 | JGI24750J21931_1007504 | JGI24750J21931_10075041 | 100 |
| 289 | 3300002073 | JGI24745J21846_1000135 | JGI24745J21846_10001355 | 100 |
| 290 | 3300002074 | JGI24748J21848_1000406 | JGI24748J21848_10004065 | 100 |
| 291 | 3300002075 | JGI24738J21930_10000005 | JGI24738J21930_100000057 | 100 |
| 292 | 3300002076 | JGI24749J21850_1000199 | JGI24749J21850_100019910 | 100 |
| 293 | 3300002077 | JGI24744J21845_10000538 | JGI24744J21845_100005384 | 100 |
| 294 | 3300002126 | JGI24035J26624_1000104 | JGI24035J26624_10001045 | 100 |
| 295 | 3300002155 | JGI24033J26618_1002293 | JGI24033J26618_10022933 | 100 |
| 296 | 3300002239 | JGI24034J26672_10016367 | JGI24034J26672_100163672 | 100 |
| 297 | 3300002244 | JGI24742J22300_10000102 | JGI24742J22300_1000010212 | 100 |
| 298 | 3300002244 | JGI24742J22300_10000282 | JGI24742J22300_100002824 | 100 |
| 299 | 3300002459 | JGI24751J29686_10007280 | JGI24751J29686_100072804 | 100 |
| 300 | 3300003354 | JGI25160J50197_1020925 | JGI25160J50197_10209253 | 100 |
| 301 | 3300003371 | JGI26145J50221_1006209 | JGI26145J50221_10062092 | 100 |
| 302 | 3300003659 | JGI25404J52841_10006995 | JGI25404J52841_100069952 | 100 |
| 303 | 3300003659 | JGI25404J52841_10012821 | JGI25404J52841_100128213 | 100 |
| 304 | 3300003659 | JGI25404J52841_10094693 | JGI25404J52841_100946932 | 100 |
| 305 | 3300003911 | JGI25405J52794_10062438 | JGI25405J52794_100624381 | 100 |
| 306 | 3300003911 | JGI25405J52794_10096839 | JGI25405J52794_100968392 | 100 |
| 307 | 3300005262 | Ga0065165_1021770 | Ga0065165_10217703 | 100 |
| 308 | 3300005290 | Ga0065712_10008945 | Ga0065712_100089454 | 100 |
| 309 | 3300005290 | Ga0065712_10070038 | Ga0065712_100700383 | 100 |
| 310 | 3300005290 | Ga0065712_10076486 | Ga0065712_100764862 | 100 |
| 311 | 3300005293 | Ga0065715_10001162 | Ga0065715_100011625 | 100 |
| 312 | 3300005293 | Ga0065715_10935511 | Ga0065715_109355112 | 100 |
| 313 | 3300005328 | Ga0070676_10000789 | Ga0070676_100007898 | 100 |
| 314 | 3300005328 | Ga0070676_10386244 | Ga0070676_103862442 | 100 |
| 315 | 3300005329 | Ga0070683_100000345 | Ga0070683_10000034513 | 100 |
| 316 | 3300005329 | Ga0070683_100187827 | Ga0070683_1001878273 | 100 |
| 317 | 3300005330 | Ga0070690_100007432 | Ga0070690_1000074326 | 100 |
| 318 | 3300005330 | Ga0070690_100204002 | Ga0070690_1002040022 | 100 |
| 319 | 3300005331 | Ga0070670_100013204 | Ga0070670_1000132044 | 100 |
| 320 | 3300005331 | Ga0070670_100278346 | Ga0070670_1002783462 | 100 |
| 321 | 3300005331 | Ga0070670_101129682 | Ga0070670_1011296821 | 100 |
| 322 | 3300005333 | Ga0070677_10000389 | Ga0070677_1000038912 | 100 |
| 323 | 3300005334 | Ga0068869_100001864 | Ga0068869_1000018648 | 100 |
| 324 | 3300005335 | Ga0070666_10111076 | Ga0070666_101110763 | 100 |
| 325 | 3300005336 | Ga0070680_100005473 | Ga0070680_1000054737 | 100 |
| 326 | 3300005336 | Ga0070680_100041530 | Ga0070680_1000415305 | 100 |
| 327 | 3300005336 | Ga0070680_100057667 | Ga0070680_1000576675 | 100 |
| 328 | 3300005336 | Ga0070680_101318137 | Ga0070680_1013181371 | 100 |
| 329 | 3300005337 | Ga0070682_100000458 | Ga0070682_10000045817 | 100 |
| 330 | 3300005337 | Ga0070682_100059840 | Ga0070682_1000598403 | 100 |
| 331 | 3300005337 | Ga0070682_100218834 | Ga0070682_1002188342 | 100 |
| 332 | 3300005337 | Ga0070682_100324082 | Ga0070682_1003240822 | 100 |
| 333 | 3300005338 | Ga0068868_100000376 | Ga0068868_1000003766 | 100 |
| 334 | 3300005338 | Ga0068868_100420776 | Ga0068868_1004207762 | 100 |
| 335 | 3300005339 | Ga0070660_100001420 | Ga0070660_10000142012 | 100 |
| 336 | 3300005339 | Ga0070660_100046112 | Ga0070660_1000461121 | 100 |
| 337 | 3300005339 | Ga0070660_100139446 | Ga0070660_1001394462 | 100 |
| 338 | 3300005340 | Ga0070689_100001572 | Ga0070689_1000015726 | 100 |
| 339 | 3300005340 | Ga0070689_100071627 | Ga0070689_1000716271 | 100 |
| 340 | 3300005340 | Ga0070689_100665220 | Ga0070689_1006652201 | 100 |
| 341 | 3300005341 | Ga0070691_10000417 | Ga0070691_100004176 | 100 |
| 342 | 3300005341 | Ga0070691_10780900 | Ga0070691_107809001 | 100 |
| 343 | 3300005343 | Ga0070687_100002155 | Ga0070687_1000021554 | 100 |
| 344 | 3300005343 | Ga0070687_100058408 | Ga0070687_1000584083 | 100 |
| 345 | 3300005343 | Ga0070687_101158899 | Ga0070687_1011588991 | 100 |
| 346 | 3300005344 | Ga0070661_100001708 | Ga0070661_1000017085 | 100 |
| 347 | 3300005344 | Ga0070661_100257876 | Ga0070661_1002578762 | 100 |
| 348 | 3300005344 | Ga0070661_100339178 | Ga0070661_1003391781 | 100 |
| 349 | 3300005345 | Ga0070692_10000078 | Ga0070692_1000007816 | 100 |
| 350 | 3300005345 | Ga0070692_10009194 | Ga0070692_100091946 | 100 |
| 351 | 3300005347 | Ga0070668_100001228 | Ga0070668_1000012286 | 100 |
| 352 | 3300005347 | Ga0070668_100010386 | Ga0070668_1000103866 | 100 |
| 353 | 3300005353 | Ga0070669_100000873 | Ga0070669_1000008733 | 100 |
| 354 | 3300005353 | Ga0070669_100115177 | Ga0070669_1001151773 | 100 |
| 355 | 3300005354 | Ga0070675_100014644 | Ga0070675_1000146442 | 100 |
| 356 | 3300005354 | Ga0070675_100033712 | Ga0070675_1000337126 | 100 |
| 357 | 3300005354 | Ga0070675_101108095 | Ga0070675_1011080952 | 100 |
| 358 | 3300005354 | Ga0070675_101300371 | Ga0070675_1013003712 | 100 |
| 359 | 3300005355 | Ga0070671_100000318 | Ga0070671_10000031820 | 100 |
| 360 | 3300005356 | Ga0070674_100001672 | Ga0070674_1000016724 | 100 |
| 361 | 3300005364 | Ga0070673_100002621 | Ga0070673_1000026218 | 100 |
| 362 | 3300005364 | Ga0070673_102187560 | Ga0070673_1021875601 | 100 |
| 363 | 3300005365 | Ga0070688_100001932 | Ga0070688_1000019323 | 100 |
| 364 | 3300005365 | Ga0070688_100032747 | Ga0070688_1000327475 | 100 |
| 365 | 3300005366 | Ga0070659_100001601 | Ga0070659_10000160112 | 100 |
| 366 | 3300005366 | Ga0070659_100962930 | Ga0070659_1009629301 | 100 |
| 367 | 3300005367 | Ga0070667_100012018 | Ga0070667_1000120183 | 100 |
| 368 | 3300005367 | Ga0070667_100094662 | Ga0070667_1000946624 | 100 |
| 369 | 3300005367 | Ga0070667_100830490 | Ga0070667_1008304902 | 100 |
| 370 | 3300005406 | Ga0070703_10009498 | Ga0070703_100094983 | 100 |
| 371 | 3300005406 | Ga0070703_10053704 | Ga0070703_100537042 | 100 |
| 372 | 3300005434 | Ga0070709_10216548 | Ga0070709_102165482 | 100 |
| 373 | 3300005434 | Ga0070709_11194481 | Ga0070709_111944811 | 100 |
| 374 | 3300005435 | Ga0070714_100404021 | Ga0070714_1004040212 | 100 |
| 375 | 3300005435 | Ga0070714_100813678 | Ga0070714_1008136782 | 100 |
| 376 | 3300005435 | Ga0070714_102105439 | Ga0070714_1021054391 | 100 |
| 377 | 3300005436 | Ga0070713_100978402 | Ga0070713_1009784022 | 100 |
| 378 | 3300005436 | Ga0070713_101116947 | Ga0070713_1011169472 | 100 |
| 379 | 3300005437 | Ga0070710_10014694 | Ga0070710_100146945 | 100 |
| 380 | 3300005438 | Ga0070701_10000388 | Ga0070701_1000038816 | 100 |
| 381 | 3300005440 | Ga0070705_100050569 | Ga0070705_1000505694 | 100 |
| 382 | 3300005440 | Ga0070705_100904128 | Ga0070705_1009041282 | 100 |
| 383 | 3300005441 | Ga0070700_100000409 | Ga0070700_10000040916 | 100 |
| 384 | 3300005444 | Ga0070694_100000312 | Ga0070694_10000031225 | 100 |
| 385 | 3300005444 | Ga0070694_100018197 | Ga0070694_1000181976 | 100 |
| 386 | 3300005445 | Ga0070708_100008294 | Ga0070708_1000082948 | 100 |
| 387 | 3300005455 | Ga0070663_100003029 | Ga0070663_1000030295 | 100 |
| 388 | 3300005455 | Ga0070663_100149893 | Ga0070663_1001498933 | 100 |
| 389 | 3300005455 | Ga0070663_102069294 | Ga0070663_1020692941 | 100 |
| 390 | 3300005456 | Ga0070678_100000673 | Ga0070678_1000006738 | 100 |
| 391 | 3300005456 | Ga0070678_100571669 | Ga0070678_1005716692 | 100 |
| 392 | 3300005457 | Ga0070662_100011704 | Ga0070662_1000117041 | 100 |
| 393 | 3300005457 | Ga0070662_100019810 | Ga0070662_1000198102 | 100 |
| 394 | 3300005457 | Ga0070662_100231254 | Ga0070662_1002312542 | 100 |
| 395 | 3300005458 | Ga0070681_10001501 | Ga0070681_1000150110 | 100 |
| 396 | 3300005458 | Ga0070681_10075545 | Ga0070681_100755452 | 100 |
| 397 | 3300005458 | Ga0070681_10300250 | Ga0070681_103002501 | 100 |
| 398 | 3300005458 | Ga0070681_11721812 | Ga0070681_117218122 | 100 |
| 399 | 3300005459 | Ga0068867_100002561 | Ga0068867_1000025618 | 100 |
| 400 | 3300005466 | Ga0070685_10031691 | Ga0070685_100316913 | 100 |
| 401 | 3300005466 | Ga0070685_10109412 | Ga0070685_101094122 | 100 |
| 402 | 3300005466 | Ga0070685_10176548 | Ga0070685_101765481 | 100 |
| 403 | 3300005467 | Ga0070706_101694545 | Ga0070706_1016945452 | 100 |
| 404 | 3300005468 | Ga0070707_100905260 | Ga0070707_1009052602 | 100 |
| 405 | 3300005530 | Ga0070679_100013134 | Ga0070679_1000131346 | 100 |
| 406 | 3300005530 | Ga0070679_100083369 | Ga0070679_1000833695 | 100 |
| 407 | 3300005530 | Ga0070679_100235744 | Ga0070679_1002357442 | 100 |
| 408 | 3300005535 | Ga0070684_100004125 | Ga0070684_1000041256 | 100 |
| 409 | 3300005535 | Ga0070684_100189935 | Ga0070684_1001899352 | 100 |
| 410 | 3300005535 | Ga0070684_100236315 | Ga0070684_1002363152 | 100 |
| 411 | 3300005535 | Ga0070684_100314538 | Ga0070684_1003145382 | 100 |
| 412 | 3300005539 | Ga0068853_100013239 | Ga0068853_1000132396 | 100 |
| 413 | 3300005539 | Ga0068853_100199229 | Ga0068853_1001992292 | 100 |
| 414 | 3300005539 | Ga0068853_100328659 | Ga0068853_1003286592 | 100 |
| 415 | 3300005543 | Ga0070672_100005118 | Ga0070672_1000051185 | 100 |
| 416 | 3300005543 | Ga0070672_100384903 | Ga0070672_1003849033 | 100 |
| 417 | 3300005543 | Ga0070672_100419171 | Ga0070672_1004191712 | 100 |
| 418 | 3300005544 | Ga0070686_100005340 | Ga0070686_1000053403 | 100 |
| 419 | 3300005544 | Ga0070686_100007239 | Ga0070686_1000072396 | 100 |
| 420 | 3300005544 | Ga0070686_100736735 | Ga0070686_1007367352 | 100 |
| 421 | 3300005545 | Ga0070695_100001168 | Ga0070695_10000116814 | 100 |
| 422 | 3300005545 | Ga0070695_100008421 | Ga0070695_1000084216 | 100 |
| 423 | 3300005546 | Ga0070696_100028030 | Ga0070696_1000280302 | 100 |
| 424 | 3300005546 | Ga0070696_100182007 | Ga0070696_1001820072 | 100 |
| 425 | 3300005546 | Ga0070696_101093909 | Ga0070696_1010939092 | 100 |
| 426 | 3300005546 | Ga0070696_101548196 | Ga0070696_1015481962 | 100 |
| 427 | 3300005547 | Ga0070693_100002738 | Ga0070693_1000027387 | 100 |
| 428 | 3300005547 | Ga0070693_100143814 | Ga0070693_1001438141 | 100 |
| 429 | 3300005548 | Ga0070665_100024095 | Ga0070665_1000240956 | 100 |
| 430 | 3300005548 | Ga0070665_100258812 | Ga0070665_1002588123 | 100 |
| 431 | 3300005548 | Ga0070665_100990875 | Ga0070665_1009908752 | 100 |
| 432 | 3300005548 | Ga0070665_102600922 | Ga0070665_1026009222 | 100 |
| 433 | 3300005549 | Ga0070704_100002142 | Ga0070704_1000021426 | 100 |
| 434 | 3300005549 | Ga0070704_100012760 | Ga0070704_1000127607 | 100 |
| 435 | 3300005563 | Ga0068855_100032409 | Ga0068855_1000324096 | 100 |
| 436 | 3300005563 | Ga0068855_100795644 | Ga0068855_1007956441 | 100 |
| 437 | 3300005564 | Ga0070664_100002197 | Ga0070664_1000021973 | 100 |
| 438 | 3300005564 | Ga0070664_100090718 | Ga0070664_1000907182 | 100 |
| 439 | 3300005564 | Ga0070664_100297517 | Ga0070664_1002975172 | 100 |
| 440 | 3300005564 | Ga0070664_100474545 | Ga0070664_1004745452 | 100 |
| 441 | 3300005577 | Ga0068857_100000914 | Ga0068857_1000009143 | 100 |
| 442 | 3300005578 | Ga0068854_100002267 | Ga0068854_1000022676 | 100 |
| 443 | 3300005578 | Ga0068854_100224413 | Ga0068854_1002244132 | 100 |
| 444 | 3300005614 | Ga0068856_100007024 | Ga0068856_1000070248 | 100 |
| 445 | 3300005614 | Ga0068856_100129914 | Ga0068856_1001299143 | 100 |
| 446 | 3300005614 | Ga0068856_100216043 | Ga0068856_1002160433 | 100 |
| 447 | 3300005615 | Ga0070702_100000793 | Ga0070702_1000007936 | 100 |
| 448 | 3300005616 | Ga0068852_100001040 | Ga0068852_1000010408 | 100 |
| 449 | 3300005616 | Ga0068852_100560263 | Ga0068852_1005602632 | 100 |
| 450 | 3300005616 | Ga0068852_100596253 | Ga0068852_1005962532 | 100 |
| 451 | 3300005616 | Ga0068852_101590085 | Ga0068852_1015900852 | 100 |
| 452 | 3300005617 | Ga0068859_100023516 | Ga0068859_1000235166 | 100 |
| 453 | 3300005617 | Ga0068859_100030436 | Ga0068859_1000304366 | 100 |
| 454 | 3300005618 | Ga0068864_100001093 | Ga0068864_10000109325 | 100 |
| 455 | 3300005618 | Ga0068864_102529688 | Ga0068864_1025296881 | 100 |
| 456 | 3300005718 | Ga0068866_10000678 | Ga0068866_100006787 | 100 |
| 457 | 3300005719 | Ga0068861_100008814 | Ga0068861_1000088146 | 100 |
| 458 | 3300005719 | Ga0068861_100154224 | Ga0068861_1001542242 | 100 |
| 459 | 3300005719 | Ga0068861_100964657 | Ga0068861_1009646571 | 100 |
| 460 | 3300005840 | Ga0068870_10000128 | Ga0068870_1000012825 | 100 |
| 461 | 3300005841 | Ga0068863_100006135 | Ga0068863_1000061358 | 100 |
| 462 | 3300005842 | Ga0068858_100007003 | Ga0068858_10000700312 | 100 |
| 463 | 3300005842 | Ga0068858_100245972 | Ga0068858_1002459723 | 100 |
| 464 | 3300005842 | Ga0068858_100581234 | Ga0068858_1005812342 | 100 |
| 465 | 3300005843 | Ga0068860_100009283 | Ga0068860_1000092836 | 100 |
| 466 | 3300005843 | Ga0068860_100068439 | Ga0068860_1000684392 | 100 |
| 467 | 3300005844 | Ga0068862_100016288 | Ga0068862_1000162882 | 100 |
| 468 | 3300005844 | Ga0068862_100017378 | Ga0068862_1000173786 | 100 |
| 469 | 3300005937 | Ga0081455_10000002 | Ga0081455_10000002239 | 100 |
| 470 | 3300005937 | Ga0081455_10010596 | Ga0081455_100105964 | 100 |
| 471 | 3300005937 | Ga0081455_10018872 | Ga0081455_100188727 | 100 |
| 472 | 3300005937 | Ga0081455_10030798 | Ga0081455_100307982 | 100 |
| 473 | 3300005937 | Ga0081455_10065070 | Ga0081455_100650705 | 100 |
| 474 | 3300005937 | Ga0081455_10081865 | Ga0081455_100818653 | 100 |
| 475 | 3300005981 | Ga0081538_10011886 | Ga0081538_100118868 | 100 |
| 476 | 3300005983 | Ga0081540_1002951 | Ga0081540_100295113 | 100 |
| 477 | 3300005983 | Ga0081540_1003344 | Ga0081540_10033446 | 100 |
| 478 | 3300005983 | Ga0081540_1009850 | Ga0081540_10098504 | 100 |
| 479 | 3300005983 | Ga0081540_1012850 | Ga0081540_10128505 | 100 |
| 480 | 3300005983 | Ga0081540_1216532 | Ga0081540_12165322 | 100 |
| 481 | 3300005985 | Ga0081539_10002161 | Ga0081539_100021616 | 100 |
| 482 | 3300005985 | Ga0081539_10052381 | Ga0081539_100523812 | 100 |
| 483 | 3300005985 | Ga0081539_10305745 | Ga0081539_103057451 | 100 |
| 484 | 3300006028 | Ga0070717_10050719 | Ga0070717_100507192 | 100 |
| 485 | 3300006028 | Ga0070717_10052545 | Ga0070717_100525455 | 100 |
| 486 | 3300006038 | Ga0075365_10088472 | Ga0075365_100884722 | 100 |
| 487 | 3300006038 | Ga0075365_10938966 | Ga0075365_109389661 | 100 |
| 488 | 3300006042 | Ga0075368_10336959 | Ga0075368_103369592 | 100 |
| 489 | 3300006042 | Ga0075368_10437985 | Ga0075368_104379851 | 100 |
| 490 | 3300006048 | Ga0075363_100188948 | Ga0075363_1001889483 | 100 |
| 491 | 3300006048 | Ga0075363_100504016 | Ga0075363_1005040162 | 100 |
| 492 | 3300006051 | Ga0075364_10484450 | Ga0075364_104844501 | 100 |
| 493 | 3300006173 | Ga0070716_101640461 | Ga0070716_1016404612 | 100 |
| 494 | 3300006175 | Ga0070712_100263900 | Ga0070712_1002639001 | 100 |
| 495 | 3300006178 | Ga0075367_10096618 | Ga0075367_100966183 | 100 |
| 496 | 3300006178 | Ga0075367_10578463 | Ga0075367_105784632 | 100 |
| 497 | 3300006178 | Ga0075367_10601054 | Ga0075367_106010541 | 100 |
| 498 | 3300006178 | Ga0075367_10607986 | Ga0075367_106079862 | 100 |
| 499 | 3300006195 | Ga0075366_10356187 | Ga0075366_103561871 | 100 |
| 500 | 3300006237 | Ga0097621_100000012 | Ga0097621_10000001253 | 100 |
| 501 | 3300006237 | Ga0097621_100500282 | Ga0097621_1005002822 | 100 |
| 502 | 3300006237 | Ga0097621_100551898 | Ga0097621_1005518982 | 100 |
| 503 | 3300006353 | Ga0075370_10057807 | Ga0075370_100578072 | 100 |
| 504 | 3300006358 | Ga0068871_100000414 | Ga0068871_10000041420 | 100 |
| 505 | 3300006358 | Ga0068871_101755095 | Ga0068871_1017550952 | 100 |
| 506 | 3300006846 | Ga0075430_101614740 | Ga0075430_1016147402 | 100 |
| 507 | 3300006852 | Ga0075433_10018274 | Ga0075433_100182746 | 100 |
| 508 | 3300006871 | Ga0075434_100001246 | Ga0075434_1000012468 | 100 |
| 509 | 3300006871 | Ga0075434_100545932 | Ga0075434_1005459322 | 100 |
| 510 | 3300006881 | Ga0068865_100000908 | Ga0068865_1000009088 | 100 |
| 511 | 3300006881 | Ga0068865_100108699 | Ga0068865_1001086992 | 100 |
| 512 | 3300006914 | Ga0075436_100693543 | Ga0075436_1006935431 | 100 |
| 513 | 3300006931 | Ga0097620_100023517 | Ga0097620_1000235176 | 100 |
| 514 | 3300006931 | Ga0097620_100030437 | Ga0097620_1000304376 | 100 |
| 515 | 3300007076 | Ga0075435_100099129 | Ga0075435_1000991292 | 100 |
| 516 | 3300007076 | Ga0075435_100300148 | Ga0075435_1003001482 | 100 |
| 517 | 3300007265 | Ga0099794_10313305 | Ga0099794_103133052 | 100 |
| 518 | 3300009011 | Ga0105251_10153201 | Ga0105251_101532012 | 100 |
| 519 | 3300009092 | Ga0105250_10017271 | Ga0105250_100172714 | 100 |
| 520 | 3300009092 | Ga0105250_10122121 | Ga0105250_101221211 | 100 |
| 521 | 3300009093 | Ga0105240_10021715 | Ga0105240_100217156 | 100 |
| 522 | 3300009093 | Ga0105240_10105946 | Ga0105240_101059463 | 100 |
| 523 | 3300009093 | Ga0105240_10830924 | Ga0105240_108309242 | 100 |
| 524 | 3300009094 | Ga0111539_10007702 | Ga0111539_100077026 | 100 |
| 525 | 3300009094 | Ga0111539_10069230 | Ga0111539_100692302 | 100 |
| 526 | 3300009094 | Ga0111539_12038065 | Ga0111539_120380652 | 100 |
| 527 | 3300009098 | Ga0105245_10000090 | Ga0105245_1000009086 | 100 |
| 528 | 3300009098 | Ga0105245_10338097 | Ga0105245_103380971 | 100 |
| 529 | 3300009098 | Ga0105245_11543743 | Ga0105245_115437431 | 100 |
| 530 | 3300009101 | Ga0105247_10003459 | Ga0105247_1000345911 | 100 |
| 531 | 3300009101 | Ga0105247_10019467 | Ga0105247_100194676 | 100 |
| 532 | 3300009101 | Ga0105247_10690922 | Ga0105247_106909222 | 100 |
| 533 | 3300009147 | Ga0114129_11073010 | Ga0114129_110730102 | 100 |
| 534 | 3300009148 | Ga0105243_10002504 | Ga0105243_1000250417 | 100 |
| 535 | 3300009148 | Ga0105243_10129090 | Ga0105243_101290902 | 100 |
| 536 | 3300009174 | Ga0105241_10000475 | Ga0105241_1000047521 | 100 |
| 537 | 3300009176 | Ga0105242_10001283 | Ga0105242_100012836 | 100 |
| 538 | 3300009177 | Ga0105248_10003064 | Ga0105248_100030646 | 100 |
| 539 | 3300009177 | Ga0105248_10004418 | Ga0105248_100044188 | 100 |
| 540 | 3300009545 | Ga0105237_10002267 | Ga0105237_1000226725 | 100 |
| 541 | 3300009545 | Ga0105237_10066313 | Ga0105237_100663133 | 100 |
| 542 | 3300009545 | Ga0105237_10303800 | Ga0105237_103038002 | 100 |
| 543 | 3300009545 | Ga0105237_10610498 | Ga0105237_106104981 | 100 |
| 544 | 3300009551 | Ga0105238_10041820 | Ga0105238_100418202 | 100 |
| 545 | 3300009551 | Ga0105238_10384723 | Ga0105238_103847232 | 100 |
| 546 | 3300009551 | Ga0105238_10437279 | Ga0105238_104372792 | 100 |
| 547 | 3300009551 | Ga0105238_11268903 | Ga0105238_112689032 | 100 |
| 548 | 3300009553 | Ga0105249_10001598 | Ga0105249_1000159817 | 100 |
| 549 | 3300009553 | Ga0105249_10006092 | Ga0105249_100060926 | 100 |
| 550 | 3300009553 | Ga0105249_11533539 | Ga0105249_115335392 | 100 |
| 551 | 3300010375 | Ga0105239_10018565 | Ga0105239_100185653 | 100 |
| 552 | 3300010375 | Ga0105239_10036649 | Ga0105239_100366494 | 100 |
| 553 | 3300010375 | Ga0105239_10040255 | Ga0105239_100402555 | 100 |
| 554 | 3300011119 | Ga0105246_10000263 | Ga0105246_1000026314 | 100 |
| 555 | 3300012473 | Ga0157340_1009937 | Ga0157340_10099372 | 100 |
| 556 | 3300012476 | Ga0157344_1025724 | Ga0157344_10257241 | 100 |
| 557 | 3300012500 | Ga0157314_1001161 | Ga0157314_10011613 | 100 |
| 558 | 3300013100 | Ga0157373_10161320 | Ga0157373_101613202 | 100 |
| 559 | 3300013102 | Ga0157371_10051992 | Ga0157371_100519922 | 100 |
| 560 | 3300013104 | Ga0157370_10248202 | Ga0157370_102482022 | 100 |
| 561 | 3300013105 | Ga0157369_10093465 | Ga0157369_100934655 | 100 |
| 562 | 3300013105 | Ga0157369_10809520 | Ga0157369_108095202 | 100 |
| 563 | 3300013105 | Ga0157369_11526521 | Ga0157369_115265212 | 100 |
| 564 | 3300013105 | Ga0157369_11679706 | Ga0157369_116797061 | 100 |
| 565 | 3300013296 | Ga0157374_10001375 | Ga0157374_1000137514 | 100 |
| 566 | 3300013296 | Ga0157374_11180448 | Ga0157374_111804482 | 100 |
| 567 | 3300013297 | Ga0157378_10002550 | Ga0157378_100025507 | 100 |
| 568 | 3300013297 | Ga0157378_10014596 | Ga0157378_100145966 | 100 |
| 569 | 3300013306 | Ga0163162_10003792 | Ga0163162_100037926 | 100 |
| 570 | 3300013307 | Ga0157372_10002994 | Ga0157372_1000299416 | 100 |
| 571 | 3300013307 | Ga0157372_10308235 | Ga0157372_103082352 | 100 |
| 572 | 3300013307 | Ga0157372_12753305 | Ga0157372_127533051 | 100 |
| 573 | 3300013308 | Ga0157375_10002382 | Ga0157375_1000238216 | 100 |
| 574 | 3300013308 | Ga0157375_10276078 | Ga0157375_102760782 | 100 |
| 575 | 3300014325 | Ga0163163_10005972 | Ga0163163_100059725 | 100 |
| 576 | 3300014325 | Ga0163163_10012135 | Ga0163163_100121357 | 100 |
| 577 | 3300014325 | Ga0163163_11171980 | Ga0163163_111719801 | 100 |
| 578 | 3300014326 | Ga0157380_10000334 | Ga0157380_1000033417 | 100 |
| 579 | 3300014326 | Ga0157380_10493558 | Ga0157380_104935582 | 100 |
| 580 | 3300014745 | Ga0157377_10000249 | Ga0157377_1000024918 | 100 |
| 581 | 3300014968 | Ga0157379_10002491 | Ga0157379_1000249113 | 100 |
| 582 | 3300014968 | Ga0157379_10053828 | Ga0157379_100538283 | 100 |
| 583 | 3300014968 | Ga0157379_10058339 | Ga0157379_100583394 | 100 |
| 584 | 3300014968 | Ga0157379_10421914 | Ga0157379_104219142 | 100 |
| 585 | 3300014969 | Ga0157376_10000709 | Ga0157376_100007098 | 100 |
| 586 | 3300014969 | Ga0157376_11240021 | Ga0157376_112400212 | 100 |
| 587 | 3300014969 | Ga0157376_11457758 | Ga0157376_114577582 | 100 |
| 588 | 3300014969 | Ga0157376_12344763 | Ga0157376_123447631 | 100 |
| 589 | 3300017792 | Ga0163161_10001471 | Ga0163161_1000147114 | 100 |
| 590 | 3300020082 | Ga0206353_10185621 | Ga0206353_101856213 | 100 |
| 591 | 3300021358 | Ga0213873_10039639 | Ga0213873_100396392 | 100 |
| 592 | 3300021358 | Ga0213873_10078927 | Ga0213873_100789272 | 100 |
| 593 | 3300021377 | Ga0213874_10324072 | Ga0213874_103240721 | 100 |
| 594 | 3300021384 | Ga0213876_10076495 | Ga0213876_100764953 | 100 |
| 595 | 3300021384 | Ga0213876_10229172 | Ga0213876_102291722 | 100 |
| 596 | 3300021388 | Ga0213875_10248293 | Ga0213875_102482931 | 100 |
| 597 | 3300024225 | Ga0224572_1005889 | Ga0224572_10058893 | 100 |
| 598 | 3300024227 | Ga0228598_1046037 | Ga0228598_10460372 | 100 |
| 599 | 3300025271 | Ga0207666_1000082 | Ga0207666_100008216 | 100 |
| 600 | 3300025290 | Ga0207673_1000240 | Ga0207673_10002406 | 100 |
| 601 | 3300025302 | Ga0207426_1001527 | Ga0207426_100152715 | 100 |
| 602 | 3300025302 | Ga0207426_1027412 | Ga0207426_10274121 | 100 |
| 603 | 3300025315 | Ga0207697_10000161 | Ga0207697_1000016118 | 100 |
| 604 | 3300025321 | Ga0207656_10631489 | Ga0207656_106314892 | 100 |
| 605 | 3300025711 | Ga0207696_1027904 | Ga0207696_10279042 | 100 |
| 606 | 3300025735 | Ga0207713_1057849 | Ga0207713_10578493 | 100 |
| 607 | 3300025885 | Ga0207653_10001232 | Ga0207653_100012326 | 100 |
| 608 | 3300025893 | Ga0207682_10000164 | Ga0207682_1000016420 | 100 |
| 609 | 3300025899 | Ga0207642_10155480 | Ga0207642_101554802 | 100 |
| 610 | 3300025900 | Ga0207710_10001285 | Ga0207710_1000128515 | 100 |
| 611 | 3300025901 | Ga0207688_10000426 | Ga0207688_100004266 | 100 |
| 612 | 3300025903 | Ga0207680_10092349 | Ga0207680_100923493 | 100 |
| 613 | 3300025904 | Ga0207647_10011699 | Ga0207647_100116996 | 100 |
| 614 | 3300025906 | Ga0207699_10403469 | Ga0207699_104034692 | 100 |
| 615 | 3300025906 | Ga0207699_11212291 | Ga0207699_112122911 | 100 |
| 616 | 3300025907 | Ga0207645_10000040 | Ga0207645_100000406 | 100 |
| 617 | 3300025908 | Ga0207643_10000082 | Ga0207643_1000008263 | 100 |
| 618 | 3300025909 | Ga0207705_10026866 | Ga0207705_100268664 | 100 |
| 619 | 3300025910 | Ga0207684_10463597 | Ga0207684_104635972 | 100 |
| 620 | 3300025911 | Ga0207654_10000364 | Ga0207654_1000036418 | 100 |
| 621 | 3300025912 | Ga0207707_10002424 | Ga0207707_1000242416 | 100 |
| 622 | 3300025912 | Ga0207707_10054633 | Ga0207707_100546332 | 100 |
| 623 | 3300025912 | Ga0207707_10062173 | Ga0207707_100621731 | 100 |
| 624 | 3300025912 | Ga0207707_10517454 | Ga0207707_105174542 | 100 |
| 625 | 3300025913 | Ga0207695_10098338 | Ga0207695_100983384 | 100 |
| 626 | 3300025913 | Ga0207695_10233891 | Ga0207695_102338912 | 100 |
| 627 | 3300025913 | Ga0207695_10612112 | Ga0207695_106121122 | 100 |
| 628 | 3300025914 | Ga0207671_10056653 | Ga0207671_100566533 | 100 |
| 629 | 3300025914 | Ga0207671_11180659 | Ga0207671_111806591 | 100 |
| 630 | 3300025915 | Ga0207693_10015206 | Ga0207693_100152063 | 100 |
| 631 | 3300025915 | Ga0207693_10169696 | Ga0207693_101696962 | 100 |
| 632 | 3300025917 | Ga0207660_10000501 | Ga0207660_1000050125 | 100 |
| 633 | 3300025917 | Ga0207660_10127218 | Ga0207660_101272182 | 100 |
| 634 | 3300025917 | Ga0207660_10129945 | Ga0207660_101299452 | 100 |
| 635 | 3300025917 | Ga0207660_11695780 | Ga0207660_116957801 | 100 |
| 636 | 3300025918 | Ga0207662_10066962 | Ga0207662_100669623 | 100 |
| 637 | 3300025918 | Ga0207662_10069506 | Ga0207662_100695063 | 100 |
| 638 | 3300025918 | Ga0207662_10122337 | Ga0207662_101223373 | 100 |
| 639 | 3300025919 | Ga0207657_10002764 | Ga0207657_1000276416 | 100 |
| 640 | 3300025919 | Ga0207657_10048811 | Ga0207657_100488113 | 100 |
| 641 | 3300025919 | Ga0207657_10294043 | Ga0207657_102940432 | 100 |
| 642 | 3300025920 | Ga0207649_10000788 | Ga0207649_1000078817 | 100 |
| 643 | 3300025920 | Ga0207649_10285849 | Ga0207649_102858492 | 100 |
| 644 | 3300025920 | Ga0207649_10545726 | Ga0207649_105457261 | 100 |
| 645 | 3300025921 | Ga0207652_10001134 | Ga0207652_1000113422 | 100 |
| 646 | 3300025921 | Ga0207652_10067223 | Ga0207652_100672235 | 100 |
| 647 | 3300025921 | Ga0207652_10171401 | Ga0207652_101714013 | 100 |
| 648 | 3300025921 | Ga0207652_10327388 | Ga0207652_103273882 | 100 |
| 649 | 3300025922 | Ga0207646_10266598 | Ga0207646_102665982 | 100 |
| 650 | 3300025923 | Ga0207681_10000539 | Ga0207681_1000053924 | 100 |
| 651 | 3300025923 | Ga0207681_10375559 | Ga0207681_103755592 | 100 |
| 652 | 3300025924 | Ga0207694_10045291 | Ga0207694_100452914 | 100 |
| 653 | 3300025924 | Ga0207694_10050997 | Ga0207694_100509972 | 100 |
| 654 | 3300025924 | Ga0207694_11591151 | Ga0207694_115911511 | 100 |
| 655 | 3300025925 | Ga0207650_10001604 | Ga0207650_1000160417 | 100 |
| 656 | 3300025925 | Ga0207650_10104673 | Ga0207650_101046733 | 100 |
| 657 | 3300025925 | Ga0207650_10562197 | Ga0207650_105621971 | 100 |
| 658 | 3300025926 | Ga0207659_10004978 | Ga0207659_100049784 | 100 |
| 659 | 3300025926 | Ga0207659_10153697 | Ga0207659_101536972 | 100 |
| 660 | 3300025926 | Ga0207659_10558044 | Ga0207659_105580442 | 100 |
| 661 | 3300025927 | Ga0207687_10000063 | Ga0207687_1000006378 | 100 |
| 662 | 3300025928 | Ga0207700_10019315 | Ga0207700_100193151 | 100 |
| 663 | 3300025928 | Ga0207700_10647816 | Ga0207700_106478162 | 100 |
| 664 | 3300025929 | Ga0207664_10336651 | Ga0207664_103366512 | 100 |
| 665 | 3300025929 | Ga0207664_10745355 | Ga0207664_107453552 | 100 |
| 666 | 3300025929 | Ga0207664_11337393 | Ga0207664_113373932 | 100 |
| 667 | 3300025931 | Ga0207644_10000661 | Ga0207644_1000066120 | 100 |
| 668 | 3300025931 | Ga0207644_10256665 | Ga0207644_102566653 | 100 |
| 669 | 3300025932 | Ga0207690_10000086 | Ga0207690_1000008619 | 100 |
| 670 | 3300025933 | Ga0207706_10019107 | Ga0207706_100191076 | 100 |
| 671 | 3300025933 | Ga0207706_10340223 | Ga0207706_103402232 | 100 |
| 672 | 3300025934 | Ga0207686_10001237 | Ga0207686_100012378 | 100 |
| 673 | 3300025935 | Ga0207709_10001095 | Ga0207709_1000109517 | 100 |
| 674 | 3300025936 | Ga0207670_10000264 | Ga0207670_1000026416 | 100 |
| 675 | 3300025936 | Ga0207670_10028387 | Ga0207670_100283872 | 100 |
| 676 | 3300025937 | Ga0207669_10000228 | Ga0207669_100002285 | 100 |
| 677 | 3300025938 | Ga0207704_10000107 | Ga0207704_1000010730 | 100 |
| 678 | 3300025938 | Ga0207704_10855321 | Ga0207704_108553212 | 100 |
| 679 | 3300025938 | Ga0207704_10999319 | Ga0207704_109993191 | 100 |
| 680 | 3300025939 | Ga0207665_10000694 | Ga0207665_100006947 | 100 |
| 681 | 3300025940 | Ga0207691_10001173 | Ga0207691_1000117325 | 100 |
| 682 | 3300025941 | Ga0207711_10004273 | Ga0207711_100042737 | 100 |
| 683 | 3300025941 | Ga0207711_10012191 | Ga0207711_100121914 | 100 |
| 684 | 3300025942 | Ga0207689_10001082 | Ga0207689_1000108217 | 100 |
| 685 | 3300025944 | Ga0207661_10000427 | Ga0207661_100004275 | 100 |
| 686 | 3300025944 | Ga0207661_10476198 | Ga0207661_104761981 | 100 |
| 687 | 3300025945 | Ga0207679_10000025 | Ga0207679_1000002520 | 100 |
| 688 | 3300025945 | Ga0207679_10448343 | Ga0207679_104483432 | 100 |
| 689 | 3300025945 | Ga0207679_10532162 | Ga0207679_105321622 | 100 |
| 690 | 3300025945 | Ga0207679_10701099 | Ga0207679_107010992 | 100 |
| 691 | 3300025945 | Ga0207679_11238659 | Ga0207679_112386591 | 100 |
| 692 | 3300025949 | Ga0207667_10006928 | Ga0207667_1000692812 | 100 |
| 693 | 3300025949 | Ga0207667_10375633 | Ga0207667_103756332 | 100 |
| 694 | 3300025949 | Ga0207667_10676039 | Ga0207667_106760391 | 100 |
| 695 | 3300025960 | Ga0207651_10000081 | Ga0207651_100000817 | 100 |
| 696 | 3300025960 | Ga0207651_10839172 | Ga0207651_108391722 | 100 |
| 697 | 3300025960 | Ga0207651_11536689 | Ga0207651_115366892 | 100 |
| 698 | 3300025961 | Ga0207712_10000587 | Ga0207712_1000058711 | 100 |
| 699 | 3300025961 | Ga0207712_10016688 | Ga0207712_100166883 | 100 |
| 700 | 3300025972 | Ga0207668_10000171 | Ga0207668_1000017121 | 100 |
| 701 | 3300025981 | Ga0207640_10001295 | Ga0207640_100012956 | 100 |
| 702 | 3300025981 | Ga0207640_10390485 | Ga0207640_103904851 | 100 |
| 703 | 3300025986 | Ga0207658_10000940 | Ga0207658_1000094012 | 100 |
| 704 | 3300025986 | Ga0207658_10535107 | Ga0207658_105351072 | 100 |
| 705 | 3300026023 | Ga0207677_10000447 | Ga0207677_1000044728 | 100 |
| 706 | 3300026023 | Ga0207677_10383178 | Ga0207677_103831782 | 100 |
| 707 | 3300026035 | Ga0207703_10006213 | Ga0207703_100062137 | 100 |
| 708 | 3300026035 | Ga0207703_10085667 | Ga0207703_100856673 | 100 |
| 709 | 3300026041 | Ga0207639_10196744 | Ga0207639_101967442 | 100 |
| 710 | 3300026041 | Ga0207639_10221467 | Ga0207639_102214671 | 100 |
| 711 | 3300026041 | Ga0207639_10602681 | Ga0207639_106026812 | 100 |
| 712 | 3300026067 | Ga0207678_10001776 | Ga0207678_100017766 | 100 |
| 713 | 3300026067 | Ga0207678_10113758 | Ga0207678_101137582 | 100 |
| 714 | 3300026067 | Ga0207678_11253062 | Ga0207678_112530622 | 100 |
| 715 | 3300026078 | Ga0207702_10006918 | Ga0207702_100069185 | 100 |
| 716 | 3300026078 | Ga0207702_11291274 | Ga0207702_112912741 | 100 |
| 717 | 3300026088 | Ga0207641_10001385 | Ga0207641_100013855 | 100 |
| 718 | 3300026089 | Ga0207648_10009579 | Ga0207648_100095796 | 100 |
| 719 | 3300026095 | Ga0207676_10001643 | Ga0207676_1000164317 | 100 |
| 720 | 3300026116 | Ga0207674_10001963 | Ga0207674_100019636 | 100 |
| 721 | 3300026116 | Ga0207674_10399009 | Ga0207674_103990092 | 100 |
| 722 | 3300026116 | Ga0207674_10966893 | Ga0207674_109668932 | 100 |
| 723 | 3300026118 | Ga0207675_100002289 | Ga0207675_1000022896 | 100 |
| 724 | 3300026118 | Ga0207675_100172842 | Ga0207675_1001728422 | 100 |
| 725 | 3300026118 | Ga0207675_100715948 | Ga0207675_1007159482 | 100 |
| 726 | 3300026121 | Ga0207683_10000001 | Ga0207683_1000000120 | 100 |
| 727 | 3300026121 | Ga0207683_10336690 | Ga0207683_103366902 | 100 |
| 728 | 3300026142 | Ga0207698_10002904 | Ga0207698_1000290410 | 100 |
| 729 | 3300026142 | Ga0207698_11269177 | Ga0207698_112691772 | 100 |
| 730 | 3300027252 | Ga0209973_1024639 | Ga0209973_10246392 | 100 |
| 731 | 3300027364 | Ga0209967_1024526 | Ga0209967_10245262 | 100 |
| 732 | 3300027378 | Ga0209981_1051746 | Ga0209981_10517462 | 100 |
| 733 | 3300027395 | Ga0209996_1066226 | Ga0209996_10662262 | 100 |
| 734 | 3300027424 | Ga0209984_1012409 | Ga0209984_10124092 | 100 |
| 735 | 3300027471 | Ga0209995_1023444 | Ga0209995_10234442 | 100 |
| 736 | 3300027526 | Ga0209968_1007446 | Ga0209968_10074462 | 100 |
| 737 | 3300027543 | Ga0209999_1027018 | Ga0209999_10270182 | 100 |
| 738 | 3300027552 | Ga0209982_1008888 | Ga0209982_10088882 | 100 |
| 739 | 3300027617 | Ga0210002_1000477 | Ga0210002_10004774 | 100 |
| 740 | 3300027665 | Ga0209983_1004381 | Ga0209983_10043812 | 100 |
| 741 | 3300027682 | Ga0209971_1003482 | Ga0209971_10034825 | 100 |
| 742 | 3300027695 | Ga0209966_1002279 | Ga0209966_10022791 | 100 |
| 743 | 3300027717 | Ga0209998_10017619 | Ga0209998_100176192 | 100 |
| 744 | 3300027876 | Ga0209974_10036531 | Ga0209974_100365311 | 100 |
| 745 | 3300027907 | Ga0207428_10001279 | Ga0207428_1000127910 | 100 |
| 746 | 3300028379 | Ga0268266_10133468 | Ga0268266_101334684 | 100 |
| 747 | 3300028379 | Ga0268266_10141267 | Ga0268266_101412673 | 100 |
| 748 | 3300028380 | Ga0268265_10001152 | Ga0268265_100011525 | 100 |
| 749 | 3300028380 | Ga0268265_11174183 | Ga0268265_111741832 | 100 |
| 750 | 3300028381 | Ga0268264_10000886 | Ga0268264_100008866 | 100 |
| 751 | 3300028381 | Ga0268264_10764967 | Ga0268264_107649672 | 100 |
| 752 | 3300028381 | Ga0268264_10892555 | Ga0268264_108925552 | 100 |
| 753 | 3300028573 | Ga0265334_10101418 | Ga0265334_101014182 | 100 |
| 754 | 3300028800 | Ga0265338_10048758 | Ga0265338_100487585 | 100 |
| 755 | 3300030760 | Ga0265762_1048865 | Ga0265762_10488652 | 100 |
| 756 | 3300031235 | Ga0265330_10153765 | Ga0265330_101537652 | 100 |
| 757 | 3300031241 | Ga0265325_10004936 | Ga0265325_100049362 | 100 |
| 758 | 3300031247 | Ga0265340_10084294 | Ga0265340_100842942 | 100 |
| 759 | 3300031249 | Ga0265339_10002208 | Ga0265339_1000220812 | 100 |
| 760 | 3300031344 | Ga0265316_10300661 | Ga0265316_103006611 | 100 |
| 761 | 3300031595 | Ga0265313_10002423 | Ga0265313_1000242310 | 100 |
| 762 | 3300031595 | Ga0265313_10021599 | Ga0265313_100215993 | 100 |
| 763 | 3300031711 | Ga0265314_10001439 | Ga0265314_1000143912 | 100 |
| 764 | 3300032004 | Ga0307414_10277404 | Ga0307414_102774042 | 100 |
| 765 | 3300032005 | Ga0307411_10692387 | Ga0307411_106923872 | 100 |
| 766 | 3300034816 | Ga0373930_0019403 | Ga0373930_0019403_508_810 | 100 |
| 767 | 3300034818 | Ga0373950_0012634 | Ga0373950_0012634_129_431 | 100 |
| 768 | 3300034819 | Ga0373958_0000496 | Ga0373958_0000496_13_315 | 100 |
| 769 | 3300034819 | Ga0373958_0021372 | Ga0373958_0021372_651_953 | 100 |
| 770 | 3300034957 | Ga0373938_0000501 | Ga0373938_0000501_573_875 | 100 |
| 771 | 3300035084 | Ga0373928_0001329 | Ga0373928_0001329_2323_2625 | 100 |
| 772 | 3300035085 | Ga0373929_0005182 | Ga0373929_0005182_753_1055 | 100 |
| 773 | 3300035085 | Ga0373929_0005356 | Ga0373929_0005356_1379_1681 | 100 |
| 774 | 3300035088 | Ga0373940_0006151 | Ga0373940_0006151_1191_1493 | 100 |
| 775 | 3300035089 | Ga0373944_0207684 | Ga0373944_0207684_71_373 | 100 |
| 776 | 3300035090 | Ga0373949_0001039 | Ga0373949_0001039_2961_3263 | 100 |
| 777 | 3300035090 | Ga0373949_0002241 | Ga0373949_0002241_4091_4393 | 100 |
| 778 | 3300035091 | Ga0373951_0001036 | Ga0373951_0001036_5273_5575 | 100 |
| 779 | 3300035091 | Ga0373951_0009429 | Ga0373951_0009429_600_902 | 100 |
| 780 | 3300035092 | Ga0373952_0000019 | Ga0373952_0000019_6421_6723 | 100 |
| 781 | 3300035112 | Ga0373932_0001702 | Ga0373932_0001702_468_770 | 100 |
| 782 | 3300035114 | Ga0373939_0000216 | Ga0373939_0000216_15321_15623 | 100 |
| 783 | 3300035114 | Ga0373939_0001911 | Ga0373939_0001911_1061_1363 | 100 |
| 784 | 3300035114 | Ga0373939_0040991 | Ga0373939_0040991_19_321 | 100 |
| 785 | 3300035115 | Ga0373941_0000554 | Ga0373941_0000554_971_1273 | 100 |
| 786 | 3300035115 | Ga0373941_0000816 | Ga0373941_0000816_3496_3798 | 100 |
| 787 | 3300035121 | Ga0373960_0000120 | Ga0373960_0000120_7823_8125 | 100 |
| 788 | 3300035241 | Ga0373961_0002336 | Ga0373961_0002336_3995_4297 | 100 |
| 789 | 3300035242 | Ga0373962_0001149 | Ga0373962_0001149_5268_5570 | 100 |
| 790 | 3300035242 | Ga0373962_0051820 | Ga0373962_0051820_869_1171 | 100 |
| 791 | 3300035691 | Ga0373931_0000168 | Ga0373931_0000168_12973_13275 | 100 |
| 792 | 3300035691 | Ga0373931_0525007 | Ga0373931_0525007_452_754 | 100 |
| 793 | 3300035695 | Ga0373927_0302343 | Ga0373927_0302343_441_743 | 100 |
| 794 | 3300035724 | Ga0373933_0001546 | Ga0373933_0001546_390_692 | 100 |
| 795 | 3300035725 | Ga0373947_0692793 | Ga0373947_0692793_320_622 | 100 |
| 796 | 3300036401 | Ga0373937_0465433 | Ga0373937_0465433_395_697 | 100 |
| 797 | 3300037068 | Ga0373925_0290237 | Ga0373925_0290237_877_1179 | 100 |
| 798 | 3300037068 | Ga0373925_0306580 | Ga0373925_0306580_339_641 | 100 |
| 799 | 3300037068 | Ga0373925_0512941 | Ga0373925_0512941_293_595 | 100 |
| 800 | 3300037068 | Ga0373925_1662082 | Ga0373925_1662082_122_424 | 100 |
| 801 | 3300037466 | Ga0395898_0091902 | Ga0395898_0091902_86_388 | 100 |
| 802 | 3300037853 | Ga0436364_0763481 | Ga0436364_0763481_496_798 | 100 |
| 803 | 3300038443 | Ga0395901_0186453 | Ga0395901_0186453_1731_2033 | 100 |
| 804 | 3300038443 | Ga0395901_0240390 | Ga0395901_0240390_1380_1682 | 100 |
| 805 | 3300038698 | Ga0242419_006070 | Ga0242419_006070_459_761 | 100 |
| 806 | 3300039437 | Ga0436365_0051319 | Ga0436365_0051319_4864_5166 | 100 |
| 807 | 3300039437 | Ga0436365_1635461 | Ga0436365_1635461_769_1071 | 100 |
| 808 | 3300039438 | Ga0436360_0080726 | Ga0436360_0080726_165_467 | 100 |
| 809 | 3300039438 | Ga0436360_0202439 | Ga0436360_0202439_625_927 | 100 |
| 810 | 3300039438 | Ga0436360_1015043 | Ga0436360_1015043_457_759 | 100 |
| 811 | 3300039447 | Ga0436361_0623870 | Ga0436361_0623870_456_758 | 100 |
| 812 | 3300039450 | Ga0436363_0224834 | Ga0436363_0224834_704_1006 | 100 |
| 813 | 3300039450 | Ga0436363_0431126 | Ga0436363_0431126_320_622 | 100 |
| 814 | 3300039450 | Ga0436363_1088775 | Ga0436363_1088775_280_582 | 100 |
| 815 | 3300039453 | Ga0436362_0138270 | Ga0436362_0138270_3061_3363 | 100 |
| 816 | 3300039453 | Ga0436362_0419658 | Ga0436362_0419658_777_1079 | 100 |
| 817 | 3300039453 | Ga0436362_0743365 | Ga0436362_0743365_28_330 | 100 |
| 818 | 3300041413 | Ga0439465_0235665 | Ga0439465_0235665_353_655 | 100 |
| 819 | 3300041451 | Ga0451791_1212031 | Ga0451791_1212031_302_604 | 100 |
| 820 | 3300041496 | Ga0451839_1021691 | Ga0451839_1021691_28_330 | 100 |
| 821 | 3300042000 | Ga0439437_001742 | Ga0439437_001742_461_763 | 100 |
| 822 | 3300042001 | Ga0439441_019518 | Ga0439441_019518_621_923 | 100 |
| 823 | 3300042003 | Ga0439443_059278 | Ga0439443_059278_287_589 | 100 |
| 824 | 3300042005 | Ga0439448_0098198 | Ga0439448_0098198_597_899 | 100 |
| 825 | 3300042008 | Ga0439450_088189 | Ga0439450_088189_214_516 | 100 |
| 826 | 3300042012 | Ga0439455_0008897 | Ga0439455_0008897_543_845 | 100 |
| 827 | 3300042436 | Ga0439435_0022509 | Ga0439435_0022509_1144_1446 | 100 |
| 828 | 3300042437 | Ga0439444_0044691 | Ga0439444_0044691_95_397 | 100 |
| 829 | 3300042439 | Ga0439464_0006642 | Ga0439464_0006642_1574_1876 | 100 |
| 830 | 3300042993 | Ga0439440_0132644 | Ga0439440_0132644_310_612 | 100 |
| 831 | 3300044656 | Ga0466969_0129828 | Ga0466969_0129828_135_437 | 100 |
| 832 | 3300044656 | Ga0466969_0577827 | Ga0466969_0577827_150_452 | 100 |
| 833 | 3300044684 | Ga0466966_0389774 | Ga0466966_0389774_28_330 | 100 |
| 834 | 3300044684 | Ga0466966_0474628 | Ga0466966_0474628_76_378 | 100 |
| 835 | 3300044684 | Ga0466966_0917341 | Ga0466966_0917341_171_473 | 100 |
| 836 | 3300044765 | Ga0466970_0564740 | Ga0466970_0564740_346_648 | 100 |
| 837 | 3300045049 | Ga0466959_0406614 | Ga0466959_0406614_566_868 | 100 |
| 838 | 3300045836 | Ga0466958_0289156 | Ga0466958_0289156_493_795 | 100 |
| 839 | 3300045976 | Ga0466967_0073407 | Ga0466967_0073407_20_322 | 100 |
| 840 | 3300045976 | Ga0466967_0941903 | Ga0466967_0941903_115_417 | 100 |
| 841 | 3300045976 | Ga0466967_1877775 | Ga0466967_1877775_209_511 | 100 |
| 842 | 3300045976 | Ga0466967_2229155 | Ga0466967_2229155_89_391 | 100 |
| 843 | 3300046452 | Ga0495617_030446 | Ga0495617_030446_182_484 | 100 |
| 844 | 3300046455 | Ga0495603_0057979 | Ga0495603_0057979_1829_2131 | 100 |
| 845 | 3300046457 | Ga0495590_0250539 | Ga0495590_0250539_269_571 | 100 |
| 846 | 3300046460 | Ga0495638_0033944 | Ga0495638_0033944_1417_1719 | 100 |
| 847 | 3300046475 | Ga0495639_0170302 | Ga0495639_0170302_370_672 | 100 |
| 848 | 3300046499 | Ga0495594_0056232 | Ga0495594_0056232_853_1155 | 100 |
| 849 | 3300046500 | Ga0495596_0434902 | Ga0495596_0434902_23_325 | 100 |
| 850 | 3300046501 | Ga0495607_0507967 | Ga0495607_0507967_203_505 | 100 |
| 851 | 3300046506 | Ga0495583_0428435 | Ga0495583_0428435_184_486 | 100 |
| 852 | 3300046507 | Ga0495606_0021503 | Ga0495606_0021503_3498_3800 | 100 |
| 853 | 3300046507 | Ga0495606_0087985 | Ga0495606_0087985_881_1183 | 100 |
| 854 | 3300046513 | Ga0495616_0203405 | Ga0495616_0203405_551_853 | 100 |
| 855 | 3300046515 | Ga0495620_0158003 | Ga0495620_0158003_310_612 | 100 |
| 856 | 3300046518 | Ga0495631_0507640 | Ga0495631_0507640_170_472 | 100 |
| 857 | 3300046520 | Ga0495637_0119799 | Ga0495637_0119799_378_680 | 100 |
| 858 | 3300046522 | Ga0495643_0243841 | Ga0495643_0243841_50_352 | 100 |
| 859 | 3300046523 | Ga0495644_0105274 | Ga0495644_0105274_692_994 | 100 |
| 860 | 3300046524 | Ga0495648_0011773 | Ga0495648_0011773_4632_4934 | 100 |
| 861 | 3300046525 | Ga0495663_0353195 | Ga0495663_0353195_62_364 | 100 |
| 862 | 3300046526 | Ga0495666_0065729 | Ga0495666_0065729_14_316 | 100 |
| 863 | 3300046528 | Ga0495642_0265770 | Ga0495642_0265770_36_338 | 100 |
| 864 | 3300046530 | Ga0495654_0116440 | Ga0495654_0116440_698_1000 | 100 |
| 865 | 3300046537 | Ga0495598_0042248 | Ga0495598_0042248_799_1101 | 100 |
| 866 | 3300046557 | Ga0495622_0037463 | Ga0495622_0037463_337_639 | 100 |
| 867 | 3300046615 | Ga0495656_0343965 | Ga0495656_0343965_232_534 | 100 |
| 868 | 3300046615 | Ga0495656_0611051 | Ga0495656_0611051_177_479 | 100 |
| 869 | 3300046615 | Ga0495656_0629729 | Ga0495656_0629729_92_394 | 100 |
| 870 | 3300046616 | Ga0495668_0174901 | Ga0495668_0174901_110_412 | 100 |
| 871 | 3300046616 | Ga0495668_0191619 | Ga0495668_0191619_494_796 | 100 |
| 872 | 3300046616 | Ga0495668_0312109 | Ga0495668_0312109_411_713 | 100 |
| 873 | 3300046648 | Ga0495611_0050268 | Ga0495611_0050268_18_320 | 100 |
| 874 | 3300046660 | Ga0495625_0094117 | Ga0495625_0094117_1473_1775 | 100 |
| 875 | 3300046660 | Ga0495625_0267767 | Ga0495625_0267767_396_698 | 100 |
| 876 | 3300046664 | Ga0495659_0013263 | Ga0495659_0013263_1497_1799 | 100 |
| 877 | 3300046665 | Ga0495661_0266784 | Ga0495661_0266784_516_818 | 100 |
| 878 | 3300046674 | Ga0495588_0024229 | Ga0495588_0024229_969_1271 | 100 |
| 879 | 3300046674 | Ga0495588_0405946 | Ga0495588_0405946_245_547 | 100 |
| 880 | 3300046681 | Ga0495647_0102158 | Ga0495647_0102158_747_1049 | 100 |
| 881 | 3300046683 | Ga0495658_0810041 | Ga0495658_0810041_236_538 | 100 |
| 882 | 3300046690 | Ga0495624_0192605 | Ga0495624_0192605_565_867 | 100 |
| 883 | 3300046691 | Ga0495670_0075745 | Ga0495670_0075745_62_364 | 100 |
| 884 | 3300046692 | Ga0495671_0084620 | Ga0495671_0084620_402_704 | 100 |
| 885 | 3300046694 | Ga0495649_0022151 | Ga0495649_0022151_1650_1952 | 100 |
| 886 | 3300046794 | Ga0495589_0240153 | Ga0495589_0240153_144_446 | 100 |
| 887 | 3300047323 | Ga0495683_0068028 | Ga0495683_0068028_270_572 | 100 |
| 888 | 3300047323 | Ga0495683_0077797 | Ga0495683_0077797_324_626 | 100 |
| 889 | 3300047445 | Ga0495677_0083670 | Ga0495677_0083670_534_836 | 100 |
| 890 | 3300047445 | Ga0495677_0094653 | Ga0495677_0094653_552_854 | 100 |
| 891 | 3300047445 | Ga0495677_0380474 | Ga0495677_0380474_228_530 | 100 |
| 892 | 3300047469 | Ga0495673_0270268 | Ga0495673_0270268_88_390 | 100 |
| 893 | 3300047472 | Ga0495686_0026275 | Ga0495686_0026275_2288_2590 | 100 |
| 894 | 3300048090 | Ga0495615_0040399 | Ga0495615_0040399_355_657 | 100 |
| 895 | 3300048091 | Ga0495626_0030649 | Ga0495626_0030649_1658_1960 | 100 |
| 896 | 3300048903 | Ga0496100_0000503 | Ga0496100_0000503_8416_8718 | 100 |
| 897 | 3300048904 | Ga0496101_0000510 | Ga0496101_0000510_18530_18832 | 100 |
| 898 | 3300048904 | Ga0496101_0156450 | Ga0496101_0156450_793_1095 | 100 |
| 899 | 3300048904 | Ga0496101_0386092 | Ga0496101_0386092_544_846 | 100 |
| 900 | 3300048905 | Ga0496102_0003114 | Ga0496102_0003114_5845_6147 | 100 |
| 901 | 3300048905 | Ga0496102_0126849 | Ga0496102_0126849_503_805 | 100 |
| 902 | 3300048905 | Ga0496102_0202660 | Ga0496102_0202660_867_1169 | 100 |
| 903 | 3300048906 | Ga0496103_0002544 | Ga0496103_0002544_3072_3374 | 100 |
| 904 | 3300048906 | Ga0496103_0356521 | Ga0496103_0356521_593_895 | 100 |
| 905 | 3300048907 | Ga0496104_0017224 | Ga0496104_0017224_3203_3505 | 100 |
| 906 | 3300048907 | Ga0496104_0029119 | Ga0496104_0029119_378_680 | 100 |
| 907 | 3300048907 | Ga0496104_0029932 | Ga0496104_0029932_2798_3100 | 100 |
| 908 | 3300048909 | Ga0496106_0000327 | Ga0496106_0000327_3072_3374 | 100 |
| 909 | 3300048910 | Ga0496107_0000143 | Ga0496107_0000143_32307_32609 | 100 |
| 910 | 3300048910 | Ga0496107_0025470 | Ga0496107_0025470_463_765 | 100 |
| 911 | 3300048910 | Ga0496107_0477856 | Ga0496107_0477856_237_539 | 100 |
| 912 | 3300048910 | Ga0496107_0580426 | Ga0496107_0580426_308_610 | 100 |
| 913 | 3300048911 | Ga0496108_0001249 | Ga0496108_0001249_18366_18668 | 100 |
| 914 | 3300048911 | Ga0496108_0002170 | Ga0496108_0002170_9045_9347 | 100 |
| 915 | 3300048911 | Ga0496108_1510326 | Ga0496108_1510326_39_341 | 100 |
| 916 | 3300048912 | Ga0496109_0000372 | Ga0496109_0000372_37431_37733 | 100 |
| 917 | 3300048912 | Ga0496109_0001114 | Ga0496109_0001114_18961_19263 | 100 |
| 918 | 3300048912 | Ga0496109_0329923 | Ga0496109_0329923_38_340 | 100 |
| 919 | 3300048913 | Ga0496110_0010802 | Ga0496110_0010802_3860_4162 | 100 |
| 920 | 3300048913 | Ga0496110_0032262 | Ga0496110_0032262_32_334 | 100 |
| 921 | 3300048914 | Ga0496111_0001119 | Ga0496111_0001119_11625_11927 | 100 |
| 922 | 3300048915 | Ga0496112_0025093 | Ga0496112_0025093_311_613 | 100 |
| 923 | 3300048915 | Ga0496112_0161531 | Ga0496112_0161531_30_332 | 100 |
| 924 | 3300048915 | Ga0496112_0673436 | Ga0496112_0673436_189_491 | 100 |
| 925 | 3300048916 | Ga0496113_0016164 | Ga0496113_0016164_2135_2437 | 100 |
| 926 | 3300048916 | Ga0496113_0037303 | Ga0496113_0037303_356_658 | 100 |
| 927 | 3300048917 | Ga0496114_0002293 | Ga0496114_0002293_7328_7630 | 100 |
| 928 | 3300048917 | Ga0496114_0067931 | Ga0496114_0067931_2496_2798 | 100 |
| 929 | 3300048918 | Ga0496115_0000555 | Ga0496115_0000555_21069_21371 | 100 |
| 930 | 3300048918 | Ga0496115_0016170 | Ga0496115_0016170_4178_4480 | 100 |
| 931 | 3300048919 | Ga0496116_0099838 | Ga0496116_0099838_734_1036 | 100 |
| 932 | 3300048921 | Ga0496118_0297511 | Ga0496118_0297511_504_806 | 100 |
| 933 | 3300048922 | Ga0496119_0053835 | Ga0496119_0053835_517_819 | 100 |
| 934 | 3300048924 | Ga0496121_0078626 | Ga0496121_0078626_1384_1686 | 100 |
| 935 | 3300048929 | Ga0496126_0214284 | Ga0496126_0214284_218_520 | 100 |
| 936 | 3300048929 | Ga0496126_0409102 | Ga0496126_0409102_27_329 | 100 |
| 937 | 3300048929 | Ga0496126_0735377 | Ga0496126_0735377_336_638 | 100 |
| 938 | 3300048929 | Ga0496126_1391407 | Ga0496126_1391407_137_439 | 100 |
| 939 | 3300049460 | Ga0495682_0033259 | Ga0495682_0033259_1402_1704 | 100 |
| 940 | 3300049569 | Ga0501032_0018358 | Ga0501032_0018358_707_1009 | 100 |
| 941 | 3300049570 | Ga0501033_0217060 | Ga0501033_0217060_922_1224 | 100 |
| 942 | 3300049571 | Ga0501034_0014156 | Ga0501034_0014156_3198_3500 | 100 |
| 943 | 3300049571 | Ga0501034_0258683 | Ga0501034_0258683_665_967 | 100 |
| 944 | 3300049571 | Ga0501034_0807348 | Ga0501034_0807348_144_446 | 100 |
| 945 | 3300049571 | Ga0501034_1718694 | Ga0501034_1718694_143_445 | 100 |
| 946 | 3300049572 | Ga0501036_0021648 | Ga0501036_0021648_1590_1892 | 100 |
| 947 | 3300049573 | Ga0501037_0110087 | Ga0501037_0110087_1297_1599 | 100 |
| 948 | 3300049574 | Ga0501038_0029854 | Ga0501038_0029854_2919_3221 | 100 |
| 949 | 3300049575 | Ga0501039_0020116 | Ga0501039_0020116_3394_3696 | 100 |
| 950 | 3300049576 | Ga0501040_0846192 | Ga0501040_0846192_294_596 | 100 |
| 951 | 3300049578 | Ga0501042_1363028 | Ga0501042_1363028_177_479 | 100 |
| 952 | 3300049579 | Ga0501043_0020670 | Ga0501043_0020670_3294_3596 | 100 |
| 953 | 3300049579 | Ga0501043_1281147 | Ga0501043_1281147_21_323 | 100 |
| 954 | 3300049580 | Ga0501046_0331951 | Ga0501046_0331951_149_451 | 100 |
| 955 | 3300049581 | Ga0501047_0511683 | Ga0501047_0511683_689_991 | 100 |
| 956 | 3300049581 | Ga0501047_0782210 | Ga0501047_0782210_151_453 | 100 |
| 957 | 3300049581 | Ga0501047_1425808 | Ga0501047_1425808_64_366 | 100 |
| 958 | 3300049583 | Ga0501067_0109307 | Ga0501067_0109307_329_631 | 100 |
| 959 | 3300049583 | Ga0501067_0173376 | Ga0501067_0173376_889_1191 | 100 |
| 960 | 3300049583 | Ga0501067_0567901 | Ga0501067_0567901_44_346 | 100 |
| 961 | 3300049583 | Ga0501067_0878796 | Ga0501067_0878796_191_493 | 100 |
| 962 | 3300049584 | Ga0501068_0382417 | Ga0501068_0382417_57_359 | 100 |
| 963 | 3300049585 | Ga0501069_0079589 | Ga0501069_0079589_1455_1757 | 100 |
| 964 | 3300049585 | Ga0501069_0096009 | Ga0501069_0096009_692_994 | 100 |
| 965 | 3300049586 | Ga0501070_0567041 | Ga0501070_0567041_317_619 | 100 |
| 966 | 3300049586 | Ga0501070_0928544 | Ga0501070_0928544_313_615 | 100 |
| 967 | 3300049588 | Ga0501072_0006089 | Ga0501072_0006089_7403_7705 | 100 |
| 968 | 3300049588 | Ga0501072_0046675 | Ga0501072_0046675_2102_2404 | 100 |
| 969 | 3300049589 | Ga0501073_0069012 | Ga0501073_0069012_849_1151 | 100 |
| 970 | 3300049590 | Ga0501074_0023893 | Ga0501074_0023893_3749_4051 | 100 |
| 971 | 3300049590 | Ga0501074_0505132 | Ga0501074_0505132_15_317 | 100 |
| 972 | 3300049592 | Ga0501076_0230372 | Ga0501076_0230372_1194_1496 | 100 |
| 973 | 3300049592 | Ga0501076_0325901 | Ga0501076_0325901_904_1206 | 100 |
| 974 | 3300049593 | Ga0501077_0015784 | Ga0501077_0015784_4149_4451 | 100 |
| 975 | 3300049741 | Ga0501079_0350618 | Ga0501079_0350618_143_445 | 100 |
| 976 | 3300049742 | Ga0501080_0284181 | Ga0501080_0284181_724_1026 | 100 |
| 977 | 3300049742 | Ga0501080_1229030 | Ga0501080_1229030_235_537 | 100 |
| 978 | 3300049743 | Ga0501081_0170893 | Ga0501081_0170893_157_459 | 100 |
| 979 | 3300049744 | Ga0501083_0094600 | Ga0501083_0094600_793_1095 | 100 |
| 980 | 3300049744 | Ga0501083_0236461 | Ga0501083_0236461_555_857 | 100 |
| 981 | 3300049744 | Ga0501083_0600349 | Ga0501083_0600349_357_659 | 100 |
| 982 | 3300049744 | Ga0501083_0888587 | Ga0501083_0888587_202_504 | 100 |
| 983 | 3300049744 | Ga0501083_1012307 | Ga0501083_1012307_12_314 | 100 |
| 984 | 3300049822 | Ga0501035_0062437 | Ga0501035_0062437_1716_2018 | 100 |
| 985 | 3300050490 | nmdc:mga03n38_330829_c1 | nmdc:mga03n38_330829_c1_201_503 | 100 |
| 986 | 3300050490 | nmdc:mga03n38_446070_c1 | nmdc:mga03n38_446070_c1_86_388 | 100 |
| 987 | 3300050491 | nmdc:mga00v17_593731_c1 | nmdc:mga00v17_593731_c1_391_693 | 100 |
| 988 | 3300050491 | nmdc:mga00v17_744843_c1 | nmdc:mga00v17_744843_c1_278_580 | 100 |
| 989 | 3300050492 | nmdc:mga0yw44_2244_c1 | nmdc:mga0yw44_2244_c1_5357_5659 | 100 |
| 990 | 3300050493 | nmdc:mga0k408_668968_c1 | nmdc:mga0k408_668968_c1_29_331 | 100 |
| 991 | 3300050494 | nmdc:mga06z11_186895_c1 | nmdc:mga06z11_186895_c1_191_493 | 100 |
| 992 | 3300050494 | nmdc:mga06z11_316866_c1 | nmdc:mga06z11_316866_c1_427_729 | 100 |
| 993 | 3300050494 | nmdc:mga06z11_319435_c1 | nmdc:mga06z11_319435_c1_441_743 | 100 |
| 994 | 3300050494 | nmdc:mga06z11_515165_c1 | nmdc:mga06z11_515165_c1_47_349 | 100 |
| 995 | 3300050496 | nmdc:mga07m45_42894_c1 | nmdc:mga07m45_42894_c1_638_940 | 100 |
| 996 | 3300050507 | nmdc:mga05p37_582763_c1 | nmdc:mga05p37_582763_c1_460_762 | 100 |
| 997 | 3300050511 | nmdc:mga08y16_3663_c1 | nmdc:mga08y16_3663_c1_13500_13802 | 100 |
| 998 | 3300050512 | nmdc:mga0n895_436512_c1 | nmdc:mga0n895_436512_c1_257_559 | 100 |
| 999 | 3300050512 | nmdc:mga0n895_55_c1 | nmdc:mga0n895_55_c1_8811_9113 | 100 |
| 1000 | 3300050513 | nmdc:mga0rr50_230836_c1 | nmdc:mga0rr50_230836_c1_472_774 | 100 |
| 1001 | 3300050513 | nmdc:mga0rr50_357645_c1 | nmdc:mga0rr50_357645_c1_336_638 | 100 |
| 1002 | 3300050515 | nmdc:mga0a205_5630_c2 | nmdc:mga0a205_5630_c2_194_496 | 100 |
| 1003 | 3300053087 | Ga0500643_196316 | Ga0500643_196316_210_512 | 100 |
| 1004 | 3300053089 | Ga0500581_342998 | Ga0500581_342998_89_391 | 100 |
| 1005 | 3300053093 | Ga0500651_0105613 | Ga0500651_0105613_254_589 | 100 |
| 1006 | 3300053096 | Ga0500641_0033083 | Ga0500641_0033083_1169_1471 | 100 |
| 1007 | 3300053118 | Ga0500594_0012364 | Ga0500594_0012364_1392_1694 | 100 |
| 1008 | 3300053119 | Ga0500595_179950 | Ga0500595_179950_69_371 | 100 |
| 1009 | 3300053124 | Ga0500617_070874 | Ga0500617_070874_144_446 | 100 |
| 1010 | 3300053136 | Ga0500559_0425577 | Ga0500559_0425577_72_374 | 100 |
| 1011 | 3300053139 | Ga0500568_0262257 | Ga0500568_0262257_269_571 | 100 |
| 1012 | 3300053142 | Ga0500577_0025610 | Ga0500577_0025610_371_673 | 100 |
| 1013 | 3300053146 | Ga0500588_0030517 | Ga0500588_0030517_167_469 | 100 |
| 1014 | 3300053147 | Ga0500589_092826 | Ga0500589_092826_105_407 | 100 |
| 1015 | 3300053153 | Ga0500616_0038934 | Ga0500616_0038934_1124_1426 | 100 |
| 1016 | 3300053153 | Ga0500616_0391717 | Ga0500616_0391717_14_316 | 100 |
| 1017 | 3300053158 | Ga0500627_0215976 | Ga0500627_0215976_397_699 | 100 |
| 1018 | 3300053162 | Ga0500638_053079 | Ga0500638_053079_1430_1732 | 100 |
| 1019 | 3300054114 | Ga0501084_0041580 | Ga0501084_0041580_945_1247 | 100 |
| 1020 | 3300054114 | Ga0501084_0657102 | Ga0501084_0657102_32_334 | 100 |
| 1021 | 3300059506 | Ga0587085_096112 | Ga0587085_096112_192_494 | 100 |
| 1022 | 3300060353 | Ga0501082_0620034 | Ga0501082_0620034_254_556 | 100 |
| 1023 | 3300060353 | Ga0501082_0724227 | Ga0501082_0724227_318_620 | 100 |
| 1024 | 3300061719 | Ga0466962_0194169 | Ga0466962_0194169_319_621 | 100 |
| 1025 | 3300005435 | Ga0070714_102037223 | Ga0070714_1020372232 | 101 |
| 1026 | 3300005548 | Ga0070665_100674196 | Ga0070665_1006741962 | 101 |
| 1027 | 3300006163 | Ga0070715_10149141 | Ga0070715_101491411 | 101 |
| 1028 | 3300025905 | Ga0207685_10063706 | Ga0207685_100637062 | 101 |
| 1029 | 3300028380 | Ga0268265_11451951 | Ga0268265_114519512 | 101 |
| 1030 | 3300035119 | Ga0373956_0580804 | Ga0373956_0580804_94_399 | 101 |
| 1031 | 3300035691 | Ga0373931_0494830 | Ga0373931_0494830_195_500 | 101 |
| 1032 | 3300037418 | Ga0395900_0304771 | Ga0395900_0304771_409_714 | 101 |
| 1033 | 3300037466 | Ga0395898_0159166 | Ga0395898_0159166_607_912 | 101 |
| 1034 | 3300037471 | Ga0395905_0110910 | Ga0395905_0110910_425_730 | 101 |
| 1035 | 3300046454 | Ga0495592_0164753 | Ga0495592_0164753_447_752 | 101 |
| 1036 | 3300046462 | Ga0495651_0006742 | Ga0495651_0006742_7291_7596 | 101 |
| 1037 | 3300046476 | Ga0495662_0194068 | Ga0495662_0194068_437_742 | 101 |
| 1038 | 3300046477 | Ga0495664_0100006 | Ga0495664_0100006_618_923 | 101 |
| 1039 | 3300046516 | Ga0495628_0008202 | Ga0495628_0008202_4741_5046 | 101 |
| 1040 | 3300046529 | Ga0495652_0150715 | Ga0495652_0150715_855_1160 | 101 |
| 1041 | 3300046533 | Ga0495640_0130139 | Ga0495640_0130139_718_1023 | 101 |
| 1042 | 3300046536 | Ga0495587_0010408 | Ga0495587_0010408_1221_1526 | 101 |
| 1043 | 3300046543 | Ga0495645_0060216 | Ga0495645_0060216_722_1027 | 101 |
| 1044 | 3300046559 | Ga0495667_0110133 | Ga0495667_0110133_838_1143 | 101 |
| 1045 | 3300046642 | Ga0495634_0046747 | Ga0495634_0046747_1511_1816 | 101 |
| 1046 | 3300046663 | Ga0495635_0124568 | Ga0495635_0124568_736_1041 | 101 |
| 1047 | 3300046675 | Ga0495657_0009428 | Ga0495657_0009428_4907_5212 | 101 |
| 1048 | 3300046678 | Ga0495599_0067631 | Ga0495599_0067631_1696_2001 | 101 |
| 1049 | 3300046680 | Ga0495646_0011058 | Ga0495646_0011058_862_1167 | 101 |
| 1050 | 3300046689 | Ga0495613_0170277 | Ga0495613_0170277_255_560 | 101 |
| 1051 | 3300046809 | Ga0495600_0002231 | Ga0495600_0002231_6925_7230 | 101 |
| 1052 | 3300047317 | Ga0495604_0003943 | Ga0495604_0003943_8676_8981 | 101 |
| 1053 | 3300047322 | Ga0495680_0005216 | Ga0495680_0005216_8152_8457 | 101 |
| 1054 | 3300047444 | Ga0495675_0009631 | Ga0495675_0009631_4434_4739 | 101 |
| 1055 | 3300047444 | Ga0495675_0368120 | Ga0495675_0368120_167_472 | 101 |
| 1056 | 3300047471 | Ga0495684_0135777 | Ga0495684_0135777_1243_1548 | 101 |
| 1057 | 3300048088 | Ga0495602_0019579 | Ga0495602_0019579_2195_2500 | 101 |
| 1058 | 3300048924 | Ga0496121_0413523 | Ga0496121_0413523_401_706 | 101 |
| 1059 | 3300049589 | Ga0501073_0621788 | Ga0501073_0621788_232_537 | 101 |
| 1060 | 3300053077 | Ga0495601_0102791 | Ga0495601_0102791_1108_1413 | 101 |
| 1061 | 3300053078 | Ga0495612_0446188 | Ga0495612_0446188_94_399 | 101 |
| 1062 | 3300053085 | Ga0495619_0043221 | Ga0495619_0043221_387_692 | 101 |
| 1063 | 3300001989 | JGI24739J22299_10036217 | JGI24739J22299_100362172 | 102 |
| 1064 | 3300005353 | Ga0070669_100322880 | Ga0070669_1003228802 | 102 |
| 1065 | 3300006038 | Ga0075365_10632495 | Ga0075365_106324952 | 102 |
| 1066 | 3300025940 | Ga0207691_10390120 | Ga0207691_103901202 | 102 |
| 1067 | 3300026067 | Ga0207678_10777730 | Ga0207678_107777302 | 102 |
| 1068 | 3300031235 | Ga0265330_10231390 | Ga0265330_102313902 | 102 |
| 1069 | 3300031240 | Ga0265320_10022931 | Ga0265320_100229311 | 102 |
| 1070 | 3300031247 | Ga0265340_10042317 | Ga0265340_100423174 | 102 |
| 1071 | 3300031711 | Ga0265314_10131333 | Ga0265314_101313333 | 102 |
| 1072 | 3300046455 | Ga0495603_0137674 | Ga0495603_0137674_550_858 | 102 |
| 1073 | 3300048908 | Ga0496105_1233987 | Ga0496105_1233987_77_385 | 102 |
| 1074 | 3300050492 | nmdc:mga0yw44_1061021_c1 | nmdc:mga0yw44_1061021_c1_209_517 | 102 |
| 1075 | 3300053108 | Ga0500562_098476 | Ga0500562_098476_32_355 | 102 |
| 1076 | 2010549000 | RicEn_C1608 | RicEn_29370 | 103 |
| 1077 | 3300003214 | JGI25165J46597_1008157 | JGI25165J46597_10081572 | 103 |
| 1078 | 3300003354 | JGI25160J50197_1001122 | JGI25160J50197_100112211 | 103 |
| 1079 | 3300003354 | JGI25160J50197_1078087 | JGI25160J50197_10780871 | 103 |
| 1080 | 3300003771 | Ga0055526_1091498 | Ga0055526_10914981 | 103 |
| 1081 | 3300003775 | Ga0055524_1057430 | Ga0055524_10574302 | 103 |
| 1082 | 3300003794 | Ga0055531_10011202 | Ga0055531_100112022 | 103 |
| 1083 | 3300004625 | Ga0055543_1029757 | Ga0055543_10297572 | 103 |
| 1084 | 3300005262 | Ga0065165_1009364 | Ga0065165_10093641 | 103 |
| 1085 | 3300005262 | Ga0065165_1023472 | Ga0065165_10234721 | 103 |
| 1086 | 3300005262 | Ga0065165_1136923 | Ga0065165_11369232 | 103 |
| 1087 | 3300005329 | Ga0070683_101304579 | Ga0070683_1013045791 | 103 |
| 1088 | 3300005331 | Ga0070670_100238088 | Ga0070670_1002380882 | 103 |
| 1089 | 3300005339 | Ga0070660_100693540 | Ga0070660_1006935401 | 103 |
| 1090 | 3300005340 | Ga0070689_100529671 | Ga0070689_1005296712 | 103 |
| 1091 | 3300005344 | Ga0070661_100133110 | Ga0070661_1001331103 | 103 |
| 1092 | 3300005353 | Ga0070669_100047333 | Ga0070669_1000473335 | 103 |
| 1093 | 3300005355 | Ga0070671_100097880 | Ga0070671_1000978803 | 103 |
| 1094 | 3300005366 | Ga0070659_100201725 | Ga0070659_1002017252 | 103 |
| 1095 | 3300005367 | Ga0070667_100095483 | Ga0070667_1000954832 | 103 |
| 1096 | 3300005455 | Ga0070663_101596343 | Ga0070663_1015963431 | 103 |
| 1097 | 3300005456 | Ga0070678_101085359 | Ga0070678_1010853592 | 103 |
| 1098 | 3300005535 | Ga0070684_101560474 | Ga0070684_1015604741 | 103 |
| 1099 | 3300005548 | Ga0070665_102120303 | Ga0070665_1021203031 | 103 |
| 1100 | 3300005564 | Ga0070664_100192491 | Ga0070664_1001924912 | 103 |
| 1101 | 3300005577 | Ga0068857_100385717 | Ga0068857_1003857172 | 103 |
| 1102 | 3300005578 | Ga0068854_100164147 | Ga0068854_1001641472 | 103 |
| 1103 | 3300005614 | Ga0068856_100176210 | Ga0068856_1001762102 | 103 |
| 1104 | 3300005615 | Ga0070702_100611363 | Ga0070702_1006113632 | 103 |
| 1105 | 3300005616 | Ga0068852_100019926 | Ga0068852_1000199262 | 103 |
| 1106 | 3300005616 | Ga0068852_100281520 | Ga0068852_1002815201 | 103 |
| 1107 | 3300005618 | Ga0068864_100551765 | Ga0068864_1005517652 | 103 |
| 1108 | 3300005719 | Ga0068861_100441800 | Ga0068861_1004418002 | 103 |
| 1109 | 3300005842 | Ga0068858_100734336 | Ga0068858_1007343362 | 103 |
| 1110 | 3300005842 | Ga0068858_102352298 | Ga0068858_1023522982 | 103 |
| 1111 | 3300005843 | Ga0068860_100958438 | Ga0068860_1009584381 | 103 |
| 1112 | 3300005983 | Ga0081540_1080929 | Ga0081540_10809291 | 103 |
| 1113 | 3300006042 | Ga0075368_10012526 | Ga0075368_100125261 | 103 |
| 1114 | 3300006048 | Ga0075363_100067838 | Ga0075363_1000678383 | 103 |
| 1115 | 3300006048 | Ga0075363_100188469 | Ga0075363_1001884692 | 103 |
| 1116 | 3300006051 | Ga0075364_10078336 | Ga0075364_100783363 | 103 |
| 1117 | 3300006051 | Ga0075364_10462832 | Ga0075364_104628322 | 103 |
| 1118 | 3300006177 | Ga0075362_10202488 | Ga0075362_102024882 | 103 |
| 1119 | 3300006178 | Ga0075367_10115630 | Ga0075367_101156302 | 103 |
| 1120 | 3300006178 | Ga0075367_10589226 | Ga0075367_105892261 | 103 |
| 1121 | 3300006186 | Ga0075369_10079883 | Ga0075369_100798833 | 103 |
| 1122 | 3300006186 | Ga0075369_10110706 | Ga0075369_101107063 | 103 |
| 1123 | 3300006186 | Ga0075369_10120497 | Ga0075369_101204972 | 103 |
| 1124 | 3300006195 | Ga0075366_10021740 | Ga0075366_100217404 | 103 |
| 1125 | 3300006195 | Ga0075366_10767014 | Ga0075366_107670142 | 103 |
| 1126 | 3300006353 | Ga0075370_10071042 | Ga0075370_100710422 | 103 |
| 1127 | 3300006353 | Ga0075370_10146723 | Ga0075370_101467231 | 103 |
| 1128 | 3300006931 | Ga0097620_100933804 | Ga0097620_1009338042 | 103 |
| 1129 | 3300006942 | Ga0099824_1033850 | Ga0099824_10338503 | 103 |
| 1130 | 3300006943 | Ga0099822_1041384 | Ga0099822_10413842 | 103 |
| 1131 | 3300006944 | Ga0099823_1012311 | Ga0099823_10123117 | 103 |
| 1132 | 3300009093 | Ga0105240_10006733 | Ga0105240_100067332 | 103 |
| 1133 | 3300009098 | Ga0105245_10129919 | Ga0105245_101299194 | 103 |
| 1134 | 3300009098 | Ga0105245_10206389 | Ga0105245_102063892 | 103 |
| 1135 | 3300009101 | Ga0105247_10040318 | Ga0105247_100403184 | 103 |
| 1136 | 3300009148 | Ga0105243_10158299 | Ga0105243_101582992 | 103 |
| 1137 | 3300009174 | Ga0105241_10041983 | Ga0105241_100419835 | 103 |
| 1138 | 3300009174 | Ga0105241_10303676 | Ga0105241_103036761 | 103 |
| 1139 | 3300009177 | Ga0105248_10094136 | Ga0105248_100941363 | 103 |
| 1140 | 3300009545 | Ga0105237_10080045 | Ga0105237_100800453 | 103 |
| 1141 | 3300009551 | Ga0105238_10545617 | Ga0105238_105456172 | 103 |
| 1142 | 3300010375 | Ga0105239_10119145 | Ga0105239_101191452 | 103 |
| 1143 | 3300010375 | Ga0105239_10167699 | Ga0105239_101676992 | 103 |
| 1144 | 3300010375 | Ga0105239_13564552 | Ga0105239_135645521 | 103 |
| 1145 | 3300011119 | Ga0105246_11461355 | Ga0105246_114613551 | 103 |
| 1146 | 3300013104 | Ga0157370_10347519 | Ga0157370_103475191 | 103 |
| 1147 | 3300013105 | Ga0157369_12671230 | Ga0157369_126712302 | 103 |
| 1148 | 3300013296 | Ga0157374_10291518 | Ga0157374_102915181 | 103 |
| 1149 | 3300013297 | Ga0157378_13074281 | Ga0157378_130742812 | 103 |
| 1150 | 3300013306 | Ga0163162_10482238 | Ga0163162_104822382 | 103 |
| 1151 | 3300013307 | Ga0157372_12788277 | Ga0157372_127882772 | 103 |
| 1152 | 3300013308 | Ga0157375_12056920 | Ga0157375_120569202 | 103 |
| 1153 | 3300014326 | Ga0157380_12468072 | Ga0157380_124680722 | 103 |
| 1154 | 3300014497 | Ga0182008_10446941 | Ga0182008_104469411 | 103 |
| 1155 | 3300017792 | Ga0163161_11805712 | Ga0163161_118057122 | 103 |
| 1156 | 3300021320 | Ga0214544_1008398 | Ga0214544_100839817 | 103 |
| 1157 | 3300021321 | Ga0214542_1005602 | Ga0214542_10056021 | 103 |
| 1158 | 3300021321 | Ga0214542_1036118 | Ga0214542_10361182 | 103 |
| 1159 | 3300021324 | Ga0214545_1000640 | Ga0214545_100064063 | 103 |
| 1160 | 3300021324 | Ga0214545_1034133 | Ga0214545_10341332 | 103 |
| 1161 | 3300021327 | Ga0214543_1009848 | Ga0214543_100984814 | 103 |
| 1162 | 3300021327 | Ga0214543_1039535 | Ga0214543_10395352 | 103 |
| 1163 | 3300025253 | Ga0209677_107668 | Ga0209677_1076682 | 103 |
| 1164 | 3300025254 | Ga0209148_1000275 | Ga0209148_100027546 | 103 |
| 1165 | 3300025261 | Ga0209233_1001359 | Ga0209233_10013597 | 103 |
| 1166 | 3300025272 | Ga0209455_1013785 | Ga0209455_10137852 | 103 |
| 1167 | 3300025273 | Ga0209673_1017321 | Ga0209673_10173212 | 103 |
| 1168 | 3300025295 | Ga0209564_1009422 | Ga0209564_10094227 | 103 |
| 1169 | 3300025295 | Ga0209564_1015893 | Ga0209564_10158934 | 103 |
| 1170 | 3300025297 | Ga0209758_1001177 | Ga0209758_100117730 | 103 |
| 1171 | 3300025297 | Ga0209758_1001736 | Ga0209758_100173621 | 103 |
| 1172 | 3300025297 | Ga0209758_1004318 | Ga0209758_10043184 | 103 |
| 1173 | 3300025297 | Ga0209758_1007225 | Ga0209758_10072259 | 103 |
| 1174 | 3300025297 | Ga0209758_1017374 | Ga0209758_10173744 | 103 |
| 1175 | 3300025297 | Ga0209758_1047251 | Ga0209758_10472512 | 103 |
| 1176 | 3300025299 | Ga0209256_1014969 | Ga0209256_10149693 | 103 |
| 1177 | 3300025302 | Ga0207426_1001552 | Ga0207426_100155215 | 103 |
| 1178 | 3300025302 | Ga0207426_1003596 | Ga0207426_10035966 | 103 |
| 1179 | 3300025302 | Ga0207426_1022473 | Ga0207426_10224732 | 103 |
| 1180 | 3300025304 | Ga0209257_1003456 | Ga0209257_100345615 | 103 |
| 1181 | 3300025304 | Ga0209257_1026569 | Ga0209257_10265693 | 103 |
| 1182 | 3300025315 | Ga0207697_10131525 | Ga0207697_101315252 | 103 |
| 1183 | 3300025904 | Ga0207647_10074901 | Ga0207647_100749012 | 103 |
| 1184 | 3300025908 | Ga0207643_10380061 | Ga0207643_103800612 | 103 |
| 1185 | 3300025911 | Ga0207654_10083585 | Ga0207654_100835853 | 103 |
| 1186 | 3300025911 | Ga0207654_10202299 | Ga0207654_102022992 | 103 |
| 1187 | 3300025913 | Ga0207695_10000107 | Ga0207695_10000107172 | 103 |
| 1188 | 3300025913 | Ga0207695_11115400 | Ga0207695_111154001 | 103 |
| 1189 | 3300025914 | Ga0207671_10007354 | Ga0207671_100073547 | 103 |
| 1190 | 3300025914 | Ga0207671_10183041 | Ga0207671_101830412 | 103 |
| 1191 | 3300025919 | Ga0207657_10302268 | Ga0207657_103022682 | 103 |
| 1192 | 3300025920 | Ga0207649_10104857 | Ga0207649_101048573 | 103 |
| 1193 | 3300025923 | Ga0207681_10350826 | Ga0207681_103508262 | 103 |
| 1194 | 3300025924 | Ga0207694_10316187 | Ga0207694_103161871 | 103 |
| 1195 | 3300025926 | Ga0207659_10413123 | Ga0207659_104131231 | 103 |
| 1196 | 3300025931 | Ga0207644_10091510 | Ga0207644_100915102 | 103 |
| 1197 | 3300025932 | Ga0207690_10380337 | Ga0207690_103803372 | 103 |
| 1198 | 3300025933 | Ga0207706_10363597 | Ga0207706_103635972 | 103 |
| 1199 | 3300025936 | Ga0207670_10359565 | Ga0207670_103595652 | 103 |
| 1200 | 3300025938 | Ga0207704_11800361 | Ga0207704_118003611 | 103 |
| 1201 | 3300025941 | Ga0207711_10648103 | Ga0207711_106481032 | 103 |
| 1202 | 3300025941 | Ga0207711_10774540 | Ga0207711_107745402 | 103 |
| 1203 | 3300025942 | Ga0207689_10206229 | Ga0207689_102062293 | 103 |
| 1204 | 3300025944 | Ga0207661_11483823 | Ga0207661_114838231 | 103 |
| 1205 | 3300025981 | Ga0207640_10184781 | Ga0207640_101847811 | 103 |
| 1206 | 3300026023 | Ga0207677_11049957 | Ga0207677_110499571 | 103 |
| 1207 | 3300026035 | Ga0207703_11266951 | Ga0207703_112669511 | 103 |
| 1208 | 3300026035 | Ga0207703_11386263 | Ga0207703_113862632 | 103 |
| 1209 | 3300026041 | Ga0207639_11144247 | Ga0207639_111442472 | 103 |
| 1210 | 3300026067 | Ga0207678_10087980 | Ga0207678_100879802 | 103 |
| 1211 | 3300026095 | Ga0207676_10203783 | Ga0207676_102037832 | 103 |
| 1212 | 3300026116 | Ga0207674_10101501 | Ga0207674_101015015 | 103 |
| 1213 | 3300026116 | Ga0207674_10456876 | Ga0207674_104568762 | 103 |
| 1214 | 3300026118 | Ga0207675_100454248 | Ga0207675_1004542481 | 103 |
| 1215 | 3300026121 | Ga0207683_12148403 | Ga0207683_121484031 | 103 |
| 1216 | 3300027296 | Ga0209389_1000153 | Ga0209389_100015360 | 103 |
| 1217 | 3300027296 | Ga0209389_1001970 | Ga0209389_100197013 | 103 |
| 1218 | 3300027357 | Ga0209589_1001441 | Ga0209589_100144113 | 103 |
| 1219 | 3300027361 | Ga0209489_100936 | Ga0209489_1009367 | 103 |
| 1220 | 3300027361 | Ga0209489_107925 | Ga0209489_10792513 | 103 |
| 1221 | 3300027363 | Ga0209700_100011 | Ga0209700_100011144 | 103 |
| 1222 | 3300027866 | Ga0209813_10019795 | Ga0209813_100197952 | 103 |
| 1223 | 3300027866 | Ga0209813_10283706 | Ga0209813_102837061 | 103 |
| 1224 | 3300028379 | Ga0268266_10138462 | Ga0268266_101384623 | 103 |
| 1225 | 3300028381 | Ga0268264_12701494 | Ga0268264_127014942 | 103 |
| 1226 | 3300031616 | Ga0307508_10803923 | Ga0307508_108039232 | 103 |
| 1227 | 3300033180 | Ga0307510_10047169 | Ga0307510_100471695 | 103 |
| 1228 | 3300033180 | Ga0307510_10057372 | Ga0307510_100573725 | 103 |
| 1229 | 3300035121 | Ga0373960_0434649 | Ga0373960_0434649_137_448 | 103 |
| 1230 | 3300035691 | Ga0373931_0534481 | Ga0373931_0534481_396_707 | 103 |
| 1231 | 3300037418 | Ga0395900_0000623 | Ga0395900_0000623_22802_23116 | 103 |
| 1232 | 3300037466 | Ga0395898_0005100 | Ga0395898_0005100_11111_11425 | 103 |
| 1233 | 3300037471 | Ga0395905_0008122 | Ga0395905_0008122_5092_5403 | 103 |
| 1234 | 3300037471 | Ga0395905_0101686 | Ga0395905_0101686_2225_2539 | 103 |
| 1235 | 3300037471 | Ga0395905_0978275 | Ga0395905_0978275_68_379 | 103 |
| 1236 | 3300038443 | Ga0395901_0025332 | Ga0395901_0025332_2685_2999 | 103 |
| 1237 | 3300038443 | Ga0395901_1922363 | Ga0395901_1922363_39_350 | 103 |
| 1238 | 3300039437 | Ga0436365_1514182 | Ga0436365_1514182_292_603 | 103 |
| 1239 | 3300041413 | Ga0439465_0135724 | Ga0439465_0135724_419_730 | 103 |
| 1240 | 3300041451 | Ga0451791_1591294 | Ga0451791_1591294_384_695 | 103 |
| 1241 | 3300041452 | Ga0451793_0115389 | Ga0451793_0115389_248_559 | 103 |
| 1242 | 3300041453 | Ga0451797_1054811 | Ga0451797_1054811_85_396 | 103 |
| 1243 | 3300041458 | Ga0451798_0684963 | Ga0451798_0684963_161_472 | 103 |
| 1244 | 3300041460 | Ga0451802_0613368 | Ga0451802_0613368_208_519 | 103 |
| 1245 | 3300041486 | Ga0451807_2241141 | Ga0451807_2241141_125_436 | 103 |
| 1246 | 3300041496 | Ga0451839_0152791 | Ga0451839_0152791_138_449 | 103 |
| 1247 | 3300041505 | Ga0451849_1088658 | Ga0451849_1088658_219_530 | 103 |
| 1248 | 3300041507 | Ga0451851_0249131 | Ga0451851_0249131_102_413 | 103 |
| 1249 | 3300042005 | Ga0439448_0067783 | Ga0439448_0067783_634_945 | 103 |
| 1250 | 3300044656 | Ga0466969_0004242 | Ga0466969_0004242_2769_3080 | 103 |
| 1251 | 3300044658 | Ga0466972_0001791 | Ga0466972_0001791_4145_4456 | 103 |
| 1252 | 3300044658 | Ga0466972_0024641 | Ga0466972_0024641_835_1146 | 103 |
| 1253 | 3300044658 | Ga0466972_0119362 | Ga0466972_0119362_827_1138 | 103 |
| 1254 | 3300044658 | Ga0466972_0124633 | Ga0466972_0124633_461_772 | 103 |
| 1255 | 3300044658 | Ga0466972_0148608 | Ga0466972_0148608_770_1081 | 103 |
| 1256 | 3300044683 | Ga0466965_0093556 | Ga0466965_0093556_808_1119 | 103 |
| 1257 | 3300044683 | Ga0466965_0217095 | Ga0466965_0217095_41_352 | 103 |
| 1258 | 3300044684 | Ga0466966_0001051 | Ga0466966_0001051_7491_7802 | 103 |
| 1259 | 3300044693 | Ga0466961_0005739 | Ga0466961_0005739_3544_3855 | 103 |
| 1260 | 3300044693 | Ga0466961_0274903 | Ga0466961_0274903_711_1022 | 103 |
| 1261 | 3300044694 | Ga0466963_0030126 | Ga0466963_0030126_1161_1472 | 103 |
| 1262 | 3300044706 | Ga0466964_0059002 | Ga0466964_0059002_383_694 | 103 |
| 1263 | 3300044719 | Ga0466971_0088729 | Ga0466971_0088729_810_1121 | 103 |
| 1264 | 3300044735 | Ga0466968_0019273 | Ga0466968_0019273_18_329 | 103 |
| 1265 | 3300044765 | Ga0466970_0080544 | Ga0466970_0080544_703_1014 | 103 |
| 1266 | 3300044765 | Ga0466970_0416824 | Ga0466970_0416824_87_398 | 103 |
| 1267 | 3300044901 | Ga0466960_0023639 | Ga0466960_0023639_1648_1959 | 103 |
| 1268 | 3300045976 | Ga0466967_0213410 | Ga0466967_0213410_324_635 | 103 |
| 1269 | 3300045976 | Ga0466967_1111338 | Ga0466967_1111338_37_348 | 103 |
| 1270 | 3300046457 | Ga0495590_0319548 | Ga0495590_0319548_49_360 | 103 |
| 1271 | 3300046459 | Ga0495629_0650542 | Ga0495629_0650542_180_491 | 103 |
| 1272 | 3300046460 | Ga0495638_0030449 | Ga0495638_0030449_453_764 | 103 |
| 1273 | 3300046475 | Ga0495639_0183763 | Ga0495639_0183763_453_764 | 103 |
| 1274 | 3300046501 | Ga0495607_0450617 | Ga0495607_0450617_135_446 | 103 |
| 1275 | 3300046506 | Ga0495583_0117172 | Ga0495583_0117172_324_635 | 103 |
| 1276 | 3300046511 | Ga0495608_0123473 | Ga0495608_0123473_699_1010 | 103 |
| 1277 | 3300046512 | Ga0495610_0192021 | Ga0495610_0192021_111_422 | 103 |
| 1278 | 3300046514 | Ga0495618_0092321 | Ga0495618_0092321_1286_1597 | 103 |
| 1279 | 3300046516 | Ga0495628_0707827 | Ga0495628_0707827_51_362 | 103 |
| 1280 | 3300046517 | Ga0495630_0388668 | Ga0495630_0388668_124_435 | 103 |
| 1281 | 3300046519 | Ga0495632_0312683 | Ga0495632_0312683_37_348 | 103 |
| 1282 | 3300046522 | Ga0495643_0023626 | Ga0495643_0023626_1641_1952 | 103 |
| 1283 | 3300046524 | Ga0495648_0212783 | Ga0495648_0212783_30_341 | 103 |
| 1284 | 3300046524 | Ga0495648_0393557 | Ga0495648_0393557_280_591 | 103 |
| 1285 | 3300046529 | Ga0495652_0238017 | Ga0495652_0238017_205_516 | 103 |
| 1286 | 3300046533 | Ga0495640_0537942 | Ga0495640_0537942_331_642 | 103 |
| 1287 | 3300046557 | Ga0495622_0033426 | Ga0495622_0033426_569_880 | 103 |
| 1288 | 3300046663 | Ga0495635_0000368 | Ga0495635_0000368_13529_13840 | 103 |
| 1289 | 3300046665 | Ga0495661_0123940 | Ga0495661_0123940_702_1013 | 103 |
| 1290 | 3300046678 | Ga0495599_0222496 | Ga0495599_0222496_830_1141 | 103 |
| 1291 | 3300046694 | Ga0495649_0196381 | Ga0495649_0196381_70_381 | 103 |
| 1292 | 3300046809 | Ga0495600_0038619 | Ga0495600_0038619_1677_1988 | 103 |
| 1293 | 3300046810 | Ga0495660_0123810 | Ga0495660_0123810_718_1029 | 103 |
| 1294 | 3300047319 | Ga0495674_0066520 | Ga0495674_0066520_2345_2656 | 103 |
| 1295 | 3300047321 | Ga0495676_0343712 | Ga0495676_0343712_36_347 | 103 |
| 1296 | 3300047323 | Ga0495683_0081109 | Ga0495683_0081109_153_464 | 103 |
| 1297 | 3300047323 | Ga0495683_0291900 | Ga0495683_0291900_71_382 | 103 |
| 1298 | 3300047443 | Ga0495687_015336 | Ga0495687_015336_961_1272 | 103 |
| 1299 | 3300047470 | Ga0495681_0389328 | Ga0495681_0389328_171_482 | 103 |
| 1300 | 3300048088 | Ga0495602_0575539 | Ga0495602_0575539_428_739 | 103 |
| 1301 | 3300048091 | Ga0495626_0280746 | Ga0495626_0280746_14_325 | 103 |
| 1302 | 3300048904 | Ga0496101_0848610 | Ga0496101_0848610_278_589 | 103 |
| 1303 | 3300048905 | Ga0496102_0292943 | Ga0496102_0292943_505_816 | 103 |
| 1304 | 3300048907 | Ga0496104_0602756 | Ga0496104_0602756_25_336 | 103 |
| 1305 | 3300048908 | Ga0496105_0005872 | Ga0496105_0005872_3650_3961 | 103 |
| 1306 | 3300048908 | Ga0496105_0171815 | Ga0496105_0171815_335_646 | 103 |
| 1307 | 3300048911 | Ga0496108_0075429 | Ga0496108_0075429_1195_1506 | 103 |
| 1308 | 3300048912 | Ga0496109_0145117 | Ga0496109_0145117_521_832 | 103 |
| 1309 | 3300048913 | Ga0496110_0665185 | Ga0496110_0665185_113_424 | 103 |
| 1310 | 3300048913 | Ga0496110_0980379 | Ga0496110_0980379_178_489 | 103 |
| 1311 | 3300048914 | Ga0496111_0122249 | Ga0496111_0122249_1104_1415 | 103 |
| 1312 | 3300048915 | Ga0496112_0037410 | Ga0496112_0037410_1974_2285 | 103 |
| 1313 | 3300048915 | Ga0496112_0921646 | Ga0496112_0921646_41_352 | 103 |
| 1314 | 3300048916 | Ga0496113_0023412 | Ga0496113_0023412_3847_4158 | 103 |
| 1315 | 3300048916 | Ga0496113_0224472 | Ga0496113_0224472_319_630 | 103 |
| 1316 | 3300048917 | Ga0496114_0600170 | Ga0496114_0600170_327_638 | 103 |
| 1317 | 3300048917 | Ga0496114_0938436 | Ga0496114_0938436_316_627 | 103 |
| 1318 | 3300048918 | Ga0496115_0472890 | Ga0496115_0472890_387_698 | 103 |
| 1319 | 3300048919 | Ga0496116_0047052 | Ga0496116_0047052_31_342 | 103 |
| 1320 | 3300048921 | Ga0496118_0041922 | Ga0496118_0041922_1331_1642 | 103 |
| 1321 | 3300048921 | Ga0496118_0081158 | Ga0496118_0081158_705_1016 | 103 |
| 1322 | 3300048921 | Ga0496118_0227616 | Ga0496118_0227616_246_557 | 103 |
| 1323 | 3300048922 | Ga0496119_0009360 | Ga0496119_0009360_45_356 | 103 |
| 1324 | 3300048922 | Ga0496119_0354845 | Ga0496119_0354845_74_385 | 103 |
| 1325 | 3300048923 | Ga0496120_0004718 | Ga0496120_0004718_6910_7221 | 103 |
| 1326 | 3300048923 | Ga0496120_0156549 | Ga0496120_0156549_720_1031 | 103 |
| 1327 | 3300048924 | Ga0496121_0083053 | Ga0496121_0083053_711_1022 | 103 |
| 1328 | 3300048924 | Ga0496121_0136042 | Ga0496121_0136042_1197_1508 | 103 |
| 1329 | 3300048927 | Ga0496124_0315973 | Ga0496124_0315973_792_1103 | 103 |
| 1330 | 3300048929 | Ga0496126_0012253 | Ga0496126_0012253_8470_8781 | 103 |
| 1331 | 3300049587 | Ga0501071_1503593 | Ga0501071_1503593_44_355 | 103 |
| 1332 | 3300049588 | Ga0501072_0758788 | Ga0501072_0758788_55_369 | 103 |
| 1333 | 3300049591 | Ga0501075_1021414 | Ga0501075_1021414_123_437 | 103 |
| 1334 | 3300050490 | nmdc:mga03n38_359809_c1 | nmdc:mga03n38_359809_c1_68_379 | 103 |
| 1335 | 3300050490 | nmdc:mga03n38_368717_c1 | nmdc:mga03n38_368717_c1_419_733 | 103 |
| 1336 | 3300050492 | nmdc:mga0yw44_13917_c1 | nmdc:mga0yw44_13917_c1_1134_1448 | 103 |
| 1337 | 3300050492 | nmdc:mga0yw44_166441_c1 | nmdc:mga0yw44_166441_c1_1066_1377 | 103 |
| 1338 | 3300050493 | nmdc:mga0k408_57039_c1 | nmdc:mga0k408_57039_c1_1945_2256 | 103 |
| 1339 | 3300050494 | nmdc:mga06z11_124555_c1 | nmdc:mga06z11_124555_c1_291_605 | 103 |
| 1340 | 3300050494 | nmdc:mga06z11_131151_c1 | nmdc:mga06z11_131151_c1_205_516 | 103 |
| 1341 | 3300050495 | nmdc:mga04h51_30189_c1 | nmdc:mga04h51_30189_c1_712_1023 | 103 |
| 1342 | 3300050496 | nmdc:mga07m45_10126_c1 | nmdc:mga07m45_10126_c1_3781_4092 | 103 |
| 1343 | 3300050496 | nmdc:mga07m45_219520_c1 | nmdc:mga07m45_219520_c1_49_360 | 103 |
| 1344 | 3300050496 | nmdc:mga07m45_34313_c1 | nmdc:mga07m45_34313_c1_13_324 | 103 |
| 1345 | 3300050496 | nmdc:mga07m45_353521_c1 | nmdc:mga07m45_353521_c1_519_833 | 103 |
| 1346 | 3300050516 | nmdc:mga0sz30_164413_c1 | nmdc:mga0sz30_164413_c1_302_613 | 103 |
| 1347 | 3300050516 | nmdc:mga0sz30_200254_c1 | nmdc:mga0sz30_200254_c1_287_601 | 103 |
| 1348 | 3300050516 | nmdc:mga0sz30_54247_c2 | nmdc:mga0sz30_54247_c2_702_1013 | 103 |
| 1349 | 3300050516 | nmdc:mga0sz30_556945_c1 | nmdc:mga0sz30_556945_c1_58_369 | 103 |
| 1350 | 3300050516 | nmdc:mga0sz30_86267_c1 | nmdc:mga0sz30_86267_c1_139_450 | 103 |
| 1351 | 3300053080 | Ga0500635_0121463 | Ga0500635_0121463_294_605 | 103 |
| 1352 | 3300053085 | Ga0495619_1005209 | Ga0495619_1005209_70_381 | 103 |
| 1353 | 3300053086 | Ga0500578_0161655 | Ga0500578_0161655_426_737 | 103 |
| 1354 | 3300053087 | Ga0500643_000063 | Ga0500643_000063_214_525 | 103 |
| 1355 | 3300053088 | Ga0500644_0155773 | Ga0500644_0155773_48_359 | 103 |
| 1356 | 3300053091 | Ga0500647_0174997 | Ga0500647_0174997_418_729 | 103 |
| 1357 | 3300053094 | Ga0500566_0009826 | Ga0500566_0009826_1463_1774 | 103 |
| 1358 | 3300053094 | Ga0500566_0067843 | Ga0500566_0067843_95_406 | 103 |
| 1359 | 3300053103 | Ga0500555_034459 | Ga0500555_034459_53_364 | 103 |
| 1360 | 3300053104 | Ga0500556_0013711 | Ga0500556_0013711_500_811 | 103 |
| 1361 | 3300053105 | Ga0500557_000177 | Ga0500557_000177_4008_4319 | 103 |
| 1362 | 3300053109 | Ga0500569_077700 | Ga0500569_077700_573_884 | 103 |
| 1363 | 3300053119 | Ga0500595_017336 | Ga0500595_017336_1497_1808 | 103 |
| 1364 | 3300053121 | Ga0500607_267376 | Ga0500607_267376_288_599 | 103 |
| 1365 | 3300053123 | Ga0500614_070524 | Ga0500614_070524_435_746 | 103 |
| 1366 | 3300053128 | Ga0500626_067371 | Ga0500626_067371_51_362 | 103 |
| 1367 | 3300053131 | Ga0500652_170659 | Ga0500652_170659_490_801 | 103 |
| 1368 | 3300053136 | Ga0500559_0124460 | Ga0500559_0124460_24_335 | 103 |
| 1369 | 3300053139 | Ga0500568_0019253 | Ga0500568_0019253_1046_1357 | 103 |
| 1370 | 3300053142 | Ga0500577_0048303 | Ga0500577_0048303_366_677 | 103 |
| 1371 | 3300053144 | Ga0500585_211349 | Ga0500585_211349_275_586 | 103 |
| 1372 | 3300053147 | Ga0500589_177959 | Ga0500589_177959_161_472 | 103 |
| 1373 | 3300053151 | Ga0500604_0333313 | Ga0500604_0333313_200_511 | 103 |
| 1374 | 3300053153 | Ga0500616_0041628 | Ga0500616_0041628_804_1115 | 103 |
| 1375 | 3300053155 | Ga0500620_123812 | Ga0500620_123812_105_416 | 103 |
| 1376 | 3300053158 | Ga0500627_0034508 | Ga0500627_0034508_1311_1622 | 103 |
| 1377 | 3300053160 | Ga0500633_0077982 | Ga0500633_0077982_64_375 | 103 |
| 1378 | 3300053162 | Ga0500638_308756 | Ga0500638_308756_285_596 | 103 |
| 1379 | 3300053177 | Ga0500636_0000143 | Ga0500636_0000143_15814_16125 | 103 |
| 1380 | 3300053729 | Ga0500625_000062 | Ga0500625_000062_18598_18909 | 103 |
| 1381 | 3300053731 | Ga0500609_016664 | Ga0500609_016664_656_967 | 103 |
| 1382 | 3300053733 | Ga0500552_123777 | Ga0500552_123777_27_338 | 103 |
| 1383 | 3300053736 | Ga0500599_000538 | Ga0500599_000538_3257_3568 | 103 |
| 1384 | 3300053737 | Ga0500601_000652 | Ga0500601_000652_3923_4234 | 103 |
| 1385 | 3300059491 | Ga0587070_194221 | Ga0587070_194221_83_394 | 103 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fiu-assembly1.cif.gz_B | crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens | 0.965 | 1 | 95 |
| 2fiu-assembly1.cif.gz_B | crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens | 0.9457 | 1 | 95 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.9172 | 3 | 92 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.8715 | 3 | 92 |
| 3dca-assembly2.cif.gz_D | crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target | 0.728 | 2 | 97 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9291 | 2 | 95 | 3.30.70.100 |
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9102 | 2 | 95 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.857 | 2 | 90 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8148 | 2 | 90 | 3.30.70.100 |
| af_Q67XD6_173_269_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7293 | 6 | 90 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533J3K2-F1-model_v4 | deleted | 0.9907 | 1 | 100 |
|
| AF-A0A1L3F244-F1-model_v4 | DUF1330 domain-containing protein | 0.9895 | 1 | 100 |
|
| AF-A0A1M2YSX0-F1-model_v4 | DUF1330 domain-containing protein | 0.9859 | 2 | 96 |
|
| AF-A0A2E1UK82-F1-model_v4 | DUF1330 domain-containing protein | 0.9855 | 1 | 95 |
|
| AF-A0A0J1HEI5-F1-model_v4 | DUF1330 domain-containing protein | 0.9831 | 3 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar