F493551

General Info

Members Datasets Scaffolds Average Seq Length
1385 768 1197 100

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_102753106|Ga0307409_1027531061
Length 94
Sequence MPAYWIAHVEVSDEARYGEYAKRAGPAIAAHGGKFLARGGRHVQLEGNDRARNVVVEFPDLASAEACYRSAAYQEALGYAKGASVRDLVVVEGV

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
19 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
20 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
25 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
26 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
27 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
28 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
29 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
30 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
31 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
32 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
33 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
34 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
35 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
36 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
37 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
38 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
39 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
40 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
41 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
42 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
43 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
44 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
45 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
46 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
47 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
48 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
49 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
50 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
51 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
52 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
53 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
54 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
55 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
56 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
57 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
58 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
59 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
60 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
61 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
62 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
63 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
64 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
65 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
66 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
67 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
68 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
69 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
70 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
71 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
72 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
73 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
74 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
75 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
76 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
77 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
78 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
79 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
80 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
81 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
82 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
83 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
84 2904699407
85 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
86 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
87 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
88 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
89 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
90 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
91 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
92 2922368715
93 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
94 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
95 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
96 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
97 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
98 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
99 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
100 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
101 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
102 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
103 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
104 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
105 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
106 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
107 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
108 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
109 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
110 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
111 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
112 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
113 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
114 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
115 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
116 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
117 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
118 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
119 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
120 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
121 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
122 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
123 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
124 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
125 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
126 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
127 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
128 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
129 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
130 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
131 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
132 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
133 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
134 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
135 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
136 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
137 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
138 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
139 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
140 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
141 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
142 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
143 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
144 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
145 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
146 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
147 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
148 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
149 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
150 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
151 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
152 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
153 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
154 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
155 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
156 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
157 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
158 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
159 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
160 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
161 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
162 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
163 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
164 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
165 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
166 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
167 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
168 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
169 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
170 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
171 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
172 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
173 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
174 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
175 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
176 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
177 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
178 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
179 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
180 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
181 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
182 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
183 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
184 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
185 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
186 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
187 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
188 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
189 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
190 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
191 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
192 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
193 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
194 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
195 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
196 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
197 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
198 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
199 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
200 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
201 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
202 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
203 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
204 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
205 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
206 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
207 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
208 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
209 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
210 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
211 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
212 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
213 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
214 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
215 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
216 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
217 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
218 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
219 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
220 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
221 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
222 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
223 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
224 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
225 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
226 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
227 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
228 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
229 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
230 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
231 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
232 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
233 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
234 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
235 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
236 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
237 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
238 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
239 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
240 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
241 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
242 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
243 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
244 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
245 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
246 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
247 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
248 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
249 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
250 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
251 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
252 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
253 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
254 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
255 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
256 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
257 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
258 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
259 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
260 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
261 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
262 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
263 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
264 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
265 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
266 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
267 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
268 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
269 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
270 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
271 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
272 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
273 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
274 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
275 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
276 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
277 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
278 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
279 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
280 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
281 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
282 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
283 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
284 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
285 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
286 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
287 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
289 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
290 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
291 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
292 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
293 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
294 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
295 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
296 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
297 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
298 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
299 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
300 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
301 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
302 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
303 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
304 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
305 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
306 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
307 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
308 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
309 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
310 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
311 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
312 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
313 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
314 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
315 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
316 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
317 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
318 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
319 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
320 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
321 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
322 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
323 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
324 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
325 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
326 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
327 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
328 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
329 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
330 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
331 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
332 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
333 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
334 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
335 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
336 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
337 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
338 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
339 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
340 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
343 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
346 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
347 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
348 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
349 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
350 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
351 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
420 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
421 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
422 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
423 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
424 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
425 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
426 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
427 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
428 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
429 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
430 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
431 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
432 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
433 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
434 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
436 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
437 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
438 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
439 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
440 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
441 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
445 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
446 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
448 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
449 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
450 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
451 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
452 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
453 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
454 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
455 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
456 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
457 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
458 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
459 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
460 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
461 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
462 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
463 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
464 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
465 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
466 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
467 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
468 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
469 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
470 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
471 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
472 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
473 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
474 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
475 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
476 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
477 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
478 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
479 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
480 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
481 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
482 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
483 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
484 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
485 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
486 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
487 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
488 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
489 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
490 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
491 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
492 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
493 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
494 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
495 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
496 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
497 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
498 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
499 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
500 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
501 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
502 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
503 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
504 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
505 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
506 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
507 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
508 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
509 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
510 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
511 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
512 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
513 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
514 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
515 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
516 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
517 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
518 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
519 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
520 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
521 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
522 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
523 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
524 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
525 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
526 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
527 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
528 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
529 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
530 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
531 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
532 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
533 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
534 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
535 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
536 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
537 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
538 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
539 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
540 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
541 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
542 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
543 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
544 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
545 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
546 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
547 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
548 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
549 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
550 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
551 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
552 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
553 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
554 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
555 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
556 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
557 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
558 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
559 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
560 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
561 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
562 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
563 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
564 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
565 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
566 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
567 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
568 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
569 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
570 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
571 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
572 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
573 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
574 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
575 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
576 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
577 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
578 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
579 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
580 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
581 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
582 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
583 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
584 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
585 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
586 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
587 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
588 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
589 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
590 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
591 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
592 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
593 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
594 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
595 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
596 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
597 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
598 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
599 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
600 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
601 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
602 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
603 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
604 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
605 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
606 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
607 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
608 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
609 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
610 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
611 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
612 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
613 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
614 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
615 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
616 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
617 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
618 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
619 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
620 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
621 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
622 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
623 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
624 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
625 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
626 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
627 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
628 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
629 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
630 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
631 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
632 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
633 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
634 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
635 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
636 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
637 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
638 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
639 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
640 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
641 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
642 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
643 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
644 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
645 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
646 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
647 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
648 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
649 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
650 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
651 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
652 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
653 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
654 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
655 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
656 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
657 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
658 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
659 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
660 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
661 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
662 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
663 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
664 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
665 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
666 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
667 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
668 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
669 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
670 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
671 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
672 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
673 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
674 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
675 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
676 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
677 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
678 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
679 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
680 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
681 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
682 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
683 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
684 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
685 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
686 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
687 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
688 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
689 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
690 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
691 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
692 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
693 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
694 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
695 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
696 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
697 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
698 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
699 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
700 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
701 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
702 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
703 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
704 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
705 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
706 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
707 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
708 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
709 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
710 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
711 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
712 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
713 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
714 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
715 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
716 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
717 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
718 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
719 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
720 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
721 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
722 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
723 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
724 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
725 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
726 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
727 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
728 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
729 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
730 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
731 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
732 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
733 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
734 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
735 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
736 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
737 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
738 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
739 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
740 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
741 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
742 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
743 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
744 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
745 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
746 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
747 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
748 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
749 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
750 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
751 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
752 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
753 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
754 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
755 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
756 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
757 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
758 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
759 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
760 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
761 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
762 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
763 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
764 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
765 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
766 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
767 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
768 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.26
Metatranscriptomes 0.29
Isolates 13.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.61
Nodule 11.41
Rhizoplane 4.69
Rhizosphere 66.57
Stem 0
Stem Tuber 0
Unclassified 6.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C1608 2010549000 Bacteria 1195
2 RicEn_FSXC2379_b1 2010549000 Bacteria 794
3 JGI24032J14994_100498 3300001430 Bacteria 2057
4 JGI24736J21556_1030537 3300001904 Bacteria 833
5 JGI24741J21665_1022626 3300001915 Bacteria 974
6 JGI24752J21851_1058508 3300001976 Bacteria 530
7 JGI24746J21847_1000164 3300001977 Bacteria 8612
8 JGI24747J21853_1000867 3300001978 Bacteria 2082
9 JGI24740J21852_10021616 3300001979 Bacteria 2227
10 JGI24739J22299_10000152 3300001989 Bacteria 22301
11 JGI24739J22299_10036217 3300001989 Bacteria 1668
12 JGI24737J22298_10002832 3300001990 Bacteria 6144
13 JGI24737J22298_10003593 3300001990 Bacteria 5467
14 JGI24737J22298_10004593 3300001990 Bacteria 4804
15 JGI24743J22301_10036218 3300001991 Bacteria 982
16 JGI24750J21931_1000497 3300002070 Bacteria 6166
17 JGI24750J21931_1000592 3300002070 Bacteria 5515
18 JGI24750J21931_1007504 3300002070 Bacteria 1373
19 JGI24745J21846_1000135 3300002073 Bacteria 5648
20 JGI24748J21848_1000406 3300002074 Bacteria 4840
21 JGI24738J21930_10000005 3300002075 Bacteria 42207
22 JGI24749J21850_1000199 3300002076 Bacteria 9677
23 JGI24744J21845_10000538 3300002077 Bacteria 6792
24 JGI24035J26624_1000104 3300002126 Bacteria 7174
25 JGI24033J26618_1002293 3300002155 Bacteria 1946
26 JGI24034J26672_10016367 3300002239 Bacteria 1142
27 JGI24742J22300_10000102 3300002244 Bacteria 12525
28 JGI24742J22300_10000282 3300002244 Bacteria 7682
29 JGI24751J29686_10007280 3300002459 Bacteria 2260
30 JGI25406J46586_10011591 3300003203 Bacteria 3862
31 JGI25165J46597_1008157 3300003214 Bacteria 1668
32 JGI25160J50197_1001122 3300003354 Bacteria 13673
33 JGI25160J50197_1020925 3300003354 Bacteria 1959
34 JGI25160J50197_1078087 3300003354 Bacteria 619
35 JGI26145J50221_1006209 3300003371 Bacteria 997
36 JGI25404J52841_10006995 3300003659 Bacteria 2374
37 JGI25404J52841_10012821 3300003659 Bacteria 1818
38 JGI25404J52841_10018798 3300003659 Bacteria 1498
39 JGI25404J52841_10094693 3300003659 Bacteria 625
40 Ga0055526_1091498 3300003771 Bacteria 573
41 Ga0055524_1057430 3300003775 Bacteria 831
42 Ga0055531_10011202 3300003794 Bacteria 4358
43 JGI25405J52794_10062438 3300003911 Bacteria 807
44 JGI25405J52794_10096839 3300003911 Bacteria 656
45 Ga0055543_1029757 3300004625 Bacteria 958
46 Ga0065165_1009364 3300005262 Bacteria 4404
47 Ga0065165_1021770 3300005262 Bacteria 2216
48 Ga0065165_1023472 3300005262 Bacteria 2091
49 Ga0065165_1136923 3300005262 Bacteria 581
50 Ga0065712_10008945 3300005290 Bacteria 2400
51 Ga0065712_10070038 3300005290 Bacteria 6388
52 Ga0065712_10076486 3300005290 Bacteria 3645
53 Ga0065715_10001162 3300005293 Bacteria 6917
54 Ga0065715_10935511 3300005293 Bacteria 564
55 Ga0070658_10071251 3300005327 Bacteria 2847
56 Ga0070676_10000789 3300005328 Bacteria 15625
57 Ga0070676_10386244 3300005328 Bacteria 971
58 Ga0070683_100000345 3300005329 Bacteria 31885
59 Ga0070683_100187827 3300005329 Bacteria 1962
60 Ga0070683_101304579 3300005329 Bacteria 698
61 Ga0070690_100007432 3300005330 Bacteria 6278
62 Ga0070690_100204002 3300005330 Bacteria 1377
63 Ga0070670_100013204 3300005331 Bacteria 7076
64 Ga0070670_100238088 3300005331 Bacteria 1584
65 Ga0070670_100278346 3300005331 Bacteria 1461
66 Ga0070670_101129682 3300005331 Bacteria 715
67 Ga0070677_10000389 3300005333 Bacteria 15407
68 Ga0068869_100001864 3300005334 Bacteria 12681
69 Ga0070666_10111076 3300005335 Bacteria 1896
70 Ga0070680_100005473 3300005336 Bacteria 9607
71 Ga0070680_100041530 3300005336 Bacteria 3729
72 Ga0070680_100057667 3300005336 Bacteria 3175
73 Ga0070680_101318137 3300005336 Bacteria 625
74 Ga0070682_100000458 3300005337 Bacteria 25727
75 Ga0070682_100059840 3300005337 Bacteria 2407
76 Ga0070682_100218834 3300005337 Bacteria 1354
77 Ga0070682_100324082 3300005337 Bacteria 1139
78 Ga0068868_100000376 3300005338 Bacteria 30404
79 Ga0068868_100420776 3300005338 Bacteria 1157
80 Ga0070660_100001420 3300005339 Bacteria 16311
81 Ga0070660_100046112 3300005339 Bacteria 3339
82 Ga0070660_100139446 3300005339 Bacteria 1944
83 Ga0070660_100693540 3300005339 Bacteria 853
84 Ga0070689_100001572 3300005340 Bacteria 14570
85 Ga0070689_100071627 3300005340 Bacteria 2708
86 Ga0070689_100529671 3300005340 Bacteria 1013
87 Ga0070689_100665220 3300005340 Bacteria 907
88 Ga0070691_10000417 3300005341 Bacteria 15597
89 Ga0070691_10780900 3300005341 Bacteria 580
90 Ga0070687_100002155 3300005343 Bacteria 7281
91 Ga0070687_100058408 3300005343 Bacteria 2026
92 Ga0070687_101158899 3300005343 Bacteria 568
93 Ga0070661_100001708 3300005344 Bacteria 15225
94 Ga0070661_100133110 3300005344 Bacteria 1869
95 Ga0070661_100257876 3300005344 Bacteria 1347
96 Ga0070661_100339178 3300005344 Bacteria 1177
97 Ga0070692_10000078 3300005345 Bacteria 20284
98 Ga0070692_10009194 3300005345 Bacteria 4445
99 Ga0070668_100001228 3300005347 Bacteria 18229
100 Ga0070668_100010386 3300005347 Bacteria 6917
101 Ga0070669_100000873 3300005353 Bacteria 21980
102 Ga0070669_100047333 3300005353 Bacteria 3137
103 Ga0070669_100115177 3300005353 Bacteria 2044
104 Ga0070669_100322880 3300005353 Bacteria 1247
105 Ga0070675_100014644 3300005354 Bacteria 6185
106 Ga0070675_100033712 3300005354 Bacteria 4152
107 Ga0070675_101108095 3300005354 Bacteria 728
108 Ga0070675_101300371 3300005354 Bacteria 670
109 Ga0070671_100000318 3300005355 Bacteria 32840
110 Ga0070671_100097880 3300005355 Bacteria 2460
111 Ga0070674_100001672 3300005356 Bacteria 11985
112 Ga0070674_100391470 3300005356 Bacteria 1133
113 Ga0070673_100002621 3300005364 Bacteria 10996
114 Ga0070673_102187560 3300005364 Bacteria 526
115 Ga0070688_100001932 3300005365 Bacteria 10409
116 Ga0070688_100032747 3300005365 Bacteria 3137
117 Ga0070659_100001601 3300005366 Bacteria 16297
118 Ga0070659_100201725 3300005366 Bacteria 1638
119 Ga0070659_100962930 3300005366 Bacteria 748
120 Ga0070667_100012018 3300005367 Bacteria 7168
121 Ga0070667_100094662 3300005367 Bacteria 2574
122 Ga0070667_100095483 3300005367 Bacteria 2563
123 Ga0070667_100830490 3300005367 Bacteria 859
124 Ga0070703_10009498 3300005406 Bacteria 2743
125 Ga0070703_10053704 3300005406 Bacteria 1297
126 Ga0070709_10216548 3300005434 Bacteria 1364
127 Ga0070709_11194481 3300005434 Bacteria 611
128 Ga0070714_100404021 3300005435 Bacteria 1292
129 Ga0070714_100813678 3300005435 Bacteria 905
130 Ga0070714_102037223 3300005435 Bacteria 560
131 Ga0070714_102105439 3300005435 Bacteria 550
132 Ga0070713_100978402 3300005436 Bacteria 816
133 Ga0070713_101116947 3300005436 Bacteria 762
134 Ga0070710_10014694 3300005437 Bacteria 3945
135 Ga0070701_10000388 3300005438 Bacteria 14825
136 Ga0070705_100050569 3300005440 Bacteria 2418
137 Ga0070705_100904128 3300005440 Bacteria 710
138 Ga0070700_100000409 3300005441 Bacteria 21951
139 Ga0070694_100000312 3300005444 Bacteria 26105
140 Ga0070694_100018197 3300005444 Bacteria 4457
141 Ga0070708_100008294 3300005445 Bacteria 8342
142 Ga0070663_100003029 3300005455 Bacteria 9597
143 Ga0070663_100149893 3300005455 Bacteria 1788
144 Ga0070663_101596343 3300005455 Bacteria 581
145 Ga0070663_102069294 3300005455 Bacteria 513
146 Ga0070678_100000673 3300005456 Bacteria 16791
147 Ga0070678_100571669 3300005456 Bacteria 1006
148 Ga0070678_101085359 3300005456 Bacteria 739
149 Ga0070662_100011704 3300005457 Bacteria 5791
150 Ga0070662_100019810 3300005457 Bacteria 4574
151 Ga0070662_100231254 3300005457 Bacteria 1479
152 Ga0070681_10001501 3300005458 Bacteria 20642
153 Ga0070681_10075545 3300005458 Bacteria 3329
154 Ga0070681_10300250 3300005458 Bacteria 1516
155 Ga0070681_11721812 3300005458 Bacteria 553
156 Ga0068867_100002561 3300005459 Bacteria 12815
157 Ga0070685_10031691 3300005466 Bacteria 2956
158 Ga0070685_10109412 3300005466 Bacteria 1700
159 Ga0070685_10176548 3300005466 Bacteria 1372
160 Ga0070706_101694545 3300005467 Bacteria 576
161 Ga0070707_100905260 3300005468 Bacteria 847
162 Ga0070679_100013134 3300005530 Bacteria 7928
163 Ga0070679_100083369 3300005530 Bacteria 3185
164 Ga0070679_100235744 3300005530 Bacteria 1789
165 Ga0070684_100004125 3300005535 Bacteria 10996
166 Ga0070684_100189935 3300005535 Bacteria 1869
167 Ga0070684_100236315 3300005535 Bacteria 1669
168 Ga0070684_100314538 3300005535 Bacteria 1438
169 Ga0070684_101560474 3300005535 Bacteria 622
170 Ga0068853_100013239 3300005539 Bacteria 6732
171 Ga0068853_100199229 3300005539 Bacteria 1822
172 Ga0068853_100328659 3300005539 Bacteria 1418
173 Ga0070672_100005118 3300005543 Bacteria 8651
174 Ga0070672_100384903 3300005543 Bacteria 1200
175 Ga0070672_100419171 3300005543 Bacteria 1150
176 Ga0070686_100005340 3300005544 Bacteria 7107
177 Ga0070686_100007239 3300005544 Bacteria 6182
178 Ga0070686_100736735 3300005544 Bacteria 789
179 Ga0070695_100001168 3300005545 Bacteria 14419
180 Ga0070695_100008421 3300005545 Bacteria 6123
181 Ga0070696_100028030 3300005546 Bacteria 3841
182 Ga0070696_100182007 3300005546 Bacteria 1559
183 Ga0070696_101093909 3300005546 Bacteria 670
184 Ga0070696_101548196 3300005546 Unclassified 568
185 Ga0070693_100002738 3300005547 Bacteria 8120
186 Ga0070693_100143814 3300005547 Bacteria 1504
187 Ga0070665_100024095 3300005548 Bacteria 6128
188 Ga0070665_100073736 3300005548 Bacteria 3419
189 Ga0070665_100258812 3300005548 Bacteria 1741
190 Ga0070665_100674196 3300005548 Bacteria 1047
191 Ga0070665_100990875 3300005548 Bacteria 853
192 Ga0070665_102120303 3300005548 Bacteria 566
193 Ga0070665_102600922 3300005548 Bacteria 507
194 Ga0070704_100002142 3300005549 Bacteria 10996
195 Ga0070704_100012760 3300005549 Bacteria 5197
196 Ga0068855_100032409 3300005563 Bacteria 6240
197 Ga0068855_100795644 3300005563 Bacteria 1005
198 Ga0070664_100002197 3300005564 Bacteria 15671
199 Ga0070664_100090718 3300005564 Bacteria 2645
200 Ga0070664_100192491 3300005564 Bacteria 1817
201 Ga0070664_100297517 3300005564 Bacteria 1458
202 Ga0070664_100474545 3300005564 Bacteria 1151
203 Ga0068857_100000914 3300005577 Bacteria 22274
204 Ga0068857_100385717 3300005577 Bacteria 1302
205 Ga0068854_100002267 3300005578 Bacteria 11836
206 Ga0068854_100164147 3300005578 Bacteria 1723
207 Ga0068854_100224413 3300005578 Bacteria 1488
208 Ga0068856_100007024 3300005614 Bacteria 10998
209 Ga0068856_100129914 3300005614 Bacteria 2524
210 Ga0068856_100176210 3300005614 Bacteria 2151
211 Ga0068856_100216043 3300005614 Bacteria 1933
212 Ga0070702_100000793 3300005615 Bacteria 12038
213 Ga0070702_100611363 3300005615 Bacteria 819
214 Ga0068852_100001040 3300005616 Bacteria 18256
215 Ga0068852_100019926 3300005616 Bacteria 5323
216 Ga0068852_100281520 3300005616 Bacteria 1603
217 Ga0068852_100560263 3300005616 Bacteria 1144
218 Ga0068852_100596253 3300005616 Bacteria 1109
219 Ga0068852_101590085 3300005616 Bacteria 676
220 Ga0068859_100023516 3300005617 Bacteria 6183
221 Ga0068859_100030436 3300005617 Bacteria 5416
222 Ga0068864_100001093 3300005618 Bacteria 22722
223 Ga0068864_100551765 3300005618 Bacteria 1114
224 Ga0068864_102529688 3300005618 Bacteria 519
225 Ga0068866_10000678 3300005718 Bacteria 15464
226 Ga0068861_100008814 3300005719 Bacteria 6947
227 Ga0068861_100154224 3300005719 Bacteria 1888
228 Ga0068861_100441800 3300005719 Bacteria 1164
229 Ga0068861_100964657 3300005719 Bacteria 812
230 Ga0068870_10000128 3300005840 Bacteria 26100
231 Ga0068863_100006135 3300005841 Bacteria 11786
232 Ga0068858_100007003 3300005842 Bacteria 10954
233 Ga0068858_100245972 3300005842 Bacteria 1698
234 Ga0068858_100581234 3300005842 Bacteria 1086
235 Ga0068858_100734336 3300005842 Bacteria 961
236 Ga0068858_102352298 3300005842 Bacteria 527
237 Ga0068860_100009283 3300005843 Bacteria 9773
238 Ga0068860_100068439 3300005843 Bacteria 3373
239 Ga0068860_100958438 3300005843 Bacteria 873
240 Ga0068862_100016288 3300005844 Bacteria 6185
241 Ga0068862_100017378 3300005844 Bacteria 5990
242 Ga0081455_10000002 3300005937 Bacteria 460472
243 Ga0081455_10010596 3300005937 Bacteria 9328
244 Ga0081455_10018872 3300005937 Bacteria 6544
245 Ga0081455_10030798 3300005937 Bacteria 4868
246 Ga0081455_10065070 3300005937 Bacteria 3051
247 Ga0081455_10081865 3300005937 Bacteria 2643
248 Ga0081455_10380821 3300005937 Bacteria 985
249 Ga0081538_10011886 3300005981 Bacteria 7027
250 Ga0081540_1002951 3300005983 Bacteria 13661
251 Ga0081540_1003344 3300005983 Bacteria 12715
252 Ga0081540_1008907 3300005983 Bacteria 6957
253 Ga0081540_1009850 3300005983 Bacteria 6535
254 Ga0081540_1012850 3300005983 Bacteria 5476
255 Ga0081540_1080929 3300005983 Bacteria 1462
256 Ga0081540_1216532 3300005983 Bacteria 684
257 Ga0081539_10002161 3300005985 Bacteria 28946
258 Ga0081539_10002854 3300005985 Bacteria 22994
259 Ga0081539_10052381 3300005985 Bacteria 2293
260 Ga0081539_10305745 3300005985 Bacteria 682
261 Ga0070717_10050719 3300006028 Bacteria 3412
262 Ga0070717_10052545 3300006028 Bacteria 3357
263 Ga0075365_10088472 3300006038 Bacteria 2107
264 Ga0075365_10632495 3300006038 Bacteria 756
265 Ga0075365_10938966 3300006038 Bacteria 610
266 Ga0075368_10012526 3300006042 Bacteria 3102
267 Ga0075368_10336959 3300006042 Bacteria 655
268 Ga0075368_10437985 3300006042 Bacteria 578
269 Ga0075363_100067838 3300006048 Bacteria 1933
270 Ga0075363_100188469 3300006048 Bacteria 1176
271 Ga0075363_100188948 3300006048 Bacteria 1174
272 Ga0075363_100504016 3300006048 Bacteria 719
273 Ga0075364_10078336 3300006051 Bacteria 2183
274 Ga0075364_10462832 3300006051 Bacteria 866
275 Ga0075364_10484450 3300006051 Bacteria 845
276 Ga0070715_10149141 3300006163 Bacteria 1144
277 Ga0070716_101640461 3300006173 Bacteria 529
278 Ga0070712_100263900 3300006175 Bacteria 1381
279 Ga0075362_10202488 3300006177 Bacteria 966
280 Ga0075367_10096618 3300006178 Bacteria 1802
281 Ga0075367_10115630 3300006178 Bacteria 1649
282 Ga0075367_10578463 3300006178 Bacteria 713
283 Ga0075367_10589226 3300006178 Bacteria 706
284 Ga0075367_10601054 3300006178 Bacteria 699
285 Ga0075367_10607986 3300006178 Bacteria 695
286 Ga0075369_10079883 3300006186 Bacteria 1449
287 Ga0075369_10110706 3300006186 Bacteria 1237
288 Ga0075369_10120497 3300006186 Bacteria 1187
289 Ga0075366_10021740 3300006195 Bacteria 3730
290 Ga0075366_10356187 3300006195 Bacteria 898
291 Ga0075366_10767014 3300006195 Bacteria 599
292 Ga0097621_100000012 3300006237 Bacteria 105108
293 Ga0097621_100500282 3300006237 Bacteria 1101
294 Ga0097621_100551898 3300006237 Bacteria 1049
295 Ga0075370_10057807 3300006353 Bacteria 2205
296 Ga0075370_10071042 3300006353 Bacteria 1991
297 Ga0075370_10146723 3300006353 Bacteria 1381
298 Ga0068871_100000414 3300006358 Bacteria 29494
299 Ga0068871_101755095 3300006358 Bacteria 589
300 Ga0075428_100810322 3300006844 Bacteria 995
301 Ga0075430_101614740 3300006846 Bacteria 532
302 Ga0075433_10018274 3300006852 Bacteria 5823
303 Ga0075434_100001246 3300006871 Bacteria 21184
304 Ga0075434_100545932 3300006871 Bacteria 1179
305 Ga0068865_100000908 3300006881 Bacteria 16791
306 Ga0068865_100108699 3300006881 Bacteria 2042
307 Ga0075436_100693543 3300006914 Bacteria 754
308 Ga0097620_100023517 3300006931 Bacteria 6183
309 Ga0097620_100030437 3300006931 Bacteria 5416
310 Ga0097620_100933804 3300006931 Bacteria 951
311 Ga0099825_1027887 3300006941 Bacteria 2819
312 Ga0099824_1009581 3300006942 Bacteria 11847
313 Ga0099824_1033850 3300006942 Bacteria 1692
314 Ga0099822_1000911 3300006943 Bacteria 31714
315 Ga0099822_1041384 3300006943 Bacteria 2488
316 Ga0099823_1012311 3300006944 Bacteria 8653
317 Ga0075435_100099129 3300007076 Bacteria 2413
318 Ga0075435_100300148 3300007076 Bacteria 1374
319 Ga0099794_10313305 3300007265 Bacteria 813
320 Ga0105251_10153201 3300009011 Bacteria 1040
321 Ga0105250_10017271 3300009092 Bacteria 2934
322 Ga0105250_10122121 3300009092 Bacteria 1071
323 Ga0105240_10006733 3300009093 Bacteria 16828
324 Ga0105240_10021715 3300009093 Bacteria 8533
325 Ga0105240_10105946 3300009093 Bacteria 3412
326 Ga0105240_10830924 3300009093 Bacteria 999
327 Ga0111539_10007702 3300009094 Bacteria 13753
328 Ga0111539_10069230 3300009094 Bacteria 4167
329 Ga0111539_12038065 3300009094 Bacteria 666
330 Ga0105245_10000090 3300009098 Bacteria 90378
331 Ga0105245_10129919 3300009098 Bacteria 2362
332 Ga0105245_10206389 3300009098 Bacteria 1889
333 Ga0105245_10338097 3300009098 Bacteria 1488
334 Ga0105245_11543743 3300009098 Bacteria 715
335 Ga0105247_10003459 3300009101 Bacteria 10293
336 Ga0105247_10019467 3300009101 Bacteria 4075
337 Ga0105247_10040318 3300009101 Bacteria 2854
338 Ga0105247_10690922 3300009101 Bacteria 767
339 Ga0114129_11073010 3300009147 Bacteria 1010
340 Ga0105243_10002504 3300009148 Bacteria 15327
341 Ga0105243_10129090 3300009148 Bacteria 2142
342 Ga0105243_10158299 3300009148 Bacteria 1950
343 Ga0105241_10000475 3300009174 Bacteria 30331
344 Ga0105241_10041983 3300009174 Bacteria 3458
345 Ga0105241_10303676 3300009174 Bacteria 1370
346 Ga0105242_10001283 3300009176 Bacteria 19844
347 Ga0105248_10003064 3300009177 Bacteria 18528
348 Ga0105248_10004418 3300009177 Bacteria 15562
349 Ga0105248_10094136 3300009177 Bacteria 3374
350 Ga0105237_10002267 3300009545 Bacteria 23930
351 Ga0105237_10066313 3300009545 Bacteria 3605
352 Ga0105237_10080045 3300009545 Bacteria 3257
353 Ga0105237_10303800 3300009545 Bacteria 1599
354 Ga0105237_10610498 3300009545 Bacteria 1098
355 Ga0105237_11326812 3300009545 Bacteria 726
356 Ga0105238_10041820 3300009551 Bacteria 4642
357 Ga0105238_10384723 3300009551 Bacteria 1395
358 Ga0105238_10437279 3300009551 Bacteria 1304
359 Ga0105238_10545617 3300009551 Bacteria 1163
360 Ga0105238_11268903 3300009551 Bacteria 762
361 Ga0105249_10001598 3300009553 Bacteria 19845
362 Ga0105249_10006092 3300009553 Bacteria 10456
363 Ga0105249_10617523 3300009553 Bacteria 1140
364 Ga0105249_11533539 3300009553 Bacteria 739
365 Ga0105239_10018565 3300010375 Bacteria 7683
366 Ga0105239_10036649 3300010375 Bacteria 5383
367 Ga0105239_10040255 3300010375 Bacteria 5121
368 Ga0105239_10119145 3300010375 Bacteria 2929
369 Ga0105239_10167699 3300010375 Bacteria 2455
370 Ga0105239_10502229 3300010375 Bacteria 1379
371 Ga0105239_13564552 3300010375 Bacteria 506
372 Ga0105246_10000263 3300011119 Bacteria 27266
373 Ga0105246_11461355 3300011119 Bacteria 640
374 Ga0157340_1009937 3300012473 Bacteria 662
375 Ga0157344_1025724 3300012476 Bacteria 536
376 Ga0157314_1001161 3300012500 Bacteria 1955
377 Ga0157373_10161320 3300013100 Bacteria 1577
378 Ga0157371_10051992 3300013102 Bacteria 2910
379 Ga0157370_10248202 3300013104 Bacteria 1646
380 Ga0157370_10347519 3300013104 Bacteria 1367
381 Ga0157369_10093465 3300013105 Bacteria 3210
382 Ga0157369_10809520 3300013105 Bacteria 962
383 Ga0157369_11526521 3300013105 Bacteria 679
384 Ga0157369_11679706 3300013105 Bacteria 645
385 Ga0157369_12671230 3300013105 Bacteria 503
386 Ga0157374_10001375 3300013296 Bacteria 20675
387 Ga0157374_10291518 3300013296 Bacteria 1613
388 Ga0157374_11180448 3300013296 Bacteria 787
389 Ga0157378_10002550 3300013297 Bacteria 16210
390 Ga0157378_10014596 3300013297 Bacteria 6877
391 Ga0157378_13074281 3300013297 Bacteria 518
392 Ga0163162_10003792 3300013306 Bacteria 14496
393 Ga0163162_10482238 3300013306 Bacteria 1371
394 Ga0157372_10002994 3300013307 Bacteria 18215
395 Ga0157372_10308235 3300013307 Bacteria 1842
396 Ga0157372_12753305 3300013307 Bacteria 564
397 Ga0157372_12788277 3300013307 Bacteria 560
398 Ga0157375_10002382 3300013308 Bacteria 16270
399 Ga0157375_10276078 3300013308 Bacteria 1843
400 Ga0157375_12056920 3300013308 Bacteria 679
401 Ga0163163_10005972 3300014325 Bacteria 10590
402 Ga0163163_10012135 3300014325 Bacteria 7840
403 Ga0163163_11171980 3300014325 Bacteria 831
404 Ga0157380_10000334 3300014326 Bacteria 28309
405 Ga0157380_10493558 3300014326 Bacteria 1187
406 Ga0157380_12468072 3300014326 Bacteria 585
407 Ga0182008_10446941 3300014497 Bacteria 702
408 Ga0157377_10000249 3300014745 Bacteria 26676
409 Ga0157379_10002491 3300014968 Bacteria 15418
410 Ga0157379_10053828 3300014968 Bacteria 3596
411 Ga0157379_10058339 3300014968 Bacteria 3451
412 Ga0157379_10421914 3300014968 Bacteria 1229
413 Ga0157376_10000709 3300014969 Bacteria 21576
414 Ga0157376_11240021 3300014969 Bacteria 775
415 Ga0157376_11457758 3300014969 Bacteria 717
416 Ga0157376_12344763 3300014969 Bacteria 573
417 Ga0163161_10001471 3300017792 Bacteria 17429
418 Ga0163161_11805712 3300017792 Bacteria 544
419 Ga0206353_10185621 3300020082 Bacteria 2787
420 Ga0214544_1008398 3300021320 Bacteria 17199
421 Ga0214542_1005602 3300021321 Bacteria 23717
422 Ga0214542_1036118 3300021321 Bacteria 1482
423 Ga0214545_1000640 3300021324 Bacteria 58221
424 Ga0214545_1034133 3300021324 Bacteria 1788
425 Ga0214543_1009848 3300021327 Bacteria 14584
426 Ga0214543_1039535 3300021327 Bacteria 1296
427 Ga0213873_10039639 3300021358 Bacteria 1208
428 Ga0213873_10078927 3300021358 Bacteria 918
429 Ga0213874_10324072 3300021377 Bacteria 585
430 Ga0213876_10076495 3300021384 Bacteria 1767
431 Ga0213876_10229172 3300021384 Bacteria 987
432 Ga0213875_10248293 3300021388 Bacteria 839
433 Ga0224572_1005889 3300024225 Bacteria 2203
434 Ga0228598_1046037 3300024227 Bacteria 863
435 Ga0209677_107668 3300025253 Bacteria 2241
436 Ga0209148_1000275 3300025254 Bacteria 80696
437 Ga0209233_1001359 3300025261 Bacteria 9739
438 Ga0207666_1000082 3300025271 Bacteria 15637
439 Ga0209455_1013785 3300025272 Bacteria 1862
440 Ga0209673_1017321 3300025273 Bacteria 2659
441 Ga0207673_1000240 3300025290 Bacteria 5596
442 Ga0209564_1009422 3300025295 Bacteria 4650
443 Ga0209564_1015893 3300025295 Bacteria 3036
444 Ga0209758_1001177 3300025297 Bacteria 33138
445 Ga0209758_1001736 3300025297 Bacteria 24275
446 Ga0209758_1004318 3300025297 Bacteria 11959
447 Ga0209758_1007225 3300025297 Bacteria 7643
448 Ga0209758_1017374 3300025297 Bacteria 3587
449 Ga0209758_1047251 3300025297 Bacteria 1542
450 Ga0209256_1014969 3300025299 Bacteria 2745
451 Ga0207426_1001527 3300025302 Bacteria 18868
452 Ga0207426_1001552 3300025302 Bacteria 18651
453 Ga0207426_1003596 3300025302 Bacteria 8234
454 Ga0207426_1022473 3300025302 Bacteria 2164
455 Ga0207426_1027412 3300025302 Bacteria 1898
456 Ga0209257_1003456 3300025304 Bacteria 13530
457 Ga0209257_1026569 3300025304 Bacteria 1947
458 Ga0207697_10000161 3300025315 Bacteria 33629
459 Ga0207697_10131525 3300025315 Bacteria 1081
460 Ga0207656_10631489 3300025321 Bacteria 547
461 Ga0207696_1027904 3300025711 Bacteria 1737
462 Ga0207713_1057849 3300025735 Bacteria 1496
463 Ga0207653_10001232 3300025885 Bacteria 8360
464 Ga0207682_10000164 3300025893 Bacteria 30348
465 Ga0207642_10155480 3300025899 Bacteria 1222
466 Ga0207710_10001285 3300025900 Bacteria 12691
467 Ga0207688_10000426 3300025901 Bacteria 19817
468 Ga0207680_10092349 3300025903 Bacteria 1928
469 Ga0207647_10011699 3300025904 Bacteria 6141
470 Ga0207647_10074901 3300025904 Bacteria 2038
471 Ga0207685_10063706 3300025905 Bacteria 1469
472 Ga0207699_10403469 3300025906 Bacteria 974
473 Ga0207699_11212291 3300025906 Bacteria 559
474 Ga0207645_10000040 3300025907 Bacteria 87876
475 Ga0207643_10000082 3300025908 Bacteria 62322
476 Ga0207643_10380061 3300025908 Bacteria 890
477 Ga0207705_10026866 3300025909 Bacteria 4102
478 Ga0207705_10704587 3300025909 Bacteria 785
479 Ga0207684_10463597 3300025910 Bacteria 1087
480 Ga0207654_10000364 3300025911 Bacteria 26734
481 Ga0207654_10083585 3300025911 Bacteria 1928
482 Ga0207654_10202299 3300025911 Bacteria 1308
483 Ga0207707_10002424 3300025912 Bacteria 16786
484 Ga0207707_10054633 3300025912 Bacteria 3476
485 Ga0207707_10062173 3300025912 Bacteria 3249
486 Ga0207707_10517454 3300025912 Bacteria 1016
487 Ga0207695_10000107 3300025913 Bacteria 252606
488 Ga0207695_10098338 3300025913 Bacteria 2926
489 Ga0207695_10233891 3300025913 Bacteria 1741
490 Ga0207695_10612112 3300025913 Bacteria 970
491 Ga0207695_11115400 3300025913 Bacteria 669
492 Ga0207671_10007354 3300025914 Bacteria 9563
493 Ga0207671_10056653 3300025914 Bacteria 2904
494 Ga0207671_10183041 3300025914 Bacteria 1631
495 Ga0207671_11180659 3300025914 Bacteria 599
496 Ga0207693_10015206 3300025915 Bacteria 6177
497 Ga0207693_10169696 3300025915 Bacteria 1718
498 Ga0207660_10000501 3300025917 Bacteria 26097
499 Ga0207660_10127218 3300025917 Bacteria 1936
500 Ga0207660_10129945 3300025917 Bacteria 1916
501 Ga0207660_11695780 3300025917 Bacteria 508
502 Ga0207662_10066962 3300025918 Bacteria 2165
503 Ga0207662_10069506 3300025918 Bacteria 2128
504 Ga0207662_10122337 3300025918 Bacteria 1633
505 Ga0207657_10002764 3300025919 Bacteria 18896
506 Ga0207657_10048811 3300025919 Bacteria 3694
507 Ga0207657_10294043 3300025919 Bacteria 1287
508 Ga0207657_10302268 3300025919 Bacteria 1267
509 Ga0207649_10000788 3300025920 Bacteria 20473
510 Ga0207649_10104857 3300025920 Bacteria 1878
511 Ga0207649_10285849 3300025920 Bacteria 1201
512 Ga0207649_10545726 3300025920 Bacteria 886
513 Ga0207652_10001134 3300025921 Bacteria 23993
514 Ga0207652_10067223 3300025921 Bacteria 3107
515 Ga0207652_10171401 3300025921 Bacteria 1948
516 Ga0207652_10327388 3300025921 Bacteria 1383
517 Ga0207646_10266598 3300025922 Bacteria 1548
518 Ga0207681_10000539 3300025923 Bacteria 26052
519 Ga0207681_10350826 3300025923 Bacteria 1181
520 Ga0207681_10375559 3300025923 Bacteria 1143
521 Ga0207694_10045291 3300025924 Bacteria 3398
522 Ga0207694_10050997 3300025924 Bacteria 3207
523 Ga0207694_10316187 3300025924 Bacteria 1288
524 Ga0207694_11591151 3300025924 Bacteria 551
525 Ga0207650_10001604 3300025925 Bacteria 16143
526 Ga0207650_10104673 3300025925 Bacteria 2183
527 Ga0207650_10562197 3300025925 Bacteria 957
528 Ga0207659_10004978 3300025926 Bacteria 8051
529 Ga0207659_10153697 3300025926 Bacteria 1799
530 Ga0207659_10413123 3300025926 Bacteria 1131
531 Ga0207659_10558044 3300025926 Bacteria 974
532 Ga0207687_10000063 3300025927 Bacteria 83105
533 Ga0207700_10019315 3300025928 Bacteria 4601
534 Ga0207700_10647816 3300025928 Bacteria 942
535 Ga0207664_10336651 3300025929 Bacteria 1334
536 Ga0207664_10745355 3300025929 Bacteria 881
537 Ga0207664_11337393 3300025929 Bacteria 636
538 Ga0207644_10000661 3300025931 Bacteria 21786
539 Ga0207644_10091510 3300025931 Bacteria 2268
540 Ga0207644_10256665 3300025931 Bacteria 1396
541 Ga0207690_10000086 3300025932 Bacteria 77995
542 Ga0207690_10380337 3300025932 Bacteria 1122
543 Ga0207706_10019107 3300025933 Bacteria 6164
544 Ga0207706_10340223 3300025933 Bacteria 1305
545 Ga0207706_10363597 3300025933 Bacteria 1257
546 Ga0207686_10001237 3300025934 Bacteria 14782
547 Ga0207709_10001095 3300025935 Bacteria 19865
548 Ga0207670_10000264 3300025936 Bacteria 32854
549 Ga0207670_10028387 3300025936 Bacteria 3552
550 Ga0207670_10359565 3300025936 Bacteria 1155
551 Ga0207669_10000228 3300025937 Bacteria 25653
552 Ga0207704_10000107 3300025938 Bacteria 45669
553 Ga0207704_10855321 3300025938 Bacteria 763
554 Ga0207704_10999319 3300025938 Bacteria 707
555 Ga0207704_11800361 3300025938 Bacteria 527
556 Ga0207665_10000694 3300025939 Bacteria 22798
557 Ga0207691_10001173 3300025940 Bacteria 26058
558 Ga0207691_10390120 3300025940 Bacteria 1188
559 Ga0207711_10004273 3300025941 Bacteria 12204
560 Ga0207711_10012191 3300025941 Bacteria 7147
561 Ga0207711_10648103 3300025941 Bacteria 985
562 Ga0207711_10774540 3300025941 Bacteria 894
563 Ga0207689_10001082 3300025942 Bacteria 26263
564 Ga0207689_10206229 3300025942 Bacteria 1624
565 Ga0207661_10000427 3300025944 Bacteria 27219
566 Ga0207661_10476198 3300025944 Bacteria 1139
567 Ga0207661_11483823 3300025944 Bacteria 622
568 Ga0207679_10000025 3300025945 Bacteria 203699
569 Ga0207679_10448343 3300025945 Bacteria 1144
570 Ga0207679_10532162 3300025945 Bacteria 1052
571 Ga0207679_10701099 3300025945 Bacteria 919
572 Ga0207679_11238659 3300025945 Bacteria 685
573 Ga0207667_10006928 3300025949 Bacteria 13696
574 Ga0207667_10375633 3300025949 Bacteria 1448
575 Ga0207667_10676039 3300025949 Bacteria 1036
576 Ga0207651_10000081 3300025960 Bacteria 42817
577 Ga0207651_10839172 3300025960 Bacteria 816
578 Ga0207651_11536689 3300025960 Bacteria 600
579 Ga0207712_10000587 3300025961 Bacteria 29197
580 Ga0207712_10016688 3300025961 Bacteria 4758
581 Ga0207668_10000171 3300025972 Bacteria 44795
582 Ga0207640_10001295 3300025981 Bacteria 13585
583 Ga0207640_10184781 3300025981 Bacteria 1566
584 Ga0207640_10390485 3300025981 Bacteria 1130
585 Ga0207658_10000940 3300025986 Bacteria 24033
586 Ga0207658_10535107 3300025986 Bacteria 1047
587 Ga0207677_10000447 3300026023 Bacteria 27944
588 Ga0207677_10383178 3300026023 Bacteria 1187
589 Ga0207677_11049957 3300026023 Bacteria 741
590 Ga0207703_10006213 3300026035 Bacteria 9560
591 Ga0207703_10085667 3300026035 Bacteria 2638
592 Ga0207703_11266951 3300026035 Bacteria 709
593 Ga0207703_11386263 3300026035 Bacteria 676
594 Ga0207639_10196744 3300026041 Bacteria 1726
595 Ga0207639_10221467 3300026041 Bacteria 1634
596 Ga0207639_10602681 3300026041 Bacteria 1013
597 Ga0207639_11144247 3300026041 Bacteria 730
598 Ga0207678_10001776 3300026067 Bacteria 19742
599 Ga0207678_10087980 3300026067 Bacteria 2655
600 Ga0207678_10113758 3300026067 Bacteria 2309
601 Ga0207678_10777730 3300026067 Bacteria 845
602 Ga0207678_11253062 3300026067 Bacteria 656
603 Ga0207702_10006918 3300026078 Bacteria 9712
604 Ga0207702_11291274 3300026078 Bacteria 724
605 Ga0207641_10001385 3300026088 Bacteria 23881
606 Ga0207648_10009579 3300026089 Bacteria 9267
607 Ga0207676_10001643 3300026095 Bacteria 16474
608 Ga0207676_10203783 3300026095 Bacteria 1750
609 Ga0207674_10001963 3300026116 Bacteria 26041
610 Ga0207674_10101501 3300026116 Bacteria 2858
611 Ga0207674_10399009 3300026116 Bacteria 1329
612 Ga0207674_10456876 3300026116 Bacteria 1234
613 Ga0207674_10966893 3300026116 Bacteria 820
614 Ga0207675_100002289 3300026118 Bacteria 19016
615 Ga0207675_100172842 3300026118 Bacteria 2066
616 Ga0207675_100454248 3300026118 Bacteria 1270
617 Ga0207675_100715948 3300026118 Bacteria 1011
618 Ga0207683_10000001 3300026121 Bacteria 352047
619 Ga0207683_10336690 3300026121 Bacteria 1383
620 Ga0207683_12148403 3300026121 Bacteria 506
621 Ga0207698_10002904 3300026142 Bacteria 10245
622 Ga0207698_11269177 3300026142 Bacteria 751
623 Ga0209973_1024639 3300027252 Bacteria 820
624 Ga0209389_1000153 3300027296 Bacteria 58606
625 Ga0209389_1001970 3300027296 Bacteria 15193
626 Ga0209589_1000021 3300027357 Bacteria 186431
627 Ga0209589_1001441 3300027357 Bacteria 39301
628 Ga0209489_100028 3300027361 Bacteria 186431
629 Ga0209489_100936 3300027361 Bacteria 58586
630 Ga0209489_107925 3300027361 Bacteria 15193
631 Ga0209700_100011 3300027363 Bacteria 362159
632 Ga0209700_100037 3300027363 Bacteria 186431
633 Ga0209967_1024526 3300027364 Bacteria 890
634 Ga0209981_1051746 3300027378 Bacteria 623
635 Ga0209996_1066226 3300027395 Bacteria 558
636 Ga0209984_1012409 3300027424 Bacteria 1110
637 Ga0209995_1023444 3300027471 Bacteria 1026
638 Ga0209968_1007446 3300027526 Bacteria 1656
639 Ga0209999_1027018 3300027543 Bacteria 1062
640 Ga0209982_1008888 3300027552 Bacteria 1479
641 Ga0210002_1000477 3300027617 Bacteria 5435
642 Ga0209983_1004381 3300027665 Bacteria 2968
643 Ga0209588_1030270 3300027671 Bacteria 1729
644 Ga0209971_1003482 3300027682 Bacteria 3732
645 Ga0209966_1002279 3300027695 Bacteria 3199
646 Ga0209998_10017619 3300027717 Bacteria 1511
647 Ga0209813_10019795 3300027866 Bacteria 1876
648 Ga0209813_10283706 3300027866 Bacteria 638
649 Ga0209974_10036531 3300027876 Bacteria 1632
650 Ga0207428_10001279 3300027907 Bacteria 26927
651 Ga0268266_10133468 3300028379 Bacteria 2222
652 Ga0268266_10138462 3300028379 Bacteria 2182
653 Ga0268266_10141267 3300028379 Bacteria 2161
654 Ga0268266_11163424 3300028379 Bacteria 746
655 Ga0268265_10001152 3300028380 Bacteria 23269
656 Ga0268265_11174183 3300028380 Bacteria 764
657 Ga0268265_11451951 3300028380 Bacteria 689
658 Ga0268264_10000886 3300028381 Bacteria 31552
659 Ga0268264_10764967 3300028381 Bacteria 963
660 Ga0268264_10892555 3300028381 Bacteria 892
661 Ga0268264_12701494 3300028381 Bacteria 500
662 Ga0265334_10101418 3300028573 Bacteria 1042
663 Ga0265338_10048758 3300028800 Bacteria 3848
664 Ga0265762_1048865 3300030760 Bacteria 844
665 Ga0265330_10153765 3300031235 Bacteria 977
666 Ga0265330_10231390 3300031235 Bacteria 780
667 Ga0265320_10022931 3300031240 Bacteria 3333
668 Ga0265325_10004936 3300031241 Bacteria 8318
669 Ga0265340_10042317 3300031247 Bacteria 2237
670 Ga0265340_10084294 3300031247 Bacteria 1492
671 Ga0265339_10002208 3300031249 Bacteria 14116
672 Ga0265316_10300661 3300031344 Bacteria 1169
673 Ga0307509_10163406 3300031507 Bacteria 2119
674 Ga0265313_10002423 3300031595 Bacteria 16122
675 Ga0265313_10021599 3300031595 Bacteria 3516
676 Ga0307508_10803923 3300031616 Bacteria 558
677 Ga0265314_10001439 3300031711 Bacteria 26627
678 Ga0265314_10131333 3300031711 Bacteria 1562
679 Ga0307409_102753106 3300031995 Bacteria 520
680 Ga0307414_10277404 3300032004 Bacteria 1407
681 Ga0307411_10692387 3300032005 Bacteria 887
682 Ga0307510_10047169 3300033180 Bacteria 4620
683 Ga0307510_10057372 3300033180 Bacteria 4042
684 Ga0307510_10468699 3300033180 Bacteria 701
685 Ga0373930_0019403 3300034816 Bacteria 1315
686 Ga0373950_0012634 3300034818 Bacteria 1397
687 Ga0373958_0000496 3300034819 Bacteria 4853
688 Ga0373958_0021372 3300034819 Bacteria 1200
689 Ga0373938_0000501 3300034957 Bacteria 6326
690 Ga0373928_0001329 3300035084 Bacteria 4849
691 Ga0373929_0005182 3300035085 Bacteria 2342
692 Ga0373929_0005356 3300035085 Bacteria 2307
693 Ga0373940_0006151 3300035088 Bacteria 2643
694 Ga0373944_0090244 3300035089 Bacteria 1023
695 Ga0373944_0207684 3300035089 Bacteria 711
696 Ga0373949_0001039 3300035090 Bacteria 8489
697 Ga0373949_0002241 3300035090 Bacteria 5051
698 Ga0373951_0001036 3300035091 Bacteria 7473
699 Ga0373951_0009429 3300035091 Bacteria 2197
700 Ga0373952_0000019 3300035092 Bacteria 19182
701 Ga0373923_0114522 3300035111 Bacteria 1200
702 Ga0373932_0001702 3300035112 Bacteria 5980
703 Ga0373936_0006248 3300035113 Bacteria 4492
704 Ga0373939_0000216 3300035114 Bacteria 15784
705 Ga0373939_0001911 3300035114 Bacteria 4985
706 Ga0373939_0040991 3300035114 Bacteria 1394
707 Ga0373941_0000554 3300035115 Bacteria 7456
708 Ga0373941_0000816 3300035115 Bacteria 6394
709 Ga0373953_0018189 3300035117 Bacteria 2597
710 Ga0373954_0045439 3300035118 Bacteria 2052
711 Ga0373956_0580804 3300035119 Bacteria 535
712 Ga0373960_0000120 3300035121 Bacteria 12660
713 Ga0373960_0434649 3300035121 Bacteria 512
714 Ga0373946_0006187 3300035171 Bacteria 4334
715 Ga0373961_0002336 3300035241 Bacteria 4952
716 Ga0373962_0001149 3300035242 Bacteria 6171
717 Ga0373962_0051820 3300035242 Bacteria 1184
718 Ga0373924_0066939 3300035410 Bacteria 1510
719 Ga0373931_0000168 3300035691 Bacteria 28567
720 Ga0373931_0494830 3300035691 Bacteria 788
721 Ga0373931_0525007 3300035691 Bacteria 766
722 Ga0373931_0534481 3300035691 Bacteria 760
723 Ga0373935_0005287 3300035692 Bacteria 7594
724 Ga0373927_0000121 3300035695 Bacteria 59449
725 Ga0373927_0302343 3300035695 Bacteria 1053
726 Ga0373933_0001546 3300035724 Bacteria 13469
727 Ga0373947_0000118 3300035725 Bacteria 39817
728 Ga0373947_0692793 3300035725 Bacteria 695
729 Ga0373937_0465433 3300036401 Bacteria 1201
730 Ga0373937_1552861 3300036401 Bacteria 609
731 Ga0373925_0003905 3300037068 Bacteria 11385
732 Ga0373925_0290237 3300037068 Bacteria 1319
733 Ga0373925_0306580 3300037068 Bacteria 1283
734 Ga0373925_0512941 3300037068 Bacteria 985
735 Ga0373925_1662082 3300037068 Bacteria 522
736 Ga0395900_0000623 3300037418 Bacteria 47633
737 Ga0395900_0304771 3300037418 Bacteria 1578
738 Ga0395898_0005100 3300037466 Bacteria 14229
739 Ga0395898_0091902 3300037466 Bacteria 2919
740 Ga0395898_0159166 3300037466 Bacteria 2160
741 Ga0395905_0008122 3300037471 Bacteria 10371
742 Ga0395905_0101686 3300037471 Bacteria 2698
743 Ga0395905_0110910 3300037471 Bacteria 2576
744 Ga0395905_0978275 3300037471 Bacteria 749
745 Ga0436364_0763481 3300037853 Bacteria 839
746 Ga0395901_0025332 3300038443 Bacteria 6089
747 Ga0395901_0186453 3300038443 Bacteria 2176
748 Ga0395901_0240390 3300038443 Bacteria 1889
749 Ga0395901_1922363 3300038443 Bacteria 539
750 Ga0242419_006070 3300038698 Bacteria 871
751 Ga0436365_0051319 3300039437 Bacteria 5468
752 Ga0436365_1514182 3300039437 Bacteria 697
753 Ga0436365_1635461 3300039437 Bacteria 1638
754 Ga0436360_0080726 3300039438 Bacteria 717
755 Ga0436360_0202439 3300039438 Bacteria 3479
756 Ga0436360_1015043 3300039438 Bacteria 1024
757 Ga0436361_0623870 3300039447 Bacteria 1736
758 Ga0436363_0224834 3300039450 Bacteria 1230
759 Ga0436363_0319292 3300039450 Bacteria 1095
760 Ga0436363_0431126 3300039450 Bacteria 873
761 Ga0436363_1088775 3300039450 Bacteria 1250
762 Ga0436362_0138270 3300039453 Bacteria 4263
763 Ga0436362_0419658 3300039453 Bacteria 1650
764 Ga0436362_0743365 3300039453 Bacteria 575
765 Ga0439465_0135724 3300041413 Bacteria 871
766 Ga0439465_0235665 3300041413 Bacteria 674
767 Ga0451791_1212031 3300041451 Bacteria 1168
768 Ga0451791_1591294 3300041451 Bacteria 1199
769 Ga0451793_0115389 3300041452 Bacteria 647
770 Ga0451797_1054811 3300041453 Bacteria 509
771 Ga0451795_0985424 3300041456 Bacteria 732
772 Ga0451798_0684963 3300041458 Bacteria 1024
773 Ga0451802_0613368 3300041460 Bacteria 692
774 Ga0451802_1363334 3300041460 Bacteria 527
775 Ga0451807_2241141 3300041486 Bacteria 925
776 Ga0451839_0152791 3300041496 Bacteria 571
777 Ga0451839_1021691 3300041496 Bacteria 510
778 Ga0451849_1088658 3300041505 Bacteria 758
779 Ga0451851_0249131 3300041507 Bacteria 513
780 Ga0439437_001742 3300042000 Bacteria 2304
781 Ga0439441_019518 3300042001 Bacteria 1234
782 Ga0439443_059278 3300042003 Bacteria 683
783 Ga0439448_0067783 3300042005 Bacteria 1186
784 Ga0439448_0098198 3300042005 Bacteria 993
785 Ga0439450_088189 3300042008 Bacteria 777
786 Ga0439455_0008897 3300042012 Bacteria 2165
787 Ga0439435_0022509 3300042436 Bacteria 1646
788 Ga0439444_0044691 3300042437 Bacteria 882
789 Ga0439464_0006642 3300042439 Bacteria 3018
790 Ga0439440_0132644 3300042993 Unclassified 702
791 Ga0466969_0004242 3300044656 Bacteria 7622
792 Ga0466969_0129828 3300044656 Bacteria 1169
793 Ga0466969_0577827 3300044656 Bacteria 515
794 Ga0466972_0001791 3300044658 Bacteria 10523
795 Ga0466972_0024641 3300044658 Bacteria 2985
796 Ga0466972_0119362 3300044658 Bacteria 1244
797 Ga0466972_0124633 3300044658 Bacteria 1214
798 Ga0466972_0148608 3300044658 Bacteria 1102
799 Ga0466965_0093556 3300044683 Bacteria 1531
800 Ga0466965_0217095 3300044683 Bacteria 1018
801 Ga0466966_0001051 3300044684 Bacteria 17608
802 Ga0466966_0389774 3300044684 Bacteria 837
803 Ga0466966_0474628 3300044684 Bacteria 752
804 Ga0466966_0917341 3300044684 Bacteria 528
805 Ga0466961_0005739 3300044693 Bacteria 7854
806 Ga0466961_0274903 3300044693 Bacteria 1032
807 Ga0466963_0030126 3300044694 Bacteria 3499
808 Ga0466964_0059002 3300044706 Bacteria 1592
809 Ga0466971_0088729 3300044719 Bacteria 1415
810 Ga0466968_0019273 3300044735 Bacteria 2746
811 Ga0466970_0080544 3300044765 Bacteria 1760
812 Ga0466970_0416824 3300044765 Bacteria 767
813 Ga0466970_0564740 3300044765 Bacteria 658
814 Ga0466960_0023639 3300044901 Bacteria 2761
815 Ga0466959_0406614 3300045049 Bacteria 925
816 Ga0466958_0289156 3300045836 Bacteria 1051
817 Ga0466967_0073407 3300045976 Bacteria 3070
818 Ga0466967_0213410 3300045976 Bacteria 1831
819 Ga0466967_0941903 3300045976 Bacteria 859
820 Ga0466967_1111338 3300045976 Bacteria 788
821 Ga0466967_1877775 3300045976 Bacteria 596
822 Ga0466967_2229155 3300045976 Bacteria 544
823 Ga0495617_030446 3300046452 Bacteria 1814
824 Ga0495592_0052893 3300046454 Bacteria 3013
825 Ga0495592_0164753 3300046454 Bacteria 1522
826 Ga0495603_0000053 3300046455 Bacteria 49373
827 Ga0495603_0052299 3300046455 Bacteria 2425
828 Ga0495603_0057979 3300046455 Bacteria 2290
829 Ga0495603_0137674 3300046455 Bacteria 1421
830 Ga0495590_0250539 3300046457 Bacteria 659
831 Ga0495590_0319548 3300046457 Bacteria 586
832 Ga0495629_0000879 3300046459 Bacteria 24220
833 Ga0495629_0650542 3300046459 Bacteria 702
834 Ga0495638_0030449 3300046460 Bacteria 3474
835 Ga0495638_0033944 3300046460 Bacteria 3259
836 Ga0495641_0001147 3300046461 Bacteria 22816
837 Ga0495651_0006742 3300046462 Bacteria 8781
838 Ga0495580_0001877 3300046472 Bacteria 18497
839 Ga0495582_0000186 3300046473 Bacteria 34006
840 Ga0495605_0214392 3300046474 Bacteria 834
841 Ga0495639_0000078 3300046475 Bacteria 46048
842 Ga0495639_0170302 3300046475 Bacteria 1057
843 Ga0495639_0183763 3300046475 Bacteria 1019
844 Ga0495662_0001412 3300046476 Bacteria 11898
845 Ga0495662_0194068 3300046476 Bacteria 1001
846 Ga0495664_0048155 3300046477 Bacteria 2530
847 Ga0495664_0100006 3300046477 Bacteria 1746
848 Ga0495594_0000103 3300046499 Bacteria 39690
849 Ga0495594_0056232 3300046499 Bacteria 2171
850 Ga0495596_0434902 3300046500 Bacteria 512
851 Ga0495607_0450617 3300046501 Bacteria 578
852 Ga0495607_0507967 3300046501 Bacteria 534
853 Ga0495583_0117172 3300046506 Bacteria 1124
854 Ga0495583_0428435 3300046506 Bacteria 519
855 Ga0495606_0021503 3300046507 Bacteria 4725
856 Ga0495606_0087985 3300046507 Bacteria 1916
857 Ga0495608_0123473 3300046511 Bacteria 1659
858 Ga0495610_0192021 3300046512 Bacteria 842
859 Ga0495616_0203405 3300046513 Bacteria 869
860 Ga0495618_0092321 3300046514 Bacteria 1936
861 Ga0495620_0158003 3300046515 Bacteria 882
862 Ga0495628_0008202 3300046516 Bacteria 8983
863 Ga0495628_0054033 3300046516 Bacteria 3167
864 Ga0495628_0707827 3300046516 Bacteria 711
865 Ga0495630_0003914 3300046517 Bacteria 10413
866 Ga0495630_0388668 3300046517 Bacteria 1069
867 Ga0495631_0507640 3300046518 Bacteria 514
868 Ga0495632_0312683 3300046519 Bacteria 695
869 Ga0495632_0362937 3300046519 Bacteria 636
870 Ga0495637_0119799 3300046520 Bacteria 1014
871 Ga0495643_0023626 3300046522 Bacteria 3492
872 Ga0495643_0243841 3300046522 Bacteria 842
873 Ga0495644_0105274 3300046523 Bacteria 1069
874 Ga0495648_0011773 3300046524 Bacteria 6565
875 Ga0495648_0212783 3300046524 Bacteria 959
876 Ga0495648_0393557 3300046524 Bacteria 621
877 Ga0495663_0353195 3300046525 Bacteria 536
878 Ga0495666_0001779 3300046526 Bacteria 10634
879 Ga0495666_0065729 3300046526 Bacteria 1730
880 Ga0495642_0265770 3300046528 Bacteria 751
881 Ga0495652_0150715 3300046529 Bacteria 1817
882 Ga0495652_0238017 3300046529 Bacteria 1357
883 Ga0495654_0116440 3300046530 Bacteria 1214
884 Ga0495665_0000190 3300046531 Bacteria 31563
885 Ga0495640_0001297 3300046533 Bacteria 19633
886 Ga0495640_0130139 3300046533 Bacteria 1629
887 Ga0495640_0537942 3300046533 Bacteria 709
888 Ga0495587_0010408 3300046536 Bacteria 5922
889 Ga0495598_0042248 3300046537 Bacteria 1337
890 Ga0495645_0060216 3300046543 Bacteria 2752
891 Ga0495622_0001547 3300046557 Bacteria 11434
892 Ga0495622_0033426 3300046557 Bacteria 2400
893 Ga0495622_0037463 3300046557 Bacteria 2259
894 Ga0495622_0333714 3300046557 Bacteria 657
895 Ga0495667_0110133 3300046559 Bacteria 1779
896 Ga0495656_0343965 3300046615 Bacteria 772
897 Ga0495656_0611051 3300046615 Bacteria 584
898 Ga0495656_0629729 3300046615 Bacteria 575
899 Ga0495668_0174901 3300046616 Bacteria 1176
900 Ga0495668_0191619 3300046616 Bacteria 1120
901 Ga0495668_0312109 3300046616 Bacteria 862
902 Ga0495634_0001169 3300046642 Bacteria 24315
903 Ga0495634_0046747 3300046642 Bacteria 2920
904 Ga0495611_0050268 3300046648 Bacteria 1877
905 Ga0495625_0094117 3300046660 Bacteria 2068
906 Ga0495625_0267767 3300046660 Bacteria 1104
907 Ga0495635_0000368 3300046663 Bacteria 28703
908 Ga0495635_0000985 3300046663 Bacteria 18760
909 Ga0495635_0124568 3300046663 Bacteria 1757
910 Ga0495659_0013263 3300046664 Bacteria 2682
911 Ga0495661_0123940 3300046665 Bacteria 1424
912 Ga0495661_0266784 3300046665 Bacteria 868
913 Ga0495588_0003732 3300046674 Bacteria 6659
914 Ga0495588_0024229 3300046674 Bacteria 3013
915 Ga0495588_0405946 3300046674 Bacteria 715
916 Ga0495657_0009428 3300046675 Bacteria 7397
917 Ga0495599_0067631 3300046678 Bacteria 2231
918 Ga0495599_0222496 3300046678 Bacteria 1154
919 Ga0495646_0011058 3300046680 Bacteria 5733
920 Ga0495646_0020279 3300046680 Bacteria 4206
921 Ga0495647_0000720 3300046681 Bacteria 9794
922 Ga0495647_0102158 3300046681 Bacteria 1188
923 Ga0495658_0005321 3300046683 Bacteria 6333
924 Ga0495658_0810041 3300046683 Bacteria 599
925 Ga0495669_0280639 3300046684 Bacteria 801
926 Ga0495613_0004274 3300046689 Bacteria 10700
927 Ga0495613_0170277 3300046689 Bacteria 1546
928 Ga0495624_0000504 3300046690 Bacteria 30575
929 Ga0495624_0192605 3300046690 Bacteria 1240
930 Ga0495670_0075745 3300046691 Bacteria 1708
931 Ga0495671_0084620 3300046692 Bacteria 1554
932 Ga0495649_0022151 3300046694 Bacteria 3555
933 Ga0495649_0196381 3300046694 Bacteria 1049
934 Ga0495589_0240153 3300046794 Bacteria 848
935 Ga0495600_0002231 3300046809 Bacteria 11032
936 Ga0495600_0038619 3300046809 Bacteria 3107
937 Ga0495660_0123810 3300046810 Bacteria 1305
938 Ga0495581_0000501 3300047315 Bacteria 20012
939 Ga0495604_0003943 3300047317 Bacteria 11814
940 Ga0495604_0874787 3300047317 Bacteria 563
941 Ga0495674_0000228 3300047319 Bacteria 46998
942 Ga0495674_0066520 3300047319 Bacteria 3126
943 Ga0495672_0199732 3300047320 Bacteria 1001
944 Ga0495676_0015031 3300047321 Bacteria 6909
945 Ga0495676_0343712 3300047321 Bacteria 998
946 Ga0495680_0005216 3300047322 Bacteria 12265
947 Ga0495683_0068028 3300047323 Bacteria 1753
948 Ga0495683_0077797 3300047323 Bacteria 1621
949 Ga0495683_0081109 3300047323 Bacteria 1582
950 Ga0495683_0291900 3300047323 Bacteria 703
951 Ga0495687_015336 3300047443 Bacteria 3902
952 Ga0495675_0009631 3300047444 Bacteria 6016
953 Ga0495675_0368120 3300047444 Bacteria 843
954 Ga0495677_0083670 3300047445 Bacteria 1198
955 Ga0495677_0094653 3300047445 Bacteria 1127
956 Ga0495677_0380474 3300047445 Bacteria 558
957 Ga0495673_0270268 3300047469 Bacteria 616
958 Ga0495681_0389328 3300047470 Bacteria 523
959 Ga0495684_0135777 3300047471 Bacteria 1846
960 Ga0495686_0026275 3300047472 Bacteria 3810
961 Ga0495593_0000033 3300047673 Bacteria 58363
962 Ga0495602_0019579 3300048088 Bacteria 6715
963 Ga0495602_0575539 3300048088 Bacteria 777
964 Ga0495614_0011420 3300048089 Bacteria 3911
965 Ga0495615_0040399 3300048090 Bacteria 1161
966 Ga0495626_0030649 3300048091 Bacteria 2594
967 Ga0495626_0280746 3300048091 Bacteria 662
968 Ga0496100_0000503 3300048903 Bacteria 18785
969 Ga0496101_0000510 3300048904 Bacteria 24389
970 Ga0496101_0156450 3300048904 Bacteria 1746
971 Ga0496101_0386092 3300048904 Bacteria 1102
972 Ga0496101_0848610 3300048904 Bacteria 720
973 Ga0496102_0003114 3300048905 Bacteria 14069
974 Ga0496102_0126849 3300048905 Bacteria 2386
975 Ga0496102_0202660 3300048905 Bacteria 1870
976 Ga0496102_0292943 3300048905 Bacteria 1534
977 Ga0496103_0002544 3300048906 Bacteria 11424
978 Ga0496103_0356521 3300048906 Bacteria 940
979 Ga0496104_0017224 3300048907 Bacteria 6575
980 Ga0496104_0029119 3300048907 Bacteria 5121
981 Ga0496104_0029932 3300048907 Bacteria 5056
982 Ga0496104_0602756 3300048907 Bacteria 1008
983 Ga0496105_0005872 3300048908 Bacteria 9360
984 Ga0496105_0171815 3300048908 Bacteria 1776
985 Ga0496105_1233987 3300048908 Bacteria 549
986 Ga0496106_0000327 3300048909 Bacteria 33634
987 Ga0496106_0115424 3300048909 Bacteria 2094
988 Ga0496107_0000143 3300048910 Bacteria 35680
989 Ga0496107_0025470 3300048910 Bacteria 4188
990 Ga0496107_0148058 3300048910 Bacteria 1736
991 Ga0496107_0477856 3300048910 Bacteria 925
992 Ga0496107_0580426 3300048910 Bacteria 829
993 Ga0496108_0001249 3300048911 Bacteria 19881
994 Ga0496108_0002170 3300048911 Bacteria 15738
995 Ga0496108_0075429 3300048911 Bacteria 2849
996 Ga0496108_1510326 3300048911 Bacteria 559
997 Ga0496109_0000372 3300048912 Bacteria 40804
998 Ga0496109_0001114 3300048912 Bacteria 22296
999 Ga0496109_0145117 3300048912 Bacteria 2220
1000 Ga0496109_0329923 3300048912 Bacteria 1440
1001 Ga0496110_0010802 3300048913 Bacteria 7444
1002 Ga0496110_0032262 3300048913 Bacteria 4522
1003 Ga0496110_0665185 3300048913 Bacteria 942
1004 Ga0496110_0980379 3300048913 Bacteria 752
1005 Ga0496111_0001119 3300048914 Bacteria 14845
1006 Ga0496111_0122249 3300048914 Bacteria 1923
1007 Ga0496112_0025093 3300048915 Bacteria 5719
1008 Ga0496112_0037410 3300048915 Bacteria 4737
1009 Ga0496112_0161531 3300048915 Bacteria 2207
1010 Ga0496112_0673436 3300048915 Bacteria 963
1011 Ga0496112_0921646 3300048915 Bacteria 795
1012 Ga0496113_0016164 3300048916 Bacteria 5150
1013 Ga0496113_0023412 3300048916 Bacteria 4379
1014 Ga0496113_0037303 3300048916 Bacteria 3565
1015 Ga0496113_0224472 3300048916 Bacteria 1497
1016 Ga0496114_0002293 3300048917 Bacteria 14586
1017 Ga0496114_0067931 3300048917 Bacteria 2991
1018 Ga0496114_0600170 3300048917 Bacteria 971
1019 Ga0496114_0938436 3300048917 Bacteria 747
1020 Ga0496115_0000555 3300048918 Bacteria 28955
1021 Ga0496115_0016170 3300048918 Bacteria 5675
1022 Ga0496115_0472890 3300048918 Bacteria 1010
1023 Ga0496116_0047052 3300048919 Bacteria 2907
1024 Ga0496116_0099838 3300048919 Bacteria 1737
1025 Ga0496118_0041922 3300048921 Bacteria 3618
1026 Ga0496118_0081158 3300048921 Bacteria 2278
1027 Ga0496118_0227616 3300048921 Bacteria 1079
1028 Ga0496118_0297511 3300048921 Bacteria 888
1029 Ga0496119_0009360 3300048922 Bacteria 8423
1030 Ga0496119_0053835 3300048922 Bacteria 2455
1031 Ga0496119_0354845 3300048922 Bacteria 709
1032 Ga0496120_0004718 3300048923 Bacteria 11225
1033 Ga0496120_0156549 3300048923 Bacteria 1140
1034 Ga0496121_0078626 3300048924 Bacteria 2621
1035 Ga0496121_0083053 3300048924 Bacteria 2530
1036 Ga0496121_0116972 3300048924 Bacteria 2020
1037 Ga0496121_0136042 3300048924 Bacteria 1830
1038 Ga0496121_0413523 3300048924 Bacteria 880
1039 Ga0496124_0315973 3300048927 Bacteria 1121
1040 Ga0496126_0012253 3300048929 Bacteria 8796
1041 Ga0496126_0214284 3300048929 Bacteria 1620
1042 Ga0496126_0409102 3300048929 Bacteria 1099
1043 Ga0496126_0735377 3300048929 Bacteria 763
1044 Ga0496126_1391407 3300048929 Bacteria 507
1045 Ga0495682_0033259 3300049460 Bacteria 1903
1046 Ga0501032_0018358 3300049569 Bacteria 4901
1047 Ga0501033_0217060 3300049570 Bacteria 1362
1048 Ga0501034_0014156 3300049571 Bacteria 8221
1049 Ga0501034_0258683 3300049571 Bacteria 1684
1050 Ga0501034_0807348 3300049571 Bacteria 830
1051 Ga0501034_1718694 3300049571 Bacteria 500
1052 Ga0501036_0021648 3300049572 Bacteria 5405
1053 Ga0501037_0110087 3300049573 Bacteria 1984
1054 Ga0501038_0029854 3300049574 Bacteria 4829
1055 Ga0501039_0020116 3300049575 Bacteria 5117
1056 Ga0501039_0655183 3300049575 Bacteria 822
1057 Ga0501040_0846192 3300049576 Bacteria 662
1058 Ga0501042_1363028 3300049578 Bacteria 517
1059 Ga0501043_0020670 3300049579 Bacteria 5164
1060 Ga0501043_1281147 3300049579 Bacteria 512
1061 Ga0501046_0331951 3300049580 Bacteria 1106
1062 Ga0501047_0511683 3300049581 Bacteria 1027
1063 Ga0501047_0782210 3300049581 Bacteria 769
1064 Ga0501047_1425808 3300049581 Bacteria 508
1065 Ga0501067_0109307 3300049583 Bacteria 1537
1066 Ga0501067_0173376 3300049583 Bacteria 1201
1067 Ga0501067_0567901 3300049583 Bacteria 635
1068 Ga0501067_0878796 3300049583 Bacteria 506
1069 Ga0501068_0382417 3300049584 Bacteria 906
1070 Ga0501069_0079589 3300049585 Bacteria 1845
1071 Ga0501069_0096009 3300049585 Bacteria 1679
1072 Ga0501070_0567041 3300049586 Bacteria 907
1073 Ga0501070_0928544 3300049586 Bacteria 678
1074 Ga0501071_1503593 3300049587 Bacteria 520
1075 Ga0501072_0006089 3300049588 Bacteria 9204
1076 Ga0501072_0046675 3300049588 Bacteria 3410
1077 Ga0501072_0758788 3300049588 Bacteria 761
1078 Ga0501073_0069012 3300049589 Bacteria 2463
1079 Ga0501073_0621788 3300049589 Bacteria 746
1080 Ga0501074_0023893 3300049590 Bacteria 4441
1081 Ga0501074_0505132 3300049590 Bacteria 856
1082 Ga0501075_1021414 3300049591 Bacteria 628
1083 Ga0501076_0230372 3300049592 Bacteria 1514
1084 Ga0501076_0325901 3300049592 Bacteria 1260
1085 Ga0501077_0015784 3300049593 Bacteria 4756
1086 Ga0501079_0350618 3300049741 Bacteria 1156
1087 Ga0501080_0284181 3300049742 Bacteria 1503
1088 Ga0501080_1229030 3300049742 Bacteria 643
1089 Ga0501081_0170893 3300049743 Bacteria 1569
1090 Ga0501083_0081561 3300049744 Bacteria 2144
1091 Ga0501083_0094600 3300049744 Bacteria 1972
1092 Ga0501083_0236461 3300049744 Bacteria 1189
1093 Ga0501083_0600349 3300049744 Bacteria 716
1094 Ga0501083_0888587 3300049744 Bacteria 580
1095 Ga0501083_1012307 3300049744 Unclassified 541
1096 Ga0501035_0062437 3300049822 Bacteria 3315
1097 nmdc:mga03n38_156690_c1 3300050490 Bacteria 1150
1098 nmdc:mga03n38_330829_c1 3300050490 Bacteria 825
1099 nmdc:mga03n38_359809_c1 3300050490 Bacteria 794
1100 nmdc:mga03n38_368717_c1 3300050490 Bacteria 785
1101 nmdc:mga03n38_446070_c1 3300050490 Bacteria 719
1102 nmdc:mga00v17_593731_c1 3300050491 Unclassified 714
1103 nmdc:mga00v17_744843_c1 3300050491 Bacteria 626
1104 nmdc:mga0yw44_1061021_c1 3300050492 Bacteria 548
1105 nmdc:mga0yw44_13917_c1 3300050492 Bacteria 4253
1106 nmdc:mga0yw44_166441_c1 3300050492 Bacteria 1446
1107 nmdc:mga0yw44_2244_c1 3300050492 Bacteria 8150
1108 nmdc:mga0k408_57039_c1 3300050493 Bacteria 2267
1109 nmdc:mga0k408_668968_c1 3300050493 Bacteria 610
1110 nmdc:mga06z11_124555_c1 3300050494 Bacteria 1441
1111 nmdc:mga06z11_131151_c1 3300050494 Bacteria 1408
1112 nmdc:mga06z11_186895_c1 3300050494 Bacteria 1197
1113 nmdc:mga06z11_316866_c1 3300050494 Bacteria 930
1114 nmdc:mga06z11_319435_c1 3300050494 Bacteria 926
1115 nmdc:mga06z11_515165_c1 3300050494 Bacteria 725
1116 nmdc:mga04h51_30189_c1 3300050495 Bacteria 1704
1117 nmdc:mga07m45_10126_c1 3300050496 Bacteria 4914
1118 nmdc:mga07m45_219520_c1 3300050496 Bacteria 1106
1119 nmdc:mga07m45_34313_c1 3300050496 Bacteria 2820
1120 nmdc:mga07m45_353521_c1 3300050496 Bacteria 854
1121 nmdc:mga07m45_42894_c1 3300050496 Bacteria 2536
1122 nmdc:mga05p37_582763_c1 3300050507 Bacteria 1266
1123 nmdc:mga08y16_3663_c1 3300050511 Bacteria 15989
1124 nmdc:mga0n895_436512_c1 3300050512 Bacteria 1323
1125 nmdc:mga0n895_55_c1 3300050512 Bacteria 66529
1126 nmdc:mga0rr50_230836_c1 3300050513 Bacteria 1531
1127 nmdc:mga0rr50_357645_c1 3300050513 Bacteria 1229
1128 nmdc:mga0a205_5630_c2 3300050515 Bacteria 8326
1129 nmdc:mga0sz30_164413_c1 3300050516 Bacteria 983
1130 nmdc:mga0sz30_200254_c1 3300050516 Bacteria 887
1131 nmdc:mga0sz30_54247_c2 3300050516 Bacteria 1274
1132 nmdc:mga0sz30_556945_c1 3300050516 Bacteria 517
1133 nmdc:mga0sz30_86267_c1 3300050516 Bacteria 1363
1134 Ga0495601_0036600 3300053077 Bacteria 3066
1135 Ga0495601_0102791 3300053077 Bacteria 1847
1136 Ga0495612_0446188 3300053078 Bacteria 591
1137 Ga0500635_0121463 3300053080 Bacteria 978
1138 Ga0495619_0004738 3300053085 Bacteria 8654
1139 Ga0495619_0043221 3300053085 Bacteria 2954
1140 Ga0495619_1005209 3300053085 Bacteria 558
1141 Ga0500578_0161655 3300053086 Bacteria 1389
1142 Ga0500643_000063 3300053087 Bacteria 122135
1143 Ga0500643_196316 3300053087 Bacteria 541
1144 Ga0500644_0155773 3300053088 Bacteria 920
1145 Ga0500581_342998 3300053089 Bacteria 570
1146 Ga0500647_0174997 3300053091 Bacteria 988
1147 Ga0500651_0105613 3300053093 Bacteria 1723
1148 Ga0500566_0009826 3300053094 Bacteria 5649
1149 Ga0500566_0067843 3300053094 Bacteria 2007
1150 Ga0500641_0033083 3300053096 Bacteria 2050
1151 Ga0500555_034459 3300053103 Bacteria 1425
1152 Ga0500556_0013711 3300053104 Bacteria 2459
1153 Ga0500557_000177 3300053105 Bacteria 12798
1154 Ga0500562_098476 3300053108 Bacteria 796
1155 Ga0500569_077700 3300053109 Bacteria 1056
1156 Ga0500594_0012364 3300053118 Bacteria 2010
1157 Ga0500595_017336 3300053119 Bacteria 2660
1158 Ga0500595_179950 3300053119 Bacteria 586
1159 Ga0500607_267376 3300053121 Bacteria 663
1160 Ga0500614_070524 3300053123 Bacteria 958
1161 Ga0500617_070874 3300053124 Bacteria 1527
1162 Ga0500626_067371 3300053128 Bacteria 1596
1163 Ga0500652_170659 3300053131 Bacteria 895
1164 Ga0500559_0124460 3300053136 Bacteria 1200
1165 Ga0500559_0425577 3300053136 Bacteria 616
1166 Ga0500568_0019253 3300053139 Bacteria 2970
1167 Ga0500568_0262257 3300053139 Bacteria 629
1168 Ga0500577_0025610 3300053142 Bacteria 1998
1169 Ga0500577_0048303 3300053142 Bacteria 1586
1170 Ga0500585_211349 3300053144 Bacteria 640
1171 Ga0500588_0030517 3300053146 Bacteria 1547
1172 Ga0500589_092826 3300053147 Bacteria 1326
1173 Ga0500589_177959 3300053147 Bacteria 839
1174 Ga0500590_372429 3300053148 Bacteria 500
1175 Ga0500604_0333313 3300053151 Bacteria 527
1176 Ga0500616_0038934 3300053153 Bacteria 2565
1177 Ga0500616_0041628 3300053153 Bacteria 2464
1178 Ga0500616_0391717 3300053153 Bacteria 557
1179 Ga0500620_123812 3300053155 Bacteria 906
1180 Ga0500627_0034508 3300053158 Bacteria 2145
1181 Ga0500627_0215976 3300053158 Bacteria 857
1182 Ga0500633_0077982 3300053160 Bacteria 1194
1183 Ga0500638_053079 3300053162 Bacteria 1957
1184 Ga0500638_308756 3300053162 Bacteria 606
1185 Ga0500636_0000143 3300053177 Bacteria 37566
1186 Ga0500625_000062 3300053729 Bacteria 20235
1187 Ga0500609_016664 3300053731 Bacteria 997
1188 Ga0500552_123777 3300053733 Bacteria 505
1189 Ga0500599_000538 3300053736 Bacteria 3987
1190 Ga0500601_000652 3300053737 Bacteria 4766
1191 Ga0501084_0041580 3300054114 Bacteria 3846
1192 Ga0501084_0657102 3300054114 Bacteria 885
1193 Ga0587070_194221 3300059491 Bacteria 536
1194 Ga0587085_096112 3300059506 Bacteria 619
1195 Ga0501082_0620034 3300060353 Bacteria 947
1196 Ga0501082_0724227 3300060353 Bacteria 871
1197 Ga0466962_0194169 3300061719 Bacteria 991

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016613128 8016618524 84
2 3300005356 Ga0070674_100391470 Ga0070674_1003914703 86
3 3300050490 nmdc:mga03n38_156690_c1 nmdc:mga03n38_156690_c1_10_285 91
4 3300053148 Ga0500590_372429 Ga0500590_372429_199_477 92
5 3300031995 Ga0307409_102753106 Ga0307409_1027531061 94
6 3300041456 Ga0451795_0985424 Ga0451795_0985424_50_334 94
7 iso_pu_bacteria 2524023228 2524537105 94
8 iso_pu_bacteria 2667528175 2671119992 94
9 iso_pu_bacteria 2874604998 2874608121 94
10 iso_pu_bacteria 2903748898 2903749505 94
11 iso_pu_bacteria 2904690495 2904690562 94
12 iso_pu_bacteria 2904699407 2904708755 94
13 iso_pu_bacteria 2908756301 2908756639 94
14 iso_pu_bacteria 3005474847 3005475012 94
15 iso_pu_bacteria 8006933436 8006936309 94
16 iso_pu_bacteria 8006973647 8006976278 94
17 iso_pu_bacteria 8056689827 8056693349 94
18 3300039450 Ga0436363_0319292 Ga0436363_0319292_161_460 95
19 3300009553 Ga0105249_10617523 Ga0105249_106175232 96
20 iso_pu_bacteria 2513237094 2513644110 96
21 iso_pu_bacteria 2513237101 2513695059 96
22 iso_pu_bacteria 2513237141 2513888722 96
23 iso_pu_bacteria 2643221547 2643758047 96
24 iso_pu_bacteria 2728368998 2728754941 96
25 iso_pu_bacteria 2744054633 2745081636 96
26 iso_pu_bacteria 2876808645 2876817195 96
27 iso_pu_bacteria 2879099564 2879108605 96
28 iso_pu_bacteria 2879110137 2879112110 96
29 iso_pu_bacteria 2922361189 2922364051 96
30 iso_pu_bacteria 2922368715 2922368997 96
31 iso_pu_bacteria 2922386360 2922392629 96
32 iso_pu_bacteria 2932784394 2932792867 96
33 iso_pu_bacteria 2932809354 2932812222 96
34 iso_pu_bacteria 2932818245 2932823213 96
35 iso_pu_bacteria 2932828146 2932836128 96
36 iso_pu_bacteria 2935616580 2935618465 96
37 iso_pu_bacteria 2935638405 2935641137 96
38 iso_pu_bacteria 2935665750 2935670053 96
39 iso_pu_bacteria 2935675223 2935679094 96
40 iso_pu_bacteria 2935684952 2935689968 96
41 iso_pu_bacteria 2935694250 2935698489 96
42 iso_pu_bacteria 2935703347 2935711424 96
43 iso_pu_bacteria 2935713505 2935717487 96
44 iso_pu_bacteria 2935722832 2935723843 96
45 iso_pu_bacteria 2935732158 2935740052 96
46 iso_pu_bacteria 2935741537 2935749315 96
47 iso_pu_bacteria 2935750917 2935757322 96
48 iso_pu_bacteria 2935760218 2935763592 96
49 iso_pu_bacteria 2935801545 2935803981 96
50 iso_pu_bacteria 2935810662 2935819400 96
51 iso_pu_bacteria 2935827899 2935835716 96
52 iso_pu_bacteria 2935837841 2935844663 96
53 iso_pu_bacteria 2935855204 2935862890 96
54 iso_pu_bacteria 2935864058 2935866632 96
55 iso_pu_bacteria 2935873716 2935874939 96
56 iso_pu_bacteria 2935992306 2935999786 96
57 iso_pu_bacteria 2936002035 2936004577 96
58 iso_pu_bacteria 2936037263 2936046113 96
59 iso_pu_bacteria 2940556831 2940563235 96
60 iso_pu_bacteria 2941538514 2941543152 96
61 iso_pu_bacteria 8006964411 8006969306 96
62 iso_pu_bacteria 8016511872 8016518243 96
63 iso_pu_bacteria 8017057580 8017058409 96
64 iso_pu_bacteria 8019576017 8019577287 96
65 iso_pu_bacteria 8019586578 8019595368 96
66 iso_pu_bacteria 8019597564 8019606391 96
67 3300003203 JGI25406J46586_10011591 JGI25406J46586_100115913 97
68 3300005548 Ga0070665_100073736 Ga0070665_1000737364 97
69 3300005985 Ga0081539_10002854 Ga0081539_1000285411 97
70 3300027671 Ga0209588_1030270 Ga0209588_10302702 97
71 3300028379 Ga0268266_11163424 Ga0268266_111634241 97
72 3300031507 Ga0307509_10163406 Ga0307509_101634063 97
73 3300035089 Ga0373944_0090244 Ga0373944_0090244_245_538 97
74 3300035111 Ga0373923_0114522 Ga0373923_0114522_344_637 97
75 3300035113 Ga0373936_0006248 Ga0373936_0006248_2727_3020 97
76 3300035117 Ga0373953_0018189 Ga0373953_0018189_720_1013 97
77 3300035118 Ga0373954_0045439 Ga0373954_0045439_1453_1746 97
78 3300035171 Ga0373946_0006187 Ga0373946_0006187_2239_2532 97
79 3300035410 Ga0373924_0066939 Ga0373924_0066939_277_570 97
80 3300035692 Ga0373935_0005287 Ga0373935_0005287_3786_4079 97
81 3300035695 Ga0373927_0000121 Ga0373927_0000121_7730_8023 97
82 3300035725 Ga0373947_0000118 Ga0373947_0000118_11327_11620 97
83 3300036401 Ga0373937_1552861 Ga0373937_1552861_241_534 97
84 3300037068 Ga0373925_0003905 Ga0373925_0003905_7602_7895 97
85 3300046454 Ga0495592_0052893 Ga0495592_0052893_1420_1713 97
86 3300046455 Ga0495603_0000053 Ga0495603_0000053_31927_32220 97
87 3300046459 Ga0495629_0000879 Ga0495629_0000879_16990_17283 97
88 3300046461 Ga0495641_0001147 Ga0495641_0001147_11646_11939 97
89 3300046472 Ga0495580_0001877 Ga0495580_0001877_3333_3626 97
90 3300046473 Ga0495582_0000186 Ga0495582_0000186_15429_15722 97
91 3300046475 Ga0495639_0000078 Ga0495639_0000078_35619_35912 97
92 3300046476 Ga0495662_0001412 Ga0495662_0001412_8931_9224 97
93 3300046477 Ga0495664_0048155 Ga0495664_0048155_72_365 97
94 3300046499 Ga0495594_0000103 Ga0495594_0000103_13637_13930 97
95 3300046516 Ga0495628_0054033 Ga0495628_0054033_1114_1407 97
96 3300046517 Ga0495630_0003914 Ga0495630_0003914_3711_4004 97
97 3300046526 Ga0495666_0001779 Ga0495666_0001779_8209_8502 97
98 3300046531 Ga0495665_0000190 Ga0495665_0000190_19414_19707 97
99 3300046533 Ga0495640_0001297 Ga0495640_0001297_15637_15930 97
100 3300046557 Ga0495622_0001547 Ga0495622_0001547_4578_4871 97
101 3300046642 Ga0495634_0001169 Ga0495634_0001169_22594_22887 97
102 3300046663 Ga0495635_0000985 Ga0495635_0000985_14625_14918 97
103 3300046680 Ga0495646_0020279 Ga0495646_0020279_1569_1862 97
104 3300046681 Ga0495647_0000720 Ga0495647_0000720_5853_6146 97
105 3300046683 Ga0495658_0005321 Ga0495658_0005321_3109_3402 97
106 3300046689 Ga0495613_0004274 Ga0495613_0004274_6877_7170 97
107 3300046690 Ga0495624_0000504 Ga0495624_0000504_9359_9652 97
108 3300047315 Ga0495581_0000501 Ga0495581_0000501_17155_17448 97
109 3300047317 Ga0495604_0874787 Ga0495604_0874787_62_355 97
110 3300047319 Ga0495674_0000228 Ga0495674_0000228_29587_29880 97
111 3300047320 Ga0495672_0199732 Ga0495672_0199732_558_851 97
112 3300047321 Ga0495676_0015031 Ga0495676_0015031_6085_6378 97
113 3300047673 Ga0495593_0000033 Ga0495593_0000033_52101_52394 97
114 3300048089 Ga0495614_0011420 Ga0495614_0011420_104_397 97
115 3300049575 Ga0501039_0655183 Ga0501039_0655183_135_428 97
116 3300049744 Ga0501083_0081561 Ga0501083_0081561_516_809 97
117 3300053077 Ga0495601_0036600 Ga0495601_0036600_1918_2211 97
118 3300053085 Ga0495619_0004738 Ga0495619_0004738_4335_4628 97
119 iso_pu_bacteria 2513237104 2513720358 97
120 iso_pu_bacteria 2881364244 2881365373 97
121 iso_pu_bacteria 2885409591 2885413922 97
122 iso_pu_bacteria 2906626472 2906627792 97
123 iso_pu_bacteria 8006926726 8006930145 97
124 3300003659 JGI25404J52841_10018798 JGI25404J52841_100187982 98
125 3300005327 Ga0070658_10071251 Ga0070658_100712514 98
126 3300005937 Ga0081455_10380821 Ga0081455_103808211 98
127 3300005983 Ga0081540_1008907 Ga0081540_10089076 98
128 3300006844 Ga0075428_100810322 Ga0075428_1008103222 98
129 3300006941 Ga0099825_1027887 Ga0099825_10278874 98
130 3300006942 Ga0099824_1009581 Ga0099824_10095813 98
131 3300006943 Ga0099822_1000911 Ga0099822_100091116 98
132 3300009545 Ga0105237_11326812 Ga0105237_113268122 98
133 3300010375 Ga0105239_10502229 Ga0105239_105022292 98
134 3300025909 Ga0207705_10704587 Ga0207705_107045872 98
135 3300027357 Ga0209589_1000021 Ga0209589_1000021171 98
136 3300027361 Ga0209489_100028 Ga0209489_100028171 98
137 3300027363 Ga0209700_100037 Ga0209700_100037171 98
138 3300033180 Ga0307510_10468699 Ga0307510_104686992 98
139 3300041460 Ga0451802_1363334 Ga0451802_1363334_30_326 98
140 3300046455 Ga0495603_0052299 Ga0495603_0052299_597_893 98
141 3300046474 Ga0495605_0214392 Ga0495605_0214392_225_521 98
142 3300046519 Ga0495632_0362937 Ga0495632_0362937_258_554 98
143 3300046557 Ga0495622_0333714 Ga0495622_0333714_78_374 98
144 3300046674 Ga0495588_0003732 Ga0495588_0003732_5946_6242 98
145 3300046684 Ga0495669_0280639 Ga0495669_0280639_221_517 98
146 3300048909 Ga0496106_0115424 Ga0496106_0115424_433_729 98
147 3300048910 Ga0496107_0148058 Ga0496107_0148058_240_536 98
148 3300048924 Ga0496121_0116972 Ga0496121_0116972_566_862 98
149 iso_pu_bacteria 2508501009 2508539111 99
150 iso_pu_bacteria 2508501042 2508695421 99
151 iso_pu_bacteria 2511231028 2511400021 99
152 iso_pu_bacteria 2513237092 2513626247 99
153 iso_pu_bacteria 2513237095 2513647650 99
154 iso_pu_bacteria 2513237102 2513702186 99
155 iso_pu_bacteria 2513237139 2513873584 99
156 iso_pu_bacteria 2513237161 2514012429 99
157 iso_pu_bacteria 2515154112 2515627386 99
158 iso_pu_bacteria 2517093001 2517107079 99
159 iso_pu_bacteria 2617270735 2617351045 99
160 iso_pu_bacteria 2617270741 2617373704 99
161 iso_pu_bacteria 2791355196 2793061987 99
162 iso_pu_bacteria 2802429603 2805915668 99
163 iso_pu_bacteria 2816332527 2818237594 99
164 iso_pu_bacteria 2824600985 2824606959 99
165 iso_pu_bacteria 2824609381 2824612268 99
166 iso_pu_bacteria 2824617872 2824620757 99
167 iso_pu_bacteria 2824626560 2824629815 99
168 iso_pu_bacteria 2824635225 2824641769 99
169 iso_pu_bacteria 2824644064 2824648362 99
170 iso_pu_bacteria 2824653114 2824655125 99
171 iso_pu_bacteria 2824671348 2824677187 99
172 iso_pu_bacteria 2824679649 2824685135 99
173 iso_pu_bacteria 2824687955 2824693656 99
174 iso_pu_bacteria 2824696289 2824699040 99
175 iso_pu_bacteria 2824704595 2824712314 99
176 iso_pu_bacteria 2824714736 2824722118 99
177 iso_pu_bacteria 2824723954 2824731046 99
178 iso_pu_bacteria 2824732956 2824738073 99
179 iso_pu_bacteria 2824746037 2824751506 99
180 iso_pu_bacteria 2824753945 2824757683 99
181 iso_pu_bacteria 2824763712 2824768805 99
182 iso_pu_bacteria 2824773399 2824775578 99
183 iso_pu_bacteria 2838122688 2838124457 99
184 iso_pu_bacteria 2841941048 2841945143 99
185 iso_pu_bacteria 2841949485 2841951925 99
186 iso_pu_bacteria 2841957949 2841965378 99
187 iso_pu_bacteria 2841966195 2841970680 99
188 iso_pu_bacteria 2841974524 2841980029 99
189 iso_pu_bacteria 2841983080 2841985208 99
190 iso_pu_bacteria 2842038055 2842043566 99
191 iso_pu_bacteria 2842045827 2842052444 99
192 iso_pu_bacteria 2844315083 2844315245 99
193 iso_pu_bacteria 2847930680 2847931018 99
194 iso_pu_bacteria 2847939898 2847942097 99
195 iso_pu_bacteria 2849076700 2849082981 99
196 iso_pu_bacteria 2857509624 2857511868 99
197 iso_pu_bacteria 2874590934 2874594389 99
198 iso_pu_bacteria 2874612657 2874613494 99
199 iso_pu_bacteria 2874628541 2874628858 99
200 iso_pu_bacteria 2874645413 2874649720 99
201 iso_pu_bacteria 2876771140 2876773881 99
202 iso_pu_bacteria 2876818435 2876818783 99
203 iso_pu_bacteria 2879074833 2879078395 99
204 iso_pu_bacteria 2879083081 2879085852 99
205 iso_pu_bacteria 2879127579 2879131009 99
206 iso_pu_bacteria 2879142872 2879148756 99
207 iso_pu_bacteria 2881665667 2881671684 99
208 iso_pu_bacteria 2885366525 2885371083 99
209 iso_pu_bacteria 2888378607 2888379649 99
210 iso_pu_bacteria 2888388044 2888390733 99
211 iso_pu_bacteria 2888419890 2888420363 99
212 iso_pu_bacteria 2889033259 2889035562 99
213 iso_pu_bacteria 2903727486 2903732144 99
214 iso_pu_bacteria 2904711408 2904713115 99
215 iso_pu_bacteria 2906602504 2906604222 99
216 iso_pu_bacteria 2906643746 2906647404 99
217 iso_pu_bacteria 2908775508 2908776194 99
218 iso_pu_bacteria 2922393267 2922394183 99
219 iso_pu_bacteria 2932794094 2932794371 99
220 iso_pu_bacteria 2932801729 2932807992 99
221 iso_pu_bacteria 2935608549 2935615246 99
222 iso_pu_bacteria 2935648319 2935656088 99
223 iso_pu_bacteria 2935656913 2935664923 99
224 iso_pu_bacteria 2935777560 2935783069 99
225 iso_pu_bacteria 2935785616 2935787915 99
226 iso_pu_bacteria 2935793552 2935796509 99
227 iso_pu_bacteria 2935819856 2935825376 99
228 iso_pu_bacteria 2935847175 2935853210 99
229 iso_pu_bacteria 2935883170 2935890096 99
230 iso_pu_bacteria 2935908558 2935910033 99
231 iso_pu_bacteria 2935916978 2935918658 99
232 iso_pu_bacteria 2935926038 2935928056 99
233 iso_pu_bacteria 2935934488 2935936072 99
234 iso_pu_bacteria 2935942939 2935944375 99
235 iso_pu_bacteria 2935951376 2935952812 99
236 iso_pu_bacteria 2935959822 2935962585 99
237 iso_pu_bacteria 2935967501 2935969652 99
238 iso_pu_bacteria 2935975950 2935980760 99
239 iso_pu_bacteria 2935984226 2935985079 99
240 iso_pu_bacteria 2936011229 2936018981 99
241 iso_pu_bacteria 2936019824 2936027627 99
242 iso_pu_bacteria 2936028420 2936036450 99
243 iso_pu_bacteria 2936046547 2936054512 99
244 iso_pu_bacteria 2936055302 2936056248 99
245 iso_pu_bacteria 2941531003 2941535567 99
246 iso_pu_bacteria 3005483717 3005486841 99
247 iso_pu_bacteria 3005506211 3005509218 99
248 iso_pu_bacteria 3005587118 3005592266 99
249 iso_pu_bacteria 3005594810 3005594970 99
250 iso_pu_bacteria 3005710791 3005710947 99
251 iso_pu_bacteria 3005718088 3005718251 99
252 iso_pu_bacteria 8016522445 8016526082 99
253 iso_pu_bacteria 8016530956 8016539690 99
254 iso_pu_bacteria 8016539877 8016543994 99
255 iso_pu_bacteria 8016548790 8016549312 99
256 iso_pu_bacteria 8016557553 8016557738 99
257 iso_pu_bacteria 8016566248 8016569393 99
258 iso_pu_bacteria 8016575299 8016582013 99
259 iso_pu_bacteria 8016583857 8016586443 99
260 iso_pu_bacteria 8016595262 8016595766 99
261 iso_pu_bacteria 8016603502 8016606627 99
262 iso_pu_bacteria 8016622563 8016623259 99
263 iso_pu_bacteria 8016630954 8016635743 99
264 iso_pu_bacteria 8019530166 8019530970 99
265 iso_pu_bacteria 8019538911 8019540614 99
266 iso_pu_bacteria 8019547302 8019550278 99
267 iso_pu_bacteria 8019619141 8019622913 99
268 iso_pu_bacteria 8019629233 8019630196 99
269 iso_pu_bacteria 8019648815 8019652537 99
270 iso_pu_bacteria 8019668869 8019676821 99
271 iso_pu_bacteria 8019687851 8019696349 99
272 iso_pu_bacteria 8056967851 8056971235 99
273 2010549000 RicEn_FSXC2379_b1 RicEn_191080 100
274 3300001430 JGI24032J14994_100498 JGI24032J14994_1004982 100
275 3300001904 JGI24736J21556_1030537 JGI24736J21556_10305372 100
276 3300001915 JGI24741J21665_1022626 JGI24741J21665_10226261 100
277 3300001976 JGI24752J21851_1058508 JGI24752J21851_10585082 100
278 3300001977 JGI24746J21847_1000164 JGI24746J21847_10001648 100
279 3300001978 JGI24747J21853_1000867 JGI24747J21853_10008673 100
280 3300001979 JGI24740J21852_10021616 JGI24740J21852_100216162 100
281 3300001989 JGI24739J22299_10000152 JGI24739J22299_1000015210 100
282 3300001990 JGI24737J22298_10002832 JGI24737J22298_100028322 100
283 3300001990 JGI24737J22298_10003593 JGI24737J22298_100035934 100
284 3300001990 JGI24737J22298_10004593 JGI24737J22298_100045932 100
285 3300001991 JGI24743J22301_10036218 JGI24743J22301_100362182 100
286 3300002070 JGI24750J21931_1000497 JGI24750J21931_10004976 100
287 3300002070 JGI24750J21931_1000592 JGI24750J21931_10005924 100
288 3300002070 JGI24750J21931_1007504 JGI24750J21931_10075041 100
289 3300002073 JGI24745J21846_1000135 JGI24745J21846_10001355 100
290 3300002074 JGI24748J21848_1000406 JGI24748J21848_10004065 100
291 3300002075 JGI24738J21930_10000005 JGI24738J21930_100000057 100
292 3300002076 JGI24749J21850_1000199 JGI24749J21850_100019910 100
293 3300002077 JGI24744J21845_10000538 JGI24744J21845_100005384 100
294 3300002126 JGI24035J26624_1000104 JGI24035J26624_10001045 100
295 3300002155 JGI24033J26618_1002293 JGI24033J26618_10022933 100
296 3300002239 JGI24034J26672_10016367 JGI24034J26672_100163672 100
297 3300002244 JGI24742J22300_10000102 JGI24742J22300_1000010212 100
298 3300002244 JGI24742J22300_10000282 JGI24742J22300_100002824 100
299 3300002459 JGI24751J29686_10007280 JGI24751J29686_100072804 100
300 3300003354 JGI25160J50197_1020925 JGI25160J50197_10209253 100
301 3300003371 JGI26145J50221_1006209 JGI26145J50221_10062092 100
302 3300003659 JGI25404J52841_10006995 JGI25404J52841_100069952 100
303 3300003659 JGI25404J52841_10012821 JGI25404J52841_100128213 100
304 3300003659 JGI25404J52841_10094693 JGI25404J52841_100946932 100
305 3300003911 JGI25405J52794_10062438 JGI25405J52794_100624381 100
306 3300003911 JGI25405J52794_10096839 JGI25405J52794_100968392 100
307 3300005262 Ga0065165_1021770 Ga0065165_10217703 100
308 3300005290 Ga0065712_10008945 Ga0065712_100089454 100
309 3300005290 Ga0065712_10070038 Ga0065712_100700383 100
310 3300005290 Ga0065712_10076486 Ga0065712_100764862 100
311 3300005293 Ga0065715_10001162 Ga0065715_100011625 100
312 3300005293 Ga0065715_10935511 Ga0065715_109355112 100
313 3300005328 Ga0070676_10000789 Ga0070676_100007898 100
314 3300005328 Ga0070676_10386244 Ga0070676_103862442 100
315 3300005329 Ga0070683_100000345 Ga0070683_10000034513 100
316 3300005329 Ga0070683_100187827 Ga0070683_1001878273 100
317 3300005330 Ga0070690_100007432 Ga0070690_1000074326 100
318 3300005330 Ga0070690_100204002 Ga0070690_1002040022 100
319 3300005331 Ga0070670_100013204 Ga0070670_1000132044 100
320 3300005331 Ga0070670_100278346 Ga0070670_1002783462 100
321 3300005331 Ga0070670_101129682 Ga0070670_1011296821 100
322 3300005333 Ga0070677_10000389 Ga0070677_1000038912 100
323 3300005334 Ga0068869_100001864 Ga0068869_1000018648 100
324 3300005335 Ga0070666_10111076 Ga0070666_101110763 100
325 3300005336 Ga0070680_100005473 Ga0070680_1000054737 100
326 3300005336 Ga0070680_100041530 Ga0070680_1000415305 100
327 3300005336 Ga0070680_100057667 Ga0070680_1000576675 100
328 3300005336 Ga0070680_101318137 Ga0070680_1013181371 100
329 3300005337 Ga0070682_100000458 Ga0070682_10000045817 100
330 3300005337 Ga0070682_100059840 Ga0070682_1000598403 100
331 3300005337 Ga0070682_100218834 Ga0070682_1002188342 100
332 3300005337 Ga0070682_100324082 Ga0070682_1003240822 100
333 3300005338 Ga0068868_100000376 Ga0068868_1000003766 100
334 3300005338 Ga0068868_100420776 Ga0068868_1004207762 100
335 3300005339 Ga0070660_100001420 Ga0070660_10000142012 100
336 3300005339 Ga0070660_100046112 Ga0070660_1000461121 100
337 3300005339 Ga0070660_100139446 Ga0070660_1001394462 100
338 3300005340 Ga0070689_100001572 Ga0070689_1000015726 100
339 3300005340 Ga0070689_100071627 Ga0070689_1000716271 100
340 3300005340 Ga0070689_100665220 Ga0070689_1006652201 100
341 3300005341 Ga0070691_10000417 Ga0070691_100004176 100
342 3300005341 Ga0070691_10780900 Ga0070691_107809001 100
343 3300005343 Ga0070687_100002155 Ga0070687_1000021554 100
344 3300005343 Ga0070687_100058408 Ga0070687_1000584083 100
345 3300005343 Ga0070687_101158899 Ga0070687_1011588991 100
346 3300005344 Ga0070661_100001708 Ga0070661_1000017085 100
347 3300005344 Ga0070661_100257876 Ga0070661_1002578762 100
348 3300005344 Ga0070661_100339178 Ga0070661_1003391781 100
349 3300005345 Ga0070692_10000078 Ga0070692_1000007816 100
350 3300005345 Ga0070692_10009194 Ga0070692_100091946 100
351 3300005347 Ga0070668_100001228 Ga0070668_1000012286 100
352 3300005347 Ga0070668_100010386 Ga0070668_1000103866 100
353 3300005353 Ga0070669_100000873 Ga0070669_1000008733 100
354 3300005353 Ga0070669_100115177 Ga0070669_1001151773 100
355 3300005354 Ga0070675_100014644 Ga0070675_1000146442 100
356 3300005354 Ga0070675_100033712 Ga0070675_1000337126 100
357 3300005354 Ga0070675_101108095 Ga0070675_1011080952 100
358 3300005354 Ga0070675_101300371 Ga0070675_1013003712 100
359 3300005355 Ga0070671_100000318 Ga0070671_10000031820 100
360 3300005356 Ga0070674_100001672 Ga0070674_1000016724 100
361 3300005364 Ga0070673_100002621 Ga0070673_1000026218 100
362 3300005364 Ga0070673_102187560 Ga0070673_1021875601 100
363 3300005365 Ga0070688_100001932 Ga0070688_1000019323 100
364 3300005365 Ga0070688_100032747 Ga0070688_1000327475 100
365 3300005366 Ga0070659_100001601 Ga0070659_10000160112 100
366 3300005366 Ga0070659_100962930 Ga0070659_1009629301 100
367 3300005367 Ga0070667_100012018 Ga0070667_1000120183 100
368 3300005367 Ga0070667_100094662 Ga0070667_1000946624 100
369 3300005367 Ga0070667_100830490 Ga0070667_1008304902 100
370 3300005406 Ga0070703_10009498 Ga0070703_100094983 100
371 3300005406 Ga0070703_10053704 Ga0070703_100537042 100
372 3300005434 Ga0070709_10216548 Ga0070709_102165482 100
373 3300005434 Ga0070709_11194481 Ga0070709_111944811 100
374 3300005435 Ga0070714_100404021 Ga0070714_1004040212 100
375 3300005435 Ga0070714_100813678 Ga0070714_1008136782 100
376 3300005435 Ga0070714_102105439 Ga0070714_1021054391 100
377 3300005436 Ga0070713_100978402 Ga0070713_1009784022 100
378 3300005436 Ga0070713_101116947 Ga0070713_1011169472 100
379 3300005437 Ga0070710_10014694 Ga0070710_100146945 100
380 3300005438 Ga0070701_10000388 Ga0070701_1000038816 100
381 3300005440 Ga0070705_100050569 Ga0070705_1000505694 100
382 3300005440 Ga0070705_100904128 Ga0070705_1009041282 100
383 3300005441 Ga0070700_100000409 Ga0070700_10000040916 100
384 3300005444 Ga0070694_100000312 Ga0070694_10000031225 100
385 3300005444 Ga0070694_100018197 Ga0070694_1000181976 100
386 3300005445 Ga0070708_100008294 Ga0070708_1000082948 100
387 3300005455 Ga0070663_100003029 Ga0070663_1000030295 100
388 3300005455 Ga0070663_100149893 Ga0070663_1001498933 100
389 3300005455 Ga0070663_102069294 Ga0070663_1020692941 100
390 3300005456 Ga0070678_100000673 Ga0070678_1000006738 100
391 3300005456 Ga0070678_100571669 Ga0070678_1005716692 100
392 3300005457 Ga0070662_100011704 Ga0070662_1000117041 100
393 3300005457 Ga0070662_100019810 Ga0070662_1000198102 100
394 3300005457 Ga0070662_100231254 Ga0070662_1002312542 100
395 3300005458 Ga0070681_10001501 Ga0070681_1000150110 100
396 3300005458 Ga0070681_10075545 Ga0070681_100755452 100
397 3300005458 Ga0070681_10300250 Ga0070681_103002501 100
398 3300005458 Ga0070681_11721812 Ga0070681_117218122 100
399 3300005459 Ga0068867_100002561 Ga0068867_1000025618 100
400 3300005466 Ga0070685_10031691 Ga0070685_100316913 100
401 3300005466 Ga0070685_10109412 Ga0070685_101094122 100
402 3300005466 Ga0070685_10176548 Ga0070685_101765481 100
403 3300005467 Ga0070706_101694545 Ga0070706_1016945452 100
404 3300005468 Ga0070707_100905260 Ga0070707_1009052602 100
405 3300005530 Ga0070679_100013134 Ga0070679_1000131346 100
406 3300005530 Ga0070679_100083369 Ga0070679_1000833695 100
407 3300005530 Ga0070679_100235744 Ga0070679_1002357442 100
408 3300005535 Ga0070684_100004125 Ga0070684_1000041256 100
409 3300005535 Ga0070684_100189935 Ga0070684_1001899352 100
410 3300005535 Ga0070684_100236315 Ga0070684_1002363152 100
411 3300005535 Ga0070684_100314538 Ga0070684_1003145382 100
412 3300005539 Ga0068853_100013239 Ga0068853_1000132396 100
413 3300005539 Ga0068853_100199229 Ga0068853_1001992292 100
414 3300005539 Ga0068853_100328659 Ga0068853_1003286592 100
415 3300005543 Ga0070672_100005118 Ga0070672_1000051185 100
416 3300005543 Ga0070672_100384903 Ga0070672_1003849033 100
417 3300005543 Ga0070672_100419171 Ga0070672_1004191712 100
418 3300005544 Ga0070686_100005340 Ga0070686_1000053403 100
419 3300005544 Ga0070686_100007239 Ga0070686_1000072396 100
420 3300005544 Ga0070686_100736735 Ga0070686_1007367352 100
421 3300005545 Ga0070695_100001168 Ga0070695_10000116814 100
422 3300005545 Ga0070695_100008421 Ga0070695_1000084216 100
423 3300005546 Ga0070696_100028030 Ga0070696_1000280302 100
424 3300005546 Ga0070696_100182007 Ga0070696_1001820072 100
425 3300005546 Ga0070696_101093909 Ga0070696_1010939092 100
426 3300005546 Ga0070696_101548196 Ga0070696_1015481962 100
427 3300005547 Ga0070693_100002738 Ga0070693_1000027387 100
428 3300005547 Ga0070693_100143814 Ga0070693_1001438141 100
429 3300005548 Ga0070665_100024095 Ga0070665_1000240956 100
430 3300005548 Ga0070665_100258812 Ga0070665_1002588123 100
431 3300005548 Ga0070665_100990875 Ga0070665_1009908752 100
432 3300005548 Ga0070665_102600922 Ga0070665_1026009222 100
433 3300005549 Ga0070704_100002142 Ga0070704_1000021426 100
434 3300005549 Ga0070704_100012760 Ga0070704_1000127607 100
435 3300005563 Ga0068855_100032409 Ga0068855_1000324096 100
436 3300005563 Ga0068855_100795644 Ga0068855_1007956441 100
437 3300005564 Ga0070664_100002197 Ga0070664_1000021973 100
438 3300005564 Ga0070664_100090718 Ga0070664_1000907182 100
439 3300005564 Ga0070664_100297517 Ga0070664_1002975172 100
440 3300005564 Ga0070664_100474545 Ga0070664_1004745452 100
441 3300005577 Ga0068857_100000914 Ga0068857_1000009143 100
442 3300005578 Ga0068854_100002267 Ga0068854_1000022676 100
443 3300005578 Ga0068854_100224413 Ga0068854_1002244132 100
444 3300005614 Ga0068856_100007024 Ga0068856_1000070248 100
445 3300005614 Ga0068856_100129914 Ga0068856_1001299143 100
446 3300005614 Ga0068856_100216043 Ga0068856_1002160433 100
447 3300005615 Ga0070702_100000793 Ga0070702_1000007936 100
448 3300005616 Ga0068852_100001040 Ga0068852_1000010408 100
449 3300005616 Ga0068852_100560263 Ga0068852_1005602632 100
450 3300005616 Ga0068852_100596253 Ga0068852_1005962532 100
451 3300005616 Ga0068852_101590085 Ga0068852_1015900852 100
452 3300005617 Ga0068859_100023516 Ga0068859_1000235166 100
453 3300005617 Ga0068859_100030436 Ga0068859_1000304366 100
454 3300005618 Ga0068864_100001093 Ga0068864_10000109325 100
455 3300005618 Ga0068864_102529688 Ga0068864_1025296881 100
456 3300005718 Ga0068866_10000678 Ga0068866_100006787 100
457 3300005719 Ga0068861_100008814 Ga0068861_1000088146 100
458 3300005719 Ga0068861_100154224 Ga0068861_1001542242 100
459 3300005719 Ga0068861_100964657 Ga0068861_1009646571 100
460 3300005840 Ga0068870_10000128 Ga0068870_1000012825 100
461 3300005841 Ga0068863_100006135 Ga0068863_1000061358 100
462 3300005842 Ga0068858_100007003 Ga0068858_10000700312 100
463 3300005842 Ga0068858_100245972 Ga0068858_1002459723 100
464 3300005842 Ga0068858_100581234 Ga0068858_1005812342 100
465 3300005843 Ga0068860_100009283 Ga0068860_1000092836 100
466 3300005843 Ga0068860_100068439 Ga0068860_1000684392 100
467 3300005844 Ga0068862_100016288 Ga0068862_1000162882 100
468 3300005844 Ga0068862_100017378 Ga0068862_1000173786 100
469 3300005937 Ga0081455_10000002 Ga0081455_10000002239 100
470 3300005937 Ga0081455_10010596 Ga0081455_100105964 100
471 3300005937 Ga0081455_10018872 Ga0081455_100188727 100
472 3300005937 Ga0081455_10030798 Ga0081455_100307982 100
473 3300005937 Ga0081455_10065070 Ga0081455_100650705 100
474 3300005937 Ga0081455_10081865 Ga0081455_100818653 100
475 3300005981 Ga0081538_10011886 Ga0081538_100118868 100
476 3300005983 Ga0081540_1002951 Ga0081540_100295113 100
477 3300005983 Ga0081540_1003344 Ga0081540_10033446 100
478 3300005983 Ga0081540_1009850 Ga0081540_10098504 100
479 3300005983 Ga0081540_1012850 Ga0081540_10128505 100
480 3300005983 Ga0081540_1216532 Ga0081540_12165322 100
481 3300005985 Ga0081539_10002161 Ga0081539_100021616 100
482 3300005985 Ga0081539_10052381 Ga0081539_100523812 100
483 3300005985 Ga0081539_10305745 Ga0081539_103057451 100
484 3300006028 Ga0070717_10050719 Ga0070717_100507192 100
485 3300006028 Ga0070717_10052545 Ga0070717_100525455 100
486 3300006038 Ga0075365_10088472 Ga0075365_100884722 100
487 3300006038 Ga0075365_10938966 Ga0075365_109389661 100
488 3300006042 Ga0075368_10336959 Ga0075368_103369592 100
489 3300006042 Ga0075368_10437985 Ga0075368_104379851 100
490 3300006048 Ga0075363_100188948 Ga0075363_1001889483 100
491 3300006048 Ga0075363_100504016 Ga0075363_1005040162 100
492 3300006051 Ga0075364_10484450 Ga0075364_104844501 100
493 3300006173 Ga0070716_101640461 Ga0070716_1016404612 100
494 3300006175 Ga0070712_100263900 Ga0070712_1002639001 100
495 3300006178 Ga0075367_10096618 Ga0075367_100966183 100
496 3300006178 Ga0075367_10578463 Ga0075367_105784632 100
497 3300006178 Ga0075367_10601054 Ga0075367_106010541 100
498 3300006178 Ga0075367_10607986 Ga0075367_106079862 100
499 3300006195 Ga0075366_10356187 Ga0075366_103561871 100
500 3300006237 Ga0097621_100000012 Ga0097621_10000001253 100
501 3300006237 Ga0097621_100500282 Ga0097621_1005002822 100
502 3300006237 Ga0097621_100551898 Ga0097621_1005518982 100
503 3300006353 Ga0075370_10057807 Ga0075370_100578072 100
504 3300006358 Ga0068871_100000414 Ga0068871_10000041420 100
505 3300006358 Ga0068871_101755095 Ga0068871_1017550952 100
506 3300006846 Ga0075430_101614740 Ga0075430_1016147402 100
507 3300006852 Ga0075433_10018274 Ga0075433_100182746 100
508 3300006871 Ga0075434_100001246 Ga0075434_1000012468 100
509 3300006871 Ga0075434_100545932 Ga0075434_1005459322 100
510 3300006881 Ga0068865_100000908 Ga0068865_1000009088 100
511 3300006881 Ga0068865_100108699 Ga0068865_1001086992 100
512 3300006914 Ga0075436_100693543 Ga0075436_1006935431 100
513 3300006931 Ga0097620_100023517 Ga0097620_1000235176 100
514 3300006931 Ga0097620_100030437 Ga0097620_1000304376 100
515 3300007076 Ga0075435_100099129 Ga0075435_1000991292 100
516 3300007076 Ga0075435_100300148 Ga0075435_1003001482 100
517 3300007265 Ga0099794_10313305 Ga0099794_103133052 100
518 3300009011 Ga0105251_10153201 Ga0105251_101532012 100
519 3300009092 Ga0105250_10017271 Ga0105250_100172714 100
520 3300009092 Ga0105250_10122121 Ga0105250_101221211 100
521 3300009093 Ga0105240_10021715 Ga0105240_100217156 100
522 3300009093 Ga0105240_10105946 Ga0105240_101059463 100
523 3300009093 Ga0105240_10830924 Ga0105240_108309242 100
524 3300009094 Ga0111539_10007702 Ga0111539_100077026 100
525 3300009094 Ga0111539_10069230 Ga0111539_100692302 100
526 3300009094 Ga0111539_12038065 Ga0111539_120380652 100
527 3300009098 Ga0105245_10000090 Ga0105245_1000009086 100
528 3300009098 Ga0105245_10338097 Ga0105245_103380971 100
529 3300009098 Ga0105245_11543743 Ga0105245_115437431 100
530 3300009101 Ga0105247_10003459 Ga0105247_1000345911 100
531 3300009101 Ga0105247_10019467 Ga0105247_100194676 100
532 3300009101 Ga0105247_10690922 Ga0105247_106909222 100
533 3300009147 Ga0114129_11073010 Ga0114129_110730102 100
534 3300009148 Ga0105243_10002504 Ga0105243_1000250417 100
535 3300009148 Ga0105243_10129090 Ga0105243_101290902 100
536 3300009174 Ga0105241_10000475 Ga0105241_1000047521 100
537 3300009176 Ga0105242_10001283 Ga0105242_100012836 100
538 3300009177 Ga0105248_10003064 Ga0105248_100030646 100
539 3300009177 Ga0105248_10004418 Ga0105248_100044188 100
540 3300009545 Ga0105237_10002267 Ga0105237_1000226725 100
541 3300009545 Ga0105237_10066313 Ga0105237_100663133 100
542 3300009545 Ga0105237_10303800 Ga0105237_103038002 100
543 3300009545 Ga0105237_10610498 Ga0105237_106104981 100
544 3300009551 Ga0105238_10041820 Ga0105238_100418202 100
545 3300009551 Ga0105238_10384723 Ga0105238_103847232 100
546 3300009551 Ga0105238_10437279 Ga0105238_104372792 100
547 3300009551 Ga0105238_11268903 Ga0105238_112689032 100
548 3300009553 Ga0105249_10001598 Ga0105249_1000159817 100
549 3300009553 Ga0105249_10006092 Ga0105249_100060926 100
550 3300009553 Ga0105249_11533539 Ga0105249_115335392 100
551 3300010375 Ga0105239_10018565 Ga0105239_100185653 100
552 3300010375 Ga0105239_10036649 Ga0105239_100366494 100
553 3300010375 Ga0105239_10040255 Ga0105239_100402555 100
554 3300011119 Ga0105246_10000263 Ga0105246_1000026314 100
555 3300012473 Ga0157340_1009937 Ga0157340_10099372 100
556 3300012476 Ga0157344_1025724 Ga0157344_10257241 100
557 3300012500 Ga0157314_1001161 Ga0157314_10011613 100
558 3300013100 Ga0157373_10161320 Ga0157373_101613202 100
559 3300013102 Ga0157371_10051992 Ga0157371_100519922 100
560 3300013104 Ga0157370_10248202 Ga0157370_102482022 100
561 3300013105 Ga0157369_10093465 Ga0157369_100934655 100
562 3300013105 Ga0157369_10809520 Ga0157369_108095202 100
563 3300013105 Ga0157369_11526521 Ga0157369_115265212 100
564 3300013105 Ga0157369_11679706 Ga0157369_116797061 100
565 3300013296 Ga0157374_10001375 Ga0157374_1000137514 100
566 3300013296 Ga0157374_11180448 Ga0157374_111804482 100
567 3300013297 Ga0157378_10002550 Ga0157378_100025507 100
568 3300013297 Ga0157378_10014596 Ga0157378_100145966 100
569 3300013306 Ga0163162_10003792 Ga0163162_100037926 100
570 3300013307 Ga0157372_10002994 Ga0157372_1000299416 100
571 3300013307 Ga0157372_10308235 Ga0157372_103082352 100
572 3300013307 Ga0157372_12753305 Ga0157372_127533051 100
573 3300013308 Ga0157375_10002382 Ga0157375_1000238216 100
574 3300013308 Ga0157375_10276078 Ga0157375_102760782 100
575 3300014325 Ga0163163_10005972 Ga0163163_100059725 100
576 3300014325 Ga0163163_10012135 Ga0163163_100121357 100
577 3300014325 Ga0163163_11171980 Ga0163163_111719801 100
578 3300014326 Ga0157380_10000334 Ga0157380_1000033417 100
579 3300014326 Ga0157380_10493558 Ga0157380_104935582 100
580 3300014745 Ga0157377_10000249 Ga0157377_1000024918 100
581 3300014968 Ga0157379_10002491 Ga0157379_1000249113 100
582 3300014968 Ga0157379_10053828 Ga0157379_100538283 100
583 3300014968 Ga0157379_10058339 Ga0157379_100583394 100
584 3300014968 Ga0157379_10421914 Ga0157379_104219142 100
585 3300014969 Ga0157376_10000709 Ga0157376_100007098 100
586 3300014969 Ga0157376_11240021 Ga0157376_112400212 100
587 3300014969 Ga0157376_11457758 Ga0157376_114577582 100
588 3300014969 Ga0157376_12344763 Ga0157376_123447631 100
589 3300017792 Ga0163161_10001471 Ga0163161_1000147114 100
590 3300020082 Ga0206353_10185621 Ga0206353_101856213 100
591 3300021358 Ga0213873_10039639 Ga0213873_100396392 100
592 3300021358 Ga0213873_10078927 Ga0213873_100789272 100
593 3300021377 Ga0213874_10324072 Ga0213874_103240721 100
594 3300021384 Ga0213876_10076495 Ga0213876_100764953 100
595 3300021384 Ga0213876_10229172 Ga0213876_102291722 100
596 3300021388 Ga0213875_10248293 Ga0213875_102482931 100
597 3300024225 Ga0224572_1005889 Ga0224572_10058893 100
598 3300024227 Ga0228598_1046037 Ga0228598_10460372 100
599 3300025271 Ga0207666_1000082 Ga0207666_100008216 100
600 3300025290 Ga0207673_1000240 Ga0207673_10002406 100
601 3300025302 Ga0207426_1001527 Ga0207426_100152715 100
602 3300025302 Ga0207426_1027412 Ga0207426_10274121 100
603 3300025315 Ga0207697_10000161 Ga0207697_1000016118 100
604 3300025321 Ga0207656_10631489 Ga0207656_106314892 100
605 3300025711 Ga0207696_1027904 Ga0207696_10279042 100
606 3300025735 Ga0207713_1057849 Ga0207713_10578493 100
607 3300025885 Ga0207653_10001232 Ga0207653_100012326 100
608 3300025893 Ga0207682_10000164 Ga0207682_1000016420 100
609 3300025899 Ga0207642_10155480 Ga0207642_101554802 100
610 3300025900 Ga0207710_10001285 Ga0207710_1000128515 100
611 3300025901 Ga0207688_10000426 Ga0207688_100004266 100
612 3300025903 Ga0207680_10092349 Ga0207680_100923493 100
613 3300025904 Ga0207647_10011699 Ga0207647_100116996 100
614 3300025906 Ga0207699_10403469 Ga0207699_104034692 100
615 3300025906 Ga0207699_11212291 Ga0207699_112122911 100
616 3300025907 Ga0207645_10000040 Ga0207645_100000406 100
617 3300025908 Ga0207643_10000082 Ga0207643_1000008263 100
618 3300025909 Ga0207705_10026866 Ga0207705_100268664 100
619 3300025910 Ga0207684_10463597 Ga0207684_104635972 100
620 3300025911 Ga0207654_10000364 Ga0207654_1000036418 100
621 3300025912 Ga0207707_10002424 Ga0207707_1000242416 100
622 3300025912 Ga0207707_10054633 Ga0207707_100546332 100
623 3300025912 Ga0207707_10062173 Ga0207707_100621731 100
624 3300025912 Ga0207707_10517454 Ga0207707_105174542 100
625 3300025913 Ga0207695_10098338 Ga0207695_100983384 100
626 3300025913 Ga0207695_10233891 Ga0207695_102338912 100
627 3300025913 Ga0207695_10612112 Ga0207695_106121122 100
628 3300025914 Ga0207671_10056653 Ga0207671_100566533 100
629 3300025914 Ga0207671_11180659 Ga0207671_111806591 100
630 3300025915 Ga0207693_10015206 Ga0207693_100152063 100
631 3300025915 Ga0207693_10169696 Ga0207693_101696962 100
632 3300025917 Ga0207660_10000501 Ga0207660_1000050125 100
633 3300025917 Ga0207660_10127218 Ga0207660_101272182 100
634 3300025917 Ga0207660_10129945 Ga0207660_101299452 100
635 3300025917 Ga0207660_11695780 Ga0207660_116957801 100
636 3300025918 Ga0207662_10066962 Ga0207662_100669623 100
637 3300025918 Ga0207662_10069506 Ga0207662_100695063 100
638 3300025918 Ga0207662_10122337 Ga0207662_101223373 100
639 3300025919 Ga0207657_10002764 Ga0207657_1000276416 100
640 3300025919 Ga0207657_10048811 Ga0207657_100488113 100
641 3300025919 Ga0207657_10294043 Ga0207657_102940432 100
642 3300025920 Ga0207649_10000788 Ga0207649_1000078817 100
643 3300025920 Ga0207649_10285849 Ga0207649_102858492 100
644 3300025920 Ga0207649_10545726 Ga0207649_105457261 100
645 3300025921 Ga0207652_10001134 Ga0207652_1000113422 100
646 3300025921 Ga0207652_10067223 Ga0207652_100672235 100
647 3300025921 Ga0207652_10171401 Ga0207652_101714013 100
648 3300025921 Ga0207652_10327388 Ga0207652_103273882 100
649 3300025922 Ga0207646_10266598 Ga0207646_102665982 100
650 3300025923 Ga0207681_10000539 Ga0207681_1000053924 100
651 3300025923 Ga0207681_10375559 Ga0207681_103755592 100
652 3300025924 Ga0207694_10045291 Ga0207694_100452914 100
653 3300025924 Ga0207694_10050997 Ga0207694_100509972 100
654 3300025924 Ga0207694_11591151 Ga0207694_115911511 100
655 3300025925 Ga0207650_10001604 Ga0207650_1000160417 100
656 3300025925 Ga0207650_10104673 Ga0207650_101046733 100
657 3300025925 Ga0207650_10562197 Ga0207650_105621971 100
658 3300025926 Ga0207659_10004978 Ga0207659_100049784 100
659 3300025926 Ga0207659_10153697 Ga0207659_101536972 100
660 3300025926 Ga0207659_10558044 Ga0207659_105580442 100
661 3300025927 Ga0207687_10000063 Ga0207687_1000006378 100
662 3300025928 Ga0207700_10019315 Ga0207700_100193151 100
663 3300025928 Ga0207700_10647816 Ga0207700_106478162 100
664 3300025929 Ga0207664_10336651 Ga0207664_103366512 100
665 3300025929 Ga0207664_10745355 Ga0207664_107453552 100
666 3300025929 Ga0207664_11337393 Ga0207664_113373932 100
667 3300025931 Ga0207644_10000661 Ga0207644_1000066120 100
668 3300025931 Ga0207644_10256665 Ga0207644_102566653 100
669 3300025932 Ga0207690_10000086 Ga0207690_1000008619 100
670 3300025933 Ga0207706_10019107 Ga0207706_100191076 100
671 3300025933 Ga0207706_10340223 Ga0207706_103402232 100
672 3300025934 Ga0207686_10001237 Ga0207686_100012378 100
673 3300025935 Ga0207709_10001095 Ga0207709_1000109517 100
674 3300025936 Ga0207670_10000264 Ga0207670_1000026416 100
675 3300025936 Ga0207670_10028387 Ga0207670_100283872 100
676 3300025937 Ga0207669_10000228 Ga0207669_100002285 100
677 3300025938 Ga0207704_10000107 Ga0207704_1000010730 100
678 3300025938 Ga0207704_10855321 Ga0207704_108553212 100
679 3300025938 Ga0207704_10999319 Ga0207704_109993191 100
680 3300025939 Ga0207665_10000694 Ga0207665_100006947 100
681 3300025940 Ga0207691_10001173 Ga0207691_1000117325 100
682 3300025941 Ga0207711_10004273 Ga0207711_100042737 100
683 3300025941 Ga0207711_10012191 Ga0207711_100121914 100
684 3300025942 Ga0207689_10001082 Ga0207689_1000108217 100
685 3300025944 Ga0207661_10000427 Ga0207661_100004275 100
686 3300025944 Ga0207661_10476198 Ga0207661_104761981 100
687 3300025945 Ga0207679_10000025 Ga0207679_1000002520 100
688 3300025945 Ga0207679_10448343 Ga0207679_104483432 100
689 3300025945 Ga0207679_10532162 Ga0207679_105321622 100
690 3300025945 Ga0207679_10701099 Ga0207679_107010992 100
691 3300025945 Ga0207679_11238659 Ga0207679_112386591 100
692 3300025949 Ga0207667_10006928 Ga0207667_1000692812 100
693 3300025949 Ga0207667_10375633 Ga0207667_103756332 100
694 3300025949 Ga0207667_10676039 Ga0207667_106760391 100
695 3300025960 Ga0207651_10000081 Ga0207651_100000817 100
696 3300025960 Ga0207651_10839172 Ga0207651_108391722 100
697 3300025960 Ga0207651_11536689 Ga0207651_115366892 100
698 3300025961 Ga0207712_10000587 Ga0207712_1000058711 100
699 3300025961 Ga0207712_10016688 Ga0207712_100166883 100
700 3300025972 Ga0207668_10000171 Ga0207668_1000017121 100
701 3300025981 Ga0207640_10001295 Ga0207640_100012956 100
702 3300025981 Ga0207640_10390485 Ga0207640_103904851 100
703 3300025986 Ga0207658_10000940 Ga0207658_1000094012 100
704 3300025986 Ga0207658_10535107 Ga0207658_105351072 100
705 3300026023 Ga0207677_10000447 Ga0207677_1000044728 100
706 3300026023 Ga0207677_10383178 Ga0207677_103831782 100
707 3300026035 Ga0207703_10006213 Ga0207703_100062137 100
708 3300026035 Ga0207703_10085667 Ga0207703_100856673 100
709 3300026041 Ga0207639_10196744 Ga0207639_101967442 100
710 3300026041 Ga0207639_10221467 Ga0207639_102214671 100
711 3300026041 Ga0207639_10602681 Ga0207639_106026812 100
712 3300026067 Ga0207678_10001776 Ga0207678_100017766 100
713 3300026067 Ga0207678_10113758 Ga0207678_101137582 100
714 3300026067 Ga0207678_11253062 Ga0207678_112530622 100
715 3300026078 Ga0207702_10006918 Ga0207702_100069185 100
716 3300026078 Ga0207702_11291274 Ga0207702_112912741 100
717 3300026088 Ga0207641_10001385 Ga0207641_100013855 100
718 3300026089 Ga0207648_10009579 Ga0207648_100095796 100
719 3300026095 Ga0207676_10001643 Ga0207676_1000164317 100
720 3300026116 Ga0207674_10001963 Ga0207674_100019636 100
721 3300026116 Ga0207674_10399009 Ga0207674_103990092 100
722 3300026116 Ga0207674_10966893 Ga0207674_109668932 100
723 3300026118 Ga0207675_100002289 Ga0207675_1000022896 100
724 3300026118 Ga0207675_100172842 Ga0207675_1001728422 100
725 3300026118 Ga0207675_100715948 Ga0207675_1007159482 100
726 3300026121 Ga0207683_10000001 Ga0207683_1000000120 100
727 3300026121 Ga0207683_10336690 Ga0207683_103366902 100
728 3300026142 Ga0207698_10002904 Ga0207698_1000290410 100
729 3300026142 Ga0207698_11269177 Ga0207698_112691772 100
730 3300027252 Ga0209973_1024639 Ga0209973_10246392 100
731 3300027364 Ga0209967_1024526 Ga0209967_10245262 100
732 3300027378 Ga0209981_1051746 Ga0209981_10517462 100
733 3300027395 Ga0209996_1066226 Ga0209996_10662262 100
734 3300027424 Ga0209984_1012409 Ga0209984_10124092 100
735 3300027471 Ga0209995_1023444 Ga0209995_10234442 100
736 3300027526 Ga0209968_1007446 Ga0209968_10074462 100
737 3300027543 Ga0209999_1027018 Ga0209999_10270182 100
738 3300027552 Ga0209982_1008888 Ga0209982_10088882 100
739 3300027617 Ga0210002_1000477 Ga0210002_10004774 100
740 3300027665 Ga0209983_1004381 Ga0209983_10043812 100
741 3300027682 Ga0209971_1003482 Ga0209971_10034825 100
742 3300027695 Ga0209966_1002279 Ga0209966_10022791 100
743 3300027717 Ga0209998_10017619 Ga0209998_100176192 100
744 3300027876 Ga0209974_10036531 Ga0209974_100365311 100
745 3300027907 Ga0207428_10001279 Ga0207428_1000127910 100
746 3300028379 Ga0268266_10133468 Ga0268266_101334684 100
747 3300028379 Ga0268266_10141267 Ga0268266_101412673 100
748 3300028380 Ga0268265_10001152 Ga0268265_100011525 100
749 3300028380 Ga0268265_11174183 Ga0268265_111741832 100
750 3300028381 Ga0268264_10000886 Ga0268264_100008866 100
751 3300028381 Ga0268264_10764967 Ga0268264_107649672 100
752 3300028381 Ga0268264_10892555 Ga0268264_108925552 100
753 3300028573 Ga0265334_10101418 Ga0265334_101014182 100
754 3300028800 Ga0265338_10048758 Ga0265338_100487585 100
755 3300030760 Ga0265762_1048865 Ga0265762_10488652 100
756 3300031235 Ga0265330_10153765 Ga0265330_101537652 100
757 3300031241 Ga0265325_10004936 Ga0265325_100049362 100
758 3300031247 Ga0265340_10084294 Ga0265340_100842942 100
759 3300031249 Ga0265339_10002208 Ga0265339_1000220812 100
760 3300031344 Ga0265316_10300661 Ga0265316_103006611 100
761 3300031595 Ga0265313_10002423 Ga0265313_1000242310 100
762 3300031595 Ga0265313_10021599 Ga0265313_100215993 100
763 3300031711 Ga0265314_10001439 Ga0265314_1000143912 100
764 3300032004 Ga0307414_10277404 Ga0307414_102774042 100
765 3300032005 Ga0307411_10692387 Ga0307411_106923872 100
766 3300034816 Ga0373930_0019403 Ga0373930_0019403_508_810 100
767 3300034818 Ga0373950_0012634 Ga0373950_0012634_129_431 100
768 3300034819 Ga0373958_0000496 Ga0373958_0000496_13_315 100
769 3300034819 Ga0373958_0021372 Ga0373958_0021372_651_953 100
770 3300034957 Ga0373938_0000501 Ga0373938_0000501_573_875 100
771 3300035084 Ga0373928_0001329 Ga0373928_0001329_2323_2625 100
772 3300035085 Ga0373929_0005182 Ga0373929_0005182_753_1055 100
773 3300035085 Ga0373929_0005356 Ga0373929_0005356_1379_1681 100
774 3300035088 Ga0373940_0006151 Ga0373940_0006151_1191_1493 100
775 3300035089 Ga0373944_0207684 Ga0373944_0207684_71_373 100
776 3300035090 Ga0373949_0001039 Ga0373949_0001039_2961_3263 100
777 3300035090 Ga0373949_0002241 Ga0373949_0002241_4091_4393 100
778 3300035091 Ga0373951_0001036 Ga0373951_0001036_5273_5575 100
779 3300035091 Ga0373951_0009429 Ga0373951_0009429_600_902 100
780 3300035092 Ga0373952_0000019 Ga0373952_0000019_6421_6723 100
781 3300035112 Ga0373932_0001702 Ga0373932_0001702_468_770 100
782 3300035114 Ga0373939_0000216 Ga0373939_0000216_15321_15623 100
783 3300035114 Ga0373939_0001911 Ga0373939_0001911_1061_1363 100
784 3300035114 Ga0373939_0040991 Ga0373939_0040991_19_321 100
785 3300035115 Ga0373941_0000554 Ga0373941_0000554_971_1273 100
786 3300035115 Ga0373941_0000816 Ga0373941_0000816_3496_3798 100
787 3300035121 Ga0373960_0000120 Ga0373960_0000120_7823_8125 100
788 3300035241 Ga0373961_0002336 Ga0373961_0002336_3995_4297 100
789 3300035242 Ga0373962_0001149 Ga0373962_0001149_5268_5570 100
790 3300035242 Ga0373962_0051820 Ga0373962_0051820_869_1171 100
791 3300035691 Ga0373931_0000168 Ga0373931_0000168_12973_13275 100
792 3300035691 Ga0373931_0525007 Ga0373931_0525007_452_754 100
793 3300035695 Ga0373927_0302343 Ga0373927_0302343_441_743 100
794 3300035724 Ga0373933_0001546 Ga0373933_0001546_390_692 100
795 3300035725 Ga0373947_0692793 Ga0373947_0692793_320_622 100
796 3300036401 Ga0373937_0465433 Ga0373937_0465433_395_697 100
797 3300037068 Ga0373925_0290237 Ga0373925_0290237_877_1179 100
798 3300037068 Ga0373925_0306580 Ga0373925_0306580_339_641 100
799 3300037068 Ga0373925_0512941 Ga0373925_0512941_293_595 100
800 3300037068 Ga0373925_1662082 Ga0373925_1662082_122_424 100
801 3300037466 Ga0395898_0091902 Ga0395898_0091902_86_388 100
802 3300037853 Ga0436364_0763481 Ga0436364_0763481_496_798 100
803 3300038443 Ga0395901_0186453 Ga0395901_0186453_1731_2033 100
804 3300038443 Ga0395901_0240390 Ga0395901_0240390_1380_1682 100
805 3300038698 Ga0242419_006070 Ga0242419_006070_459_761 100
806 3300039437 Ga0436365_0051319 Ga0436365_0051319_4864_5166 100
807 3300039437 Ga0436365_1635461 Ga0436365_1635461_769_1071 100
808 3300039438 Ga0436360_0080726 Ga0436360_0080726_165_467 100
809 3300039438 Ga0436360_0202439 Ga0436360_0202439_625_927 100
810 3300039438 Ga0436360_1015043 Ga0436360_1015043_457_759 100
811 3300039447 Ga0436361_0623870 Ga0436361_0623870_456_758 100
812 3300039450 Ga0436363_0224834 Ga0436363_0224834_704_1006 100
813 3300039450 Ga0436363_0431126 Ga0436363_0431126_320_622 100
814 3300039450 Ga0436363_1088775 Ga0436363_1088775_280_582 100
815 3300039453 Ga0436362_0138270 Ga0436362_0138270_3061_3363 100
816 3300039453 Ga0436362_0419658 Ga0436362_0419658_777_1079 100
817 3300039453 Ga0436362_0743365 Ga0436362_0743365_28_330 100
818 3300041413 Ga0439465_0235665 Ga0439465_0235665_353_655 100
819 3300041451 Ga0451791_1212031 Ga0451791_1212031_302_604 100
820 3300041496 Ga0451839_1021691 Ga0451839_1021691_28_330 100
821 3300042000 Ga0439437_001742 Ga0439437_001742_461_763 100
822 3300042001 Ga0439441_019518 Ga0439441_019518_621_923 100
823 3300042003 Ga0439443_059278 Ga0439443_059278_287_589 100
824 3300042005 Ga0439448_0098198 Ga0439448_0098198_597_899 100
825 3300042008 Ga0439450_088189 Ga0439450_088189_214_516 100
826 3300042012 Ga0439455_0008897 Ga0439455_0008897_543_845 100
827 3300042436 Ga0439435_0022509 Ga0439435_0022509_1144_1446 100
828 3300042437 Ga0439444_0044691 Ga0439444_0044691_95_397 100
829 3300042439 Ga0439464_0006642 Ga0439464_0006642_1574_1876 100
830 3300042993 Ga0439440_0132644 Ga0439440_0132644_310_612 100
831 3300044656 Ga0466969_0129828 Ga0466969_0129828_135_437 100
832 3300044656 Ga0466969_0577827 Ga0466969_0577827_150_452 100
833 3300044684 Ga0466966_0389774 Ga0466966_0389774_28_330 100
834 3300044684 Ga0466966_0474628 Ga0466966_0474628_76_378 100
835 3300044684 Ga0466966_0917341 Ga0466966_0917341_171_473 100
836 3300044765 Ga0466970_0564740 Ga0466970_0564740_346_648 100
837 3300045049 Ga0466959_0406614 Ga0466959_0406614_566_868 100
838 3300045836 Ga0466958_0289156 Ga0466958_0289156_493_795 100
839 3300045976 Ga0466967_0073407 Ga0466967_0073407_20_322 100
840 3300045976 Ga0466967_0941903 Ga0466967_0941903_115_417 100
841 3300045976 Ga0466967_1877775 Ga0466967_1877775_209_511 100
842 3300045976 Ga0466967_2229155 Ga0466967_2229155_89_391 100
843 3300046452 Ga0495617_030446 Ga0495617_030446_182_484 100
844 3300046455 Ga0495603_0057979 Ga0495603_0057979_1829_2131 100
845 3300046457 Ga0495590_0250539 Ga0495590_0250539_269_571 100
846 3300046460 Ga0495638_0033944 Ga0495638_0033944_1417_1719 100
847 3300046475 Ga0495639_0170302 Ga0495639_0170302_370_672 100
848 3300046499 Ga0495594_0056232 Ga0495594_0056232_853_1155 100
849 3300046500 Ga0495596_0434902 Ga0495596_0434902_23_325 100
850 3300046501 Ga0495607_0507967 Ga0495607_0507967_203_505 100
851 3300046506 Ga0495583_0428435 Ga0495583_0428435_184_486 100
852 3300046507 Ga0495606_0021503 Ga0495606_0021503_3498_3800 100
853 3300046507 Ga0495606_0087985 Ga0495606_0087985_881_1183 100
854 3300046513 Ga0495616_0203405 Ga0495616_0203405_551_853 100
855 3300046515 Ga0495620_0158003 Ga0495620_0158003_310_612 100
856 3300046518 Ga0495631_0507640 Ga0495631_0507640_170_472 100
857 3300046520 Ga0495637_0119799 Ga0495637_0119799_378_680 100
858 3300046522 Ga0495643_0243841 Ga0495643_0243841_50_352 100
859 3300046523 Ga0495644_0105274 Ga0495644_0105274_692_994 100
860 3300046524 Ga0495648_0011773 Ga0495648_0011773_4632_4934 100
861 3300046525 Ga0495663_0353195 Ga0495663_0353195_62_364 100
862 3300046526 Ga0495666_0065729 Ga0495666_0065729_14_316 100
863 3300046528 Ga0495642_0265770 Ga0495642_0265770_36_338 100
864 3300046530 Ga0495654_0116440 Ga0495654_0116440_698_1000 100
865 3300046537 Ga0495598_0042248 Ga0495598_0042248_799_1101 100
866 3300046557 Ga0495622_0037463 Ga0495622_0037463_337_639 100
867 3300046615 Ga0495656_0343965 Ga0495656_0343965_232_534 100
868 3300046615 Ga0495656_0611051 Ga0495656_0611051_177_479 100
869 3300046615 Ga0495656_0629729 Ga0495656_0629729_92_394 100
870 3300046616 Ga0495668_0174901 Ga0495668_0174901_110_412 100
871 3300046616 Ga0495668_0191619 Ga0495668_0191619_494_796 100
872 3300046616 Ga0495668_0312109 Ga0495668_0312109_411_713 100
873 3300046648 Ga0495611_0050268 Ga0495611_0050268_18_320 100
874 3300046660 Ga0495625_0094117 Ga0495625_0094117_1473_1775 100
875 3300046660 Ga0495625_0267767 Ga0495625_0267767_396_698 100
876 3300046664 Ga0495659_0013263 Ga0495659_0013263_1497_1799 100
877 3300046665 Ga0495661_0266784 Ga0495661_0266784_516_818 100
878 3300046674 Ga0495588_0024229 Ga0495588_0024229_969_1271 100
879 3300046674 Ga0495588_0405946 Ga0495588_0405946_245_547 100
880 3300046681 Ga0495647_0102158 Ga0495647_0102158_747_1049 100
881 3300046683 Ga0495658_0810041 Ga0495658_0810041_236_538 100
882 3300046690 Ga0495624_0192605 Ga0495624_0192605_565_867 100
883 3300046691 Ga0495670_0075745 Ga0495670_0075745_62_364 100
884 3300046692 Ga0495671_0084620 Ga0495671_0084620_402_704 100
885 3300046694 Ga0495649_0022151 Ga0495649_0022151_1650_1952 100
886 3300046794 Ga0495589_0240153 Ga0495589_0240153_144_446 100
887 3300047323 Ga0495683_0068028 Ga0495683_0068028_270_572 100
888 3300047323 Ga0495683_0077797 Ga0495683_0077797_324_626 100
889 3300047445 Ga0495677_0083670 Ga0495677_0083670_534_836 100
890 3300047445 Ga0495677_0094653 Ga0495677_0094653_552_854 100
891 3300047445 Ga0495677_0380474 Ga0495677_0380474_228_530 100
892 3300047469 Ga0495673_0270268 Ga0495673_0270268_88_390 100
893 3300047472 Ga0495686_0026275 Ga0495686_0026275_2288_2590 100
894 3300048090 Ga0495615_0040399 Ga0495615_0040399_355_657 100
895 3300048091 Ga0495626_0030649 Ga0495626_0030649_1658_1960 100
896 3300048903 Ga0496100_0000503 Ga0496100_0000503_8416_8718 100
897 3300048904 Ga0496101_0000510 Ga0496101_0000510_18530_18832 100
898 3300048904 Ga0496101_0156450 Ga0496101_0156450_793_1095 100
899 3300048904 Ga0496101_0386092 Ga0496101_0386092_544_846 100
900 3300048905 Ga0496102_0003114 Ga0496102_0003114_5845_6147 100
901 3300048905 Ga0496102_0126849 Ga0496102_0126849_503_805 100
902 3300048905 Ga0496102_0202660 Ga0496102_0202660_867_1169 100
903 3300048906 Ga0496103_0002544 Ga0496103_0002544_3072_3374 100
904 3300048906 Ga0496103_0356521 Ga0496103_0356521_593_895 100
905 3300048907 Ga0496104_0017224 Ga0496104_0017224_3203_3505 100
906 3300048907 Ga0496104_0029119 Ga0496104_0029119_378_680 100
907 3300048907 Ga0496104_0029932 Ga0496104_0029932_2798_3100 100
908 3300048909 Ga0496106_0000327 Ga0496106_0000327_3072_3374 100
909 3300048910 Ga0496107_0000143 Ga0496107_0000143_32307_32609 100
910 3300048910 Ga0496107_0025470 Ga0496107_0025470_463_765 100
911 3300048910 Ga0496107_0477856 Ga0496107_0477856_237_539 100
912 3300048910 Ga0496107_0580426 Ga0496107_0580426_308_610 100
913 3300048911 Ga0496108_0001249 Ga0496108_0001249_18366_18668 100
914 3300048911 Ga0496108_0002170 Ga0496108_0002170_9045_9347 100
915 3300048911 Ga0496108_1510326 Ga0496108_1510326_39_341 100
916 3300048912 Ga0496109_0000372 Ga0496109_0000372_37431_37733 100
917 3300048912 Ga0496109_0001114 Ga0496109_0001114_18961_19263 100
918 3300048912 Ga0496109_0329923 Ga0496109_0329923_38_340 100
919 3300048913 Ga0496110_0010802 Ga0496110_0010802_3860_4162 100
920 3300048913 Ga0496110_0032262 Ga0496110_0032262_32_334 100
921 3300048914 Ga0496111_0001119 Ga0496111_0001119_11625_11927 100
922 3300048915 Ga0496112_0025093 Ga0496112_0025093_311_613 100
923 3300048915 Ga0496112_0161531 Ga0496112_0161531_30_332 100
924 3300048915 Ga0496112_0673436 Ga0496112_0673436_189_491 100
925 3300048916 Ga0496113_0016164 Ga0496113_0016164_2135_2437 100
926 3300048916 Ga0496113_0037303 Ga0496113_0037303_356_658 100
927 3300048917 Ga0496114_0002293 Ga0496114_0002293_7328_7630 100
928 3300048917 Ga0496114_0067931 Ga0496114_0067931_2496_2798 100
929 3300048918 Ga0496115_0000555 Ga0496115_0000555_21069_21371 100
930 3300048918 Ga0496115_0016170 Ga0496115_0016170_4178_4480 100
931 3300048919 Ga0496116_0099838 Ga0496116_0099838_734_1036 100
932 3300048921 Ga0496118_0297511 Ga0496118_0297511_504_806 100
933 3300048922 Ga0496119_0053835 Ga0496119_0053835_517_819 100
934 3300048924 Ga0496121_0078626 Ga0496121_0078626_1384_1686 100
935 3300048929 Ga0496126_0214284 Ga0496126_0214284_218_520 100
936 3300048929 Ga0496126_0409102 Ga0496126_0409102_27_329 100
937 3300048929 Ga0496126_0735377 Ga0496126_0735377_336_638 100
938 3300048929 Ga0496126_1391407 Ga0496126_1391407_137_439 100
939 3300049460 Ga0495682_0033259 Ga0495682_0033259_1402_1704 100
940 3300049569 Ga0501032_0018358 Ga0501032_0018358_707_1009 100
941 3300049570 Ga0501033_0217060 Ga0501033_0217060_922_1224 100
942 3300049571 Ga0501034_0014156 Ga0501034_0014156_3198_3500 100
943 3300049571 Ga0501034_0258683 Ga0501034_0258683_665_967 100
944 3300049571 Ga0501034_0807348 Ga0501034_0807348_144_446 100
945 3300049571 Ga0501034_1718694 Ga0501034_1718694_143_445 100
946 3300049572 Ga0501036_0021648 Ga0501036_0021648_1590_1892 100
947 3300049573 Ga0501037_0110087 Ga0501037_0110087_1297_1599 100
948 3300049574 Ga0501038_0029854 Ga0501038_0029854_2919_3221 100
949 3300049575 Ga0501039_0020116 Ga0501039_0020116_3394_3696 100
950 3300049576 Ga0501040_0846192 Ga0501040_0846192_294_596 100
951 3300049578 Ga0501042_1363028 Ga0501042_1363028_177_479 100
952 3300049579 Ga0501043_0020670 Ga0501043_0020670_3294_3596 100
953 3300049579 Ga0501043_1281147 Ga0501043_1281147_21_323 100
954 3300049580 Ga0501046_0331951 Ga0501046_0331951_149_451 100
955 3300049581 Ga0501047_0511683 Ga0501047_0511683_689_991 100
956 3300049581 Ga0501047_0782210 Ga0501047_0782210_151_453 100
957 3300049581 Ga0501047_1425808 Ga0501047_1425808_64_366 100
958 3300049583 Ga0501067_0109307 Ga0501067_0109307_329_631 100
959 3300049583 Ga0501067_0173376 Ga0501067_0173376_889_1191 100
960 3300049583 Ga0501067_0567901 Ga0501067_0567901_44_346 100
961 3300049583 Ga0501067_0878796 Ga0501067_0878796_191_493 100
962 3300049584 Ga0501068_0382417 Ga0501068_0382417_57_359 100
963 3300049585 Ga0501069_0079589 Ga0501069_0079589_1455_1757 100
964 3300049585 Ga0501069_0096009 Ga0501069_0096009_692_994 100
965 3300049586 Ga0501070_0567041 Ga0501070_0567041_317_619 100
966 3300049586 Ga0501070_0928544 Ga0501070_0928544_313_615 100
967 3300049588 Ga0501072_0006089 Ga0501072_0006089_7403_7705 100
968 3300049588 Ga0501072_0046675 Ga0501072_0046675_2102_2404 100
969 3300049589 Ga0501073_0069012 Ga0501073_0069012_849_1151 100
970 3300049590 Ga0501074_0023893 Ga0501074_0023893_3749_4051 100
971 3300049590 Ga0501074_0505132 Ga0501074_0505132_15_317 100
972 3300049592 Ga0501076_0230372 Ga0501076_0230372_1194_1496 100
973 3300049592 Ga0501076_0325901 Ga0501076_0325901_904_1206 100
974 3300049593 Ga0501077_0015784 Ga0501077_0015784_4149_4451 100
975 3300049741 Ga0501079_0350618 Ga0501079_0350618_143_445 100
976 3300049742 Ga0501080_0284181 Ga0501080_0284181_724_1026 100
977 3300049742 Ga0501080_1229030 Ga0501080_1229030_235_537 100
978 3300049743 Ga0501081_0170893 Ga0501081_0170893_157_459 100
979 3300049744 Ga0501083_0094600 Ga0501083_0094600_793_1095 100
980 3300049744 Ga0501083_0236461 Ga0501083_0236461_555_857 100
981 3300049744 Ga0501083_0600349 Ga0501083_0600349_357_659 100
982 3300049744 Ga0501083_0888587 Ga0501083_0888587_202_504 100
983 3300049744 Ga0501083_1012307 Ga0501083_1012307_12_314 100
984 3300049822 Ga0501035_0062437 Ga0501035_0062437_1716_2018 100
985 3300050490 nmdc:mga03n38_330829_c1 nmdc:mga03n38_330829_c1_201_503 100
986 3300050490 nmdc:mga03n38_446070_c1 nmdc:mga03n38_446070_c1_86_388 100
987 3300050491 nmdc:mga00v17_593731_c1 nmdc:mga00v17_593731_c1_391_693 100
988 3300050491 nmdc:mga00v17_744843_c1 nmdc:mga00v17_744843_c1_278_580 100
989 3300050492 nmdc:mga0yw44_2244_c1 nmdc:mga0yw44_2244_c1_5357_5659 100
990 3300050493 nmdc:mga0k408_668968_c1 nmdc:mga0k408_668968_c1_29_331 100
991 3300050494 nmdc:mga06z11_186895_c1 nmdc:mga06z11_186895_c1_191_493 100
992 3300050494 nmdc:mga06z11_316866_c1 nmdc:mga06z11_316866_c1_427_729 100
993 3300050494 nmdc:mga06z11_319435_c1 nmdc:mga06z11_319435_c1_441_743 100
994 3300050494 nmdc:mga06z11_515165_c1 nmdc:mga06z11_515165_c1_47_349 100
995 3300050496 nmdc:mga07m45_42894_c1 nmdc:mga07m45_42894_c1_638_940 100
996 3300050507 nmdc:mga05p37_582763_c1 nmdc:mga05p37_582763_c1_460_762 100
997 3300050511 nmdc:mga08y16_3663_c1 nmdc:mga08y16_3663_c1_13500_13802 100
998 3300050512 nmdc:mga0n895_436512_c1 nmdc:mga0n895_436512_c1_257_559 100
999 3300050512 nmdc:mga0n895_55_c1 nmdc:mga0n895_55_c1_8811_9113 100
1000 3300050513 nmdc:mga0rr50_230836_c1 nmdc:mga0rr50_230836_c1_472_774 100
1001 3300050513 nmdc:mga0rr50_357645_c1 nmdc:mga0rr50_357645_c1_336_638 100
1002 3300050515 nmdc:mga0a205_5630_c2 nmdc:mga0a205_5630_c2_194_496 100
1003 3300053087 Ga0500643_196316 Ga0500643_196316_210_512 100
1004 3300053089 Ga0500581_342998 Ga0500581_342998_89_391 100
1005 3300053093 Ga0500651_0105613 Ga0500651_0105613_254_589 100
1006 3300053096 Ga0500641_0033083 Ga0500641_0033083_1169_1471 100
1007 3300053118 Ga0500594_0012364 Ga0500594_0012364_1392_1694 100
1008 3300053119 Ga0500595_179950 Ga0500595_179950_69_371 100
1009 3300053124 Ga0500617_070874 Ga0500617_070874_144_446 100
1010 3300053136 Ga0500559_0425577 Ga0500559_0425577_72_374 100
1011 3300053139 Ga0500568_0262257 Ga0500568_0262257_269_571 100
1012 3300053142 Ga0500577_0025610 Ga0500577_0025610_371_673 100
1013 3300053146 Ga0500588_0030517 Ga0500588_0030517_167_469 100
1014 3300053147 Ga0500589_092826 Ga0500589_092826_105_407 100
1015 3300053153 Ga0500616_0038934 Ga0500616_0038934_1124_1426 100
1016 3300053153 Ga0500616_0391717 Ga0500616_0391717_14_316 100
1017 3300053158 Ga0500627_0215976 Ga0500627_0215976_397_699 100
1018 3300053162 Ga0500638_053079 Ga0500638_053079_1430_1732 100
1019 3300054114 Ga0501084_0041580 Ga0501084_0041580_945_1247 100
1020 3300054114 Ga0501084_0657102 Ga0501084_0657102_32_334 100
1021 3300059506 Ga0587085_096112 Ga0587085_096112_192_494 100
1022 3300060353 Ga0501082_0620034 Ga0501082_0620034_254_556 100
1023 3300060353 Ga0501082_0724227 Ga0501082_0724227_318_620 100
1024 3300061719 Ga0466962_0194169 Ga0466962_0194169_319_621 100
1025 3300005435 Ga0070714_102037223 Ga0070714_1020372232 101
1026 3300005548 Ga0070665_100674196 Ga0070665_1006741962 101
1027 3300006163 Ga0070715_10149141 Ga0070715_101491411 101
1028 3300025905 Ga0207685_10063706 Ga0207685_100637062 101
1029 3300028380 Ga0268265_11451951 Ga0268265_114519512 101
1030 3300035119 Ga0373956_0580804 Ga0373956_0580804_94_399 101
1031 3300035691 Ga0373931_0494830 Ga0373931_0494830_195_500 101
1032 3300037418 Ga0395900_0304771 Ga0395900_0304771_409_714 101
1033 3300037466 Ga0395898_0159166 Ga0395898_0159166_607_912 101
1034 3300037471 Ga0395905_0110910 Ga0395905_0110910_425_730 101
1035 3300046454 Ga0495592_0164753 Ga0495592_0164753_447_752 101
1036 3300046462 Ga0495651_0006742 Ga0495651_0006742_7291_7596 101
1037 3300046476 Ga0495662_0194068 Ga0495662_0194068_437_742 101
1038 3300046477 Ga0495664_0100006 Ga0495664_0100006_618_923 101
1039 3300046516 Ga0495628_0008202 Ga0495628_0008202_4741_5046 101
1040 3300046529 Ga0495652_0150715 Ga0495652_0150715_855_1160 101
1041 3300046533 Ga0495640_0130139 Ga0495640_0130139_718_1023 101
1042 3300046536 Ga0495587_0010408 Ga0495587_0010408_1221_1526 101
1043 3300046543 Ga0495645_0060216 Ga0495645_0060216_722_1027 101
1044 3300046559 Ga0495667_0110133 Ga0495667_0110133_838_1143 101
1045 3300046642 Ga0495634_0046747 Ga0495634_0046747_1511_1816 101
1046 3300046663 Ga0495635_0124568 Ga0495635_0124568_736_1041 101
1047 3300046675 Ga0495657_0009428 Ga0495657_0009428_4907_5212 101
1048 3300046678 Ga0495599_0067631 Ga0495599_0067631_1696_2001 101
1049 3300046680 Ga0495646_0011058 Ga0495646_0011058_862_1167 101
1050 3300046689 Ga0495613_0170277 Ga0495613_0170277_255_560 101
1051 3300046809 Ga0495600_0002231 Ga0495600_0002231_6925_7230 101
1052 3300047317 Ga0495604_0003943 Ga0495604_0003943_8676_8981 101
1053 3300047322 Ga0495680_0005216 Ga0495680_0005216_8152_8457 101
1054 3300047444 Ga0495675_0009631 Ga0495675_0009631_4434_4739 101
1055 3300047444 Ga0495675_0368120 Ga0495675_0368120_167_472 101
1056 3300047471 Ga0495684_0135777 Ga0495684_0135777_1243_1548 101
1057 3300048088 Ga0495602_0019579 Ga0495602_0019579_2195_2500 101
1058 3300048924 Ga0496121_0413523 Ga0496121_0413523_401_706 101
1059 3300049589 Ga0501073_0621788 Ga0501073_0621788_232_537 101
1060 3300053077 Ga0495601_0102791 Ga0495601_0102791_1108_1413 101
1061 3300053078 Ga0495612_0446188 Ga0495612_0446188_94_399 101
1062 3300053085 Ga0495619_0043221 Ga0495619_0043221_387_692 101
1063 3300001989 JGI24739J22299_10036217 JGI24739J22299_100362172 102
1064 3300005353 Ga0070669_100322880 Ga0070669_1003228802 102
1065 3300006038 Ga0075365_10632495 Ga0075365_106324952 102
1066 3300025940 Ga0207691_10390120 Ga0207691_103901202 102
1067 3300026067 Ga0207678_10777730 Ga0207678_107777302 102
1068 3300031235 Ga0265330_10231390 Ga0265330_102313902 102
1069 3300031240 Ga0265320_10022931 Ga0265320_100229311 102
1070 3300031247 Ga0265340_10042317 Ga0265340_100423174 102
1071 3300031711 Ga0265314_10131333 Ga0265314_101313333 102
1072 3300046455 Ga0495603_0137674 Ga0495603_0137674_550_858 102
1073 3300048908 Ga0496105_1233987 Ga0496105_1233987_77_385 102
1074 3300050492 nmdc:mga0yw44_1061021_c1 nmdc:mga0yw44_1061021_c1_209_517 102
1075 3300053108 Ga0500562_098476 Ga0500562_098476_32_355 102
1076 2010549000 RicEn_C1608 RicEn_29370 103
1077 3300003214 JGI25165J46597_1008157 JGI25165J46597_10081572 103
1078 3300003354 JGI25160J50197_1001122 JGI25160J50197_100112211 103
1079 3300003354 JGI25160J50197_1078087 JGI25160J50197_10780871 103
1080 3300003771 Ga0055526_1091498 Ga0055526_10914981 103
1081 3300003775 Ga0055524_1057430 Ga0055524_10574302 103
1082 3300003794 Ga0055531_10011202 Ga0055531_100112022 103
1083 3300004625 Ga0055543_1029757 Ga0055543_10297572 103
1084 3300005262 Ga0065165_1009364 Ga0065165_10093641 103
1085 3300005262 Ga0065165_1023472 Ga0065165_10234721 103
1086 3300005262 Ga0065165_1136923 Ga0065165_11369232 103
1087 3300005329 Ga0070683_101304579 Ga0070683_1013045791 103
1088 3300005331 Ga0070670_100238088 Ga0070670_1002380882 103
1089 3300005339 Ga0070660_100693540 Ga0070660_1006935401 103
1090 3300005340 Ga0070689_100529671 Ga0070689_1005296712 103
1091 3300005344 Ga0070661_100133110 Ga0070661_1001331103 103
1092 3300005353 Ga0070669_100047333 Ga0070669_1000473335 103
1093 3300005355 Ga0070671_100097880 Ga0070671_1000978803 103
1094 3300005366 Ga0070659_100201725 Ga0070659_1002017252 103
1095 3300005367 Ga0070667_100095483 Ga0070667_1000954832 103
1096 3300005455 Ga0070663_101596343 Ga0070663_1015963431 103
1097 3300005456 Ga0070678_101085359 Ga0070678_1010853592 103
1098 3300005535 Ga0070684_101560474 Ga0070684_1015604741 103
1099 3300005548 Ga0070665_102120303 Ga0070665_1021203031 103
1100 3300005564 Ga0070664_100192491 Ga0070664_1001924912 103
1101 3300005577 Ga0068857_100385717 Ga0068857_1003857172 103
1102 3300005578 Ga0068854_100164147 Ga0068854_1001641472 103
1103 3300005614 Ga0068856_100176210 Ga0068856_1001762102 103
1104 3300005615 Ga0070702_100611363 Ga0070702_1006113632 103
1105 3300005616 Ga0068852_100019926 Ga0068852_1000199262 103
1106 3300005616 Ga0068852_100281520 Ga0068852_1002815201 103
1107 3300005618 Ga0068864_100551765 Ga0068864_1005517652 103
1108 3300005719 Ga0068861_100441800 Ga0068861_1004418002 103
1109 3300005842 Ga0068858_100734336 Ga0068858_1007343362 103
1110 3300005842 Ga0068858_102352298 Ga0068858_1023522982 103
1111 3300005843 Ga0068860_100958438 Ga0068860_1009584381 103
1112 3300005983 Ga0081540_1080929 Ga0081540_10809291 103
1113 3300006042 Ga0075368_10012526 Ga0075368_100125261 103
1114 3300006048 Ga0075363_100067838 Ga0075363_1000678383 103
1115 3300006048 Ga0075363_100188469 Ga0075363_1001884692 103
1116 3300006051 Ga0075364_10078336 Ga0075364_100783363 103
1117 3300006051 Ga0075364_10462832 Ga0075364_104628322 103
1118 3300006177 Ga0075362_10202488 Ga0075362_102024882 103
1119 3300006178 Ga0075367_10115630 Ga0075367_101156302 103
1120 3300006178 Ga0075367_10589226 Ga0075367_105892261 103
1121 3300006186 Ga0075369_10079883 Ga0075369_100798833 103
1122 3300006186 Ga0075369_10110706 Ga0075369_101107063 103
1123 3300006186 Ga0075369_10120497 Ga0075369_101204972 103
1124 3300006195 Ga0075366_10021740 Ga0075366_100217404 103
1125 3300006195 Ga0075366_10767014 Ga0075366_107670142 103
1126 3300006353 Ga0075370_10071042 Ga0075370_100710422 103
1127 3300006353 Ga0075370_10146723 Ga0075370_101467231 103
1128 3300006931 Ga0097620_100933804 Ga0097620_1009338042 103
1129 3300006942 Ga0099824_1033850 Ga0099824_10338503 103
1130 3300006943 Ga0099822_1041384 Ga0099822_10413842 103
1131 3300006944 Ga0099823_1012311 Ga0099823_10123117 103
1132 3300009093 Ga0105240_10006733 Ga0105240_100067332 103
1133 3300009098 Ga0105245_10129919 Ga0105245_101299194 103
1134 3300009098 Ga0105245_10206389 Ga0105245_102063892 103
1135 3300009101 Ga0105247_10040318 Ga0105247_100403184 103
1136 3300009148 Ga0105243_10158299 Ga0105243_101582992 103
1137 3300009174 Ga0105241_10041983 Ga0105241_100419835 103
1138 3300009174 Ga0105241_10303676 Ga0105241_103036761 103
1139 3300009177 Ga0105248_10094136 Ga0105248_100941363 103
1140 3300009545 Ga0105237_10080045 Ga0105237_100800453 103
1141 3300009551 Ga0105238_10545617 Ga0105238_105456172 103
1142 3300010375 Ga0105239_10119145 Ga0105239_101191452 103
1143 3300010375 Ga0105239_10167699 Ga0105239_101676992 103
1144 3300010375 Ga0105239_13564552 Ga0105239_135645521 103
1145 3300011119 Ga0105246_11461355 Ga0105246_114613551 103
1146 3300013104 Ga0157370_10347519 Ga0157370_103475191 103
1147 3300013105 Ga0157369_12671230 Ga0157369_126712302 103
1148 3300013296 Ga0157374_10291518 Ga0157374_102915181 103
1149 3300013297 Ga0157378_13074281 Ga0157378_130742812 103
1150 3300013306 Ga0163162_10482238 Ga0163162_104822382 103
1151 3300013307 Ga0157372_12788277 Ga0157372_127882772 103
1152 3300013308 Ga0157375_12056920 Ga0157375_120569202 103
1153 3300014326 Ga0157380_12468072 Ga0157380_124680722 103
1154 3300014497 Ga0182008_10446941 Ga0182008_104469411 103
1155 3300017792 Ga0163161_11805712 Ga0163161_118057122 103
1156 3300021320 Ga0214544_1008398 Ga0214544_100839817 103
1157 3300021321 Ga0214542_1005602 Ga0214542_10056021 103
1158 3300021321 Ga0214542_1036118 Ga0214542_10361182 103
1159 3300021324 Ga0214545_1000640 Ga0214545_100064063 103
1160 3300021324 Ga0214545_1034133 Ga0214545_10341332 103
1161 3300021327 Ga0214543_1009848 Ga0214543_100984814 103
1162 3300021327 Ga0214543_1039535 Ga0214543_10395352 103
1163 3300025253 Ga0209677_107668 Ga0209677_1076682 103
1164 3300025254 Ga0209148_1000275 Ga0209148_100027546 103
1165 3300025261 Ga0209233_1001359 Ga0209233_10013597 103
1166 3300025272 Ga0209455_1013785 Ga0209455_10137852 103
1167 3300025273 Ga0209673_1017321 Ga0209673_10173212 103
1168 3300025295 Ga0209564_1009422 Ga0209564_10094227 103
1169 3300025295 Ga0209564_1015893 Ga0209564_10158934 103
1170 3300025297 Ga0209758_1001177 Ga0209758_100117730 103
1171 3300025297 Ga0209758_1001736 Ga0209758_100173621 103
1172 3300025297 Ga0209758_1004318 Ga0209758_10043184 103
1173 3300025297 Ga0209758_1007225 Ga0209758_10072259 103
1174 3300025297 Ga0209758_1017374 Ga0209758_10173744 103
1175 3300025297 Ga0209758_1047251 Ga0209758_10472512 103
1176 3300025299 Ga0209256_1014969 Ga0209256_10149693 103
1177 3300025302 Ga0207426_1001552 Ga0207426_100155215 103
1178 3300025302 Ga0207426_1003596 Ga0207426_10035966 103
1179 3300025302 Ga0207426_1022473 Ga0207426_10224732 103
1180 3300025304 Ga0209257_1003456 Ga0209257_100345615 103
1181 3300025304 Ga0209257_1026569 Ga0209257_10265693 103
1182 3300025315 Ga0207697_10131525 Ga0207697_101315252 103
1183 3300025904 Ga0207647_10074901 Ga0207647_100749012 103
1184 3300025908 Ga0207643_10380061 Ga0207643_103800612 103
1185 3300025911 Ga0207654_10083585 Ga0207654_100835853 103
1186 3300025911 Ga0207654_10202299 Ga0207654_102022992 103
1187 3300025913 Ga0207695_10000107 Ga0207695_10000107172 103
1188 3300025913 Ga0207695_11115400 Ga0207695_111154001 103
1189 3300025914 Ga0207671_10007354 Ga0207671_100073547 103
1190 3300025914 Ga0207671_10183041 Ga0207671_101830412 103
1191 3300025919 Ga0207657_10302268 Ga0207657_103022682 103
1192 3300025920 Ga0207649_10104857 Ga0207649_101048573 103
1193 3300025923 Ga0207681_10350826 Ga0207681_103508262 103
1194 3300025924 Ga0207694_10316187 Ga0207694_103161871 103
1195 3300025926 Ga0207659_10413123 Ga0207659_104131231 103
1196 3300025931 Ga0207644_10091510 Ga0207644_100915102 103
1197 3300025932 Ga0207690_10380337 Ga0207690_103803372 103
1198 3300025933 Ga0207706_10363597 Ga0207706_103635972 103
1199 3300025936 Ga0207670_10359565 Ga0207670_103595652 103
1200 3300025938 Ga0207704_11800361 Ga0207704_118003611 103
1201 3300025941 Ga0207711_10648103 Ga0207711_106481032 103
1202 3300025941 Ga0207711_10774540 Ga0207711_107745402 103
1203 3300025942 Ga0207689_10206229 Ga0207689_102062293 103
1204 3300025944 Ga0207661_11483823 Ga0207661_114838231 103
1205 3300025981 Ga0207640_10184781 Ga0207640_101847811 103
1206 3300026023 Ga0207677_11049957 Ga0207677_110499571 103
1207 3300026035 Ga0207703_11266951 Ga0207703_112669511 103
1208 3300026035 Ga0207703_11386263 Ga0207703_113862632 103
1209 3300026041 Ga0207639_11144247 Ga0207639_111442472 103
1210 3300026067 Ga0207678_10087980 Ga0207678_100879802 103
1211 3300026095 Ga0207676_10203783 Ga0207676_102037832 103
1212 3300026116 Ga0207674_10101501 Ga0207674_101015015 103
1213 3300026116 Ga0207674_10456876 Ga0207674_104568762 103
1214 3300026118 Ga0207675_100454248 Ga0207675_1004542481 103
1215 3300026121 Ga0207683_12148403 Ga0207683_121484031 103
1216 3300027296 Ga0209389_1000153 Ga0209389_100015360 103
1217 3300027296 Ga0209389_1001970 Ga0209389_100197013 103
1218 3300027357 Ga0209589_1001441 Ga0209589_100144113 103
1219 3300027361 Ga0209489_100936 Ga0209489_1009367 103
1220 3300027361 Ga0209489_107925 Ga0209489_10792513 103
1221 3300027363 Ga0209700_100011 Ga0209700_100011144 103
1222 3300027866 Ga0209813_10019795 Ga0209813_100197952 103
1223 3300027866 Ga0209813_10283706 Ga0209813_102837061 103
1224 3300028379 Ga0268266_10138462 Ga0268266_101384623 103
1225 3300028381 Ga0268264_12701494 Ga0268264_127014942 103
1226 3300031616 Ga0307508_10803923 Ga0307508_108039232 103
1227 3300033180 Ga0307510_10047169 Ga0307510_100471695 103
1228 3300033180 Ga0307510_10057372 Ga0307510_100573725 103
1229 3300035121 Ga0373960_0434649 Ga0373960_0434649_137_448 103
1230 3300035691 Ga0373931_0534481 Ga0373931_0534481_396_707 103
1231 3300037418 Ga0395900_0000623 Ga0395900_0000623_22802_23116 103
1232 3300037466 Ga0395898_0005100 Ga0395898_0005100_11111_11425 103
1233 3300037471 Ga0395905_0008122 Ga0395905_0008122_5092_5403 103
1234 3300037471 Ga0395905_0101686 Ga0395905_0101686_2225_2539 103
1235 3300037471 Ga0395905_0978275 Ga0395905_0978275_68_379 103
1236 3300038443 Ga0395901_0025332 Ga0395901_0025332_2685_2999 103
1237 3300038443 Ga0395901_1922363 Ga0395901_1922363_39_350 103
1238 3300039437 Ga0436365_1514182 Ga0436365_1514182_292_603 103
1239 3300041413 Ga0439465_0135724 Ga0439465_0135724_419_730 103
1240 3300041451 Ga0451791_1591294 Ga0451791_1591294_384_695 103
1241 3300041452 Ga0451793_0115389 Ga0451793_0115389_248_559 103
1242 3300041453 Ga0451797_1054811 Ga0451797_1054811_85_396 103
1243 3300041458 Ga0451798_0684963 Ga0451798_0684963_161_472 103
1244 3300041460 Ga0451802_0613368 Ga0451802_0613368_208_519 103
1245 3300041486 Ga0451807_2241141 Ga0451807_2241141_125_436 103
1246 3300041496 Ga0451839_0152791 Ga0451839_0152791_138_449 103
1247 3300041505 Ga0451849_1088658 Ga0451849_1088658_219_530 103
1248 3300041507 Ga0451851_0249131 Ga0451851_0249131_102_413 103
1249 3300042005 Ga0439448_0067783 Ga0439448_0067783_634_945 103
1250 3300044656 Ga0466969_0004242 Ga0466969_0004242_2769_3080 103
1251 3300044658 Ga0466972_0001791 Ga0466972_0001791_4145_4456 103
1252 3300044658 Ga0466972_0024641 Ga0466972_0024641_835_1146 103
1253 3300044658 Ga0466972_0119362 Ga0466972_0119362_827_1138 103
1254 3300044658 Ga0466972_0124633 Ga0466972_0124633_461_772 103
1255 3300044658 Ga0466972_0148608 Ga0466972_0148608_770_1081 103
1256 3300044683 Ga0466965_0093556 Ga0466965_0093556_808_1119 103
1257 3300044683 Ga0466965_0217095 Ga0466965_0217095_41_352 103
1258 3300044684 Ga0466966_0001051 Ga0466966_0001051_7491_7802 103
1259 3300044693 Ga0466961_0005739 Ga0466961_0005739_3544_3855 103
1260 3300044693 Ga0466961_0274903 Ga0466961_0274903_711_1022 103
1261 3300044694 Ga0466963_0030126 Ga0466963_0030126_1161_1472 103
1262 3300044706 Ga0466964_0059002 Ga0466964_0059002_383_694 103
1263 3300044719 Ga0466971_0088729 Ga0466971_0088729_810_1121 103
1264 3300044735 Ga0466968_0019273 Ga0466968_0019273_18_329 103
1265 3300044765 Ga0466970_0080544 Ga0466970_0080544_703_1014 103
1266 3300044765 Ga0466970_0416824 Ga0466970_0416824_87_398 103
1267 3300044901 Ga0466960_0023639 Ga0466960_0023639_1648_1959 103
1268 3300045976 Ga0466967_0213410 Ga0466967_0213410_324_635 103
1269 3300045976 Ga0466967_1111338 Ga0466967_1111338_37_348 103
1270 3300046457 Ga0495590_0319548 Ga0495590_0319548_49_360 103
1271 3300046459 Ga0495629_0650542 Ga0495629_0650542_180_491 103
1272 3300046460 Ga0495638_0030449 Ga0495638_0030449_453_764 103
1273 3300046475 Ga0495639_0183763 Ga0495639_0183763_453_764 103
1274 3300046501 Ga0495607_0450617 Ga0495607_0450617_135_446 103
1275 3300046506 Ga0495583_0117172 Ga0495583_0117172_324_635 103
1276 3300046511 Ga0495608_0123473 Ga0495608_0123473_699_1010 103
1277 3300046512 Ga0495610_0192021 Ga0495610_0192021_111_422 103
1278 3300046514 Ga0495618_0092321 Ga0495618_0092321_1286_1597 103
1279 3300046516 Ga0495628_0707827 Ga0495628_0707827_51_362 103
1280 3300046517 Ga0495630_0388668 Ga0495630_0388668_124_435 103
1281 3300046519 Ga0495632_0312683 Ga0495632_0312683_37_348 103
1282 3300046522 Ga0495643_0023626 Ga0495643_0023626_1641_1952 103
1283 3300046524 Ga0495648_0212783 Ga0495648_0212783_30_341 103
1284 3300046524 Ga0495648_0393557 Ga0495648_0393557_280_591 103
1285 3300046529 Ga0495652_0238017 Ga0495652_0238017_205_516 103
1286 3300046533 Ga0495640_0537942 Ga0495640_0537942_331_642 103
1287 3300046557 Ga0495622_0033426 Ga0495622_0033426_569_880 103
1288 3300046663 Ga0495635_0000368 Ga0495635_0000368_13529_13840 103
1289 3300046665 Ga0495661_0123940 Ga0495661_0123940_702_1013 103
1290 3300046678 Ga0495599_0222496 Ga0495599_0222496_830_1141 103
1291 3300046694 Ga0495649_0196381 Ga0495649_0196381_70_381 103
1292 3300046809 Ga0495600_0038619 Ga0495600_0038619_1677_1988 103
1293 3300046810 Ga0495660_0123810 Ga0495660_0123810_718_1029 103
1294 3300047319 Ga0495674_0066520 Ga0495674_0066520_2345_2656 103
1295 3300047321 Ga0495676_0343712 Ga0495676_0343712_36_347 103
1296 3300047323 Ga0495683_0081109 Ga0495683_0081109_153_464 103
1297 3300047323 Ga0495683_0291900 Ga0495683_0291900_71_382 103
1298 3300047443 Ga0495687_015336 Ga0495687_015336_961_1272 103
1299 3300047470 Ga0495681_0389328 Ga0495681_0389328_171_482 103
1300 3300048088 Ga0495602_0575539 Ga0495602_0575539_428_739 103
1301 3300048091 Ga0495626_0280746 Ga0495626_0280746_14_325 103
1302 3300048904 Ga0496101_0848610 Ga0496101_0848610_278_589 103
1303 3300048905 Ga0496102_0292943 Ga0496102_0292943_505_816 103
1304 3300048907 Ga0496104_0602756 Ga0496104_0602756_25_336 103
1305 3300048908 Ga0496105_0005872 Ga0496105_0005872_3650_3961 103
1306 3300048908 Ga0496105_0171815 Ga0496105_0171815_335_646 103
1307 3300048911 Ga0496108_0075429 Ga0496108_0075429_1195_1506 103
1308 3300048912 Ga0496109_0145117 Ga0496109_0145117_521_832 103
1309 3300048913 Ga0496110_0665185 Ga0496110_0665185_113_424 103
1310 3300048913 Ga0496110_0980379 Ga0496110_0980379_178_489 103
1311 3300048914 Ga0496111_0122249 Ga0496111_0122249_1104_1415 103
1312 3300048915 Ga0496112_0037410 Ga0496112_0037410_1974_2285 103
1313 3300048915 Ga0496112_0921646 Ga0496112_0921646_41_352 103
1314 3300048916 Ga0496113_0023412 Ga0496113_0023412_3847_4158 103
1315 3300048916 Ga0496113_0224472 Ga0496113_0224472_319_630 103
1316 3300048917 Ga0496114_0600170 Ga0496114_0600170_327_638 103
1317 3300048917 Ga0496114_0938436 Ga0496114_0938436_316_627 103
1318 3300048918 Ga0496115_0472890 Ga0496115_0472890_387_698 103
1319 3300048919 Ga0496116_0047052 Ga0496116_0047052_31_342 103
1320 3300048921 Ga0496118_0041922 Ga0496118_0041922_1331_1642 103
1321 3300048921 Ga0496118_0081158 Ga0496118_0081158_705_1016 103
1322 3300048921 Ga0496118_0227616 Ga0496118_0227616_246_557 103
1323 3300048922 Ga0496119_0009360 Ga0496119_0009360_45_356 103
1324 3300048922 Ga0496119_0354845 Ga0496119_0354845_74_385 103
1325 3300048923 Ga0496120_0004718 Ga0496120_0004718_6910_7221 103
1326 3300048923 Ga0496120_0156549 Ga0496120_0156549_720_1031 103
1327 3300048924 Ga0496121_0083053 Ga0496121_0083053_711_1022 103
1328 3300048924 Ga0496121_0136042 Ga0496121_0136042_1197_1508 103
1329 3300048927 Ga0496124_0315973 Ga0496124_0315973_792_1103 103
1330 3300048929 Ga0496126_0012253 Ga0496126_0012253_8470_8781 103
1331 3300049587 Ga0501071_1503593 Ga0501071_1503593_44_355 103
1332 3300049588 Ga0501072_0758788 Ga0501072_0758788_55_369 103
1333 3300049591 Ga0501075_1021414 Ga0501075_1021414_123_437 103
1334 3300050490 nmdc:mga03n38_359809_c1 nmdc:mga03n38_359809_c1_68_379 103
1335 3300050490 nmdc:mga03n38_368717_c1 nmdc:mga03n38_368717_c1_419_733 103
1336 3300050492 nmdc:mga0yw44_13917_c1 nmdc:mga0yw44_13917_c1_1134_1448 103
1337 3300050492 nmdc:mga0yw44_166441_c1 nmdc:mga0yw44_166441_c1_1066_1377 103
1338 3300050493 nmdc:mga0k408_57039_c1 nmdc:mga0k408_57039_c1_1945_2256 103
1339 3300050494 nmdc:mga06z11_124555_c1 nmdc:mga06z11_124555_c1_291_605 103
1340 3300050494 nmdc:mga06z11_131151_c1 nmdc:mga06z11_131151_c1_205_516 103
1341 3300050495 nmdc:mga04h51_30189_c1 nmdc:mga04h51_30189_c1_712_1023 103
1342 3300050496 nmdc:mga07m45_10126_c1 nmdc:mga07m45_10126_c1_3781_4092 103
1343 3300050496 nmdc:mga07m45_219520_c1 nmdc:mga07m45_219520_c1_49_360 103
1344 3300050496 nmdc:mga07m45_34313_c1 nmdc:mga07m45_34313_c1_13_324 103
1345 3300050496 nmdc:mga07m45_353521_c1 nmdc:mga07m45_353521_c1_519_833 103
1346 3300050516 nmdc:mga0sz30_164413_c1 nmdc:mga0sz30_164413_c1_302_613 103
1347 3300050516 nmdc:mga0sz30_200254_c1 nmdc:mga0sz30_200254_c1_287_601 103
1348 3300050516 nmdc:mga0sz30_54247_c2 nmdc:mga0sz30_54247_c2_702_1013 103
1349 3300050516 nmdc:mga0sz30_556945_c1 nmdc:mga0sz30_556945_c1_58_369 103
1350 3300050516 nmdc:mga0sz30_86267_c1 nmdc:mga0sz30_86267_c1_139_450 103
1351 3300053080 Ga0500635_0121463 Ga0500635_0121463_294_605 103
1352 3300053085 Ga0495619_1005209 Ga0495619_1005209_70_381 103
1353 3300053086 Ga0500578_0161655 Ga0500578_0161655_426_737 103
1354 3300053087 Ga0500643_000063 Ga0500643_000063_214_525 103
1355 3300053088 Ga0500644_0155773 Ga0500644_0155773_48_359 103
1356 3300053091 Ga0500647_0174997 Ga0500647_0174997_418_729 103
1357 3300053094 Ga0500566_0009826 Ga0500566_0009826_1463_1774 103
1358 3300053094 Ga0500566_0067843 Ga0500566_0067843_95_406 103
1359 3300053103 Ga0500555_034459 Ga0500555_034459_53_364 103
1360 3300053104 Ga0500556_0013711 Ga0500556_0013711_500_811 103
1361 3300053105 Ga0500557_000177 Ga0500557_000177_4008_4319 103
1362 3300053109 Ga0500569_077700 Ga0500569_077700_573_884 103
1363 3300053119 Ga0500595_017336 Ga0500595_017336_1497_1808 103
1364 3300053121 Ga0500607_267376 Ga0500607_267376_288_599 103
1365 3300053123 Ga0500614_070524 Ga0500614_070524_435_746 103
1366 3300053128 Ga0500626_067371 Ga0500626_067371_51_362 103
1367 3300053131 Ga0500652_170659 Ga0500652_170659_490_801 103
1368 3300053136 Ga0500559_0124460 Ga0500559_0124460_24_335 103
1369 3300053139 Ga0500568_0019253 Ga0500568_0019253_1046_1357 103
1370 3300053142 Ga0500577_0048303 Ga0500577_0048303_366_677 103
1371 3300053144 Ga0500585_211349 Ga0500585_211349_275_586 103
1372 3300053147 Ga0500589_177959 Ga0500589_177959_161_472 103
1373 3300053151 Ga0500604_0333313 Ga0500604_0333313_200_511 103
1374 3300053153 Ga0500616_0041628 Ga0500616_0041628_804_1115 103
1375 3300053155 Ga0500620_123812 Ga0500620_123812_105_416 103
1376 3300053158 Ga0500627_0034508 Ga0500627_0034508_1311_1622 103
1377 3300053160 Ga0500633_0077982 Ga0500633_0077982_64_375 103
1378 3300053162 Ga0500638_308756 Ga0500638_308756_285_596 103
1379 3300053177 Ga0500636_0000143 Ga0500636_0000143_15814_16125 103
1380 3300053729 Ga0500625_000062 Ga0500625_000062_18598_18909 103
1381 3300053731 Ga0500609_016664 Ga0500609_016664_656_967 103
1382 3300053733 Ga0500552_123777 Ga0500552_123777_27_338 103
1383 3300053736 Ga0500599_000538 Ga0500599_000538_3257_3568 103
1384 3300053737 Ga0500601_000652 Ga0500601_000652_3923_4234 103
1385 3300059491 Ga0587070_194221 Ga0587070_194221_83_394 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

2

94

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.965 1 95
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9457 1 95
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.9172 3 92
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8715 3 92
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.728 2 97
ID Description Score Start End Superfamily
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9291 2 95 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9102 2 95 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.857 2 90 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8148 2 90 3.30.70.100
af_Q67XD6_173_269_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7293 6 90 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A533J3K2-F1-model_v4 deleted 0.9907 1 100
AF-A0A1L3F244-F1-model_v4 DUF1330 domain-containing protein 0.9895 1 100
AF-A0A1M2YSX0-F1-model_v4 DUF1330 domain-containing protein 0.9859 2 96
AF-A0A2E1UK82-F1-model_v4 DUF1330 domain-containing protein 0.9855 1 95
AF-A0A0J1HEI5-F1-model_v4 DUF1330 domain-containing protein 0.9831 3 95

Feature Viewer

pLDDT pTM Quality
93.48 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map